WorldWideScience

Sample records for theobroma

  1. Sulphur depletion altered somatic embryogenesis in Theobroma ...

    African Journals Online (AJOL)

    Sulphur depletion altered somatic embryogenesis in Theobroma cacao L. Biochemical difference related to sulphur metabolism between embryogenic and non embryogenic calli. Minyaka Emile, Niemenak Nicolas, Issali Emmanuel Auguste, Sangare Abdourahamane, Denis Ndoumou Omokolo ...

  2. Antimicrobial activity of fermented Theobroma cacao pod husk extract

    National Research Council Canada - National Science Library

    Santos, R X; Oliveira, D A; Sodré, G A; Gosmann, G; Brendel, M; Pungartnik, C

    2014-01-01

    Theobroma cacao L. contains more than 500 different chemical compounds some of which have been traditionally used for their antioxidant, anti-carcinogenic, immunomodulatory, vasodilatory, analgesic, and antimicrobial activities...

  3. Colonization of cashew plants by Lasiodiplodia theobromae: Microscopical features

    Science.gov (United States)

    Lasiodiplodia theobromae is a phytopathogenic fungus causing gummosis, a threatening disease for cashew plants in Brazil. In an attempt to investigate the ultrastructural features of the pathogen colonization and its response to immunofluorescence labeling, light, confocal and electron microscope st...

  4. Maxillary sinusitis caused by Lasiodiplodia theobromae

    Directory of Open Access Journals (Sweden)

    Kindo A

    2010-01-01

    Full Text Available Lasiodiplodia (monotypic comprises a very small proportion of the fungal biota. It is a common plant pathogen in tropical and subtropical regions. Clinical reports on its association with onychomycosis, corneal ulcer and phaeohyphomycosis are available. However, Lasiodiplodia theobromae causing fungal sinusitis has not been reported. We present here a case of fungal sinusitis in a 30-year-old woman, who came to the ENT OPD (out patient department with complaints of intermittent bleeding and nasal discharge from the left side for a week. The patient complained of headache, predominantly on the left side and heaviness on and off since two months. Diagnosis was based on radiological and mycological evidence; the patient underwent endoscopic surgery and was started on antifungal treatment.

  5. Floral biology of cacauhy (Theobroma speciosum - Malvaceae

    Directory of Open Access Journals (Sweden)

    Márcio Silva de Souza

    2010-08-01

    Full Text Available In the present work, cacauhy's (Theobroma speciosum floral biology was studied. Flower buds split their sepals at 14h reaching its maximum at 22h, but all flowers were fully opened at 6:00 h of the following morning. Stigmatic branches showed exudates, reaching maximum between 6:00 h and 10:00 h at the same day. Ligules and petal hoods were the floral parts with highest intensity of odour. Flowers were receptive along all the morning and noon of the anthesis day. Approximately 65% of the flowers were naturally pollinated, but only 0.85% of them set a fruit. Abscission occurred on its higher frequency at 6:00 h of the second day after anthesis. Controlled pollinations showed that cacauhy was self-incompatible species.Neste trabalho foi estudada a biologia floral do cacaui (Theobroma speciosum. Os botões florais romperam a suas sépalas às 14h com a maior freqüência às 22h, estando completamente abertas às 6 h da manhã seguinte. Os braços estigmáticos apresentaram exsudato, com o nível máximo entre 06 e 10 horas da manhã do mesmo dia. As lígulas mais as cógulas foram as partes florais com odor mais intenso. As flores estavam receptivas durante toda a manhã e à tarde do dia da antese. Aproximadamente 65% das flores foram naturalmente polinizadas, mas somente 0,85% formou fruto. A abscisão ocorreu com maior frequência às 6 h do segundo dia após a antese. Polinizações controladas mostraram que o cacauí é uma espécie auto-incompatível.

  6. Grapevine decline in Italy caused by Lasiodiplodia theobromae

    Directory of Open Access Journals (Sweden)

    Santella Burruano

    2008-10-01

    Full Text Available The first report of a dieback of grapevine caused by Lasiodiplodia theobromae in Sicily (Italy is given. About twelve per cent of the vines in the cv. Insolia vineyard surveyed, showed spur dieback, retarded growth and wood necrosis. Isolation trials and pathogenicity tests are briefl y reported, together with morphological, cultural and molecular characters on which identification was based.

  7. Antifungal effects of sisal leaf juice on Lasiodiplodia theobromae ...

    African Journals Online (AJOL)

    This study was carried out to evaluate the antifungal activities of leaf juices (fresh juice, fermented juice, boiled juice and sterile juice) of nine sisal varieties on Lasiodiplodia theobromae, the causal agent of mulberry root rot. Results show that all the leaf juices could inhibit the mycelial growth in different degrees (the ...

  8. The genetic identity of Theobroma cacao L. CCN-51

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important cash crop for several growing regions of the world especially for small cacao farmers. In the Americas the cacao production is ~13.0% globally. Ecuador is among the higher producers in South America and its cacao beans are well known for fine flavors, aro...

  9. Emerging resistance against different fungicides in Lasiodiplodia theobromae, the cause of mango dieback in Pakistan

    Directory of Open Access Journals (Sweden)

    Rehman ur Ateeq

    2015-01-01

    Full Text Available Dieback of mango caused by Lasiodiplodia theobromae is among several diseases responsible for low crop production in Pakistan. To further complicate the issue, resistance in L. theobromae is emerging against different fungicides. L. theobromae was isolated from diseased samples of mango plants collected from various orchards in the Multan District. The efficacy of different fungicides viz. copper oxychloride, diethofencarb, pyrachlostrobin, carbendazim, difenoconazole, mancozeb, and thiophanate-methyl was evaluated in vitro using a poison food technique. Thiophanate-methyl at all concentrations was found to be the most effective among five systemic fungicides against L. theobromae, followed by carbendazim, difenoconazole and diethofencarb. The fungicides, i.e., thiophanate-methyl, difenoconazole, carbendazim and diethofencarb showed maximum efficacy with increasing concentration. The isolates of L. theobromae showed some resistance development against the tested fungicides when compared with previous work. These investigations provide new information about chemical selection for the control of holistic disease in mango growing zones of Pakistan.

  10. Temperature Modulates the Secretome of the Phytopathogenic Fungus Lasiodiplodia theobromae.

    Science.gov (United States)

    Félix, Carina; Duarte, Ana S; Vitorino, Rui; Guerreiro, Ana C L; Domingues, Pedro; Correia, António C M; Alves, Artur; Esteves, Ana C

    2016-01-01

    Environmental alterations modulate host-microorganism interactions. Little is known about how climate changes can trigger pathogenic features on symbiont or mutualistic microorganisms. Current climate models predict increased environmental temperatures. The exposing of phytopathogens to these changing conditions can have particularly relevant consequences for economically important species and for humans. The impact on pathogen/host interaction and the shift on their biogeographical range can induce different levels of virulence in new hosts, allowing massive losses in agricultural and health fields. Lasiodiplodia theobromae is a phytopathogenic fungus responsible for a number of diseases in various plants. It has also been described as an opportunist pathogen in humans, causing infections with different levels of severity. L. theobromae has a high capacity of adaptation to different environments, such as woody plants, moist argillaceous soils, or even humans, being able to grow and infect hosts in a wide range of temperatures (9-39°C). Nonetheless, the effect of an increase of temperature, as predicted in climate change models, on L. theobromae is unknown. Here we explore the effect of temperature on two strains of L. theobromae - an environmental strain, CAA019, and a clinical strain, CBS339.90. We show that both strains are cytotoxic to mammalian cells but while the environmental strain is cytotoxic mainly at 25°C, the clinical strain is cytotoxic mainly at 30 and 37°C. Extracellular gelatinolytic, xylanolytic, amylolytic, and cellulolytic activities at 25 and 37°C were characterized by zymography and the secretome of both strains grown at 25, 30, and 37°C were characterized by electrophoresis and by Orbitrap LC-MS/MS. More than 75% of the proteins were identified, mostly enzymes (glycosyl hydrolases and proteases). The strains showed different protein profiles, which were affected by growth temperature. Also, strain specific proteins were identified, such

  11. Chloroplast microsatellite primers for cacao (Theobroma cacao) and other Malvaceae.

    Science.gov (United States)

    Yang, Ji Y; Motilal, Lambert A; Dempewolf, Hannes; Maharaj, Kamaldeo; Cronk, Q C B

    2011-12-01

    Chloroplast microsatellites were developed in Theobroma cacao to examine the genetic diversity of cacao cultivars in Trinidad and Tobago. Nine polymorphic microsatellites were designed from the chloroplast genomes of two T. cacao accessions. These microsatellites were tested in 95 hybrid accessions from Trinidad and Tobago. An average of 2.9 alleles per locus was found. These chloroplast microsatellites, particularly the highly polymorphic pentameric repeat, were useful in assessing genetic variation in T. cacao. In addition, these markers should also prove to be useful for population genetic studies in other species of Malvaceae.

  12. Enzyme activity in banana fruits rotted by Botryodiplodia theobromae Pat.

    Directory of Open Access Journals (Sweden)

    Nityananda Chakraborty

    2015-06-01

    Full Text Available Peroxidase and polyphenol oxidase activities in fruits of two cultivars of banana, 'champa' and 'kanthali' rotted by Botryodiplodia theobromae Pat. was studied. The enzymes showed much higher activities in infected than that in uninfected 'tissues. Increase in peroxidase activity was evidently inhibited by cycloheximide. Polyphenol oxidase activity was also inhibited in presence of phenylthiourea and Na-diethyldithiocarbamate more strongly by the former. Increase in activities seemed to be due to increased sytheses of the enzymes. In an in vitro culture, the fungus exhibited some peroxidase but no polyphenoloxidase activity.

  13. Data from proteome analysis of Lasiodiplodia theobromae (Botryosphaeriaceae

    Directory of Open Access Journals (Sweden)

    Carla C. Uranga

    2017-08-01

    Full Text Available Trunk disease fungi are a global problem affecting many economically important fruiting trees. The Botryosphaeriaceae are a family of trunk disease fungi that require detailed biochemical characterization in order to gain insight into their pathogenicity. The application of a modified Folch extraction to protein extraction from the Botryosphaeriaceae Lasiodiplodia theobromae generated an unprecedented data set of protein identifications from fragmentation analysis and de novo peptide sequencing of its proteome. This article contains data from protein identifications obtained from a database-dependent fragmentation analysis using three different proteomics algorithms (MSGF, Comet and X! Tandem via the SearchGUI proteomics pipeline program and de novo peptide sequencing. Included are data sets of gene ontology annotations using an all-Uniprot ontology database, as well as a Saccharomyces cerevisiae-only and a Candida albicans-only ontology database, in order to discern between those proteins involved in common functions with S. cerevisiae and those in common with the pathogenic yeast C. albicans. Our results reveal the proteome of L. theobromae contains more ontological categories in common to C. albicans, yet possesses a much wider metabolic repertoire than any of the yeasts studied in this work. Many novel proteins of interest were identified for further biochemical characterization and annotation efforts, as further discussed in the article referencing this article (1. Interactive Cytoscape networks of molecular functions of identified peptides using an all-Uniprot ontological database are included. Data, including raw data, are available via ProteomeXchange with identifier PXD005283.

  14. Optimized Jasmonic Acid Production by Lasiodiplodia theobromae Reveals Formation of Valuable Plant Secondary Metabolites

    OpenAIRE

    Eng, Felipe; Haroth, Sven; Feussner, Kirstin; Meldau, Dorothea; Rekhter, Dmitrij; Ischebeck, Till; Brodhun, Florian; Feussner, Ivo

    2016-01-01

    Jasmonic acid is a plant hormone that can be produced by the fungus Lasiodiplodia theobromae via submerged fermentation. From a biotechnological perspective jasmonic acid is a valuable feedstock as its derivatives serve as important ingredients in different cosmetic products and in the future it may be used for pharmaceutical applications. The objective of this work was to improve the production of jasmonic acid by L. theobromae strain 2334. We observed that jasmonic acid formation is depende...

  15. Repression of calcitonin gene-related peptide expression in trigeminal neurons by a Theobroma cacao extract.

    Science.gov (United States)

    Abbey, Marcie J; Patil, Vinit V; Vause, Carrie V; Durham, Paul L

    2008-01-17

    Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation.

  16. Repression of calcitonin gene-related peptide expression in trigeminal neurons by a Theobroma cacao extract☆

    Science.gov (United States)

    Abbey, Marcie J.; Patil, Vinit V.; Vause, Carrie V.; Durham, Paul L.

    2008-01-01

    Ethnopharmacological relevance Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. Aim of the study To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Results Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24 h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Conclusions Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation. PMID:17997062

  17. Influence of Infection Court, Host Vigor, and Culture Filtrates on Canker Production by Botryodiplodia Theobromae Conidia in Sycamore

    Science.gov (United States)

    R. Lewis

    1978-01-01

    Some of the factors that influence canker development in American sycamores inoculated with Botryodiplodia theobromae conidia were determined. A combination of B. theobromae culture filtrates and conidia resulted in 100% canker production when introduced into stem wounds; however, a combination of Cephalosporium diospyri...

  18. Aktivitas Filtrat Cendawan Lasiodiploida theobromae sebagai Inhibitor Pertumbuhan Tanaman Bayam (Amaranthus spp. L.

    Directory of Open Access Journals (Sweden)

    Syahbudin Hasibuan

    2015-12-01

    Full Text Available Lasiodiploidia theobromae merupakan cendawan patogen yang umum ditemukan pada  berbagai inang. Cendawan ini diketahui menghasilkan senyawa metabolik berupa theobroksida yang merupakan senyawa bahan alami epoxy cyclohexene. Theobroksida  mampu menginduksi pembungaan, menginduksi tuberisasi tanaman kentang pada lingkungan non-inducing dan berkaitan dengan inhibisi perpanjangan batang tanaman. Sebagai inhibitor alami yang diisolasi dari kultur filtrat cendawan Lasiodiploidia theobromae, aktivitas senyawa theobroksida telah diuji di lahan percobaan Fakultas Pertanian Universitas Medan Area sejak bulan Mei sampai bulan Juli 2015. Ekstrak diuji pada tanaman bayam (Amaranthus spp L. yang percobaannya disusun dalam rancangan acak kelompok sederhana dengan faktor perlakuan yaitu konsentrasi Filtrat Lasiodiploidia theobromae yang terdiri atas tiga taraf yaitu 0, 100, 200 dan 300 ppm. Hasil uji aktivitas menunjukkan bahwa aplikasi theobrokside menghambat pertumbuhan pada peubah tinggi tanaman,luas daun dan jumlah daun tanaman bayam. Lasiodiploidia theobromae is a fungal pathogen which is usually found in various host plants. This fungi is recognized to produce metabolic compounds namely theobroxide, a natural compound of epoxy cyclohexene. Theobroxide has ability to induce flowering initiation, induce tuberisation in potato plants in non-inducing environment also related to inhibition of plant stem elongation. As natural inhibitors isolated from filtrate culture of Lasiodiploidia theobromae, a research to evaluate activities of theobroxide was conducted in experimental station belonged to Faculty of Agriculture, University of Medan Area, started from Mei until July 2015.  This Experiment was arranged in simple randomized block design (RBD with filtrate Lasiodiploidia theobromae concentration as treatment factor. The treatment comprised four levels i.e. 0, 100, 200, and 300 ppm. Results showed that application of theobroxide could significantly inhibit

  19. Antimicrobial activity of fermented Theobroma cacao pod husk extract.

    Science.gov (United States)

    Santos, R X; Oliveira, D A; Sodré, G A; Gosmann, G; Brendel, M; Pungartnik, C

    2014-09-26

    Theobroma cacao L. contains more than 500 different chemical compounds some of which have been traditionally used for their antioxidant, anti-carcinogenic, immunomodulatory, vasodilatory, analgesic, and antimicrobial activities. Spontaneous aerobic fermentation of cacao husks yields a crude husk extract (CHE) with antimicrobial activity. CHE was fractioned by solvent partition with polar solvent extraction or by silica gel chromatography and a total of 12 sub-fractions were analyzed for chemical composition and bioactivity. CHE was effective against the yeast Saccharomyces cerevisiae and the basidiomycete Moniliophthora perniciosa. Antibacterial activity was determined using 6 strains: Staphylococcus aureus, Staphylococcus epidermidis, and Bacillus subtilis (Gram-positive) and Pseudomonas aeruginosa, Klebsiella pneumoniae, and Salmonella choleraesuis (Gram-negative). At doses up to 10 mg/mL, CHE was not effective against the Gram-positive bacteria tested but against medically important P. aeruginosa and S. choleraesuis with a minimum inhibitory concentration (MIC) of 5.0 mg/mL. Sub-fractions varied widely in activity and strongest antibacterial activity was seen with CHE8 against S. choleraesuis (MIC of 1.0 mg/mL) and CHE9 against S. epidermidis (MIC of 2.5 mg/mL). All bioactive CHE fractions contained phenols, steroids, or terpenes, but no saponins. Fraction CHE9 contained flavonoids, phenolics, steroids, and terpenes, amino acids, and alkaloids, while CHE12 had the same compounds but lacked flavonoids.

  20. Cryopreservation of cocoa (Theobroma cacao L.) somatic embryos by vitrification.

    Science.gov (United States)

    Adu-Gyamfi, Raphael; Wetten, Andy

    2012-01-01

    Losses of cultivated cocoa (Theobroma cacao L.) due to diseases and continued depletion of forests that harbour the wild progenitors of the crop make ex situ conservation of cocoa germplasm of paramount importance. In order to enhance security of in situ germplasm collections, 2-3 mm floral-derived secondary somatic embryos were cryopreserved by vitrification. This work demonstrates the most uncomplicated clonal cocoa cryopreservation. Optimal post-cryostorage survival (74.5 percent) was achieved by 5 d preculture of SSEs on 0.5 M sucrose medium followed by 60 min dehydration in cold PVS2. To minimise free radical related cryo-injury, cation sources were removed from the embryo development solution and/or the recovery medium, the former treatment resulting in a significant benefit. After optimisation with cocoa genotype AMAZ 15, the same protocol was effective across all five additional cocoa genotypes tested. For the multiplication of clones, embryos regenerated following cryopreservation were used as explant sources, and vitrification was found to maintain their embryogenic potential.

  1. Chromatin differentiation between Theobroma cacao L. and T. grandiflorum Schum.

    Science.gov (United States)

    Dantas, Liliane G; Guerra, Marcelo

    2010-01-01

    A comparative analysis of mitotic chromosomes of Theobroma cacao (cacao) and T. grandiflorum (cupuaçu) was performed aiming to identify cytological differences between the two most important species of this genus. Both species have symmetric karyotypes, with 2n = 20 metacentric chromosomes ranging in size from 2.00 to 1.19 μm (cacao) and from 2.21 to 1.15 μm (cupuaçu). The interphase nuclei of both species were of the arreticulate type, displaying up to 20 chromocentres, which were more regularly shaped in cacao than in cupuaçu. Prophase chromosomes of both species were more condensed in the proximal region, sometimes including the whole short arm. Both species exhibited only one pair of terminal heterochromatic bands, positively stained with chromomycin A (3) , which co-localized with the single 45S rDNA site. Each karyotype displayed a single 5S rDNA site in the proximal region of another chromosome pair. Heterochromatic bands were also observed on the centromeric/pericentromeric regions of all 20 chromosomes of cacao after C-banding followed by Giemsa or DAPI staining, whereas in cupuaçu they were never detected. These data suggest that the chromosomes of both species have been largely conserved and their pericentromeric chromatin is the only citologically differentiated region.

  2. Chromatin differentiation between Theobroma cacao L. and T. grandiflorum Schum

    Directory of Open Access Journals (Sweden)

    Liliane G. Dantas

    2010-01-01

    Full Text Available A comparative analysis of mitotic chromosomes of Theobroma cacao (cacao and T. grandiflorum (cupuaçu was performed aiming to identify cytological differences between the two most important species of this genus. Both species have symmetric karyotypes, with 2n = 20 metacentric chromosomes ranging in size from 2.00 to 1.19 µm (cacao and from 2.21 to 1.15 mm (cupuaçu. The interphase nuclei of both species were of the arreticulate type, displaying up to 20 chromocentres, which were more regularly shaped in cacao than in cupuaçu. Prophase chromosomes of both species were more condensed in the proximal region, sometimes including the whole short arm. Both species exhibited only one pair of terminal heterochromatic bands, positively stained with chromomycin A3, which co-localized with the single 45S rDNA site. Each karyotype displayed a single 5S rDNA site in the proximal region of another chromosome pair. Heterochromatic bands were also observed on the centromeric/pericentromeric regions of all 20 chromosomes of cacao after C-banding followed by Giemsa or DAPI staining, whereas in cupuaçu they were never detected. These data suggest that the chromosomes of both species have been largely conserved and their pericentromeric chromatin is the only citologically differentiated region.

  3. Production of amylolytic enzymes in culture by Botryodiplodia theobromae and Sclerotium rolfsii associated with the corm rots of Colocasia esculenta.

    Science.gov (United States)

    Nwufo, M I; Fajola, A O

    1988-01-01

    Extracellular amylase was detected in culture filtrates of Botryodiplodia theobromae and Sclerotium rolfsii. During 10 days incubation S. rolfsii produced more amylase than B. theobromae. B. theobromae produced the greatest amount of amylase at 25 degrees C, while S. rolfsii at 30 degrees C. Both organism exerted the highest amylase activity at pH 6-7. In starch-free medium extracellular amylase was in very low quantities. There was a positive correlation between increase in starch concentration and production of extracellular amylolytic enzymes.

  4. Association mapping of fruit, seed and disease resistance traits in Theobroma cacao L

    Science.gov (United States)

    An association mapping approach was employed to find markers for color, size, girth and mass of fruits; seed number and butterfat content; and resistance to black pod and witches’ broom diseases in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms...

  5. Altered physiology, cell structure and gene expression of Theobroma cacao seedlings submitted to Cu toxicity

    Science.gov (United States)

    Theobroma cacao seedlings from the genotype CCN 51 were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16 and 32 mg Cu L-1) in nutrient solution. When doses were equal or higher than 8 mg Cu L-1, after 24 h of treatment application, leaf gas exch...

  6. Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.

    Science.gov (United States)

    Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ~4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification pr...

  7. CACAO (THEOBROMA CACAO L.) GENETIC RESOURCES RESEARCH AT THE USDA-ARS TROPICAL AGRICULTURE RESEARCH STATION

    Science.gov (United States)

    The current USDA ARS Tropical Agriculture Research Station’s cacao (Theobroma cacao) collection consists of 154 clonally propagated accessions. Each accession is represented by six individual trees grafted on Amelonado rootstocks and planted in a completely randomized block design with three blocks...

  8. Molecular, physiological and morphological analysis of waterlogging tolerance in clonal genotypes of Theobroma cacao

    Science.gov (United States)

    In soil, hypoxia and anoxia conditions generated by waterlogging induce changes in genetic morphological, physiological processes, and as well as altering the growth and development of plant The mass propagation of cacao (Theobroma cacao) cuttings-to produce plantlets (clones) is affected by waterlo...

  9. Molecular genetic diversity in a core of cocoa ( Theobroma cacao L ...

    African Journals Online (AJOL)

    This study aimed to assess the genetic variability in groups of 11 clones of Theobroma cacao L., from different geographical regions, based on microsatellite markers, with the interest to characterize germplasm for breeding. The products of the amplification of these materials with 15 simple sequence repeat (SSR) markers ...

  10. Molecular fingerprinting of cacao (Theobroma cacao L.) genetic resources in the Dominican Republic

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is a significant agricultural commodity in the Dominican Republic ranking 11th in the world and number one in organic cacao exports. Dominican cacao genetic resources are maintained, propagated and distributed nationally out of the IDIAF’s Mata Larga research stations. T...

  11. High-Quality Draft Genome Sequence of Bacillus amyloliquefaciens Strain 629, an Endophyte from Theobroma cacao.

    Science.gov (United States)

    SantAnna, Brena M M; Marbach, Phellippe P A; Rojas-Herrera, Marcelo; De Souza, Jorge T; Roque, Milton R A; Queiroz, Artur T L

    2015-11-19

    Bacillus amyloliquefaciens strain 629 is an endophyte isolated from Theobroma cacao L. Here, we report the draft genome sequence (3.9 Mb) of B. amyloliquefaciens strain 629 containing 16 contigs (3,903,367 bp), 3,912 coding sequences, and an average 46.5% G+C content. Copyright © 2015 SantAnna et al.

  12. Towards The Identification Of Candidate Genes Involved In Witches' Broom Disease Resistance In Theobroma cacao L.

    Science.gov (United States)

    Theobroma cacao, the source of cocoa beans for chocolate, is an important tropical agriculture commodity that is affected by a number of fungal pathogens and insect pests, as well as concerns about yield and quality. We are trying to find molecular genetic markers that are linked to disease resista...

  13. Factors influencing the survival of developing embryos of theobroma cacao L. (Malvaceae) in cryogenic storage

    Science.gov (United States)

    Cacao, Theobroma cacao L., is native to tropical South American rainforests and is the source of chocolate. Ex situ conservation of this economically important species and its relatives is imperative to prevent genetic erosion resulting from diminished suitable habitat and increased pressure from a...

  14. Impact Of Selfing On The Inference Of Demographic History From Whole Genomes In Theobroma cacao L.

    Science.gov (United States)

    Theobroma cacao L (cacao: Malvaceae) is a small tree found naturally in the Amazonian rain forest. An interesting feature of cacao is that it persists in populations of naturally outcrossing and inbreeding plants, as it is a species with a complex system of self-incompatibility, where a fraction of...

  15. Toward The Identification Of Candidate Genes Involved In Black Pod Disease Resistance In Theobroma cacao L.

    Science.gov (United States)

    Black Pod (Phytophthora sp.) has a devastating effect on the worldwide cacao (Theobroma cacao) yield and incorporating resistance into production fields has been an ongoing effort of breeding programs. Previous meta-QTL analysis of genetic maps created with a variety of molecular markers identified...

  16. Complex origin of Trinitario-type Theobroma cacao (Malvaceae) revealed using plastid genomics

    Science.gov (United States)

    Trinidad and Tobago has a long history of producing high quality cacao (Theobroma cacao L.) flavor, despite this industry having been threatened in the past by disease and changing economic fortunes. Cacao genotypes in Trinidad and Tobago are of a highly distinctive kind, the so-called “Trinitari...

  17. Genetic diversity and spatial structure in cacao (Theobroma cacao L.) germplasm from Bolivia

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important economic crop widely cultivated in the Bolivian Amazon. The germplasm group used by the Bolivian farmers was called “Cacao Nacional Boliviano” (CNB). Wild cacao populations are also found in the Beni River and in the valleys of Andes foot hills. Using DNA...

  18. The interaction of Theobroma cacao and Moniliophthora perniciosa, the causal agent of witches’ broom disease, during parthenocarpy

    Science.gov (United States)

    Infection of Theobroma cacao L. flower cushions by Moniliophthora perniciosa induces parthenocarpy. Healthy and parthenocarpic immature cacao pods were obtained from seven cacao clones. Microscopic observations of parthenocarpic pods confirmed fruits lack viable seed. Septate mycelium colonized part...

  19. Cocoa Bean (Theobroma cacao L.Drying Kinetics Cinética del Secado de Cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Ndukwu MacManus Chinenye

    2010-12-01

    Full Text Available Cocoa (Theobroma cacao L. is widely produced in West Africa and South America and is a great economic tree crop, with so many industrial uses. In this work, the experimental drying kinetics of foreign species was investigated, and the experiments were carried out under isothermal conditions, using heated batch drier at 55, 70 and 81 ºC. The moisture ratio data obtained from change of moisture content with the drying time was fit to two thin layer drying model with good results. A faster drying process was observed at a higher drying temperature resulting in higher drying rates which is advantageous when evaluating costs. Fick’s second law of diffusion was used to predict effective diffusivity using experimental data assuming that the variation of diffusivity with temperature can be expressed by an Arrhenius type function, and the values of diffusivity obtained ranged from 6.137 x 10-10 to 2.1855 x 10-9 m2 s-1 for the temperature used. The Arrhenius constant (D is predicted at 8.64 x 10-4 m2 s-1 while the activation energy was predicted at 39.94 kJ mol-1.El cacao (Theobroma cacao L. es ampliamente producido en el Oeste de África y Sudamérica y es un cultivo de gran importancia económica, con muchos usos industriales. En este trabajo se investigó la cinética del secado experimental de especies foráneas, y se realizaron experimentos bajo condiciones isotérmicas, usando un secador discontinuo en caliente a 55, 70 y 81 °C. Los datos de relación de humedad obtenidos desde el cambio de contenido de humedad con el tiempo de secado se ajustaron a un modelo de secado de dos capas delgadas con buenos resultados. Se observó un proceso de secado más rápido a una temperatura de secado mayor resultando en mayores tasas de secado, lo que es ventajoso al evaluar costos. La segunda ley de difusión de Fick se usó para predecir difusividad efectiva usando datos experimentales, asumiendo que la variación de difusividad con la temperatura puede ser

  20. Invasive Fungal Sinusitis by Lasiodiplodia theobromae in an Patient with Aplastic Anemia: An Extremely Rare Case Report and Literature Review.

    Science.gov (United States)

    Gu, Hyun Jung; Kim, Young Jin; Lee, Hee Joo; Dong, Sung Hwa; Kim, Sung Wan; Huh, Hee Jae; Ki, Chang-Seok

    2016-12-01

    Human Lasiodiplodia theobromae infection has not been reported frequently. We report the first case of invasive L. theobromae nasal and neck infection. A 66-year-old male visited our hospital with anemia and general weakness. He showed pancytopenia, and his bone marrow examination revealed markedly decreased hematopoietic cells. The patient was presumed to have iatrogenic aplastic anemia due to mushroom toxicity. He began treatment for multiple organ infections with broad-spectrum antibiotics and antifungal agents. During hospitalization, he complained of nasal obstruction and left neck lymph node enlargement. A mass-like lesion was observed, and a nasal mass biopsy was performed. The mass was identified as a fungal ball. He underwent surgical excision for the nasal mass and the neck lymph node. The pathologic examination indicated an invasive fungal infection, and the lymph node revealed chronic granulomatous inflammation with fungal infection. 18s rRNA sequencing revealed that the sequence shared 99 % identity with L. theobromae. The nasal mass fungus was identified by internal transcribed spacer region sequencing from pathologic paraffin sections. The obtained sequence corresponded to Lasiodiplodia or Macrophoma. The sequence corresponded to the neck discharge sequence results. Hence, the patient was diagnosed with invasive fungal sinusitis with neck lymph node involvement caused by L. theobromae. To our knowledge, this is the first report of L. theobromae infection in Korea and the first report of invasive L. theobromae fungal sinusitis in the literature. We should include more precise evaluations of additional novel fungal species as possible candidates.

  1. Inhibition of Acetylcholinesterase and Fatty Acid Composition in Theobroma grandiflorum Seeds

    Directory of Open Access Journals (Sweden)

    Casandra Valentina Itriago

    2017-07-01

    Full Text Available Theobroma grandiflorum is an important fruit tree from Sterculiaceae family, native to the Brazilian Amazon, known in the region as cupuaçu. The seeds have a high fat content (24% with characteristics that resemble those of cocoa (Theobroma cacao butter with potential applications in the cosmetic, pharmaceutical and food industries. The main objective of this work was to explore the seed fats from T. grandiflorum that were analyzed for fatty acid composition by Gas Chromatography with Flame Ionization Detector (GC-FID and to analyze their activity for acetylcholinesterase inhibition. Chromatographic analysis provided detection of nine fatty acids. The major fatty acids found in the species were oleic (40.0%, stearic (32.7%, arachidic (10.4% and palmitic (8.0%. The acetylcholinesterase inhibition by fats from seeds was over 40.48%. DOI: http://dx.doi.org/10.17807/orbital.v0i0.894 

  2. BIOTRANSFORMATION OF FERULIC ACID BY THE PHYTOPATHOGENIC FUNGI Colletotrichum acutatum AND Lasiodiplodia theobromae

    Directory of Open Access Journals (Sweden)

    Manuel Alejandro Numpaque

    2016-01-01

    Full Text Available The microbial transformation of ferulic acid (FA offers a cleaner, more economical alternative for the natural production of flavorings and fragrances. In the present study, the biotransformation of FA using the filamentous phytopathogenic fungi Colletotrichum acutatum and Lasiodiplodia theobromae was researched. Initially, the toxicity of FA against both fungi was evaluated; the FA displayed a moderate toxicity (total inhibition at concentrations ≥ 2000 mg L-1 and apparently a detoxification mechanism was present. Afterwards, the microorganisms were incubated with the substrate at room conditions using a Czapek-Dox culture medium. The results demonstrated that the FA was mainly converted to 4-vinylguaiacol, reaching the highest abundance within the first 48 hours. To a lesser extent, acetovanillone, ethylguaiacol, and vanillin, among others, were produced. Interestingly, the compounds generated in the biotransformation of FA with C. acutatum and L. theobromae have been used as flavorings. Based on the identified metabolites, a possible metabolic pathway was proposed.

  3. Pod Characteristics of cocoa (Theobroma cacao L.) related to rocoa pod borer resistance.

    OpenAIRE

    Agung Wahyu Susilo; Surip Mawardi; Witjaksono .; Woerjono Mangoendidjojo

    2015-01-01

    The characteristics of cocoa (Theobroma cacao L.) pod related to cocoa pod borer resistance (CPB) had been identified in a series of study. The objective of this research is to evaluate the characteristics of cocoa pod using more diverse of genetic background to obtain selection criteria. Genetic materials for this studywere 25 cocoa clones planted in Central Sulawesi for resistance evaluation. Field evaluation of the resistance were assessed by using variable of the percentage of unextractab...

  4. Packaging of Post Acclimatized Somatic Embryogenesis Cocoa Plantlet (Theobroma cacao L.)

    OpenAIRE

    Soedarsianto Soedarsianto; Teguh Iman Santoso

    2009-01-01

    Clonal plants that produced by somatic embryogenesis technique is one of the best choice to produce supperior clonal cacao (Theobroma cacao L.) planting materials. The somatic embryogenesis technique is a possible way for massive propagation, the outcome is true to type plants, the architecture similarity that the seedlings but there is not segregation like seedlings plants. At present mass production started of plantlets production until post-acclimatized plantlets of somatic embryogenesis c...

  5. Fatty acid esters produced by Lasiodiplodia theobromae function as growth regulators in tobacco seedlings

    Energy Technology Data Exchange (ETDEWEB)

    Uranga, Carla C., E-mail: curanga@cicese.edu.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico); Beld, Joris, E-mail: joris.beld@drexelmed.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Mrse, Anthony, E-mail: amrse@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Córdova-Guerrero, Iván, E-mail: icordova@uabc.edu.mx [Universidad Autónoma de Baja California (UABC), Calzada Universidad 14418 Parque Industrial Internacional Tijuana, Tijuana, B.C. 22390 (Mexico); Burkart, Michael D., E-mail: mburkart@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Hernández-Martínez, Rufina, E-mail: ruhernan@cicese.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico)

    2016-04-01

    The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.

  6. In silico analysis of cacao (Theobroma cacao L.) genes that involved in pathogen and disease responses

    Science.gov (United States)

    Agung, Muhammad Budi; Budiarsa, I. Made; Suwastika, I. Nengah

    2017-02-01

    Cocoa bean is one of the main commodities from Indonesia for the world, which still have problem regarding yield degradation due to pathogens and disease attack. Developing robust cacao plant that genetically resistant to pathogen and disease attack is an ideal solution in over taking on this problem. The aim of this study was to identify Theobroma cacao genes on database of cacao genome that homolog to response genes of pathogen and disease attack in other plant, through in silico analysis. Basic information survey and gene identification were performed in GenBank and The Arabidopsis Information Resource database. The In silico analysis contains protein BLAST, homology test of each gene's protein candidates, and identification of homologue gene in Cacao Genome Database using data source "Theobroma cacao cv. Matina 1-6 v1.1" genome. Identification found that Thecc1EG011959t1 (EDS1), Thecc1EG006803t1 (EDS5), Thecc1EG013842t1 (ICS1), and Thecc1EG015614t1 (BG_PPAP) gene of Cacao Genome Database were Theobroma cacao genes that homolog to plant's resistance genes which highly possible to have similar functions of each gene's homologue gene.

  7. Optimized Jasmonic Acid Production by Lasiodiplodia theobromae Reveals Formation of Valuable Plant Secondary Metabolites.

    Directory of Open Access Journals (Sweden)

    Felipe Eng

    Full Text Available Jasmonic acid is a plant hormone that can be produced by the fungus Lasiodiplodia theobromae via submerged fermentation. From a biotechnological perspective jasmonic acid is a valuable feedstock as its derivatives serve as important ingredients in different cosmetic products and in the future it may be used for pharmaceutical applications. The objective of this work was to improve the production of jasmonic acid by L. theobromae strain 2334. We observed that jasmonic acid formation is dependent on the culture volume. Moreover, cultures grown in medium containing potassium nitrate as nitrogen source produced higher amounts of jasmonic acid than analogous cultures supplemented with ammonium nitrate. When cultivated under optimal conditions for jasmonic acid production, L. theobromae secreted several secondary metabolites known from plants into the medium. Among those we found 3-oxo-2-(pent-2-enyl-cyclopentane-1-butanoic acid (OPC-4 and hydroxy-jasmonic acid derivatives, respectively, suggesting that fungal jasmonate metabolism may involve similar reaction steps as that of plants. To characterize fungal growth and jasmonic acid-formation, we established a mathematical model describing both processes. This model may form the basis of industrial upscaling attempts. Importantly, it showed that jasmonic acid-formation is not associated to fungal growth. Therefore, this finding suggests that jasmonic acid, despite its enormous amount being produced upon fungal development, serves merely as secondary metabolite.

  8. Successful Treatment of Lasiodiplodia theobromae Keratitis – Assessing the Role of Voriconazole

    Directory of Open Access Journals (Sweden)

    Stephen Tak-lun Li

    2016-10-01

    Full Text Available Purpose: The aim of this paper is to report the successful management of the first case of Lasiodiplodia theobromae keratitis in Hong Kong. Methods: We conducted a case report. Results: A 43-year-old Chinese male with a history of diabetes developed left eye keratitis after a trauma during tree felling. Fungal keratitis was diagnosed using a confocal microscope on day 1, and L. theobromae was confirmed from the culture. He was given oral voriconazole, topical natamycin, and topical and intracameral amphotericin B. The patient’s condition improved after the initial treatment. However, there was a slow progression to descemetocele formation and impending perforation due to corneal melting. Penetrating keratoplasty was performed at 8 weeks after presentation. Final visual recovery was good with no recurrence of infection. The cornea remained clear. Conclusions: We report the first case of L. theobromae keratitis in Hong Kong, and it is the only case so far that involved the use of oral voriconazole in the combination therapy. Early recognition with the aid of confocal microscopy allowed the early start of treatment. The use of newer antifungal voriconazole topically and orally combined with topical amphotericin B appeared to be useful in the eradication of the fungus and prevention of recurrence. Intracameral antifungals might have improved the clinical management.

  9. Optimized Jasmonic Acid Production by Lasiodiplodia theobromae Reveals Formation of Valuable Plant Secondary Metabolites.

    Science.gov (United States)

    Eng, Felipe; Haroth, Sven; Feussner, Kirstin; Meldau, Dorothea; Rekhter, Dmitrij; Ischebeck, Till; Brodhun, Florian; Feussner, Ivo

    2016-01-01

    Jasmonic acid is a plant hormone that can be produced by the fungus Lasiodiplodia theobromae via submerged fermentation. From a biotechnological perspective jasmonic acid is a valuable feedstock as its derivatives serve as important ingredients in different cosmetic products and in the future it may be used for pharmaceutical applications. The objective of this work was to improve the production of jasmonic acid by L. theobromae strain 2334. We observed that jasmonic acid formation is dependent on the culture volume. Moreover, cultures grown in medium containing potassium nitrate as nitrogen source produced higher amounts of jasmonic acid than analogous cultures supplemented with ammonium nitrate. When cultivated under optimal conditions for jasmonic acid production, L. theobromae secreted several secondary metabolites known from plants into the medium. Among those we found 3-oxo-2-(pent-2-enyl)-cyclopentane-1-butanoic acid (OPC-4) and hydroxy-jasmonic acid derivatives, respectively, suggesting that fungal jasmonate metabolism may involve similar reaction steps as that of plants. To characterize fungal growth and jasmonic acid-formation, we established a mathematical model describing both processes. This model may form the basis of industrial upscaling attempts. Importantly, it showed that jasmonic acid-formation is not associated to fungal growth. Therefore, this finding suggests that jasmonic acid, despite its enormous amount being produced upon fungal development, serves merely as secondary metabolite.

  10. Co-occurrence of pathogenic and non-pathogenic Fusarium decemcellulare and Lasiodiplodia theobromae isolates in cushion galls disease of cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Castillo Daynet Sosa del

    2016-04-01

    Full Text Available Flowery cushion gall of cacao is a disease complex with six types. Fusarium decemcellulare have been isolated from both flowery and green point galls and recognized as the etiological agent of the disease. In the present work we: i identified by ITS-rDNA sequencing and/or taxonomy the cultivable fungal species or Operative Taxonomic Units (OTUs associated with the five symptoms of cushion galls in cacao from Venezuela, and ii determined the gall inducing capacity on cacao peeled seeds after 45 days of inoculation with suspensions of mycelia/ spores from distinct isolate types. The whole isolate collection rendered an abundance of 113 isolates with a richness of 39 OTUs (27 and eight identified at the species or genera levels, respectively, and in unidentified fungi. The dominant recovered species (≈36% were F. decemcellulare and Lasiodiplodia theobromae. Some isolates of F. decemcellulare, L. theobromae, F. equiseti, Fusarium spp., F. solani, F. incarnatum, Rhizocthonia solani and Penicillium sp. were pathogenic. Some other isolates of the first six mentioned taxa behave as non-pathogenic. Furthermore, pathogenic and non-pathogenic isolates can also co-occur within a single plant and gall type. Moreover, 2-5 species within a single gall symptom in a single tree were identified (not necessarily at the same point in the tree, indicating a broad diversity of co-occurring taxa.

  11. Characterisation of the metabolites of an antibacterial endophyte Botryodiplodia theobromae Pat. of Dracaena draco L. by LC-MS/MS.

    Science.gov (United States)

    Zaher, Ahmed M; Moharram, Ahmad M; Davis, Richard; Panizzi, Peter; Makboul, Makboul A; Calderón, Angela I

    2015-01-01

    Botryodiplodia theobromae Pat. belongs to the endophytic fungi that live within the tissues of medicinal plants and produce bioactive natural products. The endophyte was isolated from the leaves of Dracaena draco L. The LC-MS-based metabolite fingerprinting of the ethyl acetate extract of B. theobromae with antibacterial activity led to the identification of 13 metabolites pertaining to various classes: dipeptides (maculosin and L,L-cyclo(leucylprolyl), alkaloid (norharman), coumarin and isocoumarins (bergapten, meranzin and monocerin), sesquiterpene (dihydrocumambrin A), aldehyde (formyl indanone), fatty alcohol (halaminol A) and fatty acid amide (palmitoleamide, palmitamide, capsi-amide and oleamide). This study reports for the first time, the LC-MS and LC-MS/MS identification of 13 known bioactive metabolites from the antibacterial ethyl acetate extract of B.theobromae isolated from the leaves of D. draco L.

  12. Genome size, cytogenetic data and transferability of EST-SSRs markers in wild and cultivated species of the genus Theobroma L. (Byttnerioideae, Malvaceae.

    Directory of Open Access Journals (Sweden)

    Rangeline Azevedo da Silva

    Full Text Available The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI- bands. The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted.

  13. Genome size, cytogenetic data and transferability of EST-SSRs markers in wild and cultivated species of the genus Theobroma L. (Byttnerioideae, Malvaceae).

    Science.gov (United States)

    da Silva, Rangeline Azevedo; Souza, Gustavo; Lemos, Lívia Santos Lima; Lopes, Uilson Vanderlei; Patrocínio, Nara Geórgia Ribeiro Braz; Alves, Rafael Moysés; Marcellino, Lucília Helena; Clement, Didier; Micheli, Fabienne; Gramacho, Karina Peres

    2017-01-01

    The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR) of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI- bands). The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC) ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted.

  14. Reacción a Moniliophthora roreri en Theobroma spp. en Caquetá, Colombia

    Directory of Open Access Journals (Sweden)

    Armando Sterling Cuéllar

    2015-09-01

    Full Text Available El objetivo de este estudio fue evaluar in situ la reacción de 50 materiales genéticos de tres especies de Theobroma(T. cacao, T. grandiflorum y T. bicolor a la inoculación controlada de tres aislados autóctonos de Moniliophthora roreri (agente causal de la moniliasis del cacao en el Departamento de Caquetá (Amazonia colombiana. Las variables incidencia de la enfermedad (IMr, severidad externa (SE y severidad interna (SI, se evaluaron nueve semanas después de la inoculación de mazorcas de 2 a 3 meses de edad con una suspensión de esporas de 1,2 x 105 esporas/mL. La enfermedad se evidenció en las tres especies de Theobroma, sin embargo, ésta no se presentó en 13 de los 50 materiales genéticos evaluados, representados así: seis T. grandiflorum, cinco T. bicolor y dos T. cacao. Los materiales genéticos de T. bicolor y T. grandiflorum fueron los menos afectados comparados con los de T. cacao. Se encontraron diferencias significativas para IMr, SE y SI entre las tres especies de Theobroma y entre los 50 materiales genéticos. Diferencias significativas entre los aislados solo ocurrieron para SE. La incidencia y la severidad de la enfermedad entre materiales genéticos, fueron influenciadas por el patógeno aislado. Los materiales genéticos con menor reacción a M. roreri pueden ser utilizados en programas de mejoramiento por resistencia a la moniliasis.

  15. Fertilisation minérale du cacaoyer ( Theobroma cacao L.) en Côte d ...

    African Journals Online (AJOL)

    En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point ...

  16. A new eremophilane-type sesquiterpene from the phytopatogen fungus Lasiodiplodia theobromae (Sphaeropsidaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Nunes, Fatima M.; Oliveira, Maria da Conceicao F. de; Arriaga, Angela M.C.; Lemos, Telma L.G.; Andrade-Neto, Manoel; Mattos, Marcos C. de [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Quimica Organica e Inorganica]. E-mail: mcfo@ufc.br; Mafezoli, Jair [Universidade de Fortaleza, CE (Brazil). Curso de Farmacia; Viana, Francisco M.P.; Ferreira, Viviane M. [EMBRAPA Agroindustria Tropical, Fortaleza, CE (Brazil). Lab. de Fitopatologia; Rodrigues-Filho, Edson; Ferreira, Antonio G. [Universidade Federal de Sa Carlos (UFSCAR), SP (Brazil). Dept. de Quimica

    2008-07-01

    The phytopatogenic fungus Lasiodiplodia theobromae, isolated from guava, was cultivated in rice for 32 days at room temperature. Extraction with CH{sub 2}Cl{sub 2}:MeOH (3:7), followed by chromatography fractionation of the extract provided ergosterol. From the fungus culture in Czapeck medium for 40 days at room temperature, were isolated isocoumarin cis-4-hydroxymeleine and an eremophilane-type sesquiterpene. The latter compound is being reported for the first time in the literature. Also, this is the first time that an eremophilane sesquiterpene is described for Lasiodiplodia genus. (author)

  17. Actividad antibacteriana de la cáscara de cacao, Theobroma cacao L

    OpenAIRE

    Cuéllar G, Oscar; Guerrero A, Gloria

    2012-01-01

    RESUMENObjetivo. Evaluar la actividad antibacteriana de diferentes fracciones de la cáscara de cacao (Theobroma cacao L.). Materiales y métodos. Se evaluó la actividad antibacteriana mediante el método de difusión en agar de diferentes fracciones de la cáscara de cacao, empleando cepas autóctonas y de referencia ATCC. Posteriormente, se hizo un análisis de estas fracciones por cromatografía líquida de alta eficiencia y cromatografía de gases acoplada a espectrometría de masas. Resultados. La ...

  18. Presencia de metales pesados en cultivo de cacao (Theobroma cacao L.) orgánico

    OpenAIRE

    Hugo Alfredo Huamaní-Yupanqui; Miguel ángel Huauya-Rojas; Luis Germán Mansilla-Minaya; Nelino Florida-Rofner; Gilmer Milton Neira-Trujillo

    2012-01-01

    La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...

  19. 1H NMR study of fermented cocoa (Theobroma cacao L.) beans.

    Science.gov (United States)

    Caligiani, Augusta; Acquotti, Domenico; Cirlini, Martina; Palla, Gerardo

    2010-12-08

    This study reports for the first time the metabolic profile of cocoa (Theobroma cacao L.) beans using the (1)H NMR technique applied to polar extracts of fermented cocoa beans. The simultaneous detection and quantification of amino acids, polyalcohols, organic acids, sugars, methylxanthines, catechins, and phenols were obtained by assigning the major signals of the spectra for different varieties of cocoa beans (Forastero, Criollo, and Trinitario) from different countries (Ecuador, Ghana, Grenada, and Trinidad). The data set obtained, representative of all classes of soluble compounds of cocoa, was useful to characterize the fermented cocoa beans as a function of the variety and geographic origin.

  20. QTL mapping for resistance to frosty pod and black pod diseases in an f1 population of Theobroma cacao L

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is a native crop of the Americas; however severe losses due to frosty pod (FP) [Moniliophthora roreri (Cif. and Par.)], and black pod (BP) [Phytophthora palmivora (Butl.) Butl.] have reduced cacao in the Americas to only 13.0% of world production. Agronomic practices to co...

  1. The influence of formulation on Trichoderma biological activity and frosty pod rot disease management in Theobroma cacao

    Science.gov (United States)

    Frosty pod rot (FPR), caused by Moniliophthora roreri is responsible for significant losses in Theobroma cacao. Due to the limited options for FPR management, biological control methods using Trichoderma are being studied. Combinations of three formulations and two Trichoderma isolates were studied ...

  2. Molecular characterization of an earliest cacao (Theobroma cacao L.) collection from Peruvian Amazon using microsatllite DNA markers

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is indigenous to the Amazon region of South America. The Peruvian Amazon harbors a large number of diverse cacao populations. Since the 1930s, several numbers of populations have been collected from the Peruvian Amazon and maintained as ex situ germplasm repositories in ...

  3. Comparison of two cacao (Theobroma cacao L.) clones for the effect of pollination intensity on fruit set and seed content

    NARCIS (Netherlands)

    Falque, M.; Lesdalons, C.; Eskes, A.B.

    1996-01-01

    We compared the influence of pollination intensity (PI) on fruit set and seed number per pod in two cacao (Theobroma cacao L.) clones, IFC5 (Forastero Lower-Amazon Amelonado), which is self-compatible and known to produce a high number of seeds per pod under open pollination, and SCA6 (Forastero

  4. Trichoderma martiale sp. nov., a new endophyte from sapwood of Theobroma caco with a potential for biological control

    Science.gov (United States)

    The new species Trichoderma martiale was isolated as an endophyte from sapwood of Theobroma cacao (cacao) in Brazil. On the basis of sequences of translation-elongation factor 1-alpha (tef1) and RNA polymerase II subunit (rpb2) T. martiale is a close relative of, and morphologically similar to, T. v...

  5. Characterization of the legumains encoded by the genome of Theobroma cacao L.

    Science.gov (United States)

    Santana, Juliano Oliveira; Freire, Laís; de Sousa, Aurizangela Oliveira; Fontes Soares, Virgínia Lúcia; Gramacho, Karina Peres; Pirovani, Carlos Priminho

    2016-01-01

    Legumains are cysteine proteases related to plant development, protein degradation, programmed cell death, and defense against pathogens. In this study, we have identified and characterized three legumains encoded by Theobroma cacao genome through in silico analyses, three-dimensional modeling, genetic expression pattern in different tissues and as a response to the inoculation of Moniliophthora perniciosa fungus. The three proteins were named TcLEG3, TcLEG6, and TcLEG9. Histidine and cysteine residue which are part of the catalytic site were conserved among the proteins, and they remained parallel in the loop region in the 3D modeling. Three-dimensional modeling showed that the propeptide, which is located in the terminal C region of legumains blocks the catalytic cleft. Comparing dendrogram data with the relative expression analysis, indicated that TcLEG3 is related to the seed legumain group, TcLEG6 is related with the group of embryogenesis activities, and protein TcLEG9, with processes regarding the vegetative group. Furthermore, the expression analyses proposes a significant role for the three legumains during the development of Theobroma cacao and in its interaction with M. perniciosa. Copyright © 2015 Universidade Estadual de Santa Cruz, CNPJ: 40738999/0001-95. Published by Elsevier Masson SAS.. All rights reserved.

  6. JENIS TANAMAN INANG DAN MASA INKUBASI PATOGEN BOTRYODIPLODIA THEOBROMAE PAT. PENYEBAB PENYAKIT KULIT DIPLODIA PADA JERUK

    Directory of Open Access Journals (Sweden)

    Salamiah, Badruzsaufari, dan Muhammad Arsyad .

    2011-11-01

    Full Text Available Alternative hosts and Incubation period of Botryodiplodia theobromae the causal of  diplodia bark diseases on citrus. Citrus is one of the important horticulture commodities in South Kalimantan. Citrus growers in the region encounter diplodia disease caused by a genus of Botryodiplodia.  There is no single method practiced today proved to be effective control for the disease. Insufficient information of the pathogen life cycle is considered to contribute in  the failure of disease management.   Information of the alternative hosts and incubation period of the pathogens is  very crucial in the diseases management. The experiments were carried out at the Laboratory of Plant Diseases and at a Glass House of the Department of Plant Pests and Diseases of the Faculty of Agriculture, Lambung Mangkurat University in Banjarbaru from March – October 2006. The experiments were conducted in three phases, i.e. (1 identification of pathogen, (2 the study of alternative hosts, and (3 the study of incubation periods of the pathogen in the test plants. Results showed that the diplodia disease of citrus “Siam Banjar” was caused by a fungus of the genus Botryodiplodia theobromae.  The pathogen can also  infected chasew  and avocado plants.  The Incubation periods of the pathogen in citrus, chasew, and avocado were  64, 39 and 39 days, respectively.

  7. Low doses of gamma radiation in the management of postharvest Lasiodiplodia theobromae in mangos

    Directory of Open Access Journals (Sweden)

    Alice Maria Gonçalves Santos

    2015-09-01

    Full Text Available The postharvest life of mango is limited by the development of pathogens, especially fungi that cause rot, among which stands out the Lasiodiplodia theobromae. Several control methods have been employed to minimize the damages caused by this fungus, chemical control can leave residues to man and nature; physical control by the use of gamma radiation in combination with modified atmosphere and cold storage. The use of gamma radiation helps to reduce the severity of the pathogen assist in the ripening process of fruits, even at low doses (0.25, 0.35 and 0.45 kGy chemical properties such as pH, soluble solids, acid ascorbic, titratable acidity and also the quality parameters of the pulp showed no damage that are ideal for trade and consumption of mangoes. This treatment can be extended for use in the management of diseases such as natural infections for penducular rot complex that has as one of L. theobroma pathogens involved.

  8. EFFISIENSI INHIBISI KOROSI BAJA LUNAK DALAM MEDIA ASAM DENGAN INHIBITOR EKSTRAK KULIT BUAH KAKAO (Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Yuli Yetri

    2016-11-01

    Full Text Available Efek inhibisi korosi dan sifat-sifat adsorpsi oleh ekstrak kulit buah kakao (Theobroma cacao  pada baja lunak (mild steel dalam larutan asam 1,5M HCl telah dipelajari menggunakan teknik konvensional metode berat hilang pada variasi waktu, konsentrasi dan suhu. Parameter-parameter termodinamika seperti energi aktivasi, entalpi, entropi dan perubahan energi bebas dihitung. Polarisasi elektrokimia telah dievaluasi untuk memastikan jenis inhibitor. Spektra infrared dan GCMS dilakukan untuk mengetahui senyawa ekstrak yang berperan  dalam proses inhibisi. Morfologi permukaan sampel diamati dengan menggunakan scanning electro microscopy dengan  energy dispersive X-ray spectroscopy (SEM-EDX . Keseluruhan hasil penelitian menunjukkan bahwa ekstrak polar kulit buah coklat  dapat digunakan sebagai inhibitor korosi yang efektif pada baja karbon di lingkungan 1,5M HCl dengan pencapaian efisiensi  inhibisi   terkorosi sebesar 96.26% (weight loss dan 92.08% (Tafel pada konsentrasi ekstrak 2,5% selama768 jam. Mekanisme inhibisi adalah  adsorpsi chemiadsorpsi berdasar tingginya nilai entalpi dan energi bebas.Effisiensi Inhibisi diketahui meningkat dengan peningkatan konsentrasi dari ekstrak serta menurun dengan peningkatan suhu. Kurva polarisasi menunjukkan inhibitor ini berperilaku sebagai inhibitor campuran dengan dominan pada inhibisi katodik. Ekstrak diadsorpsi oleh permukaan mild steel  mengikuti model adsorpsi isotherm Langmuir. Kondisi permukaan mild steel menunjukan terjadinya adsorpsi di permukaan membentuk lapisan tipis di permukaan logam. Penambahan ekstrak kulit buah kakao ke dalam larutan HCl sangat efektif untuk mengurangi serangan korosi di permukaan mild steel.  Kata kunci: Korosi, Inhibitor, Theobroma cacao, Mild steel, Potensiodinamik Corrosion Inhibition Efficiency Mild Steel in Acid Media with Inhibitor Peels Extract of Cacao (Theobroma cacaoABSTRACT Inhibition and adsorption properties of Theobroma cacao peel polar extract

  9. KELIMPAHAN LALAT Bactrocera carambolae DAN Bactrocera umbrosa PADA PERKEBUNAN KAKAO Theobroma cacao L. DI DESA MOJONG KECAMATAN WATTANG SIDENRENG KABUPATEN SIDRAP SULAWESI SELATAN

    OpenAIRE

    Damayanti, Fatmah; Soekendarsih, Eddy; Syahribulan; Ambeng

    2017-01-01

    Research on Abundance of flies Bactrocera carambolae and Bactrocera umbrosa on cocoa plantation Theobroma cacao L. in Mojong Village Wattang Sidenreng Subdistrict Sidrap Regency South Sulawesi. This research aims to know the abundance of Bactrocera carambolae, and Bactrocera umbrosa in cocoa plant Theobroma cacao L. The method used, namely: pheromone trap to catch fruit flies conducted once a week for 4 weeks. The results obtained 2 types of fruit flies that pertolong into 1 genus, with the h...

  10. Molecular characterization of 93 genotypes of cocoa (Theobroma cacao L. with random amplified microsatellites RAMs

    Directory of Open Access Journals (Sweden)

    Yacenia Morillo C.

    2014-12-01

    Full Text Available Random amplified microsatellite (RAMs markers six were used to characterize 93 genotypes of cocoa in Tumaco (Colombia. Hundred twenty seven bands were generated. The number of polymorphic loci varied between 11 and 25 for the AG and TG primers, respectively. This study differentiated the 93 genotypes into six groups with a 0.53 similarity, 0.28 mean heterozygosity (He for the population, and 0.12±0.02 genetic differentiation coefficient or Fst. A significant level of genetic diversity was evident in the T. cacao genotypes. This resource would benefit selection programs of individual trees or plant breeding programs. The genotypes clustered in a large proportion in accordance with the collection zone. This characteristic was associated with collection zones and along the rivers in the municipality of Tumaco. The RAM technique proved to be a useful tool for the determination of genetic diversity in Theobroma species.

  11. Antioxidant effects of an ozonized theobroma oil formulation on damaged-inflammatory rat skin

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Y.; Diaz, M.F.; Hernandez, F.; Gila, D.; Ga, G.

    2011-07-01

    The aim of this study was to determine whether a cosmetic formulation elaborated with ozonized theobroma oil may exert beneficial effects in the restoring of the antioxidant activity on the skin of rats previously irradiated with ultraviolet light. 0.5 g of the formulation was applied on the skin of rats for five days. Superoxide dismutase (SOD), glutathione peroxidase (GPx) and catalase (CAT) activity were determined in a homogenate of rat skin. Malondialdehyde (MDA), conjugated dienes (CD) and total hydroperoxide (THP) content were determined as biomarkers of oxidative stress. Using these parameters, antioxidant and oxidant activity, redox index and oxidative stress grade were determined. The total antioxidant activity was significantly increased while the redox index, total oxidant activity and oxidative stress grade decreased significantly in damaged rats treated with the formulation. These results show the antioxidant properties of the cosmetic formulation due to the stimulation of antioxidant enzymes such as SOD and GPx, preventing skin injury induced by ultraviolet irradiation. (Author).

  12. Phenology of Flowering and Pod Maturity on Some Cocoa Clones (Theobroma cacao L)

    OpenAIRE

    Indah Anita Sari; Agung Wahyu Susilo

    2015-01-01

    Phenology  of  flowering  is  an  important  aspect  in  the  growth  cycle  of cocoa (Theobroma  cacao L.) because the  performance of  plant  especially  flowering is  linked with  anthesis time, time and  duration  of  stigma  receptivity, fruit formation, crossing,  and  seed  development  which  determine  the  plant  breeding  programs . Research was conducted at the Kaliwining experimental station of Indonesian Coffee and  Cocoa  Research Institute  (ICCRI).  The  cocoa  plant  was  or...

  13. Geographic and genetic population differentiation of the Amazonian chocolate tree (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Juan C Motamayor

    Full Text Available Numerous collecting expeditions of Theobroma cacao L. germplasm have been undertaken in Latin-America. However, most of this germplasm has not contributed to cacao improvement because its relationship to cultivated selections was poorly understood. Germplasm labeling errors have impeded breeding and confounded the interpretation of diversity analyses. To improve the understanding of the origin, classification, and population differentiation within the species, 1241 accessions covering a large geographic sampling were genotyped with 106 microsatellite markers. After discarding mislabeled samples, 10 genetic clusters, as opposed to the two genetic groups traditionally recognized within T. cacao, were found by applying Bayesian statistics. This leads us to propose a new classification of the cacao germplasm that will enhance its management. The results also provide new insights into the diversification of Amazon species in general, with the pattern of differentiation of the populations studied supporting the palaeoarches hypothesis of species diversification. The origin of the traditional cacao cultivars is also enlightened in this study.

  14. Application of solid state fermentation on the cocoa bran (Theobroma Cacao L.: producing ligninases

    Directory of Open Access Journals (Sweden)

    Tamires Carvalho dos Santos

    2011-06-01

    Full Text Available The aim of this study was to analyze and quantify the kinetic activity of enzymes ligninases laccase, lignin peroxidase and manganese peroxidase, produced by Solid State Fermentation. We used the fungus Aspergillus niger as inoculum and the waste from the processing of cocoa (Theobroma Cacao L. as raw material at different water concentrations. The agro-industrial residue, after generated, you need to target appropriate because, in addition to creating potential environmental problems, represents losses of raw materials and energy, requiring significant investments in treatments to control pollution. We evaluated the potential of kinetic activity of enzymes depending on weather conditions (24, 72, and 120 hours and water content (40%, 50% and 60%. The fermentation was conducted at 30 0C in a bacteriological incubator. The results indicate the maximization of enzyme activity occurred within 72 hours of fermentation and 50% water content, for all the enzymes.

  15. Geographic and genetic population differentiation of the Amazonian chocolate tree (Theobroma cacao L).

    Science.gov (United States)

    Motamayor, Juan C; Lachenaud, Philippe; da Silva E Mota, Jay Wallace; Loor, Rey; Kuhn, David N; Brown, J Steven; Schnell, Raymond J

    2008-10-01

    Numerous collecting expeditions of Theobroma cacao L. germplasm have been undertaken in Latin-America. However, most of this germplasm has not contributed to cacao improvement because its relationship to cultivated selections was poorly understood. Germplasm labeling errors have impeded breeding and confounded the interpretation of diversity analyses. To improve the understanding of the origin, classification, and population differentiation within the species, 1241 accessions covering a large geographic sampling were genotyped with 106 microsatellite markers. After discarding mislabeled samples, 10 genetic clusters, as opposed to the two genetic groups traditionally recognized within T. cacao, were found by applying Bayesian statistics. This leads us to propose a new classification of the cacao germplasm that will enhance its management. The results also provide new insights into the diversification of Amazon species in general, with the pattern of differentiation of the populations studied supporting the palaeoarches hypothesis of species diversification. The origin of the traditional cacao cultivars is also enlightened in this study.

  16. Isolation of ESTs from cacao (Theobroma cacao L.) leaves treated with inducers of the defense response.

    Science.gov (United States)

    Verica, Joseph A; Maximova, Siela N; Strem, Mary D; Carlson, John E; Bailey, Bryan A; Guiltinan, Mark J

    2004-11-01

    Pathogenic diseases represent a major constraint to the growth and yield of cacao (Theobroma cacao L.). Ongoing research on model plant systems has revealed that defense responses are activated via signaling pathways mediated by endogenous signaling molecules such as salicylic acid, jasmonic acid and ethylene. Activation of plant defenses is associated with changes in the expression of large numbers of genes. To gain a better understanding of defense responses in cacao, we have employed suppressive subtractive hybridization (SSH) cDNA libraries, macroarray hybridization analysis, high throughput DNA sequencing and bioinformatics to identify cacao genes induced by these signaling molecules. Additionally, we investigated gene activation by a phytotoxic elicitor-like protein, Nep1. We have identified a unigene set of 1,256 members, including 330 members representing genes induced during the defense response.

  17. ISOLATION AND PURIFICATION OF LIPASE FROM COCOA BEANS (Theobroma cacao. L. OF CLONE PBC 159

    Directory of Open Access Journals (Sweden)

    Ratna Agung Samsumaharto

    2010-06-01

    Full Text Available Lipase (triacylglycerol acylhydrolase, EC 3.1.1.3 was extracted and purified from acetone dry powder of cocoa (Theobroma cacao. L. of clone PBC 159 extract. The Lipase  from AcDP of cocoa beans was used for purification using 40-60 and 60-80% ammonium sulphate precipitation. The resulted indicated 44.73 and 60.51-fold purification with 26.74 and 33.31% recovery lipase activity (yield, respectively. The crude lipase enzyme from both precipitation were eluted, producing a single peak after applying through Sephacryl S-200 chromatography. The purified enzyme had a uniform specific activity throughout the final chromatography peak. The results from SDS-PAGE analysis showed that the molecular weight of the lipase enzyme was in between 45-66 kDa.   Keywords: isolation, purification, lipase, cocoa beans

  18. Pengaruh Biofer 2000-N dan Pupuk Kascing terhadap Pertumbuhan Bibit Kakao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    I K. NARTA

    2013-08-01

    Full Text Available The Effects of Biofer 2000-N and Casting on Growth of Cacao (Theobroma cacao L. Seedling. The aims of the research were to obtain Biofer 2000-N and Casting effects on growth of cacao (Theobroma cacao L. seedling. The design used was Randomized Block Design with three replications. Treatments were allocated in factorial. First factors were four rates of Biofer: 0 g; 10 g, 20 g and 30 g/plastic bag. The second factors were four rates of Casting: 0 g, 15 g, 30 g and 45 g/plastic bag. The results showed that Biofer rate at 30 g/plastic bag, produced the highest total dry weight of seedling (21.03 mg, significantly (20.24% higher than control (17,49 mg. Biofer at 30 g/plastic bag, increased plant height, stem diameter, stem fresh weight, leaf number, leaf area, leaf fresh weight, fresh weight of plant top, root length, fresh roots weight and total plant fresh weight respectively by 9.02%, 3.58%, 36.02%, 6.00%, 20.50%, 34.45%, 34.94%, 33.31%, 44.44%, and 34.31% than control. Casting rete at 45 g/plastic bag produced the highest dry weight of seedling (20.11 mg, significantly higher (9.89% than control (18.30 mg.. Casting at 45 g/plastic bag, increased plant height, stem diameter, stem fresh weight, lef number, leaf area, fresh leaf weight, fresh plant top weight, root length, fresh roots weight, total plant fresh weight, respectively by 9.70%, 4.31%, 18.32%, 8.03%, 20.54%, 34.53%, 28.26%, 33.15%, 47.65% and 26.00% than control. Biofer 2000-N, Casting or both could increase cacao seedling growth, so, the seedling to be better and could be planted in the field earlier.

  19. Treatment With Intrastromal and Intracameral Voriconazole in 2 Eyes With Lasiodiplodia theobromae Keratitis

    Science.gov (United States)

    Lekhanont, Kaevalin; Nonpassopon, Manachai; Nimvorapun, Nutthida; Santanirand, Pitak

    2015-01-01

    Abstract To report the clinical presentation and the role of intrastromal and intracameral voriconazole injection in the management of rare cases of fungal keratitis caused by Lasiodiplodia theobromae. Two eyes of 2 patients with Lasiodiplodia keratitis unresponsive to topical and oral antifungal medications were included in this study. Diagnosis of Lasiodiplodia keratitis was confirmed by microbiological analysis, including culture-based (case 1 and 2) and DNA sequencing techniques (case 2 only). The first patient presented with multiple satellite lesions and one of these infiltrates spread deeply into the cornea, forming a stromal abscess. Another patient had a large full-thickness corneal infiltrates with several fungal balls in the anterior chamber, requiring a limbus-to-limbus therapeutic penetrating keratoplasty. Despite aggressive topical therapy, the stromal abscess continued to worsen in the first case and recurrent keratitis was observed postoperatively in the second case. Voriconazole 50 μg/0.1 mL was administered intracamerally and intrastromally around the fungal abscess as adjuncts to topical antimycotics in the first case. The second patient who needed therapeutic keratoplasty was treated with an intracameral injection of 50 μg/0.1 mL voriconazole at the end of surgery. Postoperatively, 100 μg/0.1 mL voriconazole was also injected intracamerally after the recurrence of infection was noted in the graft. Reinjections were given 48 hours apart in both cases. After the injections, all corneal and anterior chamber lesions were reduced in size and density and completely resolved within 4 weeks. Intrastromal and intracameral voriconazole injections may offer safe and effective treatment options for L theobromae keratitis. PMID:25674759

  20. The Age of Chocolate: a biogeographic history of Theobroma and Malvaceae

    Directory of Open Access Journals (Sweden)

    James Edward Richardson

    2015-11-01

    Full Text Available Dated molecular phylogenies of broadly distributed lineages can help to compare patterns of diversification in different parts of the world. An explanation for greater Neotropical diversity compared to other parts of the tropics is that it was an accident of the Andean orogeny. Using dated phylogenies, of chloroplast ndhF and nuclear DNA WRKY sequence datasets, generated using BEAST we demonstrate that the diversification of the genera Theobroma and Herrania occurred from 12.7 (11.6-14.9 [95% HPD] million years ago (Ma and thus coincided with Andean uplift from the mid-Miocene and that this lineage had a faster diversification rate than other major clades in Malvaceae. We also demonstrate that Theobroma cacao, the source of chocolate, diverged from its most recent common ancestor 9.9 (7.7-12.9 95% HPD Ma, in the mid-to late-Miocene, suggesting that this economically important species has had ample time to generate significant within-species genetic diversity that is useful information for a developing chocolate industry. In addition, we address questions related to the latitudinal gradient in species diversity within Malvaceae. A faster diversification rate is an explanation for the greater species diversity at lower latitudes. Alternatively, tropical conditions may have existed for longer and occupied greater areas than temperate ones meaning that tropical lineages have had more time and space in which to diversify. Our dated molecular phylogeny of Malvaceae demonstrated that at least one temperate lineage within the family diverged from tropical ancestors then diversified at a rate comparable with many tropical lineages in the family. These results are consistent with the hypothesis that Malvaceae are more species rich in the tropics because tropical lineages within the family have existed for longer and occupied more space than temperate ones, and not because of differences in diversification rate.

  1. The Effect of 2,4 Dichlorophenoxyacetic Acid on in Vitro Callogenesis of Cocoa (Theobroma Cacao L.)

    OpenAIRE

    Pancaningtyas, Sulistyani

    2015-01-01

    Cocoa (Theobroma cacao L.) development using modern breeding techniques can be facilitated by propagation of planting material through somatic embryogenesis. Various factors that may affect embryogenesis are the composition of culture medium and culture condition. Hormone commonly used to initiate the formation of callus is auxin with type 2.4-D (2.4 Dichlorophenoxy acetic acid). The aim of this study was to determine the effect of the addition of 2.4 -D hormoneson the process of cocoa embryo...

  2. Phylogeography and population structure analysis reveals diversity by mutations in Lasiodiplodia theobromae with distinct sources of selection.

    Science.gov (United States)

    Santos, P H D; Carvalho, B M; Aguiar, K P; Aredes, F A S; Poltronieri, T P S; Vivas, J M S; Dias, V Mussi; Bezerra, G A; Pinho, D B; Pereira, M G; Silveira, S F

    2017-04-20

    Lasiodiplodia theobromae is a plant pathogen with a worldwide distribution, with low host specificity, causing stem cankers, dieback diseases, and fruit rot in several species of plants. In coconut, this pathogen is reported as the etiological agent of "coconut leaf blight" (CLB) disease, causing several losses in fruit production. The CLB is an important disease for this crop in Brazil. In our study, we used a phylogeographic approach through the molecular characterization of the translation elongation factor 1-α (TEF1-α) to elucidate the pathogen distribution in Brazil and other countries, besides, search information about diversity sources of this pathogen in coconut palm tree at Brazilian northern, northeast, and southeast. We found that L. theobromae diversity is within populations (locations), and populations that are located closest to the center of the tropical zone have more variability as Central Africa, Brazilian Southeast, and Northeast. The widespread distribution could be in part related with long-distance dispersal via global trade of plants and plant products. The entrance route of L. theobromae in Brazil probably occurred from Africa route and not occurred once. In Brazil, the diversity of this pathogen in coconut tree could be linked to two agents of selection: high host diversity (in Northeast) and distinct management measures adopted in Southeast. These different sources of selection, mainly the mutations, could be one of the reasons that we found distinct reactions to "coconut leaf blight" chemical control in these regions.

  3. Calogênese do híbrido Theobroma grandiflorum x T. obovatum (Sterculiaceae Calogenesis of Theobroma grandiflorum x. T. obovatum hibrid (Sterculiaceae

    Directory of Open Access Journals (Sweden)

    Giorgini Augusto Venturieri

    2004-12-01

    Full Text Available O declínio da cacauicultura na amazônia tem sido causado pela doença vassoura-de-bruxa (Crinipellis perniciosa. Um híbrido interespecífico do mesmo gênero (Theobroma grandiflorum x T. obovatum tem demonstrando resistência a esta doença. Avaliou-se a calogênese deste híbrido com a finalidade de sua propagação massiva. Os explantes usados (tegumento, cotilédone e embrião foram postos para desenvolver em condições estéreis em meio de cultura LPm mais água de coco (50 ml/l, glucose (20 g/l, 2,4 - D (2 mg/l, Thidiazuron - TDZ nas concentrações de 0, 5 e 10 µg/l, carvão ativado (2 g/l em gelrite (2 g/l a um pH de 5,8. Cada concentração de TDZ x tipo de tecido foi considerado um tratamento. As culturas foram mantidas no escuro, à temperatura de 22 ± 2 ºC. Os tecidos não mostraram diferenças significativas quanto a proporção do explante recoberto por calos (p= 0,14 embora notou-se que nos cotilédones tenha sido maior. A dosagem de TDZ nitidamente não influenciou no recobrimento de calos (p= 0,94. Quanto a freqüência, os tecidos mostraram diferentes capacidades de desenvolver calos (p= 0,02 sem mostrar-se influenciados pela dosagem de TDZ (p = 0,66. Os explantes de cotilédones foram os que formaram calos em maior freqüência. Houve uma leve tendência de que quanto menor a dosagem de TDZ maior a freqüência de calos obtidos. Não foi constatada interação entre tipo de calo/frasco x dosagem de TDZ (p = 0,32.Decline of cocoa plantations in Amazonia has been attributed to Witches-broom-disease (Crinipellis perniciosa. An interspecific hybrid (Theobroma grandiflorum x T. obovatum has demonstrated resistance to this disease. Calogenesis of this hybrid was evaluated, in preparation for its mass propagation. The explants used (tegument, cotyledons and embryos were developed in sterile conditions in LPm media plus coconut milk (50 ml/l, glucose (20 g/l, 2,4 - D (2 mg/l, Thidiazuron - TDZ at concentrations of 0, 5 e 10 µg

  4. THEOBROMA CACAO

    African Journals Online (AJOL)

    Mimi

    Afoakwa EO1*, Kongor JE1, Budu AS1,. Mensah-Brown H3 and JF Takrama2. Emmanuel Afoakwa. *Corresponding author email: eafoakwa@ug.edu.gh / eoafoakwa@gmail.com. 1Department of Nutrition & Food Science, University of Ghana, ..... microbiology – fundamentals and frontiers, ASM Press, Washington DC, 2001.

  5. Theobroma cacao

    African Journals Online (AJOL)

    SAM

    2014-07-16

    Jul 16, 2014 ... Full Length Research Paper. Assessing .... Cocoa pods inoculation. The apparently healthy pods were harvested, washed with tap ..... Coffee, cocoa, tea. 20:97-115. Boudjeko T (2003). Few indicators of resistance in the parasitic relation. Xanthosoma sagittifolium L. Schott/Pytium myriotylum. PhD thesis of.

  6. Functional analysis of the Theobroma cacao NPR1 gene in Arabidopsis.

    Science.gov (United States)

    Shi, Zi; Maximova, Siela N; Liu, Yi; Verica, Joseph; Guiltinan, Mark J

    2010-11-15

    The Arabidopsis thaliana NPR1 gene encodes a transcription coactivator (NPR1) that plays a major role in the mechanisms regulating plant defense response. After pathogen infection and in response to salicylic acid (SA) accumulation, NPR1 translocates from the cytoplasm into the nucleus where it interacts with other transcription factors resulting in increased expression of over 2000 plant defense genes contributing to a pathogen resistance response. A putative Theobroma cacao NPR1 cDNA was isolated by RT-PCR using degenerate primers based on homologous sequences from Brassica, Arabidopsis and Carica papaya. The cDNA was used to isolate a genomic clone from Theobroma cacao containing a putative TcNPR1 gene. DNA sequencing revealed the presence of a 4.5 kb coding region containing three introns and encoding a polypeptide of 591 amino acids. The predicted TcNPR1 protein shares 55% identity and 78% similarity to Arabidopsis NPR1, and contains each of the highly conserved functional domains indicative of this class of transcription factors (BTB/POZ and ankyrin repeat protein-protein interaction domains and a nuclear localization sequence (NLS)). To functionally define the TcNPR1 gene, we transferred TcNPR1 into an Arabidopsis npr1 mutant that is highly susceptible to infection by the plant pathogen Pseudomonas syringae pv. tomato DC3000. Driven by the constitutive CaMV35S promoter, the cacao TcNPR1 gene partially complemented the npr1 mutation in transgenic Arabidopsis plants, resulting in 100 fold less bacterial growth in a leaf infection assay. Upon induction with SA, TcNPR1 was shown to translocate into the nucleus of leaf and root cells in a manner identical to Arabidopsis NPR1. Cacao NPR1 was also capable of participating in SA-JA signaling crosstalk, as evidenced by the suppression of JA responsive gene expression in TcNPR1 overexpressing transgenic plants. Our data indicate that the TcNPR1 is a functional ortholog of Arabidopsis NPR1, and is likely to play a

  7. A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6.

    Science.gov (United States)

    Saski, Christopher A; Feltus, Frank A; Staton, Margaret E; Blackmon, Barbara P; Ficklin, Stephen P; Kuhn, David N; Schnell, Raymond J; Shapiro, Howard; Motamayor, Juan Carlos

    2011-08-16

    The fermented dried seeds of Theobroma cacao (cacao tree) are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS) II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105) span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map assembly. A comparison between the two T. cacao

  8. Functional analysis of the theobroma cacao NPR1 gene in arabidopsis

    Directory of Open Access Journals (Sweden)

    Verica Joseph

    2010-11-01

    Full Text Available Abstract Background The Arabidopsis thaliana NPR1 gene encodes a transcription coactivator (NPR1 that plays a major role in the mechanisms regulating plant defense response. After pathogen infection and in response to salicylic acid (SA accumulation, NPR1 translocates from the cytoplasm into the nucleus where it interacts with other transcription factors resulting in increased expression of over 2000 plant defense genes contributing to a pathogen resistance response. Results A putative Theobroma cacao NPR1 cDNA was isolated by RT-PCR using degenerate primers based on homologous sequences from Brassica, Arabidopsis and Carica papaya. The cDNA was used to isolate a genomic clone from Theobroma cacao containing a putative TcNPR1 gene. DNA sequencing revealed the presence of a 4.5 kb coding region containing three introns and encoding a polypeptide of 591 amino acids. The predicted TcNPR1 protein shares 55% identity and 78% similarity to Arabidopsis NPR1, and contains each of the highly conserved functional domains indicative of this class of transcription factors (BTB/POZ and ankyrin repeat protein-protein interaction domains and a nuclear localization sequence (NLS. To functionally define the TcNPR1 gene, we transferred TcNPR1 into an Arabidopsis npr1 mutant that is highly susceptible to infection by the plant pathogen Pseudomonas syringae pv. tomato DC3000. Driven by the constitutive CaMV35S promoter, the cacao TcNPR1 gene partially complemented the npr1 mutation in transgenic Arabidopsis plants, resulting in 100 fold less bacterial growth in a leaf infection assay. Upon induction with SA, TcNPR1 was shown to translocate into the nucleus of leaf and root cells in a manner identical to Arabidopsis NPR1. Cacao NPR1 was also capable of participating in SA-JA signaling crosstalk, as evidenced by the suppression of JA responsive gene expression in TcNPR1 overexpressing transgenic plants. Conclusion Our data indicate that the TcNPR1 is a functional

  9. Modified pectin from Theobroma cacao induces potent pro-inflammatory activity in murine peritoneal macrophage.

    Science.gov (United States)

    Amorim, Juliana C; Vriesmann, Lucia Cristina; Petkowicz, Carmen L O; Martinez, Glaucia Regina; Noleto, Guilhermina R

    2016-11-01

    In vitro effects of acetylated pectin (OP) isolated from cacao pod husks (Theobroma cacao L.), its partially deacetylated and de-esterified form (MOP), and a commercial homogalacturonan (PG) were investigated on murine peritoneal macrophages. MOP stood out among the studied pectins. After 48h of incubation, compared with the control group, it was able to promote significant macrophage morphological differentiation from resident to activated stage and also stimulated nitric oxide production, which reached a level of 85% of that of LPS stimulus. In the presence of the highest tested concentration of MOP (200μg·mL-1), the levels of the cytokines TNF-α (6h) and IL-12 and IL-10 (48h) increased substantially in relation to untreated cells. Our results show that the partial deacetylation and de-esterification of pectin extracted from cacao pod husks (T. cacao L.) produced a polymer with greater ability than its native form to activate macrophages to a cytotoxic phenotype. Like this, they provide the possibility of a therapeutic application to MOP, which could lead to a decreased susceptibility to microbial infection besides antitumor activity. Additionally, the present results also corroborate with the proposition of that the chemical modifications of the biopolymers can result in an improved molecule with new possibilities of application. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Gene flow and genetic diversity in cultivated and wild cacao (Theobroma cacao) in Bolivia.

    Science.gov (United States)

    Chumacero de Schawe, Claudia; Durka, Walter; Tscharntke, Teja; Hensen, Isabell; Kessler, Michael

    2013-11-01

    The role of pollen flow within and between cultivated and wild tropical crop species is little known. To study the pollen flow of cacao, we estimated the degree of self-pollination and pollen dispersal distances as well as gene flow between wild and cultivated cacao (Theobroma cacao L.). We studied pollen flow and genetic diversity of cultivated and wild cacao populations by genotyping 143 wild and 86 cultivated mature plants and 374 seedlings raised from 19 wild and 25 cultivated trees at nine microsatellite loci. A principal component analysis distinguished wild and cultivated cacao trees, supporting the notion that Bolivia harbors truly wild cacao populations. Cultivated cacao had a higher level of genetic diversity than wild cacao, presumably reflecting the varied origin of cultivated plants. Both cacao types had high outcrossing rates, but the paternity analysis revealed 7-14% self-pollination in wild and cultivated cacao. Despite the tiny size of the pollinators, pollen was transported distances up to 3 km; wild cacao showed longer distances (mean = 922 m) than cultivated cacao (826 m). Our data revealed that 16-20% of pollination events occurred between cultivated and wild populations. We found evidence of self-pollination in both wild and cultivated cacao. Pollination distances are larger than those typically reported in tropical understory tree species. The relatively high pollen exchange from cultivated to wild cacao compromises genetic identity of wild populations, calling for the protection of extensive natural forest tracts to protect wild cacao in Bolivia.

  11. Diversity of chloroplast genome among local clones of cocoa (Theobroma cacao, L.) from Central Sulawesi

    Science.gov (United States)

    Suwastika, I. Nengah; Pakawaru, Nurul Aisyah; Rifka, Rahmansyah, Muslimin, Ishizaki, Yoko; Cruz, André Freire; Basri, Zainuddin; Shiina, Takashi

    2017-02-01

    Chloroplast genomes typically range in size from 120 to 170 kilo base pairs (kb), which relatively conserved among plant species. Recent evaluation on several species, certain unique regions showed high variability which can be utilized in the phylogenetic analysis. Many fragments of coding regions, introns, and intergenic spacers, such as atpB-rbcL, ndhF, rbcL, rpl16, trnH-psbA, trnL-F, trnS-G, etc., have been used for phylogenetic reconstructions at various taxonomic levels. Based on that status, we would like to analysis the diversity of chloroplast genome within species of local cacao (Theobroma cacao L.) from Central Sulawesi. Our recent data showed, there were more than 20 clones from local farming in Central Sulawesi, and it can be detected based on phenotypic and nuclear-genome-based characterization (RAPD- Random Amplified Polymorphic DNA and SSR- Simple Sequences Repeat) markers. In developing DNA marker for this local cacao, here we also included analysis based on the variation of chloroplast genome. At least several regions such as rpl32-TurnL, it can be considered as chloroplast markers on our local clone of cocoa. Furthermore, we could develop phylogenetic analysis in between clones of cocoa.

  12. Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.

    Science.gov (United States)

    Livingstone, Donald; Royaert, Stefan; Stack, Conrad; Mockaitis, Keithanne; May, Greg; Farmer, Andrew; Saski, Christopher; Schnell, Ray; Kuhn, David; Motamayor, Juan Carlos

    2015-08-01

    Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ∼4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification project was undertaken using RNAseq data from 16 diverse cacao cultivars. RNA sequences were aligned to the assembled transcriptome of the cultivar Matina 1-6, and 330,000 SNPs within coding regions were identified. From these SNPs, a subset of 6,000 high-quality SNPs were selected for inclusion on an Illumina Infinium SNP array: the Cacao6kSNP array. Using Cacao6KSNP array data from over 1,000 cacao samples, we demonstrate that our custom array produces a saturated genetic map and can be used to distinguish among even closely related genotypes. Our study enhances and expands the genetic resources available to the cacao research community, and provides the genome-scale set of tools that are critical for advancing breeding with molecular markers in an agricultural species with high genetic diversity. © The Author 2015. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  13. Theobroma cacao cystatins impair Moniliophthora perniciosa mycelial growth and are involved in postponing cell death symptoms.

    Science.gov (United States)

    Pirovani, Carlos Priminho; da Silva Santiago, André; dos Santos, Lívia Santana; Micheli, Fabienne; Margis, Rogério; da Silva Gesteira, Abelmon; Alvim, Fátima Cerqueira; Pereira, Gonçalo Amarante Guimarães; de Mattos Cascardo, Júlio Cézar

    2010-11-01

    Three cystatin open reading frames named TcCys1, TcCys2 and TcCys3 were identified in cDNA libraries from compatible interactions between Theobroma cacao (cacao) and Moniliophthora perniciosa. In addition, an ORF named TcCys4 was identified in the cDNA library of the incompatible interaction. The cDNAs encoded conceptual proteins with 209, 127, 124, and 205 amino acid residues, with a deduced molecular weight of 24.3, 14.1, 14.3 and 22.8 kDa, respectively. His-tagged recombinant proteins were purified from Escherichia coli expression, and showed inhibitory activities against M. perniciosa. The four recombinant cystatins exhibited K(i) values against papain in the range of 152-221 nM. Recombinant TcCYS3 and TcCYS4 immobilized in CNBr-Sepharose were efficient to capture M. perniciosa proteases from culture media. Polyclonal antibodies raised against the recombinant TcCYS4 detected that the endogenous protein was more abundant in young cacao tissues, when compared with mature tissues. A ~85 kDa cacao multicystatin induced by M. perniciosa inoculation, MpNEP (necrosis and ethylene-inducing protein) and M. perniciosa culture supernatant infiltration were detected by anti-TcCYS4 antibodies in cacao young tissues. A direct role of the cacao cystatins in the defense against this phytopathogen was proposed, as well as its involvement in the development of symptoms of programmed cell death.

  14. Comparative evaluation of total RNA extraction methods in Theobroma cacao using shoot apical meristems.

    Science.gov (United States)

    Silva, D V; Branco, S M J; Holanda, I S A; Royaert, S; Motamayor, J C; Marelli, J P; Corrêa, R X

    2016-03-04

    Theobroma cacao is a species of great economic importance with its beans used for chocolate production. The tree has been a target of various molecular studies. It contains many polyphenols, which complicate the extraction of nucleic acids with the extraction protocols requiring a large amount of plant material. These issues, therefore, necessitate the optimization of the protocols. The aim of the present study was to evaluate different methods for extraction of total RNA from shoot apical meristems of T. cacao 'CCN 51' and to assess the influence of storage conditions for the meristems on the extraction. The study also aimed to identify the most efficient protocol for RNA extraction using a small amount of plant material. Four different protocols were evaluated for RNA extraction using one shoot apical meristem per sample. Among these protocols, one that was more efficient was then tested to extract RNA using four different numbers of shoot apical meristems, subjected to three different storage conditions. The best protocol was tested for cDNA amplification using reverse transcription-polymerase chain reaction; the cDNA quality was determined to be satisfactory for molecular analyses. The study revealed that with the best RNA extraction protocol, one shoot apical meristem was sufficient for extraction of high-quality total RNA. The results obtained might enable advances in genetic analyses and molecular studies using reduced amount of plant material.

  15. Comparative proteomic analysis of early somatic and zygotic embryogenesis in Theobroma cacao L.

    Science.gov (United States)

    Noah, Alexandre Mboene; Niemenak, Nicolas; Sunderhaus, Stephanie; Haase, Christin; Omokolo, Denis Ndoumou; Winkelmann, Traud; Braun, Hans-Peter

    2013-01-14

    Somatic embryogenesis can efficiently foster the propagation of Theobroma cacao, but the poor quality of resulted plantlet hinders the use of this technique in the commercial scale. The current study has been initiated to systematically compare the physiological mechanisms underlying somatic and zygotic embryogenesis in T. cacao on the proteome level. About 1000 protein spots per fraction could be separated by two-dimensional isoelectric focusing/SDS PAGE. More than 50 of the protein spots clearly differed in abundance between zygotic and somatic embryos: 33 proteins spots were at least 3-fold higher in abundance in zygotic embryos and 20 in somatic embryos. Analyses of these protein spots differing in volume by mass spectrometry resulted in the identification of 68 distinct proteins. Many of the identified proteins are involved in genetic information processing (21 proteins), carbohydrate metabolism (11 proteins) and stress response (7 proteins). Somatic embryos especially displayed many stress related proteins, few enzymes involved in storage compound synthesis and an exceptional high abundance of endopeptidase inhibitors. Phosphoenolpyruvate carboxylase, which was accumulated more than 3-fold higher in zygotic embryos, represents a prominent enzyme in the storage compound metabolism in cacao seeds. Implications on the improvement of somatic embryogenesis in cacao are discussed. Copyright © 2012 Elsevier B.V. All rights reserved.

  16. Ultra-barcoding in cacao (Theobroma spp.; Malvaceae) using whole chloroplast genomes and nuclear ribosomal DNA.

    Science.gov (United States)

    Kane, Nolan; Sveinsson, Saemundur; Dempewolf, Hannes; Yang, Ji Yong; Zhang, Dapeng; Engels, Johannes M M; Cronk, Quentin

    2012-02-01

    To reliably identify lineages below the species level such as subspecies or varieties, we propose an extension to DNA-barcoding using next-generation sequencing to produce whole organellar genomes and substantial nuclear ribosomal sequence. Because this method uses much longer versions of the traditional DNA-barcoding loci in the plastid and ribosomal DNA, we call our approach ultra-barcoding (UBC). We used high-throughput next-generation sequencing to scan the genome and generate reliable sequence of high copy number regions. Using this method, we examined whole plastid genomes as well as nearly 6000 bases of nuclear ribosomal DNA sequences for nine genotypes of Theobroma cacao and an individual of the related species T. grandiflorum, as well as an additional publicly available whole plastid genome of T. cacao. All individuals of T. cacao examined were uniquely distinguished, and evidence of reticulation and gene flow was observed. Sequence variation was observed in some of the canonical barcoding regions between species, but other regions of the chloroplast were more variable both within species and between species, as were ribosomal spacers. Furthermore, no single region provides the level of data available using the complete plastid genome and rDNA. Our data demonstrate that UBC is a viable, increasingly cost-effective approach for reliably distinguishing varieties and even individual genotypes of T. cacao. This approach shows great promise for applications where very closely related or interbreeding taxa must be distinguished.

  17. In vitro antioxidant and antiproliferative activities of methanolic plant part extracts of Theobroma cacao.

    Science.gov (United States)

    Baharum, Zainal; Akim, Abdah Md; Taufiq-Yap, Yun Hin; Hamid, Roslida Abdul; Kasran, Rosmin

    2014-11-10

    The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH), thiobarbituric acid-reactive substances (TBARS), and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT) assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50) was 358.3±7.0 µg/mL and total phenolic content was 22.0±1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4%±1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50)=41.4±3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.

  18. Pengaruh Kadar Air dan Persamaan Model Bet untuk Prediksi Masa Simpan Kakao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Rita Hayati

    2017-04-01

    Full Text Available Effect of moisture content and BET equation to the shelf life of cocoa (Theobroma cacao L. has been conducted. Increasing the quality of cocoa beans is with proper post-harvest handling, including how the harvest, the level of ripeness, curing, fermenting, drying up storage. The purpose of this study was to determine the water content and the appropriate levels of critical in determining the shelf life of cocoa. The benefits of this research are as information for farmers in determining the shelf life of cocoa in order to design a storage area corresponding to the respiratory system owned by cocoa. The results showed that the effect of fermentation facilitator (Staphilococcus cerevisiae and drying temperature on water content showed that the fermentation facilitator (Staphilococcus cerevisiae highly significant effect on water content. The drying temperature is also highly significant effect on water content. BET equation obtained was Y = 2,912x + 1.238 (R2 = 0.965, Y = 2,897x + 1.353 (R2 = 0.968 and Y = 2,806x + 1.89 (R2 = 0.954.

  19. Use of secondary somatic embryos promotes genetic fidelity in cryopreservation of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    J-Y. FANG

    2008-12-01

    Full Text Available The inability to conserve cocoa (Theobroma cacao L. germplasm via seed storage and the vulnerability of field collections make the establishment of cryopreserved genebanks for the crop a priority. An effective encapsulation-dehydration based cryopreservation system has been developed for cocoa but because the somatic embryos used for freezing arise after a protracted period of callus culture there is concern about maintenance of genetic fidelity during the process. Microsatellite markers for seven of the 10 cocoa linkage groups were used to screen a population of 189 primary somatic embryo-derived emblings and the 43 secondary somatic embryos they gave rise to. Of the primary somatic embryos, 38.1% exhibited polymorphic microsatellite profiles while for secondary somatic embryos the frequency was 23.3%. The same microsatellite markers used to screen another population of 44 secondary somatic embryos cryopreserved through encapsulation-dehydration revealed no polymorphisms. Scanning electron microscopy showed the secondary somatic embryos were derived from cotyledonary epidermal cells rather than callus. The influence of embryo ontogeny on somaclonal variation is discussed.;

  20. Presencia de metales pesados en cultivo de cacao (Theobroma cacao L. orgánico

    Directory of Open Access Journals (Sweden)

    Hugo Alfredo Huamaní-Yupanqui

    2012-12-01

    Full Text Available La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L. es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron análisis de correlación de Pearson entre los contenidos de plomo y cadmio disponibles en el suelo con variables foliares (P, Mg, Ca, Zn, Cd, Pb y del suelo (arena, arcilla y K. En los suelos, sólo en el caso de potasio se presentan deficiencias; mientras que en el tejido foliar se presentaron deficiencias de N, P, K, Mg y Zn. Los valores promedio de cadmio y plomo disponible en los suelos fueron 0.53 y 3.02 ppm y en las hojas de cacao de 0.21 y 0.58 ppm respectivamente.

  1. Carbohydrate metabolism changes in Prunus persica gummosis infected with Lasiodiplodia theobromae.

    Science.gov (United States)

    Li, Z; Gao, L; Wang, Y T; Zhu, W; Ye, J L; Li, G H

    2014-05-01

    Peach gummosis represents a significant global disease of stone fruit trees and a major disease in the south peach production area of the Yangtze River of China. In this study, the carbohydrate composition of peach shoots during infection by Lasiodiplodia theobromae was examined. The expression of genes related to metabolic enzymes was also investigated. Control wounded and noninoculated tissue, lesion tissue, and wounded and inoculated surrounding lesion tissue of peach shoots were analyzed. Soluble sugars, glucose, mannose, arabinose, and xylose significantly increased in inoculated tissues of peach shoots compared with control tissues at different times after inoculation. Accumulation of polysaccharides was also observed by section observation and periodic acid Schiff's reagent staining during infection. Analysis using quantitative reverse-transcription polymerase chain reaction revealed that the abundance of key transcripts on the synthesis pathway of uridine diphosphate (UDP)-D-glucuronate, UDP-D-galactose, and UDP-D-arabinose increased but the synthesis of L-galactose and guanosine diphosphate-L-galactose were inhibited. After inoculation, the transcript levels of sugar transport-related genes (namely, SUT, SOT, GMT, and UGT) was induced. These changes in sugar content and gene expression were directly associated with peach gum polysaccharide formation and may be responsible for the symptoms of peach gummosis.

  2. In Vitro Antioxidant and Antiproliferative Activities of Methanolic Plant Part Extracts of Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Zainal Baharum

    2014-11-01

    Full Text Available The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH, thiobarbituric acid-reactive substances (TBARS, and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50 was 358.3 ± 7.0 µg/mL and total phenolic content was 22.0 ± 1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4% ± 1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50 = 41.4 ± 3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.

  3. Biosynthesis, accumulation and degradation of theobromine in developing Theobroma cacao fruits.

    Science.gov (United States)

    Zheng, Xin-Qiang; Koyama, Yoko; Nagai, Chifumi; Ashihara, Hiroshi

    2004-04-01

    We have studied the purine alkaloid content and purine metabolism in Theobroma cacao fruits at differing growth stages: Stage A (young small fruit, fresh weight, ca. 2 g); stage B (medium size fruit, fresh weight, ca. 100 g) and stage C (large size, fresh weight, ca. 500 g). The major purine alkaloid in stage A fruits (mainly pericarp) was theobromine (0.7 micromol g(-1) fresh weight), followed by caffeine (0.09 micromol g(-1) fresh weight). The theobromine content of the pericarp decreased sharply with tissue age, and the caffeine content decreased gradually. A large amount of theobromine (22 micromol g(-1) fresh weight) had accumulated in seeds (mainly cotyledons) of stage C fruits. Theobromine was found also in the seed coat and placenta. Tracer experiments with [8-(14)C]adenine show that the major sites of theobromine synthesis are the young pericarp and cotyledons of T. cacao fruits. Limited amounts of purine alkaloids may be transported from the pericarp to seed tissue, but most purine alkaloids that accumulated in seeds appeared to be synthesised in cotyledons. Degradation of [8-(14)C]theobromine and [8-(14)C]caffeine to CO2 via 3-methylxanthine and ureides (allantoin and allantoic acid) was detected only in the pericarp of stage C fruits.

  4. Gene discovery and microarray analysis of cacao (Theobroma cacao L.) varieties.

    Science.gov (United States)

    Jones, Paul G; Allaway, David; Gilmour, D Martin; Harris, Chris; Rankin, Debbie; Retzel, Ernest R; Jones, Chris A

    2002-12-01

    The cacao bean harvest from the relatively under developed tropical tree cacao (Theobroma cacao L.) is subject to high losses in potential production due to pests and diseases. To discover and understand the stability of putative natural resistance mechanisms in this commodity crop, essential for chocolate production, we undertook a gene-discovery program and demonstrated its use in gene-expression arrays. Sequencing and assembling bean and leaf cDNA library inserts produced a unique contig set of 1,380 members. High-quality annotation of this gene set using Blast and MetaFam produced annotation for 75% of the contigs and allowed us to identify the types of gene expressed in cacao beans and leaves. Microarrays were constructed using amplified inserts of the uni-gene set and challenged with bean and leaf RNA from five cacao varieties. The microarray performed well across the five randomly chosen cacao genotypes and did not show a bias towards either leaf or bean tissues. This demonstrates that the gene sequences are useful for microarray analysis across cacao genotypes and tissue types. The array results, when compared with real-time PCR results for selected genes, showed a correlation with differential gene-expression patterns. We intend that the resultant DNA sequences and molecular microarray platform will help the cacao community to understand the basis, likely stability and pathotype resistance range of candidate cacao plants.

  5. Microencapsulation of Theobroma cacao L. waste extract: optimization using response surface methodology.

    Science.gov (United States)

    Gabbay Alves, Taís Vanessa; Silva da Costa, Russany; Aliakbarian, Bahar; Casazza, Alessandro Alberto; Perego, Patrizia; Carréra Silva Júnior, José Otávio; Ribeiro Costa, Roseane Maria; Converti, Attilio

    2017-03-01

    The cocoa extract (Theobroma cacao L.) has a significant amount of polyphenols (TP) with potent antioxidant activity (AA). This study aims to optimise microencapsulation of the extract of cocoa waste using chitosan and maltodextrin. Microencapsulation tests were performed according to a Box-Behnken factorial design, and the results were evaluated by response surface methodology with temperature, maltodextrin concentration (MD) and extract flowrate (EF) as independent variables, and the fraction of encapsulated TP, TP encapsulation yield, AA, yield of drying and solubility index as responses. The optimum conditions were: inlet temperature of 170 °C, MD of 5% and EF of 2.5 mL/min. HPLC analysis identified epicatechin as the major component of both the extract and microparticles. TP release was faster at pH 3.5 than in water. These results as a whole suggest that microencapsulation was successful and the final product can be used as a nutrient source for aquatic animal feed. Highlights Microencapsulation is optimised according to a factorial design of the Box-Behnken type. Epicatechin is the major component of both the extract and microcapsules. The release of polyphenols from microcapsules is faster at pH 3.5 than in water.

  6. Confocal observations of late-acting self-incompatibility in Theobroma cacao L.

    Science.gov (United States)

    Ford, Caroline S; Wilkinson, Mike J

    2012-09-01

    Cocoa (Theobroma cacao) has an idiosyncratic form of late-acting self-incompatibility that operates through the non-fusion of incompatible gametes. Here, we used high-resolution confocal microscopy to define fine level changes to the embryo sac of the strongly self-incompatible cocoa genotype SCA 24 in the absence of pollination, and following compatible and incompatible pollination. All sperm nuclei had fused with the female nuclei by 48 h following compatible pollinations. However, following incompatible pollinations, we observed divergence in the behaviour of sperm nuclei following release into the embryo sac. Incomplete sperm nucleus migration occurred in approximately half of the embryo sacs, where the sperm nuclei had so far failed to reach the female gamete nuclei. Sperm nuclei reached but did not fuse with the female gamete nuclei in the residual cases. We argue that the cellular mechanisms governing sperm nucleus migration to the egg nucleus and those controlling subsequent nuclear fusion are likely to differ and should be considered independently. Accordingly, we recommend that future efforts to characterise the genetic basis of LSI in cocoa should take care to differentiate between these two events, both of which contribute to failed karyogamy. Implications of these results for continuing efforts to gain better understanding of the genetic control of LSI in cocoa are discussed.

  7. Management of Chinese Rose Beetle (Adoretus sinicus) Adults Feeding on Cacao (Theobroma cacao) Using Insecticides.

    Science.gov (United States)

    Spafford, Helen; Ching, Alexander; Manley, Megan; Hardin, Chelsea; Bittenbender, Harry

    2016-06-24

    The Chinese rose beetle (Adoretus sinicus Burmeister (Coleoptera: Scarabaeidae)) is an introduced, widely-established pest in Hawai'i. The adult beetles feed on the leaves of cacao (Theobroma cacao L.), which can lead to defoliation and even death of young trees. We evaluated the impact of five commercially available products with different active ingredients (imidacloprid, azadirachtin, Beauveria bassiana (Bals.-Criv.) Vuill., kaolin clay, and pyrethrin) and the presence or absence of weed mat cover in reducing adult beetle feeding on sapling cacao in the field. The use of weed mat cover reduced feeding damage compared to the untreated control, as did foliar application of imidacloprid, azadirachtin, and B. bassiana. In the laboratory, field-collected adult beetles were presented cacao leaf samples dipped in one of the five products and compared to a control. Beetles exposed to pyrethrin died rapidly. Among the other treatments, only exposure to imidacloprid significantly reduced survival relative to the control. Beetles fed very little on leaf samples with azadirachtin but their longevity was not significantly reduced. Imidacloprid, azadirachtin, and weed mat application had the most promise for reducing adult Chinese rose beetle feeding damage in young cacao and deserve further investigation for successful management of this significant pest.

  8. Headspace volatile markers for sensitivity of cocoa (Theobroma cacao L.) somatic embryos to cryopreservation.

    Science.gov (United States)

    Fang, Jong-Yi; Wetten, Andrew; Johnston, Jason

    2008-03-01

    The mechanisms that reduce the viability of plant somatic embryos following cryopreservation are not known. The objective of the present study was to evaluate the sensitivity of cocoa (Theobroma cacao L.) somatic embryos at different stages of an encapsulation-dehydration protocol using stress-related volatile hydrocarbons as markers of injury and recovery. The plant stress hormone ethylene and volatile hydrocarbons derived from hydroxyl radicals (methane) and lipid peroxidation (ethane) were determined using gas chromatography headspace analysis. Ethylene and methane were the only volatiles detected, with both being produced after each step of the cryogenic protocol. Ethylene production was significantly reduced following exposure to liquid nitrogen, but then increased in parallel with embryo recovery. In contrast, the production of methane was cyclic during recovery, with the first cycle occurring earlier for embryos recovered from liquid nitrogen and desiccation than those recovered from earlier steps in the protocol. These results suggest that loss of somatic embryo viability during cryopreservation may be related to the oxidative status of the tissue, and its capacity to produce ethylene. This study has demonstrated that headspace volatile analysis provides a robust non-destructive analytical approach for assessing the survival and recovery of plant somatic embryos following cryopreservation.

  9. Optimizing carbon dioxide and light levels during in vitro culture of Theobroma cacao

    Energy Technology Data Exchange (ETDEWEB)

    Figueira, A.; Janick, J. (Purdue Univ., West Lafayette, IN (United States). Dept. of Horticulture)

    1994-07-01

    In vitro culture of axillary cotyledonary shoots of Theobroma cacao L. (cacao) under increasing CO[sub 2] concentration from ambient to 24,000 ppm (culture tube levels) significantly increased total shoot elongation, number of leaves, leaf area per explant, and shoot dry and fresh weight. Although light was necessary for the CO[sub 2] response, the effect of various photon fluxes was not significant for the measured growth parameters. Net photosynthesis estimated on the basis of CO[sub 2] depletion in culture tubes increased 3.5 times from 463 to 2639 ppm CO[sub 2], and increased 1.5 times from 2,639 to 14,849 ppm CO[sub 2], but declined from 14,849 to 24,015 ppm CO[sub 2]. Ethylene concentration in culture vessels increased under enriched CO[sub 2] conditions. Depletion of nutrients (fructose, K, Ca, Mg, and P) from the medium was increased under enriched CO[sub 2] conditions.

  10. Characterization of leafy cotyledon1-like during embryogenesis in Theobroma cacao L.

    Science.gov (United States)

    Alemanno, Laurence; Devic, Martine; Niemenak, Nicolas; Sanier, Christine; Guilleminot, Jocelyne; Rio, Mariannick; Verdeil, Jean-Luc; Montoro, Pascal

    2008-03-01

    Theobroma cacao L., an economically important crop for developing countries, can be experimentally propagated by somatic embryogenesis. Because of their potential roles in embryogenesis, a gene candidate strategy was initiated to find gene homologues of the members of the leafy cotyledon family of transcription factors. A homologue of the leafy cotyledon1-like gene, that encodes the HAP 3 subunit of the CCAAT box-binding factor, was found in the cocoa genome (TcL1L). The translated peptide shared a high amino acid sequence identity with the homologous genes of Arabidopsis thaliana, Phaseolus coccineus and Helianthus annuus. TcL1L transcripts mainly accumulated in young and immature zygotic embryos, and, to a lesser extent, in young and immature somatic embryos. In situ hybridization specified the localization of the transcripts as being mainly in embryonic cells of young embryos, the meristematic cells of the shoot and root apex of immature embryos, and in the protoderm and epidermis of young and immature embryos, either zygotic or somatic. Non-embryogenic explants did not show TcL1L expression. Ectopic expression of the TcL1L gene could partially rescue the Arabidopsis lec1 mutant phenotype, suggesting a similarity of function in zygotic embryogenesis.

  11. Protocol: transient expression system for functional genomics in the tropical tree Theobroma cacao L.

    Science.gov (United States)

    Fister, Andrew S; Shi, Zi; Zhang, Yufan; Helliwell, Emily E; Maximova, Siela N; Guiltinan, Mark J

    2016-01-01

    Theobroma cacao L., the source of cocoa, is a crop of significant economic value around the world. To facilitate the study of gene function in cacao we have developed a rapid Agrobacterium-mediated transient genetic transformation protocol. Here we present a detailed methodology for our transformation assay, as well as an assay for inoculation of cacao leaves with pathogens. Agrobacterium tumefaciens cultures are induced then vacuum-infiltrated into cacao leaves. Transformation success can be gauged 48 h after infiltration by observation of green fluorescent protein and by qRT-PCR. We clarify the characteristics of cacao leaf stages and demonstrate that our strategy efficiently transforms leaves of developmental stage C. The transformation protocol has high efficacy in stage C leaves of four of eight tested genotypes. We also present the functional analysis of cacao chitinase overexpression using the transient transformation system, which resulted in decreased pathogen biomass and lesion size after infection with Phytophthora tropicalis. Leaves expressing transgenes of interest can be used in subsequent functional genetic assays such as pathogen bioassay, metabolic analysis, gene expression analysis etc. This transformation protocol can be carried out in 1 day, and the transgenes expressing leaf tissue can be maintained in petri dishes for 5-7 days, allowing sufficient time for performance of additional downstream gene functional analysis. Application of these methods greatly increases the rapidity with which candidate genes with roles in defense can be tested.

  12. The effect of 2,4 dichlorophenoxyacetic acid on in vitro callogenesis of cocoa (Theobroma cacao L.)

    OpenAIRE

    Sulistyani Pancaningtyas

    2015-01-01

    Cocoa (Theobroma cacao L.) development using modern breeding techniques can be facilitated by propagation of planting material through somatic embryogenesis. Various factors that may affect embryogenesis are the composition of culture medium and culture condition. Hormone commonly used to initiate the formation of callus is auxin with type 2.4-D (2.4 Dichlorophenoxy acetic acid). The aim of this study was to determine the effect of the addition of 2.4 -D hormoneson the process of cocoa embryo...

  13. Dynamic changes in pod and fungal physiology associated with the shift from biotrophy to necrotrophy during the infection of Theobroma cacao by Moniliophthora roreri

    Science.gov (United States)

    Where it occurs in South and Central America, M. roreri (Mr) causes a destructive pod disease (frosty pod rot) on Theobroma cacao (cacao). Hand pollinated cacao pods were inoculated with Mr spores in the field and assessed for disease symptoms over a 90 day period. On average, pods showed symptoms o...

  14. Genetic diversity and parentage in farmer varieties of cacao (Theobroma cacao L.) from Honduras and Nicaragua as revealed by Single Nucleotide Polymorphism (SNP) markers

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is the main source for chocolate with an annual production of four million tons worldwide. This Neotropical tree crop was domesticated in Mesoamerica as far back as 3,000 years ago. Knowledge of genetic diversity and population structure in farmer varieties of cacao in the...

  15. Molecular Characterization of Resistant Accessions of Cocoa (Theobroma cocoa L.) to Phytophthora Pod Rot Selected on-Farm in Côte-d’Ivoire.

    Science.gov (United States)

    Cocoa is (Theobroma cacao L.) is a significant agricultural commodity in Côted’Ivoire which ranks 1st in the world cocoa export. Phytophthora pod rot (Ppr)also call Black pod is the most widespread disease of cocoa. Lost due to this disease depends on the species of the pathogen and vary globally fr...

  16. EFECTO DE UN GEL DE THEOBROMA CACAO EN EL CONTROL DE CARIES VESTIBULAR EN PACIENTES CON TRATAMIENTO DE ORTODONCIA. CONSULTA PRIVADA. AREQUIPA. 2014

    OpenAIRE

    SALAS LINARES, MARY JULISSA

    2015-01-01

    THEOBROMA CACAO GENERALIDADES DESCRIPCIÓN ORIGEN Y EXTENSIÓN CLASIFICACIÓN CIENTÍFICA VARIEDADES DEL CACAO DISTRIBUCIÓN USOS MEDICINALES EFECTO ANTICARIOGÉNICO GEL CARIES DENTAL FACTORES DE RIESGO MICROORGANISMOS IMPLICADOS EN LA CARIES DENTAL CARIES EN EL ESMALTE CLASIFICACIÓN DE LA CARIES MÉTODOS DE DETECCIÓN DE CARIES CRITERIOS ICDAS

  17. Morphological, biochemical, molecular and ultrastructural changes induced by Cd toxicity in seedlings of Theobroma cacao L.

    Science.gov (United States)

    Castro, Andressa V; de Almeida, Alex-Alan F; Pirovani, Carlos P; Reis, Graciele S M; Almeida, Nicolle M; Mangabeira, Pedro A O

    2015-05-01

    Seeds from Theobroma cacao progenies derived from the self-pollination of 'Catongo'×'Catongo' and the crossing between CCN-10×SCA-6 were immersed for 24h in different Cd solutions (2; 4; 8; 16 and 32 mgL(-1)) along with the control treatment (without Cd). Shortly after, the seeds were sown in plastic tubes containing organic substrate and were grown in a greenhouse for 60 days. The treatment with Cd was observed to cause morphological, biochemical, molecular and ultrastructural changes in both progenies of T. cacao. There has been deformation in chloroplasts, nuclear chromatin condensation, and reduction in thickness of the mesophyll. As for 'Catongo'×'Catongo', a decrease in thickness of the epidermis was noted on the abaxial face. There has been increased guaiacol peroxidase activity in the roots of CCN-10×SCA-6, as well as in the''Catongo'×'Catongo' leaves. In the presence of Cd, CCN-10×SCA-6 showed increased expression of the genes associated with the biosynthesis of phytochelatin (PCS-1) and class III peroxidases (PER-1) in leaves, and metallothionein (MT2b), in roots. In 'Catongo'×'Catongo', there has been an increase in the expression of genes associated with the biosynthesis of PER-1 and cytosolic superoxide dismutase dependent on copper and zinc (Cu-Zn SODCyt) in leaves and from MT2b and PCS-1 and roots. There was higher accumulation of Cd in the aerial parts of seedlings from both progenies, whereas the most pronounced accumulation was seen in''Catongo'×'Catongo'. The increase in Cd concentration has led to lower Zn and Fe levels in both progenies. Hence, one may conclude that the different survival strategies used by CCN-10×SCA-6 made such progeny more tolerant to Cd stress when compared to''Catongo'×'Catongo'. Copyright © 2015. Published by Elsevier Inc.

  18. Association mapping of seed and disease resistance traits in Theobroma cacao L.

    Science.gov (United States)

    Motilal, Lambert A; Zhang, Dapeng; Mischke, Sue; Meinhardt, Lyndel W; Boccara, Michel; Fouet, Olivier; Lanaud, Claire; Umaharan, Pathmanathan

    2016-12-01

    Microsatellite and single nucleotide polymorphism markers that could be used in marker assisted breeding of cacao were identified for number of filled seeds, black pod resistance and witches' broom disease resistance. An association mapping approach was employed to identify markers for seed number and resistance to black pod and witches' broom disease (WBD) in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms (SNPs) were assessed on 483 unique trees in the International Cocoa Genebank Trinidad (ICGT). Linkage disequilibrium (LD) and association mapping studies were conducted to identify markers to tag the phenotypic traits. Decay of LD occurred over an average 9.3 cM for chromosomes 1-9 and 2.5 cM for chromosome 10. Marker/trait associations were generally identified based on general linear models (GLMs) that incorporated principal components from molecular information on relatedness factor. Seven markers (mTcCIR 8, 66, 126, 212; TcSNP368, 697, 1370) on chromosomes 1 and 9 were identified for number of filled seeds (NSEED). A single marker was found for black pod resistance (mTcCIR280) on chromosome 3, whereas six markers on chromosomes 4, 5, 6, 8, and 10 were detected for WBD (mTcCIR91, 183; TcSNP375, 720, 1230 and 1374). It is expected that this association mapping study in cacao would contribute to the knowledge of the genetic determinism of cocoa traits and that the markers identified herein would prove useful in marker assisted breeding of cacao.

  19. Recombinant β-1,3-1,4-glucanase from Theobroma cacao impairs Moniliophthora perniciosa mycelial growth.

    Science.gov (United States)

    Britto, Dahyana Santos; Pirovani, Carlos Priminho; Andrade, Bruno Silva; Dos Santos, Tassiara Pereira; Pungartnik, Cristina; Cascardo, Júlio Cezar M; Micheli, Fabienne; Gesteira, Abelmon S

    2013-09-01

    In this work, we identified a gene from Theobroma cacao L. genome and cDNA libraries, named TcGlu2, that encodes a β-1,3-1,4-glucanase. The TcGlu2 ORF was 720 bp in length and encoded a polypeptide of 239 amino acids with a molecular mass of 25.58 kDa. TcGlu2 contains a conserved domain characteristic of β-1,3-1,4-glucanases and presented high protein identity with β-1,3-1,4-glucanases from other plant species. Molecular modeling of TcGlu2 showed an active site of 13 amino acids typical of glucanase with β-1,3 and 1,4 action mode. The recombinant cDNA TcGlu2 obtained by heterologous expression in Escherichia coli and whose sequence was confirmed by mass spectrometry, has a molecular mass of about 22 kDa (with His-Tag) and showed antifungal activity against the fungus Moniliophthora perniciosa, causal agent of the witches' broom disease in cacao. The integrity of the hyphae membranes of M. perniciosa, incubated with protein TcGlu2, was analyzed with propidium iodide. After 1 h of incubation, a strong fluorescence emitted by the hyphae indicating the hydrolysis of the membrane by TcGlu2, was observed. To our knowledge, this is the first study of a cacao β-1,3-1,4-glucanase expression in heterologous system and the first analysis showing the antifungal activity of a β-1,3-1,4-glucanase, in particular against M. perniciosa.

  20. TcNPR3 from Theobroma cacao functions as a repressor of the pathogen defense response.

    Science.gov (United States)

    Shi, Zi; Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J

    2013-12-06

    Arabidopsis thaliana (Arabidopsis) NON-EXPRESSOR OF PR1 (NPR1) is a transcription coactivator that plays a central role in regulating the transcriptional response to plant pathogens. Developing flowers of homozygous npr3 mutants are dramatically more resistant to infection by the pathogenic bacterium Pseudomonas syringae, suggesting a role of NPR3 as a repressor of NPR1-mediated defense response with a novel role in flower development. We report here the characterization of a putative NPR3 gene from the tropical tree species Theobroma cacao (TcNPR3). Like in Arabidopsis, TcNPR3 was constitutively expressed across a wide range of tissue types and developmental stages but with some differences in relative levels compared to Arabidopsis. To test the function of TcNPR3, we performed transgenic complementation analysis by introducing a constitutively expressing putative TcNPR3 transgene into an Arabidopsis npr3 mutant. TcNPR3 expressing Arabidopsis plants were partially restored to the WT pathogen phenotype (immature flowers susceptible to bacterial infection). To test TcNPR3 function directly in cacao tissues, a synthetic microRNA targeting TcNPR3 mRNA was transiently expressed in cacao leaves using an Agrobacterium-infiltration method. TcNPR3 knock down leaf tissues were dramatically more resistance to infection with Phytophthora capsici in a leaf bioassay, showing smaller lesion sizes and reduced pathogen replication. We conclude that TcNPR3 functions similar to the Arabidopsis NPR3 gene in the regulation of the cacao defense response. Since TcNPR3 did not show a perfect complementation of the Arabidopsis NPR3 mutation, the possibility remains that other functions of TcNPR3 remain to be found. This novel knowledge can contribute to the breeding of resistant cacao varieties against pathogens through molecular markers based approaches or biotechnological strategies.

  1. Enhanced somatic embryogenesis in Theobroma cacao using the homologous BABY BOOM transcription factor.

    Science.gov (United States)

    Florez, Sergio L; Erwin, Rachel L; Maximova, Siela N; Guiltinan, Mark J; Curtis, Wayne R

    2015-05-16

    Theobroma cacao, the chocolate tree, is an important economic crop in East Africa, South East Asia, and South and Central America. Propagation of elite varieties has been achieved through somatic embryogenesis (SE) but low efficiencies and genotype dependence still presents a significant limitation for its propagation at commercial scales. Manipulation of transcription factors has been used to enhance the formation of SEs in several other plant species. This work describes the use of the transcription factor Baby Boom (BBM) to promote the transition of somatic cacao cells from the vegetative to embryonic state. An ortholog of the Arabidopsis thaliana BBM gene (AtBBM) was characterized in T. cacao (TcBBM). TcBBM expression was observed throughout embryo development and was expressed at higher levels during SE as compared to zygotic embryogenesis (ZE). TcBBM overexpression in A. thaliana and T. cacao led to phenotypes associated with SE that did not require exogenous hormones. While transient ectopic expression of TcBBM provided only moderate enhancements in embryogenic potential, constitutive overexpression dramatically increased SE proliferation but also appeared to inhibit subsequent development. Our work provides validation that TcBBM is an ortholog to AtBBM and has a specific role in both somatic and zygotic embryogenesis. Furthermore, our studies revealed that TcBBM transcript levels could serve as a biomarker for embryogenesis in cacao tissue. Results from transient expression of TcBBM provide confirmation that transcription factors can be used to enhance SE without compromising plant development and avoiding GMO plant production. This strategy could compliment a hormone-based method of reprogramming somatic cells and lead to more precise manipulation of SE at the regulatory level of transcription factors. The technology would benefit the propagation of elite varieties with low regeneration potential as well as the production of transgenic plants, which

  2. Altered physiology, cell structure, and gene expression of Theobroma cacao seedlings subjected to Cu toxicity.

    Science.gov (United States)

    Souza, Vânia L; de Almeida, Alex-Alan F; Souza, Jadiel de S; Mangabeira, Pedro A O; de Jesus, Raildo M; Pirovani, Carlos P; Ahnert, Dário; Baligar, Virupax C; Loguercio, Leandro L

    2014-01-01

    Seedlings of Theobroma cacao CCN 51 genotype were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16, and 32 mg Cu L(-1)) in nutrient solution. When doses were equal or higher than 8 mg Cu L(-1), after 24 h of treatment application, leaf gas exchange was highly affected and changes in chloroplasts thylakoids of leaf mesophyll cells and plasmolysis of cells from the root cortical region were observed. In addition, cell membranes of roots and leaves were damaged. In leaves, 96 h after treatments started, increases in the percentage of electrolyte leakage through membranes were observed with increases of Cu in the nutrient solution. Moreover, there was an increase in the concentration of thiobarbituric acid-reactive substances in roots due to lipid peroxidation of membranes. Chemical analysis showed that increases in Cu concentrations in vegetative organs of T. cacao increased with the increase of the metal in the nutrient solution, but there was a greater accumulation of Cu in roots than in shoots. The excess of Cu interfered in the levels of Mn, Zn, Fe, Mg, K, and Ca in different organs of T. cacao. Analysis of gene expression via RTq-PCR showed increased levels of MT2b, SODCyt, and PER-1 expression in roots and of MT2b, PSBA, PSBO, SODCyt, and SODChI in leaves. Hence, it was concluded that Cu in nutrient solution at doses equal or above 8 mg L(-1) significantly affected leaf gas exchange, cell ultrastructure, and transport of mineral nutrients in seedlings of this T. cacao genotype.

  3. Characterization of Pseudomonas chlororaphis from Theobroma cacao L. rhizosphere with antagonistic activity against Phytophthora palmivora (Butler).

    Science.gov (United States)

    Acebo-Guerrero, Y; Hernández-Rodríguez, A; Vandeputte, O; Miguélez-Sierra, Y; Heydrich-Pérez, M; Ye, L; Cornelis, P; Bertin, P; El Jaziri, M

    2015-10-01

    To isolate and characterize rhizobacteria from Theobroma cacao with antagonistic activity against Phytophthora palmivora, the causal agent of the black pod rot, which is one of the most important diseases of T. cacao. Among 127 rhizobacteria isolated from cacao rhizosphere, three isolates (CP07, CP24 and CP30) identified as Pseudomonas chlororaphis, showed in vitro antagonistic activity against P. palmivora. Direct antagonism tested in cacao detached leaves revealed that the isolated rhizobacteria were able to reduce symptom severity upon infection with P. palmivora Mab1, with Ps. chlororaphis CP07 standing out as a potential biocontrol agent. Besides, reduced symptom severity on leaves was also observed in planta where cacao root system was pretreated with the isolated rhizobacteria followed by leaf infection with P. palmivora Mab1. The production of lytic enzymes, siderophores, biosurfactants and HCN, as well as the detection of genes encoding antibiotics, the formation of biofilm, and bacterial motility were also assessed for all three rhizobacterial strains. By using a mutant impaired in viscosin production, derived from CP07, it was found that this particular biosurfactant turned out to be crucial for both motility and biofilm formation, but not for the in vitro antagonism against Phytophthora, although it may contribute to the bioprotection of T. cacao. In the rhizosphere of T. cacao, there are rhizobacteria, such as Ps. chlororaphis, able to protect plants against P. palmivora. This study provides a theoretical basis for the potential use of Ps. chlororaphis CP07 as a biocontrol agent for the protection of cacao plants from P. palmivora infection. © 2015 The Society for Applied Microbiology.

  4. Study of Seed Germination by Soaking Methode of Cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2014-12-01

    Full Text Available Study of germination methods conduct to get information about seed viability based on germination rate, percentage of germination and vigority. Germination methods was studied to get the efficiency and effectivity of germination, easy to handle, low costs with high vigority. Sand and gunny sack methods  for germination, need extensive place  and 3-4 days germination period after planting. This research will study the alternative of germination method with soaking. This method can be accelerating  germination rate and effectively place usage without decreasing the quality of cacao seedling.The research was done at Kaliwining Experimental Station, Indonesian Coffee and Cocoa Research Institue. This research consist of two experiment was arranged based on factorial completely random design. First experiment will observed to compared germination rate and the second experiment will observed seedling quality between soaking and wet gunny sack germination method.The results showed that length of radicel on soaking method longer than wet gunny sack method. Growth of radicel started from 2 hours after soaking, moreover length of radicel at 4 hours after soaking have significant different value with gunny sack method. On 24 hours after soaking have 3,69 mm and 0,681 mm on wet gunny sack treatment. Except lengt of hipocotyl, there is not different condition between seedling that out came  from soaking and wet gunny sack method. Length of hipocotyl on 36 hours after soaking have 9,15 cm and significant different between wet gunny sack germination method that have 5,40 cm. Keywords : seed germination, soaking method, Theobroma cacao L., cocoa seedlings

  5. Evaluation of the Allergenicity Potential of TcPR-10 Protein from Theobroma cacao

    Science.gov (United States)

    Cardoso, Thyago Hermylly Santana; Pirovani, Carlos Priminho; Micheli, Fabienne; Noronha, Fátima Soares Motta; Alves, Andréa Catão; Faria, Ana Maria Caetano; da Silva Gesteira, Abelmon

    2012-01-01

    Background The pathogenesis related protein PR10 (TcPR-10), obtained from the Theobroma cacao-Moniliophthora perniciosa interaction library, presents antifungal activity against M. perniciosa and acts in vitro as a ribonuclease. However, despite its biotechnological potential, the TcPR-10 has the P-loop motif similar to those of some allergenic proteins such as Bet v 1 (Betula verrucosa) and Pru av 1 (Prunus avium). The insertion of mutations in this motif can produce proteins with reduced allergenic power. The objective of the present work was to evaluate the allergenic potential of the wild type and mutant recombinant TcPR-10 using bioinformatics tools and immunological assays. Methodology/Principal Findings Mutant substitutions (T10P, I30V, H45S) were inserted in the TcPR-10 gene by site-directed mutagenesis, cloned into pET28a and expressed in Escherichia coli BL21(DE3) cells. Changes in molecular surface caused by the mutant substitutions was evaluated by comparative protein modeling using the three-dimensional structure of the major cherry allergen, Pru av 1 as a template. The immunological assays were carried out in 8–12 week old female BALB/c mice. The mice were sensitized with the proteins (wild type and mutants) via subcutaneous and challenged intranasal for induction of allergic airway inflammation. Conclusions/Significance We showed that the wild TcPR-10 protein has allergenic potential, whereas the insertion of mutations produced proteins with reduced capacity of IgE production and cellular infiltration in the lungs. On the other hand, in vitro assays show that the TcPR-10 mutants still present antifungal and ribonuclease activity against M. perniciosa RNA. In conclusion, the mutant proteins present less allergenic potential than the wild TcPR-10, without the loss of interesting biotechnological properties. PMID:22768037

  6. Evaluation of the allergenicity potential of TcPR-10 protein from Theobroma cacao.

    Directory of Open Access Journals (Sweden)

    Sara Pereira Menezes

    Full Text Available BACKGROUND: The pathogenesis related protein PR10 (TcPR-10, obtained from the Theobroma cacao-Moniliophthora perniciosa interaction library, presents antifungal activity against M. perniciosa and acts in vitro as a ribonuclease. However, despite its biotechnological potential, the TcPR-10 has the P-loop motif similar to those of some allergenic proteins such as Bet v 1 (Betula verrucosa and Pru av 1 (Prunus avium. The insertion of mutations in this motif can produce proteins with reduced allergenic power. The objective of the present work was to evaluate the allergenic potential of the wild type and mutant recombinant TcPR-10 using bioinformatics tools and immunological assays. METHODOLOGY/PRINCIPAL FINDINGS: Mutant substitutions (T10P, I30V, H45S were inserted in the TcPR-10 gene by site-directed mutagenesis, cloned into pET28a and expressed in Escherichia coli BL21(DE3 cells. Changes in molecular surface caused by the mutant substitutions was evaluated by comparative protein modeling using the three-dimensional structure of the major cherry allergen, Pru av 1 as a template. The immunological assays were carried out in 8-12 week old female BALB/c mice. The mice were sensitized with the proteins (wild type and mutants via subcutaneous and challenged intranasal for induction of allergic airway inflammation. CONCLUSIONS/SIGNIFICANCE: We showed that the wild TcPR-10 protein has allergenic potential, whereas the insertion of mutations produced proteins with reduced capacity of IgE production and cellular infiltration in the lungs. On the other hand, in vitro assays show that the TcPR-10 mutants still present antifungal and ribonuclease activity against M. perniciosa RNA. In conclusion, the mutant proteins present less allergenic potential than the wild TcPR-10, without the loss of interesting biotechnological properties.

  7. Ekstraksi Pektin dari Kulit Kakao (Theobroma cacao L. Menggunakan Amonium Oksalat

    Directory of Open Access Journals (Sweden)

    Cut Erika

    2013-06-01

    Full Text Available Cocoa (Theobroma cocoa L is one of the local superior commodities in Aceh Province. The production of cocoa continues to increase significantly every year. Cocoa Pod husk is a waste product of cocoa beans industry, which is containing pectin with concentration ranged between 2-10%. Pectin extraction is one of the potential researches to increase economic value of cocoa pod husks. This study aimed to determine the effect of extraction time and pH on the characteristics of cocoa pod husk pectin. Pectin was extracted from cocoa pod husks using ammonium oxalate, extraction time (60 and 120 min and pH (2.6, 3.6 and 4.6. The use of ammonium oxalate produced high yield of pectin ranged from 6.63 to 12.75%, moisture content was 7,36 to 10,77%, methoxyl content was 5.19 to 5.70%, anhydrogalacturonic acid of 59.84 to 63.14%, the esterification degree was 48.43 to 51.43 % and relative viscosity was 40 – 186,6 cP. The extraction time for 60 minutes at pH 3,6 showed a higher yield compared to 120 min at pH 4,6. Pectin on the extraction time of 60 minutes at pH 3.6 had the highest relative viscosity was 186,6 cP, and the lowest viscosity of pectin obtained at pH 2.6 and extraction time of 60 min which was 40 cP. Keywords: cocoa pod husks, ammonium oxalate, extraction time, pH

  8. Actividad antibacteriana de la cáscara de cacao, Theobroma cacao L

    Directory of Open Access Journals (Sweden)

    Oscar Cuéllar G.

    2012-12-01

    Full Text Available Objetivo. Evaluar la actividad antibacteriana de diferentes fracciones de la cáscara de cacao (Theobroma cacao L.. Materiales y métodos. Se evaluó la actividad antibacteriana mediante el método de difusión en agar de diferentes fracciones de la cáscara de cacao, empleando cepas autóctonas y de referencia ATCC. Posteriormente, se hizo un análisis de estas fracciones por cromatografía líquida de alta eficiencia y cromatografía de gases acoplada a espectrometría de masas. Resultados. La fracción clorofórmica presentó actividad antibacteriana frente a Bacillus cereus ATCC 11778 y Streptococcus agalactiae (autóctona, con porcentajes de inhibición de 34.90% (100 μg/μl y 52.40% (100 μg/μl respectivamente. También se evidenció una concentración mínima inhibitoria de 512 μg/ml frente a Bacillus cereus ATCC 11778 y de 128 μg/ml frente a Streptococcus agalactiae. Conclusiones. Este trabajo es el primer reporte a saber en Colombia sobre actividad antibacteriana in vitro de la cáscara de cacao, el cual resulta ser un avance importante para esta agroindustria. Esta investigación abre paso a otros estudios relacionados para establecer el espectro de inhibición frente a otros microorganismos.

  9. Karyotype variation in cultivars and spontaneous cocoa mutants (Theobroma cacao L.).

    Science.gov (United States)

    Figueiredo, G S F; Melo, C A F; Souza, M M; Araújo, I S; Zaidan, H A; Pires, J L; Ahnert, D

    2013-10-18

    Four mutant cocoa accessions with morphological changes and a cultivar sample were karyomorphologically characterized. Slides were prepared by enzymatic digestion of the root meristem and squashed in 45% acetic acid, followed by 2% Giemsa staining. The chromosome number of 2n = 20 was seen in all accessions. The karyotype formula for Cacau Comum and Cacau Rui was 2n = 20m. Submetacentric chromosomes were observed in Cacau Pucala and Cacau Jaca, both with 2n = 18m + 2sm, but the karyotype formula for Cacau Sem Vidro was 2n = 16m + 4sm. Satellites were located on the long arm of the 1st and 2nd chromosome pairs of Cacau Comum, whereas Cacau Pucala had satellites on the 6th chromosome pair. Greater karyotypic variation in Cacau Sem Vidro was found, whose 1st and 2nd chromosome pairs had satellites on the long arm and 6th and 10th pairs had satellites on the short arm. Analysis revealed a lower average chromosome length in Cacau Comum (1.53 ± 0.026 µm) and a higher length in Cacau Sem Vidro (2.26 ± 0.038 µm). ANOVA revealed significant difference (P < 0.01) for the average chromosome length and the length of chromosome pairs within and between accessions. The average chromosome lengths of mutants of Cacau Rui and Cacau Jaca were not statistically different by the Tukey test at 5% probability. The karyotypic diversity observed in this study is not necessarily associated with the changing character of the accessions analyzed, but may reflect the genetic variation observed in Theobroma cacao.

  10. Proanthocyanidin synthesis in Theobroma cacao: genes encoding anthocyanidin synthase, anthocyanidin reductase, and leucoanthocyanidin reductase.

    Science.gov (United States)

    Liu, Yi; Shi, Zi; Maximova, Siela; Payne, Mark J; Guiltinan, Mark J

    2013-12-05

    The proanthocyanidins (PAs), a subgroup of flavonoids, accumulate to levels of approximately 10% total dry weight of cacao seeds. PAs have been associated with human health benefits and also play important roles in pest and disease defense throughout the plant. To dissect the genetic basis of PA biosynthetic pathway in cacao (Theobroma cacao), we have isolated three genes encoding key PA synthesis enzymes, anthocyanidin synthase (ANS), anthocyanidin reductase (ANR) and leucoanthocyanidin reductase (LAR). We measured the expression levels of TcANR, TcANS and TcLAR and PA content in cacao leaves, flowers, pod exocarp and seeds. In all tissues examined, all three genes were abundantly expressed and well correlated with PA accumulation levels, suggesting their active roles in PA synthesis. Overexpression of TcANR in an Arabidopsis ban mutant complemented the PA deficient phenotype in seeds and resulted in reduced anthocyanidin levels in hypocotyls. Overexpression of TcANS in tobacco resulted in increased content of both anthocyanidins and PAs in flower petals. Overexpression of TcANS in an Arabidopsis ldox mutant complemented its PA deficient phenotype in seeds. Recombinant TcLAR protein converted leucoanthocyanidin to catechin in vitro. Transgenic tobacco overexpressing TcLAR had decreased amounts of anthocyanidins and increased PAs. Overexpressing TcLAR in Arabidopsis ldox mutant also resulted in elevated synthesis of not only catechin but also epicatechin. Our results confirm the in vivo function of cacao ANS and ANR predicted based on sequence homology to previously characterized enzymes from other species. In addition, our results provide a clear functional analysis of a LAR gene in vivo.

  11. Molecular, physiological and morphological analysis of waterlogging tolerance in clonal genotypes of Theobroma cacao L.

    Science.gov (United States)

    Bertolde, Fabiana Zanelato; De Almeida, Alex-Alan Furtado; Corrêa, Ronan Xavier; Gomes, Fábio Pinto; Gaiotto, Fernanda Amato; Baligar, Virupax C; Loguercio, Leandro Lopes

    2010-01-01

    In soil, anoxia conditions generated by waterlogging induce changes in genetic, morphological and physiological processes, altering the growth and development of plants. Mass propagation of cacao (Theobroma cacao L.) plantlets (clones) is affected by waterlogging caused by heavy rains and irrigation methods used to induce rooting. An experiment was undertaken to assess the effects of a 45-day flooding (anoxia) on physiological and morphological traits of 35 elite cacao genotypes, aiming at potentially identifying those with greater tolerance to flooding of the growth substrate. Eighteen fluorochrome-labeled microsatellite (SSR) primer pairs were used to assess genetic variability among clones, with 248 alleles being amplified and used to calculate similarity coefficients. The resulting dendrogram indicated the presence of four major groups, in which two represented 60% and 31% of the genotypes tested. A general trend toward high levels of heterozygosity was also found for physiological and morphological traits. The survival index (IS) for flood tolerance observed varied from 30 to 96%. Clones TSA-654, TSA-656, TSA-792, CA-1.4, CEPEC-2009 and PH-17 showed an IS value above 94%, whereas CEPEC-2010, CEPEC-2002, CA-7.1 and VB-903 clones were those mostly affected by waterlogging, with IS value below 56%. All genotypes displayed lenticel and adventitious root formation in response to waterlogging, although with different intensities. To determine whether patterns of physiological response could be associated with tolerance to anoxia, a similarity-grouping analysis was performed using the ratio between waterlogged and control values obtained for a series of physiological variables assessed. No specific pattern of physiological and morphological responses to waterlogging was strictly associated with survival of plantlets. However, results revealed by the dendrogram suggest that absence of leaf chlorosis may be a proper trait to indicate cacao clones with higher survival

  12. [Cocoa (Theobroma cacao L.) hulls: a posible commercial source of pectins].

    Science.gov (United States)

    Barazarte, Humberto; Sangronis, Elba; Unai, Emaldi

    2008-03-01

    Commercial exploitation of cocoa (Theobroma cacao L.) generates a volume of hulls that could be used in the production of pectins on an industrial scale. Therefore, pectins from cocoa hulls were extracted at different pH and temperature conditions, and their main chemical characteristics were evaluated. EDTA at 0.5% was used for the extraction at pHs 3, 4 and 5 and temperatures of 60, 75 and 90 degrees C, under a 3 2 factorial design. The response variables were yield, content of anhydrous galacturonic acid (AGA), content of metoxil, degree of esterification and equivalent weight of the pectins extracted. The strength of the pectic gel was determined with a TA-XT2 texturometer. Strawberry jam was made with the pectin extracted, and its acceptability was determined using a 7-point hedonic scale. The results obtained were as follows: an extraction yield from 2.64 to 4.69 g/100 g; an AGA content between 49.8 and 64.06 g/100 g; a content of metoxil between 4.72 and 7.18 g/100 g; a degree of esterification between 37.94 and 52.20%; an equivalent weight from 385.47 to 464.61 g/equivalent of H+, and a degree of gelation between 28.64 and 806.03 g force. The pectin extracted at pH 4 and 90 degrees C showed a gelation power of 422.16 g force, purity 62.26 g/100 g of AGA, and a yield of extraction of 3.89 g/100 g and allowed to prepare ajam with an average level of liking of "like moderately". Pectins from cocoa hulls show potential application in the food industry, but it is necessary to optimize the extraction parameters to increase its yield.

  13. The effect of cocoa (Theobroma cacao L on the basic color stability of thermoplastic nylon resin dentures

    Directory of Open Access Journals (Sweden)

    Amiyatun Naini

    2011-11-01

    Full Text Available Nylon thermoplastic resin is material of choice for the making of flexible. This denture do not use wire retention, but has the physical properties of water absorption. In the oral cavity, it will always be in contact with food and beverages consumed. One of the foods that are consumed by the public is chocolate. This study aimed to determine the effect of cocoa (Theobroma cacao L on color stability of the thermoplastic nylon denture base. The study sample was thermoplastic nylon (valplast with a size of 10x10x2 mm soaked in the chocolate solution for 7 and 14 days. As the control, the sample soaked with distilled water. The color testing stability used was densitometer. There were significant differences between the control group (distilled water and the chocolate solution. This was due to dissolved components/tannin having a capillary flow diffusion into thermoplastic nylons that causing discoloration. The conclusion of this study, there was the effect of cocoa (Theobroma cacao L against the color stability of the nylon thermoplastic denture base. The longer time of immersion of nylon thermoplastic the greater the change in color.

  14. Antioxidant effect of an ozonized theobroma oil formulation on damaged-inflammatory rat skin

    Directory of Open Access Journals (Sweden)

    Sánchez, Yaima

    2011-03-01

    Full Text Available The aim of this study was to determine whether a cosmetic formulation elaborated with ozonized theobroma oil may exert beneficial effects in the restoring of the antioxidant activity on the skin of rats previously irradiated with ultraviolet light. 0.5 g of the formulation was applied on the skin of rats for five days. Superoxide dismutase (SOD, glutathione peroxidase (GPx and catalase (CAT activity were determined in a homogenate of rat skin. Malondialdehyde (MDA, conjugated dienes (CD and total hydroperoxide (THP content were determined as biomarkers of oxidative stress. Using these parameters, antioxidant and oxidant activity, redox index and oxidative stress grade were determined. The total antioxidant activity was significantly increased while the redox index, total oxidant activity and oxidative stress grade decreased significantly in damaged rats treated with the formulation. These results show the antioxidant properties of the cosmetic formulation due to the stimulation of antioxidant enzymes such as SOD and GPx, preventing skin injury induced by ultraviolet irradiation.

    El objetivo de este estudio fue determinar si una formulación cosmética elaborada con aceite de teobroma ozonizado puede ejercer efectos beneficiosos en la restauración de la actividad antioxidante sobre la piel de ratas previamente irradiadas con luz ultravioleta. Fue aplicada 0,5 g de la formulación sobre la piel de ratas durante cinco días. La actividad de las enzimas superóxido dismutasa (SOD, glutatión peroxidasa (GPx, y catalasa fueron determinadas en homogeneizado de piel de ratas. Los contenidos de malonildialdehído (MDA, dienos conjugados (DC e hidroperóxidos totales (HPT fueron considerados como los biomarcadores de daño oxidativo. Con todos estos parámetros fueron determinados las actividades antioxidantes y oxídantes, índice redox y grado de estrés oxidativo. La actividad antioxidante total fue incrementada significativamente, mientras

  15. Pod Characteristics of cocoa (Theobroma cacao L. related to rocoa pod borer resistance.

    Directory of Open Access Journals (Sweden)

    Agung Wahyu Susilo

    2015-04-01

    Full Text Available The characteristics of cocoa (Theobroma cacao L. pod related to cocoa pod borer resistance (CPB had been identified in a series of study. The objective of this research is to evaluate the characteristics of cocoa pod using more diverse of genetic background to obtain selection criteria. Genetic materials for this studywere 25 cocoa clones planted in Central Sulawesi for resistance evaluation. Field evaluation of the resistance were assessed by using variable of the percentage of unextractable beans, number of larvae entry and exit holes by which the clones were grouped into 5 groups of resistance. A laboratory works were carried out to assess pod characteristics based on the number of trichomes, granules of tannin and thickness the lignified-tissue of sclerotic layer using micro-technique method at the different level of pod maturity (3.0; 3.5; 4.0 months. Correlation between groups of those variables was analyzed using canonical correlation. The result performed a positive association between the thickness of sclerotic layer at the secondary furrow with the number of entry holes and the number of entry holes through sclerotic layer. The thickness performed a higher value of the coefficient in association with the variables of canonical for pod characteristics 0.59; 0.55; 0.43 and the variables of canonical correlation for CPB resistance 0.54; 0.51; 0.39 that would presenting the characteristics of pod related to CPB resistance in 3.0, 3.5 and 4.0 months of pod maturity. Lignification at sclerotic layer was considered as genotypic expressions due to the thickness at the secondary furrow at 3.0, 3.5 and 4.0 months of pod maturity performed high value of broad-sense heritability i.e. 0.75, 0.89 and 0.92 respectively. A qualitative assessment of the lignification clearly differentiated the resistant clones of ARDACIAR 10 with the susceptible clones of ICCRI 04, KW 516, and KW 564.

  16. Pod Characteristics of Cocoa (Theobroma cacao L. Related to Cocoa Pod Borer Resistance (Conopomorpha cramerella Snell.

    Directory of Open Access Journals (Sweden)

    Agung Wahyu Soesilo

    2015-03-01

    Full Text Available AbstractThe characteristics of pod related to cocoa pod borer resistance (CPB, Conopomorpha cramerella Snell. had been identified in a series study. This research has objective to evaluate performance of the characteristics using more diverse of genetic background to select criteria for selection. Genetic materials for this study were 25 cocoa clones which be planted in Central Sulawesi for resistant evaluation. Field evaluation of the resistance were assessed using the variable of the percentage of unextractable bean, number of entry and exit hole larvae by which the clones were grouped into 5 groups of resistance. A laboratory works were carried out to assess pod characteristics based on the number of trichome, granule of tannin and thickness the lignified-tissue of sclerotic layer using micro-technique method at the different level of pod maturity (3.0; 3.5; 4.0 months. Correlation between groups of those variables was analyzed using Canonical Correlation. The analysis performed a positive association between the thickness of sclerotic layer at the secondary furrow with the number of entry holes and the number of entry holes through sclerotic layer. The thickness performed a higher value of the coefficient in association with the variables of canonical for pod characteristics (0.59; 0.55; 0.43 and the variables of canonical for CPB resistance (0.54; 0.51; 0.39 that would presenting the characteristics of pod related to CPB resistance. Lignification at sclerotic layer was considered as genotypic expressions due to the thickness at the secondary furrow at 3.0, 3.5 and 4.0 months of pod maturity performed high value of broad-sense heritability i.e. 0.75, 0.89 and 0.92 respectively. A qualitative assessment of the lignification clearly differentiate the resistant clones (ARDACIAR 10 with the susceptible clones (ICCRI 04, KW 516 and KW 564.Key words : cocoa pod borer, Theobroma cacao L., pod characteristics, resistance

  17. Stability of cupuaçu (Theobroma grandiflorum nectar during storage

    Directory of Open Access Journals (Sweden)

    Margarida Cortez Vieira

    2014-10-01

    Full Text Available A shelf-life study on cupuaçu nectar (Theobroma grandiflorum was carried out in two parts. Part I studied the microbial stability of the regular nectar (batch R and the same nectar fortified with synthetic ascorbic acid (AA (batch F, pasteurized at 90 °C for 3 min and hot filled in glass bottles. Total Plate Count (TPC, yeast and molds as well as pH, total soluble solids (TTS, titratable acidity and hidroxymethylfurfural (HMF were followed along 43 storage days at 4, 25 and 35 °C. At the end of the storage period neither TPC nor molds or yeast had recovered the initial loads observed before pasteurization, for both R and F batches. Right after pasteurization, acidity increased slightly, pH decreased from 3.52 to 3.3, and TSS increased from 18.7 to 19.0 °Brix, with all stabilizing afterwards.Part II evaluated ascorbic (AA and dehydroascorbic (DHAA acids’ stabilization in the two batches, R and F, and dissolved oxygen (DO was monitored. Both batches were stored at the same temperatures as in Part I for two months. For batch R, the AA degradation results followed a reversible first order reaction (EaAA(R=-34±6 kJ/mol, kAA(R25°C=0.006±0.003 days-1, C0AA(R=0.92±0.01 and C∞AA(R= 0.43±0.19. For the (F nectar, the experimental data fitted a first order model well (EaAA(F=30±17 kJ/mol, kAA(F25°C =0.0016±0.0004 days-1. DO was modeled as a fractional conversion model (EaDO= 67±17 kJ/mol, kDO25°C= 1.94±0.94 days-1, C0DO=0.97±0.03 and C∞DO= 0.55±0.01. For both nectars, storage at environmental temperatures was preferred (AA retention above 80% to refrigeration, due to the slower rate of diffusion of DO at lower temperatures.

  18. (Agronomical and anatomical study of resulted early cocoa (Theobroma cacao L. grafting

    Directory of Open Access Journals (Sweden)

    Adi Prawoto

    2005-05-01

    , weak and hollow when microtomised. Health union showed lignified accumulation that made tight union. It can be concluded that early cocoa grafting will success if the nursery is separated far from cocoa plantation, the medium is steril from soil borne disease, the graftstick is health, and tying of graft union must tight enough, then disease control must be done properly.Key Words : Theobroma cacao, clone, wiring, graft union, graftake.

  19. Early Yield and Economical Study of Pogostemon Cablinas Intercrop in Young Cocoa (Theobroma cacaoL.

    Directory of Open Access Journals (Sweden)

    Adi Prawoto

    2006-08-01

    P. cablinin young cacao provided opportunity to farmers to have additional income, the benefit cost ratio (B/C for Leucaenatreatment 1.00–1.35 depend on dose of fertilizer, while for A. catechutreatment gave no profit (B/C 0.59–1.03 depend on fertilizer dose. Meanwhile, P. cablinmonoculture cultivation gave B/C 1.44–2.71. Key Words: Pogostemon cablin, Theobroma cacao,Leucaena glauca, Areca catechu, intercropping, patchouly alcohol, B/C ratio, fertilizer.

  20. Packaging of Post Acclimatized Somatic Embryogenesis Cocoa Plantlet (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Soedarsianto Soedarsianto

    2009-05-01

    Full Text Available Clonal plants that produced by somatic embryogenesis technique is one of the best choice to produce supperior clonal cacao (Theobroma cacao L. planting materials. The somatic embryogenesis technique is a possible way for massive propagation, the outcome is true to type plants, the architecture similarity that the seedlings but there is not segregation like seedlings plants. At present mass production started of plantlets production until post-acclimatized plantlets of somatic embryogenesis cocoa was done at Indonesian Coffee and Cocoa Research Institute. Distribution system of the planting materials to whole areas in form of as up-rooted post-acclimatized plantlet. Some problems identified to reduce probability of decreasing viability of up-rooted post-acclimatized plantlets and one of them is extreme internal water deficit. This research investigate of the influece storage condition (air tight and non-air tight and box storage (mica plastic and cardboardbox. The first experiment result show, there is no significant different between mica plastic and cardboard box usage for storage of post-acclimatized cocoa pantlet. Viability of up-rooted post acclimatized cocoa plantlet influenced exactly by air tight and non-air tight storage condition. Air tight storage condition have better viability of up-rooted post acclimatised (81,58% than non-air tight storage condition (65,00%. Leaf sanasence on air tight storage condition (10,33% lower than non-air tight storage (32,58%. There is not significantly on volume storage per plantlet between 4.416 cm3 and 12.600 cm3. Relationship between fallen leaves and cocoa planlet viability follow negative linear correlation y = -1,4719x + 104,88 (R2 = 0,9772. The second experiment treatment showed that maximal storage periode of post cclimatized cocoa plantlet just until 6 days stored (97% and not significant with 3 days one. Viability of post acclimatized cocoa plantlet decreased after 6 days storage period

  1. Chemical and rheological properties of a starch-rich fraction from the pulp of the fruit cupuassu (Theobroma grandiflorum)

    Energy Technology Data Exchange (ETDEWEB)

    Vriesmann, Lucia C.; Silveira, Joana L.M. [Universidade Federal do Parana, Departamento de Bioquimica e Biologia Molecular, CP 19046, CEP 81531-990, Curitiba-PR (Brazil); Petkowicz, Carmen L. de O [Universidade Federal do Parana, Departamento de Bioquimica e Biologia Molecular, CP 19046, CEP 81531-990, Curitiba-PR (Brazil)], E-mail: clop@ufpr.br

    2009-03-01

    The pulp obtained from the fruit of cupuassu (Theobroma grandiflorum) was extracted with hot aqueous 0.1% citric acid to give fraction 0.1CA-2 in 15% yield. This was the predominant component polysaccharide, 91% of which was composed of starch, by an iodine test and monosaccharide composition, and its {sup 13}C NMR spectrum was consistent with that of a high amylose starch. The content of amylose found in fraction 0.1CA-2 was 71%. This value is higher than those of common starches of cereal grains, tubers, roots, and other fruits. The fraction was submitted to rheological examination, gels being prepared on heating with concentrations of 4 to 7% (w/w). A non-Newtonian behavior was observed, and gel viscosity and strength depended on the concentration. The presence of starch, as well as the presence of previously investigated pectin, conferred the high viscosity and gelling capability of the pulp.

  2. The Purification and Characterization of Lipases from Lasiodiplodia theobromae, and Their Immobilization and Use for Biodiesel Production from Coconut Oil.

    Science.gov (United States)

    Venkatesagowda, Balaji; Ponugupaty, Ebenezer; Barbosa-Dekker, Aneli M; Dekker, Robert F H

    2017-12-18

    The coconut kernel-associated fungus, Lasiodiplodia theobromae VBE1, was grown on coconut cake with added coconut oil as lipase inducer under solid-state fermentation conditions. The extracellular-produced lipases were purified and resulted in two enzymes: lipase A (68,000 Da)-purified 25.41-fold, recovery of 47.1%-and lipase B (32,000 Da)-purified 18.47-fold, recovery of 8.2%. Both lipases showed optimal activity at pH 8.0 and 35 °C, were activated by Ca 2+ , exhibited highest specificity towards coconut oil and p-nitrophenyl palmitate, and were stable in iso-octane and hexane. Ethanol supported higher lipase activity than methanol, and n-butanol inactivated both lipases. Crude lipase immobilized by entrapment within 4% (w/v) calcium alginate beads was more stable than the crude-free lipase preparation within the range pH 2.5-10.0 and 20-80 °C. The immobilized lipase preparation was used to catalyze the transesterification/methanolysis of coconut oil to biodiesel (fatty acyl methyl esters (FAMEs)) and was quantified by gas chromatography. The principal FAMEs were laurate (46.1%), myristate (22.3%), palmitate (9.9%), and oleate (7.2%), with minor amounts of caprylate, caprate, and stearate also present. The FAME profile was comparatively similar to NaOH-mediated transesterified biodiesel from coconut oil, but distinctly different to petroleum-derived diesel. This study concluded that Lasiodiplodia theobromae VBE1 lipases have potential for biodiesel production from coconut oil.

  3. Study on the presence and influence of phenolic compounds in callogenesis and somatic embryo development of cocoa (Theobroma cacao L..

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2015-03-01

    Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although  the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.Kata kunci: Theobroma cacao L., polifenol, embrio somatik, kalus, flavonoid, katekin, in vitro recalcitance

  4. Caracterização e seleção de gorduras de sementes do genero Theobroma para aplicação tecnologica

    OpenAIRE

    Maria Victoria Gilabert Escriva

    2002-01-01

    Resumo: O gênero Theobroma pertence à família Sterculiaceae. As 22 espécies do gênero Theobroma estão restritas à América Tropical sendo que destas, 9 são encontradas na Amazônia brasileira: T. cacao, T. camargoanum, T. bic%r, T. grandif/orum, T. microcarpum, T. obovatum, T. speciosum, T. subincanum, T. sy/vestre. A maioria das amêndoas destas espécies são ricas em gorduras livres de ácidos graxos trans. Dentre estas, destaca-se o T. grandif/orum (cupuaçu), cuja semelhança com o cacaueiro res...

  5. Estudio analitico de especies oxigenadas en el aceite de teobroma ozonizado Analytical study of oxygenated species in the ozonized theobroma oil

    OpenAIRE

    Maritza F. Díaz Gómez; Goitybell Martínez Téllez; Rosa Ibis Meneau Hernández; Manuel Alaiz; Rafael Garcés

    2008-01-01

    Ozonization of theobroma oil at different applied ozone dosages was carried out with measurement of peroxide index values, oxygen percentage content and fatty acids composition. The comparison of peroxide values with percentage content of oxygen at different applied ozone dosages showed good correlation (r=0.9923). Unsaturated fatty acids and triacylglycerols decrease with ozone applied dosage due to ozone reaction with double bonds. Small amounts of oleic acid were consumed with applied ozon...

  6. Caracterização cultural, morfológica e patogênica de Lasiodiplodia theobromae associado a frutíferas tropicais

    Directory of Open Access Journals (Sweden)

    Joilson Silva Lima

    2013-06-01

    Full Text Available Lasiodiplodia theobromae é um fungo cosmopolita, polífago e oportunista, com reduzida especialização patogênica, capaz de infectar espécies de plantas em regiões tropicais e temperadas, causando os mais variados sintomas. Este estudo teve como objetivo caracterizar isolados de L. theobromae associados a frutíferas tropicais na região nordeste, considerando os aspectos cultural, morfológico e patogênico. Foram avaliados o crescimento micelial, coloração da colônia, dimensões dos conídios e patogenicidade dos isolados em mudas de cajazeira (Spondia mombin L., cajueiro (Anacardium occidentale L., gravioleira (Annona muricata L. e umbuzeiro (Spondias tuberosa Arruda. Os dados de caracterização morfológica e cultural revelaram diversidade na população do patógeno. Alta variabilidade patogênica foi também detectada, embora não tenha sido possível observar especificidade patogênica em cajueiro. O umbuzeiro apresentou maior resistência relativa ao fungo. Os dados demonstraram também uma interação entre as características morfo-culturais e a patogenicidade dos isolados de L. theobromae.

  7. Flowering levels, harvest season and yields of cupuassu (Theobroma grandiflorum Níveis de floração, período de safra e produção do cupuaçuzeiro (Theobroma grandiflorum

    Directory of Open Access Journals (Sweden)

    Giorgini Augusto Venturieri

    2011-03-01

    Full Text Available Cupuassu (Theobroma grandiflorum, a specie native to Amazonia, has been planted commercially in Brazil to satisfy the demand for the flavorful juice obtained from the pulp around its seeds. The trees are notorious for low and irregular fruit production. Data gathered over two seasons from trees in a germplasm collection in Pará, Brazil, showed that some of them fruited more regularly than others. Differences in fruit production correlated to differences in flower production. Tree-to-tree variation in flower production, fruit production, and consistency of both over time suggest considerable scope for improving yields by selection. Hand pollinations resulted in a much higher frequency of fruit set than open pollinations, indicating that lack of effective pollination is also a reason for low yield. However, attempts to increase the level of effective pollination are handicapped by low knowledge about the pollinators of cupuassu and their behavior.Cupuaçu (Theobroma grandiflorum é uma espécie nativa da Amazônia que vem sendo plantada comercialmente no Brasil para satisfazer a demanda pelo seu suco, de sabor marcante, obtido da polpa que envolve as suas sementes. As árvores não notórias pela sua baixa e irregular produtividade. Dados obtidos de dois períodos produtivos, de árvores de uma coleção de germoplasma no estado do Pará, Brasil, mostraram que algumas delas frutificam mais irregularmente que outras. Diferenças na produção de frutos foram correlacionadas à diferenças na produção de flores. Variações entre plantas nas produções de flores e de frutos, e a repetibilidade de ambos ao longo do tempo sugerem melhoria das colheitas por seleção. Polinizações manuais resultaram em aumento no pegamento dos frutos, indicando que a falta de polinizador efetivo é também um causa da produtividade baixa. Entretanto, tentativas para aumentar o nível de polinização efetiva são dificultadas pelo pouco conhecimento sobre os

  8. Efeito da temperatura radicular na resistência ao movimento de água no cacaueiro (Theobroma cacao L. Radicular temperature effects in water movement resistence in cacao tree (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Solange Maria Costa de Amorim

    1992-07-01

    Full Text Available O efeito da temperatura radicular na resistência ao movimento de água foi estudada em plântulas de cacau (Theobroma cacao L. cv. Catongo sob condições de casa de vegetação e a temperaturas radiculares de 10, 20, 30 e 40ºC, em folhas cobertas com papel de alumínio e sacos de polieteileno preto e em folhas descobertas. As folhas estavdf am localizadas na parte basal, intermediária e apical do caule. Mediram-se trocas gasosas foliares utilizando o sistema portátil de fotossíntese LI-6000. O potencial hídrico e o osmótico foram mensurados por psicrometria. O potencial de turgor foi estimado por diferença entre o potencial hídrico e o osmótico. Os resultados obtidos sugerem que a resistência ao movimento de água nas plântulas de cacau depende do fluxo transpiracional e que a variação dos gradientes do potencial hídrico na planta é determinada por temperaturas radiculares maiores de 30ºC. As trocas gasosas, a temperaturas radiculares diferentes, dependem do estado hídrico da planta.The effects of root temperature on water movement resistance were studied on cacao (Theobroma cacao L. cv Catongo seedlings under greenhouse conditions at root temperatures of 10, 20 30 and 40ºC, on leaves covered with aluminum foil and black plastic bags and on uncovered leaves. The leaves were located at the base, intermediates part and apex of the stem. Gas exchange measurements were done utilizing a LI-6000 portable photosynthetic system. Water and osmotic potential were measured by psychrometry. Turgor potential was estimated as the difference between water potential and osmotic potential. The results suggested that the resistance to water movement depends on the transpirational flux and that the water potential gradients across the plant vary at temperatures greater than 30ºC. Gas exchanges, at diferent root temperature, depend on the water status of the plant.

  9. Transposon fingerprinting using low coverage whole genome shotgun sequencing in cacao (Theobroma cacao L.) and related species.

    Science.gov (United States)

    Sveinsson, Saemundur; Gill, Navdeep; Kane, Nolan C; Cronk, Quentin

    2013-07-24

    Transposable elements (TEs) and other repetitive elements are a large and dynamically evolving part of eukaryotic genomes, especially in plants where they can account for a significant proportion of genome size. Their dynamic nature gives them the potential for use in identifying and characterizing crop germplasm. However, their repetitive nature makes them challenging to study using conventional methods of molecular biology. Next generation sequencing and new computational tools have greatly facilitated the investigation of TE variation within species and among closely related species. (i) We generated low-coverage Illumina whole genome shotgun sequencing reads for multiple individuals of cacao (Theobroma cacao) and related species. These reads were analysed using both an alignment/mapping approach and a de novo (graph based clustering) approach. (ii) A standard set of ultra-conserved orthologous sequences (UCOS) standardized TE data between samples and provided phylogenetic information on the relatedness of samples. (iii) The mapping approach proved highly effective within the reference species but underestimated TE abundance in interspecific comparisons relative to the de novo methods. (iv) Individual T. cacao accessions have unique patterns of TE abundance indicating that the TE composition of the genome is evolving actively within this species. (v) LTR/Gypsy elements are the most abundant, comprising c.10% of the genome. (vi) Within T. cacao the retroelement families show an order of magnitude greater sequence variability than the DNA transposon families. (vii) Theobroma grandiflorum has a similar TE composition to T. cacao, but the related genus Herrania is rather different, with LTRs making up a lower proportion of the genome, perhaps because of a massive presence (c. 20%) of distinctive low complexity satellite-like repeats in this genome. (i) Short read alignment/mapping to reference TE contigs provides a simple and effective method of investigating

  10. Phenology of Flowering and Pod Maturity on Some Cocoa Clones (Theobroma cacao L

    Directory of Open Access Journals (Sweden)

    Indah Anita Sari

    2015-08-01

    Full Text Available Phenology  of  flowering  is  an  important  aspect  in  the  growth  cycle  of cocoa (Theobroma  cacao L. because the  performance of  plant  especially  flowering is  linked with  anthesis time, time and  duration  of  stigma  receptivity, fruit formation, crossing,  and  seed  development  which  determine  the  plant  breeding  programs . Research was conducted at the Kaliwining experimental station of Indonesian Coffee and  Cocoa  Research Institute  (ICCRI.  The  cocoa  plant  was  originated  from  top grafting seedling  with the age  of eight  years.  Design  of  experiment  was  randomized complete  block  design  consisted  of  eight  clones  as  treatment  with  three  replications.  Each  plot  consisted  of  20  sample  flowers.  The  parameters  observed  were phenology  of  flowering  and  pod  maturity.  Phenology  of  flowering  observed  were age  of  flowering,  number  of  opened  flower  buds,  number  of  flower  buds  that dropped  before  being  opened,  number  of  flower  buds  that  dropped  after  being opened,  and  number  of  opening  flowers  that  developed  into  tiny  fruits.  Observation  on  pod  and  been  quality  was  done  on  pod  size,  pod  weight,  pod  length, pod  girth,  and  bean  number.  The  result  of  experiment  showed  that  difference  in phenologyof  flowering and age of pod maturity  existed within eight cocoa clones tested.  KKM  22  showed  the  shortest  flowering  age  and  pod  maturity,  and  lowest number  of  beans.  The  highest  success  of  pollination  was  observed  on  Sca  6  and KW 617. ICCRI 03, Sulawesi 03, ICCRI 07, KKM 22 and KW 617 showed relative low success of  pollination,  that  iswas between 10  to 17.6%.  Age  of  flower  opening did  not  significantly  influence  age  of  pod

  11. Selection of Lactic Acid Bacteria with Probiotic Potential Isolated from the Fermentation Process of "Cupuaçu" (Theobroma grandiflorum).

    Science.gov (United States)

    Ornellas, Roberta Maria Santos; Santos, Tiza Teles; Arcucio, Leonardo Borges; Sandes, Sávio Henrique Cicco; Oliveira, Mayara Messias; Dias, Cristiano Villela; de Carvalho Silva, Samuel; Uetanabaro, Ana Paula Trovatti; Vinderola, Gabriel; Nicoli, Jacques Robert

    2017-01-01

    In the present study, nine lactic acid bacteria isolated from the fermentation process of "cupuaçu" (Theobroma grandiflorum) were selected for probiotic use. In vitro (resistance to gastrointestinal environment, in vitro antagonism and co-aggregation with pathogens) and in vivo (intestinal colonization and ex vivo antagonism in germ-free mice, cumulative mortality, translocation to liver and spleen, histopathological examination of liver and ileum and mRNA cytokine gene expression during an experimental infection with S. Typhimurium) assays were used. Among the nine Lactobacillus strains isolated from the "cupuaçu" fermentation, L. plantarum 81 and L. plantarum 90 were selected as potential probiotics based on better results obtained in in vitro evaluations (production of diffusible inhibitory compounds and co-aggregation) as well as in vivo experiments (resistance to gastrointestinal environment, ex vivo antagonism, higher survival after enteropathogen challenge, lower hepatic translocation of enteropathogen, lower histopathological lesions in ileum and liver and anti-inflammatory pattern of immunological response). Concluding, L. plantarum 81 and L. plantarum 90 showed in vitro and in vivo capacities for probiotic use through different mechanisms of protection and its origin would allow an easier adaptation in an alimentary matrix for its administration.

  12. FOOD-PACKAGING INTERACTION ON THE STABILITY OF CANNED SWEETENED CUPUAÇU (Theobroma grandiflorum Schum. PUREE

    Directory of Open Access Journals (Sweden)

    MARIA TERESA DE ALVARENGA FREIRE

    2016-01-01

    Full Text Available Cupuaçu ( Theobroma grandiflorum Schum. is an exotic fruit with a promising economic potential, particularly due to its strong aroma and creamy texture. This study aimed to produce sweetened cupuaçu puree and evaluate the effects of packaging corrosion on its sensory properties and shelf - life in tinplated cans. After 240 days of storage, the commercially sterile product had average sensory analysis scores of 5.89 ± 0.21, 5.39 ± 0.30, 5.45 ± 0.21 and 5.49 ± 0.25, for appearance, aroma, flavor and overall appreciation, respectively. Sensory acceptance scores did not change during storage (p>0.05. Corrosion potential and low tin and iron levels in the product, which are parameters used to evaluate food - packaging interaction, demonstrated the product remained food - safe throughout its shelf - life. Tinplate is a promising packaging material for sweetened cupuaçu puree due to its mechanical and protective properties. Furthermore, tin plating is an economically viable food technology to extend the shelf - life of cupuaçu products and expand its domestic and international markets.

  13. Application of glycerol as a foliar spray activates the defence response and enhances disease resistance of Theobroma cacao.

    Science.gov (United States)

    Zhang, Yufan; Smith, Philip; Maximova, Siela N; Guiltinan, Mark J

    2015-01-01

    Previous work has implicated glycerol-3-phosphate (G3P) as a mobile inducer of systemic immunity in plants. We tested the hypothesis that the exogenous application of glycerol as a foliar spray might enhance the disease resistance of Theobroma cacao through the modulation of endogenous G3P levels. We found that exogenous application of glycerol to cacao leaves over a period of 4 days increased the endogenous level of G3P and decreased the level of oleic acid (18:1). Reactive oxygen species (ROS) were produced (a marker of defence activation) and the expression of many pathogenesis-related genes was induced. Notably, the effects of glycerol application on G3P and 18:1 fatty acid content, and gene expression levels, in cacao leaves were dosage dependent. A 100 mm glycerol spray application was sufficient to stimulate the defence response without causing any observable damage, and resulted in a significantly decreased lesion formation by the cacao pathogen Phytophthora capsici; however, a 500 mm glycerol treatment led to chlorosis and cell death. The effects of glycerol treatment on the level of 18:1 and ROS were constrained to the locally treated leaves without affecting distal tissues. The mechanism of the glycerol-mediated defence response in cacao and its potential use as part of a sustainable farming system are discussed. © 2014 BSPP AND JOHN WILEY & SONS LTD.

  14. Enhanced resistance in Theobroma cacao against oomycete and fungal pathogens by secretion of phosphatidylinositol-3-phosphate-binding proteins.

    Science.gov (United States)

    Helliwell, Emily E; Vega-Arreguín, Julio; Shi, Zi; Bailey, Bryan; Xiao, Shunyuan; Maximova, Siela N; Tyler, Brett M; Guiltinan, Mark J

    2016-03-01

    The internalization of some oomycete and fungal pathogen effectors into host plant cells has been reported to be blocked by proteins that bind to the effectors' cell entry receptor, phosphatidylinositol-3-phosphate (PI3P). This finding suggested a novel strategy for disease control by engineering plants to secrete PI3P-binding proteins. In this study, we tested this strategy using the chocolate tree Theobroma cacao. Transient expression and secretion of four different PI3P-binding proteins in detached leaves of T. cacao greatly reduced infection by two oomycete pathogens, Phytophthora tropicalis and Phytophthora palmivora, which cause black pod disease. Lesion size and pathogen growth were reduced by up to 85%. Resistance was not conferred by proteins lacking a secretory leader, by proteins with mutations in their PI3P-binding site, or by a secreted PI4P-binding protein. Stably transformed, transgenic T. cacao plants expressing two different PI3P-binding proteins showed substantially enhanced resistance to both P. tropicalis and P. palmivora, as well as to the fungal pathogen Colletotrichum theobromicola. These results demonstrate that secretion of PI3P-binding proteins is an effective way to increase disease resistance in T. cacao, and potentially in other plants, against a broad spectrum of pathogens. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  15. Analysis of gene expression and proteomic profiles of clonal genotypes from Theobroma cacao subjected to soil flooding.

    Science.gov (United States)

    Bertolde, Fabiana Z; Almeida, Alex-Alan F; Pirovani, Carlos P

    2014-01-01

    Soil flooding causes changes in gene transcription, synthesis and degradation of proteins and cell metabolism. The main objective of this study was to understand the biological events of Theobroma cacao during soil flooding-induced stress, using the analyses of gene expression and activity of key enzymes involved in fermentation, as well as the identification of differentially expressed proteins by mass spectrometry in two contrasting genotypes for flooding tolerance (tolerant - TSA-792 and susceptible - TSH-774). Soil anoxia caused by flooding has led to changes in the expression pattern of genes associated with the biosynthesis of alcohol dehydrogenase (ADH), pyruvate decarboxylase (PDC) and lactate dehydrogenase (LDH) in leaves and roots of the two evaluated genotypes. Significant differences were observed between the enzyme activities of the two genotypes. Leaves and roots of the TSA-792 genotype showed higher ADH activity as compared to the TSH-774 genotype, whereas the activities of PDC and LDH have varied over the 96 h of soil flooding, being higher for TSA-792 genotype, at the initial stage, and TSH-774 genotype, at the final stage. Some of the identified proteins are those typical of the anaerobic metabolism-involved in glycolysis and alcoholic fermentation-and different proteins associated with photosynthesis, protein metabolism and oxidative stress. The ability to maintain glycolysis and induce fermentation was observed to play an important role in anoxia tolerance in cacao and may also serve to distinguish tolerant and susceptible genotypes in relation to this stressor.

  16. High-resolution transcript profiling of the atypical biotrophic interaction between Theobroma cacao and the fungal pathogen Moniliophthora perniciosa.

    Science.gov (United States)

    Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães

    2014-11-01

    Witches' broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen's transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. © 2014 American Society of Plant Biologists. All rights reserved.

  17. Screening of bacterial biocontrols against sapstain fungus (Lasiodiplodia theobromae Pat.) of rubberwood (Hevea brasiliensis Muell.Arg.).

    Science.gov (United States)

    Sajitha, K L; Maria Florence, E J; Dev, Suma Arun

    2014-09-01

    Diverse bacterial biocontrol agents from various sources of aerobic composts against the sapstain fungus Lasiodiplodia theobromae in rubberwood (Hevea brasiliensis) were isolated, screened and identified by various morphological, biochemical and molecular techniques. The inhibitory effect of seventeen bacterial isolates was examined and seven exhibited inhibition towards the sapstain fungus. Among the seven antagonists, six were conclusively identified as Bacillus subtilis and one as Paenibacillus polymyxa using 16S rRNA-encoding gene sequencing. This is the first report on the occurrence of P. polymyxa, a potent biofertilizer and antagonist in vermicompost. HiCrome Bacillus agar was identified as an effective medium for differentiation of B. subtilis from other Bacillus species. The present work demonstrates the efficacy of the antagonistic property of B. subtilis strains against rubberwood sapstain fungus. Culture-based antagonistic inhibition displayed by B. subtilis can be extended to cater to the biocontrol requirements of wood-based industries against the stain fungus. The study showed the utility of an integrated approach, employing morphological, biochemical and molecular tools for conclusive identification of several bacterial isolates present in aerobic composts from diverse sources. Copyright © 2014 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  18. Analysis of gene expression and proteomic profiles of clonal genotypes from Theobroma cacao subjected to soil flooding.

    Directory of Open Access Journals (Sweden)

    Fabiana Z Bertolde

    Full Text Available Soil flooding causes changes in gene transcription, synthesis and degradation of proteins and cell metabolism. The main objective of this study was to understand the biological events of Theobroma cacao during soil flooding-induced stress, using the analyses of gene expression and activity of key enzymes involved in fermentation, as well as the identification of differentially expressed proteins by mass spectrometry in two contrasting genotypes for flooding tolerance (tolerant - TSA-792 and susceptible - TSH-774. Soil anoxia caused by flooding has led to changes in the expression pattern of genes associated with the biosynthesis of alcohol dehydrogenase (ADH, pyruvate decarboxylase (PDC and lactate dehydrogenase (LDH in leaves and roots of the two evaluated genotypes. Significant differences were observed between the enzyme activities of the two genotypes. Leaves and roots of the TSA-792 genotype showed higher ADH activity as compared to the TSH-774 genotype, whereas the activities of PDC and LDH have varied over the 96 h of soil flooding, being higher for TSA-792 genotype, at the initial stage, and TSH-774 genotype, at the final stage. Some of the identified proteins are those typical of the anaerobic metabolism-involved in glycolysis and alcoholic fermentation-and different proteins associated with photosynthesis, protein metabolism and oxidative stress. The ability to maintain glycolysis and induce fermentation was observed to play an important role in anoxia tolerance in cacao and may also serve to distinguish tolerant and susceptible genotypes in relation to this stressor.

  19. Isolation of dimeric, trimeric, tetrameric and pentameric procyanidins from unroasted cocoa beans (Theobroma cacao L.) using countercurrent chromatography.

    Science.gov (United States)

    Esatbeyoglu, Tuba; Wray, Victor; Winterhalter, Peter

    2015-07-15

    The main procyanidins, including dimeric B2 and B5, trimeric C1, tetrameric and pentameric procyanidins, were isolated from unroasted cocoa beans (Theobroma cacao L.) using various techniques of countercurrent chromatography, such as high-speed countercurrent chromatography (HSCCC), low-speed rotary countercurrent chromatography (LSRCCC) and spiral-coil LSRCCC. Furthermore, dimeric procyanidins B1 and B7, which are not present naturally in the analysed cocoa beans, were obtained after semisynthesis of cocoa bean polymers with (+)-catechin as nucleophile and separated by countercurrent chromatography. In this way, the isolation of dimeric procyanidin B1 in considerable amounts (500mg, purity>97%) was possible in a single run. This is the first report concerning the isolation and semisynthesis of dimeric to pentameric procyanidins from T. cacao by countercurrent chromatography. Additionally, the chemical structures of tetrameric (cinnamtannin A2) and pentameric procyanidins (cinnamtannin A3) were elucidated on the basis of (1)H NMR spectroscopy. Interflavanoid linkage was determined by NOE-correlations, for the first time. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. The protein profile of Theobroma cacao L. seeds as obtained by matrix-assisted laser desorption/ionization mass spectrometry.

    Science.gov (United States)

    Bertazzo, Antonella; Agnolin, Fabio; Comai, Stefano; Zancato, Mirella; Costa, Carlo V L; Seraglia, Roberta; Traldi, Pietro

    2011-07-30

    The water-soluble protein profile of the seeds of green, red, and yellow Theobroma cacao L. fruits has been determined by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-ToF-MS). The seeds were powdered under liquid nitrogen and defatted. The residues were dialyzed and lyophilized. The obtained samples were suspended in the matrix solution of sinapinic acid. The obtained MALDI mass spectra showed the presence of a wide number of proteins with molecular weight ranging from 8000 to 13,000 Da and a cluster of peaks centered at 21,000 Da that were attributed to albumin. The abundance of this peak was found to depend on the different portion of the seed (husk, apical and cortical parts); however, the MALDI mass spectra obtained from the different varieties of cocoa were practically superimposable. Changes in the protein profiles were also observed after the cocoa seeds were treated by fermentation and roasting, which are processes usually employed for the commercial production of cocoa. Copyright © 2011 John Wiley & Sons, Ltd.

  1. Insight into the wild origin, migration and domestication history of the fine flavour Nacional Theobroma cacao L. variety from Ecuador.

    Directory of Open Access Journals (Sweden)

    Rey Gaston Loor Solorzano

    Full Text Available Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.

  2. Study on the presence and influence of phenolic compounds in callogenesis and somatic embryo development of cocoa (Theobroma cacao L..

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2015-04-01

    Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.

  3. Insight into the wild origin, migration and domestication history of the fine flavour Nacional Theobroma cacao L. variety from Ecuador.

    Science.gov (United States)

    Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire

    2012-01-01

    Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR) markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.

  4. Prediction of fermentation index of cocoa beans (Theobroma cacao L.) based on color measurement and artificial neural networks.

    Science.gov (United States)

    León-Roque, Noemí; Abderrahim, Mohamed; Nuñez-Alejos, Luis; Arribas, Silvia M; Condezo-Hoyos, Luis

    2016-12-01

    Several procedures are currently used to assess fermentation index (FI) of cocoa beans (Theobroma cacao L.) for quality control. However, all of them present several drawbacks. The aim of the present work was to develop and validate a simple image based quantitative procedure, using color measurement and artificial neural network (ANNs). ANN models based on color measurements were tested to predict fermentation index (FI) of fermented cocoa beans. The RGB values were measured from surface and center region of fermented beans in images obtained by camera and desktop scanner. The FI was defined as the ratio of total free amino acids in fermented versus non-fermented samples. The ANN model that included RGB color measurement of fermented cocoa surface and R/G ratio in cocoa bean of alkaline extracts was able to predict FI with no statistical difference compared with the experimental values. Performance of the ANN model was evaluated by the coefficient of determination, Bland-Altman plot and Passing-Bablok regression analyses. Moreover, in fermented beans, total sugar content and titratable acidity showed a similar pattern to the total free amino acid predicted through the color based ANN model. The results of the present work demonstrate that the proposed ANN model can be adopted as a low-cost and in situ procedure to predict FI in fermented cocoa beans through apps developed for mobile device. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Fermentation of cacao (Theobroma cacao L.) seeds with a hybrid Kluyveromyces marxianus strain improved product quality attributes.

    Science.gov (United States)

    Leal, Gildemberg Amorim; Gomes, Luiz Humberto; Efraim, Priscilla; de Almeida Tavares, Flavio Cesar; Figueira, Antonio

    2008-08-01

    Fermentation of Theobroma cacao (cacao) seeds is an absolute requirement for the full development of chocolate flavor precursors. An adequate aeration of the fermenting cacao seed mass is a fundamental prerequisite for a satisfactory fermentation. Here, we evaluated whether a controlled inoculation of cacao seed fermentation using a Kluyveromyces marxianus hybrid yeast strain, with an increased pectinolytic activity, would improve an earlier liquid drainage ('sweatings') from the fermentation mass, developing a superior final product quality. Inoculation with K. marxianus increased by one third the volume of drained liquid and affected the microorganism population structure during fermentation, which was detectable up to the end of the process. Introduction of the hybrid yeast affected the profile of total seed protein degradation evaluated by polyacrylamide gel electrophoresis, with improved seed protein degradation, and reduction of titrable acidity. Sensorial evaluation of the chocolate obtained from beans fermented with the K. marxianus inoculation was more accepted by analysts in comparison with the one from cocoa obtained through natural fermentation. The increase in mass aeration during the first 24 h seemed to be fundamental for the improvement of fermentation quality, demonstrating the potential application of this improved hybrid yeast strain with superior exogenous pectinolytic activity.

  6. Effect of fertigation through drip and micro sprinkler on plant biometric characters in cocoa (Theobroma cacao L.).

    Science.gov (United States)

    Krishnamoorthy, C; Rajamani, K

    2013-12-15

    A field experiment to study the influence of fertigation of N, P and K fertilizers on biometric characters of cocoa (Theobroma cacao L.) was conducted at the Department of Spices and Plantation Crops, Horticultural College and Research Institute, Tamil Nadu Agricultural University, Coimbatore during January 2010 to December 2011. The experiment was laid out with thirteen treatments replicated three times in a randomized block design. A phenomenal increase in growth parameters such as trunk girth, canopy spread and weight of the pruned branches removed, leaf fresh weight and leaf dry weight was observed with increasing levels of NPK as well as methods of fertilizer application in this study. Among the various treatments, fertigation with 125% 'Recommended Dose of Fertilizers' (125:50:175 g NPK plant year(-1)) as Water Soluble Fertilizers (WSF) through drip irrigation increased all vegetative growth parameters like trunk girth increment (1.62 cm), canopy spread increment (66.79 cm), leaf fresh weight (3.949 g), leaf dry weight (2.039 g), weight of the pruned branches removed (fresh weight 7.628 kg plant(-1)) and dry weight (4.650 kg plant(-1)).

  7. Estudio analitico de especies oxigenadas en el aceite de teobroma ozonizado Analytical study of oxygenated species in the ozonized theobroma oil

    Directory of Open Access Journals (Sweden)

    Maritza F. Díaz Gómez

    2008-01-01

    Full Text Available Ozonization of theobroma oil at different applied ozone dosages was carried out with measurement of peroxide index values, oxygen percentage content and fatty acids composition. The comparison of peroxide values with percentage content of oxygen at different applied ozone dosages showed good correlation (r=0.9923. Unsaturated fatty acids and triacylglycerols decrease with ozone applied dosage due to ozone reaction with double bonds. Small amounts of oleic acid were consumed with applied ozone dosage at 35 mg/g, which demonstrated that peroxide values and oxygen content were not principally increased by the ozone attack on the double bonds, but other mechanisms could be involved in the reaction system.

  8. Caracterización de productos tradicionales y no tradicionales derivados de cacao (Theobroma cacao L.) en el estado de Tabasco, México.

    OpenAIRE

    Naranjo González, José Alberto

    2011-01-01

    El presente trabajo se realizó en la zona de la Chontalpa del estado de Tabasco, México, que comprende los municipios de Comalcalco, Cárdenas, Huimanguillo, Jalpa de Méndez, Paraíso y Cunduacán. Dicha región es conocida como la cuna del cacao (Theobroma cacao L.) en el Estado, con una superficie sembrada de 41,025 ha. El objetivo de esta investigación fue identificar, clasificar y caracterizar fisicoquímicamente los productos no tradicionales derivados del cacao (PNTC), representativos de las...

  9. Progreso temporal y manejo integrado de la moniliais [Moniliophthora roreri (Cif y Par.) Evans et al.] del cacao (Theobroma cacao) en Tabasco, México.

    OpenAIRE

    Torres de la Cruz, Magdiel

    2010-01-01

    El cacao (Theobroma cacao L.) es uno de los principales recursos agrícolas de Tabasco, México. En abril del 2005, se reportó la moniliasis (Moniliophthora roreri) del cacao en Tabasco; para 2007, la enfermedad había invadido todas las regiones productoras del estado, convirtiéndose en la principal limitante parasítica. En la presente investigación se estudió el progreso temporal de la moniliasis en Tabasco, se evaluó al azoxystrobin como agente curativo de M. roreri, y evaluó un programa de m...

  10. Efecto de la ubicación y época de cosecha en el control de fermentación del cacao (#Theobroma cacao# L.)

    OpenAIRE

    Alvarado, Mary Lisbeth; Portillo, Elvis; Boulanger, Renaud; Bastide, Philippe; Macia, Isabel

    2014-01-01

    En el estado Portuguesa específicamente en las zonas de Biscucuy y Chabasquén, el desarrollo y producción de cacao (Theobroma cacao L.) en los últimos años, ha representado una alternativa de diversificación de los sistemas productivos puesto que se han caracterizados principalmente por el cultivo de café, indicando esto que no existe una amplia experiencia relacionada con el manejo del cultivo y tratamiento poscosecha. Por lo que, se planteó explicar el efecto de la ubicación y época de cose...

  11. BASES PARA LA ZONIFICACIÓN AGROECOLÓGICA EN EL CULTIVO DEL CACAO (Theobroma cacao, Lin) POR MEDIO DEL CRITERIO DE EXPERTOS

    OpenAIRE

    Giclis M. Suárez; René Florido Bacallao; Francisco Soto Carreño; Alberto Caballero Núñez

    2013-01-01

    El objetivo del presente trabajo fue establecer las bases para la zonificación agroecológica del cacao (Theobroma cacao, Lin) por medio del criterio de expertos mediante el método Delphi. Se seleccionaron expertos de diferentes esferas y se determinó el nivel de experticia y el nivel de competencia de cada experto respecto a la problemática relacionada con la definición de los factores que definen la ubicación del cultivo. Para ello se elaboró y aplicó un sistema de rondas de preguntas o cues...

  12. Variabilidad genética de Moniliophthora perniciosa (Stahel) Aime y Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae) en variedades de cacao (Theobroma cacao L.)

    OpenAIRE

    Carolina Osorio-Solano; Carlos Alberto Orozco-Castaño; Germán Ariel López-Gartner; Fredy Arvey Rivera-Páez

    2012-01-01

    Moniliophthora perniciosa, agente causante de la 'escoba de bruja' en cacao (Theobroma cacao), presen- ta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cer- canas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos en...

  13. Effects of enriched compost with efficient microorganisms on the germination of recalcitrant seeds of breadfruit (Parkinson) Fosberg and Theobroma cacao L.

    OpenAIRE

    Yánez Yánez Wilfrido; Villacís-Aldaz Luis Alfredo; León-Gordón Olguer Alfredo; Velástegui-Espín Giovanny Patricio; López-Villacís Isabel Cristina; Cruz-Tobar Saúl Eduardo

    2016-01-01

    The research was conducted at the Center for Research, Graduate Studies and Amazon Conservation (CIPA) of the Amazon State University, Ecuador. The purpose was to assess the effect of enriched compost Germination, day and day’s emergency transplantation two species of tropical origin and breadfruit Theobroma cacao. The experimental field is located in the province of Napo, 16'-1 and S and 77º 36'' 58'y 76'' W, at an altitude of 556 meters, with temperature between 18 and 32oC, average annual ...

  14. Somatic embryogenesis and plant regeneration in elite clones of Theobroma cacao Embriogênese somática e regeneração in vitro de clones elite de Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Thiago Édson Ribeiro da Silva

    2008-10-01

    Full Text Available The objective of this work was to evaluated a procedure for somatic embryogenesis and regeneration of cacao (Theobroma cacao L. elite clones. Petal explants from cacao clones TSH 565 and TSH 1188 were cultured on PCG and SCG-2 media, for calli growth. Somatic embryos were formed on the surface of embryogenic calli after transfer to embryo development (ED medium. Clone TSH 565 showed a higher embryogenic potential than TSH 1188. The best combination of carbon source for embryo induction in ED medium was genotype-specific. Embryogenic callus formations increased in micropore tape-sealed Petri dishes, irrespective of cacao genotype. Mature somatic embryos were successfully converted into plantlets.O objetivo deste trabalho foi avaliar um procedimento para embriogênese somática e regeneração de clones elite de cacau. Pétalas dos clones de cacau TSH 565 e TSH 1188 foram cultivadas em meios PCG e SCG-2 para o crescimento de calos. Embriões somáticos desenvolveram-se na superfície dos calos embriogênicos, após a transferência para o meio ED. O clone TSH 565 apresentou maior potencial embriogênico do que o TSH 1188. A melhor combinação de fonte de carbono quanto à indução de embriões em meio ED foi específica do genótipo. A formação de calos embriogênicos foi superior em placas de Petri seladas com fita hipoalergênica, independentemente do genótipo. Embriões maduros de ambos os genótipos foram convertidos em plântulas.

  15. Identification and mapping of conserved ortholog set(COS) II sequences of cacao and their conversion to SNP markers for marker-assisted selection in Theobroma cocoa and comparative genomics studies

    Science.gov (United States)

    Theobroma cacao is a tree cultivated in the tropics around the world for its seeds that are the source of both chocolate and cocoa butter. The cacao genome sequencing project initiated as a collaboration between USDA, Mars, Inc. and IBM has generated a great deal of transcriptome and genome sequenc...

  16. Polyclonal Antibody-based ELISA in combination with specific PCR amplification of ITS 1 regions for the detection and quantitation of Lasiodiplodia theobromae, causal agent of 2 gummosis in cashew nut plants

    NARCIS (Netherlands)

    Muniz, C.R.; Freire, F.C.O.; Viana, F.M.P.; Cardoso, J.E.; Correia, D.; Jalink, H.; Kema, G.H.J.; Silva, G.F.; Guedes, M.I.F.

    2012-01-01

    Members of Botryosphaeriaceae family are associated with serious diseases in different plants 18 across the world. In cashew nut plants (Anacardium occidentale L.), the fungus Lasiodiplodia 19 theobromae causes a severe group of symptoms related to gummosis that results in decreased nut 20

  17. The effect of 2,4 dichlorophenoxyacetic acid on in vitro callogenesis of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2015-08-01

    Full Text Available Cocoa (Theobroma cacao L. development using modern breeding techniques can be facilitated by propagation of planting material through somatic embryogenesis. Various factors that may affect embryogenesis are the composition of culture medium and culture condition. Hormone commonly used to initiate the formation of callus is auxin with type 2.4-D (2.4 Dichlorophenoxy acetic acid. The aim of this study was to determine the effect of the addition of 2.4 -D hormoneson the process of cocoa embryogenesis. The treatments were arragged in factorial combination in completely randomized design, which consisted of two factors. Thefirst factor was the concentration of auxin 2,4-D 25 %, 50 %, 75 %, and 100 %; and the second factor was cocoa clones; Sulawesi 01 and Sulawesi 02. The resultshowed that the addition of 2.4-D hormone up to 100% on somatic embryogenesis of cocoa for Sulawesi 01 clone was not significantly different from Sulawesi 02 clone for all parameters. While on the addition of 2.4-D, there was significant difference between Sulawesi 01 and 02. Cocoa embryogenic callus using the addition of 2.4-D (25%-100% was significantly different from control. Increased concentrations of 2,4-D hormone which is applied onto media would inhibit the formation of the somatic embryo. Addition of 2.4 D 25%, encouraged towards non-embryogenic callus. Keywords: 2.4 Dichlorophenoxy acetic acid, embryogenic callus, somatic embryos, cocoa, medium culture, hormone

  18. Efficient method of protein extraction from Theobroma cacao L. roots for two-dimensional gel electrophoresis and mass spectrometry analyses.

    Science.gov (United States)

    Bertolde, F Z; Almeida, A-A F; Silva, F A C; Oliveira, T M; Pirovani, C P

    2014-07-04

    Theobroma cacao is a woody and recalcitrant plant with a very high level of interfering compounds. Standard protocols for protein extraction were proposed for various types of samples, but the presence of interfering compounds in many samples prevented the isolation of proteins suitable for two-dimensional gel electrophoresis (2-DE). An efficient method to extract root proteins for 2-DE was established to overcome these problems. The main features of this protocol are: i) precipitation with trichloroacetic acid/acetone overnight to prepare the acetone dry powder (ADP), ii) several additional steps of sonication in the ADP preparation and extractions with dense sodium dodecyl sulfate and phenol, and iii) adding two stages of phenol extractions. Proteins were extracted from roots using this new protocol (Method B) and a protocol described in the literature for T. cacao leaves and meristems (Method A). Using these methods, we obtained a protein yield of about 0.7 and 2.5 mg per 1.0 g lyophilized root, and a total of 60 and 400 spots could be separated, respectively. Through Method B, it was possible to isolate high-quality protein and a high yield of roots from T. cacao for high-quality 2-DE gels. To demonstrate the quality of the extracted proteins from roots of T. cacao using Method B, several protein spots were cut from the 2-DE gels, analyzed by tandem mass spectrometry, and identified. Method B was further tested on Citrus roots, with a protein yield of about 2.7 mg per 1.0 g lyophilized root and 800 detected spots.

  19. Application of IBA in environmental remediation using skins of cocoa (Theobroma cacao) and sweet potatoes (Ipomoea batatas)

    Energy Technology Data Exchange (ETDEWEB)

    Sumbu, K. [Department of Chemistry, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa); Mars, J.A.; Gihwala, D. [Department of Biomedical Sciences, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa)

    2013-07-01

    Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)

  20. Genes differentially expressed in Theobroma cacao associated with resistance to witches' broom disease caused by Crinipellis perniciosa.

    Science.gov (United States)

    Leal, Gildemberg Amorim; Albuquerque, Paulo S B; Figueira, Antonio

    2007-05-01

    SUMMARY The basidiomycete Crinipellis perniciosa is the causal agent of witches' broom disease of Theobroma cacao (cocoa). Hypertrophic growth of infected buds ('brooms') is the most dramatic symptom, but the main economic losses derive from pod infection. To identify cocoa genes differentially expressed during the early stages of infection, two cDNA libraries were constructed using the suppression subtractive hybridization (SSH) approach. Subtraction hybridization was conducted between cDNAs from infected shoot-tips of the susceptible genotype 'ICS 39' and the resistant 'CAB 214', in both directions. A total of 187 unique sequences were obtained, with 83 from the library enriched for the susceptible 'ICS 39' sequences, and 104 for the resistant 'CAB 214'. By homology search and ontology analyses, the identified sequences were mainly putatively categorized as belonging to 'signal transduction', 'response to biotic and abiotic stress', 'metabolism', 'RNA and DNA metabolism', 'protein metabolism' and 'cellular maintenance' classes. Quantitative reverse transcription amplification (RT-qPCR) of 23 transcripts identified as differentially expressed between genotypes revealed distinct kinetics of gene up-regulation at the asymptomatic stage of the disease. Expression induction in the susceptible 'ICS 39' in response to C. perniciosa was delayed and limited, while in 'CAB 214' there was a quicker and more intense reaction, with two peaks of gene induction at 48 and 120 h after inoculation, corresponding to morphological and biochemical changes previously described during colonization. Similar differences in gene induction were validated for another resistant genotype ('CAB 208') in an independent experiment. Validation of these genes corroborated similar hypothetical mechanisms of resistance described in other pathosystems.

  1. Successful pod infections by Moniliophthora roreri result in differential Theobroma cacao gene expression depending on the clone's level of tolerance.

    Science.gov (United States)

    Ali, Shahin S; Melnick, Rachel L; Crozier, Jayne; Phillips-Mora, Wilberth; Strem, Mary D; Shao, Jonathan; Zhang, Dapeng; Sicher, Richard; Meinhardt, Lyndel; Bailey, Bryan A

    2014-09-01

    An understanding of the tolerance mechanisms of Theobroma cacao used against Moniliophthora roreri, the causal agent of frosty pod rot, is important for the generation of stable disease-tolerant clones. A comparative view was obtained of transcript populations of infected pods from two susceptible and two tolerant clones using RNA sequence (RNA-Seq) analysis. A total of 3009 transcripts showed differential expression among clones. KEGG (Kyoto Encyclopedia of Genes and Genomes) pathway analysis of differentially expressed genes indicated shifts in 152 different metabolic pathways between the tolerant and susceptible clones. Real-time quantitative reverse transcription polymerase chain reaction (real-time qRT-PCR) analyses of 36 genes verified the differential expression. Regression analysis validated a uniform progression in gene expression in association with infection levels and fungal loads in the susceptible clones. Expression patterns observed in the susceptible clones diverged in tolerant clones, with many genes showing higher expression at a low level of infection and fungal load. Principal coordinate analyses of real-time qRT-PCR data separated the gene expression patterns between susceptible and tolerant clones for pods showing malformation. Although some genes were constitutively differentially expressed between clones, most results suggested that defence responses were induced at low fungal load in the tolerant clones. Several elicitor-responsive genes were highly expressed in tolerant clones, suggesting rapid recognition of the pathogen and induction of defence genes. Expression patterns suggested that the jasmonic acid-ethylene- and/or salicylic acid-mediated defence pathways were activated in the tolerant clones, being enhanced by reduced brassinosteroid (BR) biosynthesis and catabolic inactivation of both BR and abscisic acids. Finally, several genes associated with hypersensitive response-like cell death were also induced in tolerant clones. © 2014

  2. Identificación de un gen codificante de polifenol oxidasa (PPO en Theobroma cacao L. (cacao de Ecuador

    Directory of Open Access Journals (Sweden)

    Jaime Morante-Carriel

    2017-12-01

    Full Text Available En Ecuador, las plantaciones de cacao presentan bajos promedios de producción debido a la diversidad de patógenos, especialmente a la infección por Moniliophthora roreri (monilia. Se cree que existe una relación entre el ataque del hongo y el aumento de los niveles de expresión de genes codificantes de polifenol oxidasas (PPOs como mecanismo de defensa ante patógenos y herbívoros en diferentes plantas. Para la identificación de genes que codifican para PPOs, se seleccionaron hojas de cacao Nacional, provenientes de plantas resistentes y susceptibles a monilia, ubicadas en la Finca Experimental La Represa, propiedad de la Universidad Técnica Estatal de Quevedo. Se afinó un protocolo de extracción de ARN total de alta calidad para hojas de cacao recalcitrantes. Después de su retrotranscripción a ADNc, se realizaron ensayos de amplificación por PCR con diferentes primers, diseñados a partir de secuencias conservadas de PPOs. Los productos de amplificación permitieron la identificación de un gen de 961 pb, similar a un gen que codifica para la PPO predictiva de Theobroma cacao depositada en NCBI (XP_017978715.1 La identificación de este gen, es fundamental para evaluar a futuro los niveles de expresión y cuantificación en diferentes estados de desarrollo del fruto. Dicha cuantificación permitirá proponer herramientas de control para monilia y construir las bases para el mejoramiento genético del cacao Nacional.

  3. Development of Selection Criteria on Bean Weight Character of Cocoa (Theobroma cacaoL. through Path Analysis Approach

    Directory of Open Access Journals (Sweden)

    Indah Anita Sari

    2013-12-01

    Full Text Available Path coefficient analysis is frequently used for development of selection criteria on various type of plants. Path analysis on this research was conducted to find the selection criteria of yield component which directly affect bean weight. In addition to the value of path analysis coefficient, genetic variation coefficient, heritability and the value of genetic progress were also studied. The study was conducted at the Indonesian Coffee and Cocoa Research Institute. The research used randomized complete block design consisting of 14 accession numbers and each consisting of three replications. Pod girth, pod length, pod weight, wet beans weight per pod, number of normal beans per pod, number of abnormal beans per pod, dry weight per normal bean, and shell content were observed. The results showed that the pod weight character had an important role in determining the dry weight of normal bean. The character had a positive genotype correlation coefficient values which was high and significantly different (r=0.46 for dry weight per normal bean, considerable direct influence (P=0.479, moderate of the genotype variation coefficient (9.6%, and high genetic progress (95.23. Character of wet bean weight per pod could also be used indirectly for the selection criteria for dry weight per normal bean based on genetic variation coefficient value (11.88%, genetic progress value (82.48, and direct effect on dry weight per normal bean had positive value (P=0.006. Key words: Selection criteria, dry weight per bean, path analysis,Theobroma cacaoL.

  4. Sodium-potassium synergism in Theobroma cacao: stimulation of photosynthesis, water-use efficiency and mineral nutrition.

    Science.gov (United States)

    Gattward, James N; Almeida, Alex-Alan F; Souza, José O; Gomes, Fábio P; Kronzucker, Herbert J

    2012-11-01

    In ecological setting, sodium (Na(+)) can be beneficial or toxic, depending on plant species and the Na(+) level in the soil. While its effects are more frequently studied at high saline levels, Na(+) has also been shown to be of potential benefit to some species at lower levels of supply, especially in C4 species. Here, clonal plants of the major tropical C3 crop Theobroma cacao (cacao) were grown in soil where potassium (K(+)) was partially replaced (at six levels, up to 50% replacement) by Na(+), at two concentrations (2.5 and 4.0 mmol(c) dm(-3)). At both concentrations, net photosynthesis per unit leaf area (A) increased more than twofold with increasing substitution of K(+) by Na(+). Concomitantly, instantaneous (A/E) and intrinsic (A/g(s)) water-use efficiency (WUE) more than doubled. Stomatal conductance (g(s)) and transpiration rate (E) exhibited a decline at 2.5 mmol dm(-3), but remained unchanged at 4 mmol dm(-3). Leaf nitrogen content was not impacted by Na(+) supplementation, whereas sulfur (S), calcium (Ca(2+)), magnesium (Mg(2+)) and zinc (Zn(2+)) contents were maximized at 2.5 mmol dm(-3) and intermediate (30-40%) replacement levels. Leaf K(+) did not decline significantly. In contrast, leaf Na(+) content increased steadily. The resultant elevated Na(+)/K(+) ratios in tissue correlated with increased, not decreased, plant performance. The results show that Na(+) can partially replace K(+) in the nutrition of clonal cacao, with significant beneficial effects on photosynthesis, WUE and mineral nutrition in this major perennial C3 crop. Copyright © Physiologia Plantarum 2012.

  5. Expression of the Theobroma cacao Bax-inhibitor-1 gene in tomato reduces infection by the hemibiotrophic pathogen Moniliophthora perniciosa.

    Science.gov (United States)

    Scotton, Danielle Camargo; Azevedo, Mariana Da Silva; Sestari, Ivan; Da Silva, Jamille Santos; Souza, Lucas Anjos; Peres, Lázaro Eustáquio Pereira; Leal, Gildemberg Amorim; Figueira, Antonio

    2017-10-01

    Programmed cell death (PCD) plays a key role in plant responses to pathogens, determining the success of infection depending on the pathogen lifestyle and on which participant of the interaction triggers cell death. The hemibiotrophic basidiomycete Moniliophthora perniciosa is the causal agent of witches' broom disease of Theobroma cacao L. (cacao), a serious constraint for production in South America and the Caribbean. It has been hypothesized that M. perniciosa pathogenesis involves PCD, initially as a plant defence mechanism, which is diverted by the fungus to induce necrosis during the dikaryotic phase of the mycelia. Here, we evaluated whether the expression of a cacao anti-apoptotic gene would affect the incidence and severity of M. perniciosa infection using the 'Micro-Tom' (MT) tomato as a model. The cacao Bax-inhibitor-1 (TcBI-1) gene, encoding a putative basal attenuator of PCD, was constitutively expressed in MT to evaluate function. Transformants expressing TcBI-1, when treated with tunicamycin, an inducer of endoplasmic reticulum stress, showed a decrease in cell peroxidation. When the same transformants were inoculated with the necrotrophic fungal pathogens Sclerotinia sclerotiorum, Sclerotium rolfsii and Botrytis cinerea, a significant reduction in infection severity was observed, confirming TcBI-1 function. After inoculation with M. perniciosa, TcBI-1 transformant lines showed a significant reduction in disease incidence compared with MT. The overexpression of TcBI-1 appears to affect the ability of germinating spores to penetrate susceptible tissues, restoring part of the non-host resistance in MT against the S-biotype of M. perniciosa. © 2016 BSPP AND JOHN WILEY & SONS LTD.

  6. Theobroma cacao L. pathogenesis-related gene tandem array members show diverse expression dynamics in response to pathogen colonization.

    Science.gov (United States)

    Fister, Andrew S; Mejia, Luis C; Zhang, Yufan; Herre, Edward Allen; Maximova, Siela N; Guiltinan, Mark J

    2016-05-17

    The pathogenesis-related (PR) group of proteins are operationally defined as polypeptides that increase in concentration in plant tissues upon contact with a pathogen. To date, 17 classes of highly divergent proteins have been described that act through multiple mechanisms of pathogen resistance. Characterizing these families in cacao, an economically important tree crop, and comparing the families to those in other species, is an important step in understanding cacao's immune response. Using publically available resources, all members of the 17 recognized pathogenesis-related gene families in the genome of Theobroma cacao were identified and annotated resulting in a set of ~350 members in both published cacao genomes. Approximately 50 % of these genes are organized in tandem arrays scattered throughout the genome. This feature was observed in five additional plant taxa (three dicots and two monocots), suggesting that tandem duplication has played an important role in the evolution of the PR genes in higher plants. Expression profiling captured the dynamics and complexity of PR genes expression at basal levels and after induction by two cacao pathogens (the oomycete, Phytophthora palmivora, and the fungus, Colletotrichum theobromicola), identifying specific genes within families that are more responsive to pathogen challenge. Subsequent qRT-PCR validated the induction of several PR-1, PR-3, PR-4, and PR-10 family members, with greater than 1000 fold induction detected for specific genes. We describe candidate genes that are likely to be involved in cacao's defense against Phytophthora and Colletotrichum infection and could be potentially useful for marker-assisted selection for breeding of disease resistant cacao varieties. The data presented here, along with existing cacao-omics resources, will enable targeted functional genetic screening of defense genes likely to play critical functions in cacao's defense against its pathogens.

  7. Effects of enriched compost with efficient microorganisms on the germination of recalcitrant seeds of breadfruit (Parkinson Fosberg and Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Yánez Yánez Wilfrido

    2016-11-01

    Full Text Available The research was conducted at the Center for Research, Graduate Studies and Amazon Conservation (CIPA of the Amazon State University, Ecuador. The purpose was to assess the effect of enriched compost Germination, day and day’s emergency transplantation two species of tropical origin and breadfruit Theobroma cacao. The experimental field is located in the province of Napo, 16'-1 and S and 77º 36'' 58'y 76'' W, at an altitude of 556 meters, with temperature between 18 and 32oC, average annual precipitation above 3000mm and relative humidity between 87 and 89%. An experimental design with five treatments in a randomized complete block design with three replications was applied. Treatments consisted of compost (1 MS, (2 lactic acid bacteria, (3 commercial yeast, (4 a combination thereof and (5 only compost, witness. It was determined that the compost mixture (T4 as a whole, has the greatest effect on the parameters of the seeds. Germination was found that in two of the T3 and T4 treatments significantly decreased the number of days to germination, in relation to the witness, 33 days and 13 days Artocarpus altilis, Theobroma cacao. The number of emerged plants, increase in both species with the addition of EM, lactic acid bacteria and commercial yeast (T4. a reduction is also reported in the days to transplant species studied to be significant particularly in cocoa. It was also determined that most bioburden corresponded to bacteria.

  8. Protein Synthesis During Fungal Spore Germination II. Aminoacyl-soluble Ribonucleic Acid Synthetase Activities During Germination of Botryodiplodia theobromae Spores1

    Science.gov (United States)

    Etten, James L. Van; Brambl, Robert M.

    1968-01-01

    The specific activities of 13 aminoacyl-soluble ribonucleic acid (sRNA) synthetases were measured at various time intervals during the germination of Botryodiplodia theobromae conidiospores. The enzyme activities were low or absent in ungerminated spores, and they increased rapidly as germination proceeded. When extracts of the ungerminated spores were prepared with mortar and pestle, very little or no enzyme activity was detected. When the extracts were prepared with a mechanical homogenizer, however, they exhibited some enzyme activity, although less than did the extracts from germinated spores. Enzyme activities from germinated spores were approximately the same, regardless of the method of preparation. The enzyme fraction from ungerminated spores prepared with a mechanical homogenizer could also stimulate incorporation of phenylalanine into polyphenylalanine in the presence of ribosomes, polyuridylic acid, and sRNA, although the activity was approximately only 15 to 20% that of a similar enzyme fraction from germinated spores. It is concluded that ungerminated spores of B. theobromae contain active aminoacyl-sRNA synthetases and transfer enzymes, although the activities are low when compared to germinated spores. PMID:5685990

  9. EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of health claims related to caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood (ID 4276) pursuant to Article 13(1) of Regulation (EC) No 1924/2006

    DEFF Research Database (Denmark)

    Tetens, Inge

    or directly from stakeholders. The food that is the subject of the health claim is cocoa (Theobroma cacao L.). The Panel considers that whereas the food, cocoa (Theobroma cacao L.), is not sufficiently characterised in relation to the claimed effect evaluated in this opinion, the food constituents, caffeine...... that a cause and effect relationship has not been established between the consumption of caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood....... claims in relation to caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood. The scientific substantiation is based on the information provided by the Member States in the consolidated list of Article 13 health claims and references that EFSA has received from Member States...

  10. Influência do substrato no crescimento de mudas de cupuaçu (Theobroma grandiflorum Schum. = Influence of the substrate on the growth of cupuassu (Theobroma grandiflorum Schum. seedlings

    Directory of Open Access Journals (Sweden)

    Maria das Graças Rodrigues Ferreira

    2009-10-01

    Full Text Available Entre as fruteiras amazônicas, destaca-se o cupuaçuzeiro, espécie de recente domesticação que vêm sendo valorizada por suas características de sabor e aroma. Um dos fatores determinantes para produção de mudas é a recomendação do substrato mais apropriado e, para espécies nativas, esta informação ainda é escassa. O objetivo deste trabalho foi avaliar o efeito de diferentes substratos na velocidade de germinação das sementes e no crescimento das mudas decupuaçu. O trabalho foi realizado em casa-de-vegetação, sendo testados sete substratos: terra vegetal + areia (1:1, terra vegetal, bioplant®, bioclone®, plugmix®, areia e vermiculita. Foram avaliadas as características: índice de velocidade de emergência (IVE, comprimento da raiz (CR, comprimento da parte aérea (CPA, biomassa seca da raiz (BSR e biomassa seca da parte aérea (BSPA, em delineamento experimental inteiramente casualizado com sete tratamentos, com quatro repetições de 15 sementes. As médias dos efeitos de substrato foram agrupadas pelo teste de Scott-Knott e a recomendação dos substratos foi realizada com o auxílio da técnicamultivariada de variáveis canônicas. O substrato bioclone® se destacou na maioria das características de germinação e qualidade das mudas avaliadas.The cupuassu (Theobroma grandiflorum stands out as an important recently domesticated Amazon fruit. Although the substrate is a prime factor for plantlet development, there are few recommendations for cupuassu plantlet production. The objective of this work was to evaluate the influence of different substrates on cupuassu germination and seedling growth. Seven substrates were tested in greenhouse conditions: vegetable soil + sand (1:1, vegetable soil, bioplant®, bioclone®, plugmix®, sand and vermiculite. The following germination and seedling traits were evaluated: germination speedindex, length and dry mass of roots and aerial parts; using a completely randomized design

  11. Use of Trichoderma fungi in spray solutions to reduce Moniliophthora roreri infection of Theobroma cacao fruits in Northeastern Costa Rica.

    Science.gov (United States)

    Seng, John; Herrera, Geovanny; Vaughan, Christopher S; McCoy, Michael B

    2014-09-01

    Cacao (Theobroma cacao) is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthllora roreri, known commonly as "monilia", has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Thichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia) at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma). Each treatment was applied to four trees of each clone. We monitored the incidence of monilia infection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p ≤ 0.05) in only 35d, as compared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1,500 kg dried beans/ha by 198 kg/ha up to 1,698 kg/ha or by a total increase over the whole 110 ha plantation by 21,780 kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days) would decrease infection incidence even more. Application of this fungal control

  12. Doxorubicin induced neuro- and cardiotoxicities in experimental rats: Protection against oxidative damage by Theobroma cacao Stem bark

    Directory of Open Access Journals (Sweden)

    A.M. Kosoko

    2017-07-01

    Full Text Available 80 rats, randomly selected, were divided into 3 treatment groups: pre-, co- and post-treatment; consisting of 6 sub-groups each (5 rats per sub-group: baseline, normal saline (2 mL, α-lipoic acid (20 mg/kg body weight, 200 mg/kg, 400 mg/kg or 800 mg/kg body weight Theobroma cacao stem bark aqueous extract (TCAE. All rats except for baseline group were intoxicated with 20 mg/kg body weight doxorubicin (DOX intraperitoneally. The animals in pre- or post-treatment group received a single dose of DOX (20 mg/kg body weight intraperitoneally 24 h before or after 7 days’ oral administration with TCAE respectively while those in co-treatment group were co-administered 2.86 mg/kg body weight of DOX with either normal saline, α- lipoic acid or TCAE orally for 7 days. Animals were sacrificed (pre- and post- treatment groups were sacrificed on the ninth day while the co-treatment group sacrificed on the 8th day. Brain and heart tissue samples were harvested for enzyme markers of toxicity, oxidative stress and histopathological examinations. DOX intoxication caused significant decrease in activities of LDH and ACP, and increase in γGT and ALP activities in brain tissues while causing a significant increase in LDH, ACP, γGT activities and decrease in ALP activity in the cardiac tissues. DOX intoxication caused a significant increase in concentrations of H2O2 generated, MDA and PC, XO, MPx and NOX activities with concomitant decrease in CAT, SOD, GPx and GST activities, and in concentrations of GSH, AsA and α-Toc in brain and cardiac tissues. Pre-, co- and post-treatment with TCAE at either 200 mg/kg, 400 mg/kg or 800 mg/kg body weight significantly reversed the oxidative damage to the organs induced by DOX-intoxication. The result affirmed that T. cacao stem bark aqueous extract protected against DOX induced oxidative damage in brain and cardiac tissues of experimental rats.

  13. Analisis Pindah Panas pada Ruang Fermentasi Biji Kakao (Theobroma cacao L dengan Menggunakan Kotak Kayu dan Styrofoam

    Directory of Open Access Journals (Sweden)

    Fazzatul Rahmi

    2017-04-01

    Full Text Available Abstrak. Fermentasi merupakan kegiatan untuk melepaskan zat lendir dari permukaan kulit biji dan menghasilkan biji mutu dan aroma yang baik. Selain itu fermentasi juga dilakukan untuk menghindari tumbuhnya jamur selama masa penyimpanan. Selama fermentasi berlangsung akan terjadinya perpindahan panas/ suhu di dalam kotak fermentasi. Tujuan yang ingin dicapai dalam penelitian yaitu untuk melihat perubahan suhu selama proses fermentasi, mengetahui pengaruh bahan kotak (kayu dan styrofoam terhadap perpindahan panas di dalam kotak fermentasi dan perpindahan panas dari dalam kotak fermentasi terhadap lingkungan luar. Hasil penelitian yang diperoleh bahwa suhu ideal fermentasi pada kotak kayu dihasilkan pada hari ke-5, sedangkan kotak styrofoam suhu ideal dihasilkan pada hari ke-3. Perpindahan panas pada bahan kayu suhunya lebih tinggi dibandingkan dengan bahan styrofoam. Hal ini disebabkan karena panas pada kotak kayu keluar lebih cepat, sehingga suhu pada proses fermentasi bisa lebih rendah dibandingkan menggunakan kotak styrofoam. Hasil fermentasi biji kakao dengan menggunakan kotak kayu didapatkan biji kakao yang bagus yaitu pada hari ke-5 fermentasi dan kotak styrofoam pada hari ke-5 fermentasi didapatkan biji kakao yang berjamur.   Analysis Of Transfer Heat Room Of Cocoa Seed Fermentation (Theobroma cacao L. Using Wood Box and Styrofoam Abstract. Fermentation is an activity to remove mucous substances from the skin surface to produce quality of seed and good aroma. In addition, fermentation also done to avoid the growth of mold during storage period. During fermentation, the heat transfer / temperature will be happen inside the fermentation box. The aim of this study is to observe the changes of temperature during the fermentation process, knowing the effect of packaging materials (wood and styrofoam to heat transfer in the fermentation box and heat transfer from inside of fermentation box to the environment in the outside. The results showed

  14. Use of Trichoderma fungi in spray solutions to reduce Moniliophthora roreri infection of Theobroma cacao fruits in Northeastern Costa Rica

    Directory of Open Access Journals (Sweden)

    John Seng

    2014-09-01

    Full Text Available Cacao (Theobroma cacao is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthora roreri, known commonly as “monilia”, has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. Fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Trichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma. Each treatment was applied to four trees of each clone. We monitored the incidence of moniliainfection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p<0.05 in only 35d, ascompared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1 500kg dried beans/ha by 198kg/ha up to 1 698kg/ha or by a total increase over the whole 110ha plantation by 21 780kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days would decrease infection incidence even more. Application of this fungal

  15. A Larger Chocolate Chip—Development of a 15K Theobroma cacao L. SNP Array to Create High-Density Linkage Maps

    Directory of Open Access Journals (Sweden)

    Donald Livingstone

    2017-12-01

    Full Text Available Cacao (Theobroma cacao L. is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.

  16. Endophytic fungal diversity in Theobroma cacao (cacao) and T. grandiflorum (cupuaçu) trees and their potential for growth promotion and biocontrol of black-pod disease.

    Science.gov (United States)

    Hanada, Rogério Eiji; Pomella, Alan William V; Costa, Heron Salazar; Bezerra, José Luiz; Loguercio, Leandro L; Pereira, José O

    2010-01-01

    The endophytic niches of plants are a rich source of microbes that can directly and indirectly promote plant protection, growth and development. The diversity of culturable endophytic fungi from stems and branches of Theobroma cacao (cacao) and Theobroma grandiflorum (cupuaçu) trees growing in the Amazon region of Brazil was assessed. The collection of fungal endophytic isolates obtained was applied in field experiments to evaluate their potential as biocontrol agents against Phytophthora palmivora, the causal agent of the black-pod rot disease of cacao, one of the most important pathogens in cocoa-producing regions worldwide. The isolated endophytic fungi from 60 traditional, farmer-planted, healthy cacao and 10 cupuaçu plants were cultured in PDA under conditions inducing sporulation. Isolates were classified based upon the morphological characteristics of their cultures and reproductive structures. Spore suspensions from a total of 103 isolates that could be classified at least up to genus level were tested against P. palmivora in pods attached to cacao trees in the field. Results indicated that ∼70% of isolates showed biocontrol effects to a certain extent, suggesting that culturable endophytic fungal biodiversity in this system is of a mostly mutualistic type of interaction with the host. Eight isolates from genera Trichoderma (reference isolate), Pestalotiopsis, Curvularia, Tolypocladium and Fusarium showed the highest level of activity against the pathogen, and were further characterized. All demonstrated their endophytic nature by colonizing axenic cacao plantlets, and confirmed their biocontrol activity on attached pods trials by showing significant decrease in disease severity in relation to the positive control. None, however, showed detectable growth-promotion effects. Aspects related to endophytic biodiversity and host-pathogen-endophyte interactions in the environment of this study were discussed on the context of developing sustainable strategies

  17. Avaliação e seleção de progênies de cupuaçuzeiro (Theobroma grandiflorum, em Belém, Pará Evaluation and selection of Theobroma grandiflorum parents, in Belem, Para

    Directory of Open Access Journals (Sweden)

    Rafael Moysés Alves

    2010-03-01

    Full Text Available Este trabalho teve por objetivo a seleção entre e dentro de progênies de irmãos completos de cupuaçuzeiro. Foram avaliadas 21 progênies de irmãos completos, em dois experimentos, com cinco plantas por parcela. Os experimentos foram avaliados ao nível de indivíduos, em cada safra, para os caracteres: produção de frutos, polpa e semente, bem como resistência à vassoura-de-bruxa. Para efeito de seleção, também foi considerado o grau de parentesco das matrizes. As análises foram conduzidas via metodologia de modelos lineares mistos, como delineamento em blocos incompletos, desbalanceados com tratamentos comuns. Foram estimados os parâmetros genéticos e os valores genotípicos ajustados de progênies, bem como os valores genéticos aditivos e genotípicos individuais. Os resultados demonstraram que as progênies 12; 13; 18; 20; 21 e 24 tiveram os melhores desempenhos para as variáveis de produção. Entre elas, as progênies 12; 13 e 18 foram as que mais se destacaram. Foram selecionadas três matrizes da progênie 18, duas matrizes da progênie 12 e uma matriz de cada uma das progênies 13; 20 e 21. É possível concluir que essas matrizes, juntamente com materiais selecionados em outras áreas experimentais, apresentam potencial para compor um pomar de sementes clonais, estabelecido em lote isolado de outros plantios, onde será produzida uma população melhorada de primeiro ciclo que se constituirá na nova cultivar de cupuaçuzeiro.This paper had as objective the selection among and within full sib families of Theobroma grandiflorum. A total of 21 full sibs progenies were appraised, in two experiments, with five plants for plot. The experiments were appraised at the individuals' level, in each crop, for the traits: production of fruits, pulp and seed and resistance to witch's broom disease. The degree of genetic relationship of the candidates was also considered. The analyses were performed through the methodology of mixed

  18. ( Theobroma cacao ) families

    African Journals Online (AJOL)

    ) which causes high production losses. In Cameroon, these losses reached 80% of cocoa production depending on ecological zones. In order to contribute to the efficiency of selection methods used in resistance or tolerance to black pod ...

  19. Indução de calos em espécies amazônicas do gênero Theobroma Callus induction in amazonian species of the Theobroma genus

    Directory of Open Access Journals (Sweden)

    Marivana Borges Silva

    2006-04-01

    Full Text Available Vários trabalhos vem sendo desenvolvidos sobre o cultivo in vitro de cacau (T.cacao, mas são raros para a maioria das outras espécies do gênero, como o cupuaçu (T. grandiflorum, cuja a área plantada vem aumentando expressivamente, e outras que poderiam servir de fonte de genes para as espécies economicamente já reconhecidas. Protocolos para obtenção de embriões somáticos in vitro para as espécies T. cacao,T. grandiflorum,T. speciosum e o híbrido T. grandiflorum x T. obovatum foram avaliados a partir de duas fontes de explantes, estaminódios e pétalas (formadas por lígulas e cógulas cultivados em meio de crescimento primário de calo, consistindo de sais DKW, suplementado com 20 g l-1 de sacarose, 250 mg l-1de glutamina, 200 mg l-1de mio-inositol, 0,2 mg l-1 de tiamina-HCl, 0,1 mg l-1 de ácido nicotínico, 0,2 mg l-1 de glicina, 2 mg l-1 de 2,4-D, 2,2 g l-1 de Gelrite® e pH 5,8. A este meio foram adicionadas diferentes concentrações de tidiazuron (0, 5 e 10 µg l-1. As culturas foram mantidas no escuro por 14 dias, à temperatura de 25 ± 2 ºC, e então transferidas para meio de crescimento secundário de calo, constituído de sais WPM, vitaminas de Gamborg, 20 g l-1 de sacarose, 2 mg l-1 de 2,4 D, 0,3 mg l-1 de cinetina, 50 ml l-1 de água de côco, 2,2 g l-1 de Gelrite® e pH 5,8. A formação de calos ocorreu em todas as espécies. Embriões somáticos foram obtidos somente para T. cacao. A calogênese mostrou-se influenciada pelo genótipo e foi maior nos estaminódios.Many works have been done on cocoa (Theobroma cacao in vitro culture, with few studies being published for other species of the same genus, as cupuassu (T. grandiflorum, whose planted area is increasing expressively, and others that could be used as a source of genes for those with recognized economical importance. Protocols to obtain in vitro somatic embryos from T. cacao,T. grandiflorum,T. speciosum and the hybrid T. grandiflorum x T. obovatum from two

  20. Produção e caracterização de biomassa extracelular obtida por fermentação submersa usando Lasidioplodia theobromae isolado do cacau

    Directory of Open Access Journals (Sweden)

    Josileide Gonçalves Borges

    2014-01-01

    Full Text Available Gomas produzidas por microrganismos são usadas como modificadores de alimentos e a biomassa residual para isolamento de seus constituintes. O objetivo deste trabalho foi produzir e caracterizar biomassa extracelular por fermentação submersa com Lasidioplodia theobromae isolado de cacau da Bahia com morte descendente. Foram testadas quatro fontes de carbono fermentadas a 28 ºC, 180 rpm por 72 horas. A que resultou em maior produção de biomassa foi avaliada quanto à variação da concentração e pH. As frações obtidas foram caracterizadas por infravermelho (FTIR e análise por termogravimetria (TG, composição centesimal e monossacarídica. A fermentação submersa da sacarose comercial a 40 g.L-1 em pH 4,0 por L. theobromae resultou em máxima produção da fração I (8,64g.L-1, e a 50g.L-1, pH 5,0, da fração II (23,69 g.L-1. Os espectros de FTIR mostraram presença de grupos amino, poliois e ésteres, e nas análises termogravimétricas observaram-se três eventos de perda de massa em diferentes intensidades. As frações contêm mesma composição em proporções diferenciadas, sendo fontes de proteínas (19,88-29,45%, lipídios (11,07-28,79%, cinzas (3,55-3,88%, e carboidratos (30,16-37,96% compostos unicamente de glicose e manose em diferentes proporções, portanto ambas glucomananas. As frações apresentam propriedades e potencial desejáveis para ampla utilização em processos biotecnológicos de alta relevância científica.

  1. EFEITO DO EXTRATO FOLIAR DE Gossypium arboreum L. (ALGODÃO SOB O CRESCIMENTO MICELIAL DE Lasiodiplodia theobromae (PAT. GRIFFON & MAUBL

    Directory of Open Access Journals (Sweden)

    Caroline da Cruz Vasconcelos

    2017-03-01

    Full Text Available O uso de extratos vegetais tem sido amplamente estudado como controle biológico alternativo de doenças de plantas, especialmente aquelas causadas por fungos patogênicos. Nesse sentido, o objetivo do presente estudo foi avaliar a atividade antifúngica in vitro do extrato bruto etanólico obtido de folhas de algodão (Gossypium arboreum L., Malvaceae em diferentes concentrações sob o desenvolvimento micelial do fungo fitopatogênico Lasiodiplodia theobromae. O ensaio foi conduzido nos Laboratórios de Microbiologia/Fitopatologia/Genética e de Cultivo/Isolamento da Universidade do Estado do Amapá/UEAP, em Macapá, Amapá. Em um Delineamento Inteiramente Casualizado (DIC, seis tratamentos e seis repetições foram organizados: T1 (controle negativo – BDA (Batata-Dextrose-Ágar + 0 mg.mL-1 (extrato foliar; T2 - BDA + 5 mg.mL-1 (extrato foliar; T3 - BDA + 10 mg.mL-1 (extrato foliar; T4 - BDA + 20 mg.mL-1 (extrato foliar; T5 - BDA + 2,5 mL de etanol e T6 (controle positivo - BDA + 2,5 mL de fungicida comercial (Derosal®. As variáveis inibição do crescimento micelial (ICM, índice de velocidade de crescimento micelial (IVCM e área abaixo da curva de cobertura de crescimento micelial (AACCM foram calculadas ao final do experimento. Os resultados mostraram que o extrato bruto etanólico das folhas de G. arboreum não apresentou atividade antifúngica in vitro frente ao fungo L. theobromae nas concentrações testadas. O extrato induziu o crescimento micelial do fungo, especialmente na concentração 10 mg.mL-1, a qual apresentou condição ideal para o desenvolvimento das estruturas do fungo. Palavras-chave: Malvaceae, extrato vegetal, controle biológico, fitopatógeno.

  2. High-Resolution Transcript Profiling of the Atypical Biotrophic Interaction between Theobroma cacao and the Fungal Pathogen Moniliophthora perniciosa[C][W][OPEN

    Science.gov (United States)

    Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães

    2014-01-01

    Witches’ broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen’s transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. PMID:25371547

  3. Characterization of necrosis and ethylene-inducing proteins (NEP) in the basidiomycete Moniliophthora perniciosa, the causal agent of witches' broom in Theobroma cacao.

    Science.gov (United States)

    Garcia, Odalys; Macedo, Joci A N; Tibúrcio, Ricardo; Zaparoli, Gustavo; Rincones, Johana; Bittencourt, Livia M C; Ceita, Geruza O; Micheli, Fabienne; Gesteira, Abelmon; Mariano, Andréa C; Schiavinato, Marlene A; Medrano, Francisco J; Meinhardt, Lyndel W; Pereira, Gonçalo A G; Cascardo, Júlio C M

    2007-04-01

    The hemibiotrophic basidiomycete Moniliophthora perniciosa causes witches' broom disease of Theobroma cacao. Analysis of the M. perniciosa draft genome led to the identification of three putative genes encoding necrosis and ethylene-inducing proteins (MpNEPs), which are apparently located on the same chromosome. MpNEP1 and 2 have highly similar sequences and are able to induce necrosis and ethylene emission in tobacco and cacao leaves. MpNEP1 is expressed in both biotrophic and saprotrophic mycelia, the protein behaves as an oligomer in solution and is very sensitive to temperature. MpNEP2 is expressed mainly in biotrophic mycelia, is present as a monomer in solution at low concentrations (<40 microM) and is able to recover necrosis activity after boiling. These differences indicate that similar NEPs can have distinct physical characteristics and suggest possible complementary roles during the disease development for both proteins. This is the first report of NEP1-like proteins in a basidiomycete.

  4. The causal agents of witches' broom and frosty pod rot of cacao (chocolate, Theobroma cacao) form a new lineage of Marasmiaceae.

    Science.gov (United States)

    Aime, M C; Phillips-Mora, W

    2005-01-01

    The two most devastating diseases of cacao (Theobroma cacao)--the source of chocolate--in tropical America are caused by the fungi Crinipellis perniciosa (witches' broom disease) and Moniliophthora roreri (frosty pod rot or moniliasis disease). Despite the agricultural, socio-economic and environmental impact of these fungi, most aspects of their life cycles are unknown, and the phylogenetic relationships of M. roreri have yet to be conclusively established. In this paper, extensive phylogenetic analyses of five nuclear gene regions (28S rDNA, 18S rDNA, ITS, RPB1, and EF1-alpha) confirm that C. perniciosa and M. roreri are sister taxa that belong in the Marasmiaceae (euagarics). Furthermore, these taxa form part of a separate and distinct lineage within the family. This lineage includes the biotrophic fungi Moniliophthora perniciosa comb. nov. and M. roreri, as well as one undescribed endophytic species. The sister genera to Moniliophthora are Marasmius, Crinipellis and Chaetocalathus, which consist mainly of saprotrophic litter fungi.

  5. Theobroma cacao extract attenuates the development of Dermatophagoides farinae-induced atopic dermatitis-like symptoms in NC/Nga mice.

    Science.gov (United States)

    Kang, Heerim; Lee, Chang Hyung; Kim, Jong Rhan; Kwon, Jung Yeon; Son, Myoung-Jin; Kim, Jong-Eun; Lee, Ki Won

    2017-02-01

    Cacao beans from Theobroma cacao are an abundant source of polyphenols, particularly flavonoids. Previous studies demonstrated that cacao flavanols decrease pro-inflammatory cytokines resulting in the alleviation of allergic symptoms. We sought to investigate the effects of cacao extract (CE) on Dermatophagoides farinae extract (DFE)-induced atopic dermatitis (AD)-like symptoms. CE attenuated DFE-induced AD-like symptoms as assessed by skin lesion analyses, dermatitis score, and skin thickness. Histopathological analysis revealed that CE suppressed DFE-induced immune cell infiltration into the skin. These observations occurred concomitantly with the downregulation of inflammatory markers including serum immunoglobulin (Ig) E, chemokine; thymus and activation-regulated chemokine and macrophage-derived chemokine as well as the skin-derived cytokines interleukin (IL)-4, IL-5, and interferon-γ. CE also significantly alleviated transepidermal water loss and increased skin hydration. These results suggest that CE, a natural phytochemical-rich food, has potential therapeutic efficacy for the treatment of AD. Copyright © 2016. Published by Elsevier Ltd.

  6. [Effect of mixed edaphic bacterial inoculants in the early development of improved cocoa cultivars (Theobroma cacao L.) in a traditional agroforestry system of Oaxaca, Mexico].

    Science.gov (United States)

    Hipólito-Romero, E; Carcaño-Montiel, M G; Ramos-Prado, J M; Vázquez-Cabañas, E A; López-Reyes, L; Ricaño-Rodríguez, J

    Cocoa plant (Theobroma cacao L.) is native from South America and it represents one of the most significant "bio-cultural" resources of Mesoamerica, since it is a region where it was domesticated and had a relevance as ritual drink and as currency in many pre-hispanic cultures until the arrival of the Spaniards who spread its use worldwide, and became it one of the most consumed commodity goods. Through this research, an alternative is proposed to address the problem of cultivars through the introduction of a wide variety of cocoa plants in traditional agroforestry systems, in synergy with the inoculation of nitrogen-fixing and insoluble phosphor solubilizing edaphic bacterial consortia. Four cultivars of improved grafted cocoa plants were introduced in a traditional agroforestry plot and three fertilization treatments were applied: application of biofertilizer, application of chemical fertilizer and control. Measurements of height, stem diameter, number of leaves and branches were recorded at 2 and 12 months after planting and rhizosphere microbial populations were characterized. Growth results showed good potential for all studied cultivars and it was observed that biofertilization foresees significant effects in some of the growth indicators of cocoa plant. Thereby, plant associations in an agroforestry system could be favorable to promote fruit development and resistance to pests and diseases. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  7. Effect of Organic and Conventional Fertilization on the Growth and Production of Theobroma Cacao L. Under an Agroforestry System in Rivera (Huila, Colombia

    Directory of Open Access Journals (Sweden)

    Faver Álvarez Carrillo

    2015-07-01

    Full Text Available The impact of organic fertilizing schemes on the cocoa (Theobroma cacao L. growth and production under agroforestry systems (AFS has been scarcely studied. In this sense, in Rivera (Huila-Colombia, the effect of different management strategies for amendment application in cocoa under agroforestry systems was evaluated. Four treatments were considered: i conventional fertilizing or farmer fertilizing (chemical, T1; ii Potassium sulfate (chemical, T2; iii eco-cocoa + Super 4 (ECO-S4 (organical, T3; and iv the mixture of among the treatments with potassium sulfate + eco-cocoa (SP-ECO (chemical + organical, T4. Variance analysis, Fisher test (p<0.05 and principal components analysis (PCA were used for data comparisons. For the height of cocoa plants, there was an average increase of 22.5 cm, while for stem diameter was 4.71 cm, with significant differences between the treatments. In general, an effect of the fertilizing scheme on the agronomic parameters of cocoa evaluated was found —especially for some important variables such as number of grains per pod and average weight of the grain—. There were similar parameters between the chemical and the organic treatments. This demonstrates that organic schemes of fertilizing could be an important alternative for improving cocoa production.

  8. High incidence of preharvest colonization of huanglongbing-symptomatic citrus sinensis fruit by Lasiodiplodia theobromae (Diplodia natalensis) and exacerbation of postharvest fruit decay by that fungus.

    Science.gov (United States)

    Zhao, Wei; Bai, Jinhe; McCollum, Greg; Baldwin, Elizabeth

    2015-01-01

    Huanglongbing (HLB), presumably caused by the bacterium "Candidatus Liberibacter asiaticus," is a devastating citrus disease associated with excessive preharvest fruit drop. Lasiodiplodia theobromae (diplodia) is the causal organism of citrus stem end rot (SER). The pathogen infects citrus fruit under the calyx abscission zone (AZ-C) and is associated with cell wall hydrolytic enzymes similar to plant enzymes involved in abscission. By means of DNA sequencing, diplodia was found in "Ca. Liberibacter asiaticus"-positive juice from HLB-symptomatic fruit (S) but not in "Ca. Liberibacter asiaticus"-negative juice. Therefore, the incidence of diplodia in fruit tissues, the impact on HLB-related postharvest decay, and the implications for HLB-related preharvest fruit drop were investigated in Hamlin and Valencia oranges. Quantitative PCR results (qPCR) revealed a significantly (P production (R = -0.838 for Hamlin; R = -0.858 for Valencia) in S fruit, and positively correlated with fruit detachment force (R = 0.855 for Hamlin; R = 0.850 for Valencia), suggesting that diplodia colonization in AZ-C may exacerbate HLB-associated preharvest fruit drop. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  9. Protective activity of Theobroma cacao L. phenolic extract on AML12 and MLP29 liver cells by preventing apoptosis and inducing autophagy.

    Science.gov (United States)

    Arlorio, Marco; Bottini, Consuelo; Travaglia, Fabiano; Locatelli, Monica; Bordiga, Matteo; Coïsson, Jean Daniel; Martelli, Aldo; Tessitore, Luciana

    2009-11-25

    Theobroma cacao L. is known to have potential cardiovascular and cancer chemopreventive activities because of its high content of phenolic phytochemicals and their antioxidant capacities. In this work, we show for the first time that cocoa inhibits drug-triggered liver cytotoxicity by inducing autophagy. Phenolic-rich extracts of both unroasted and roasted cocoa prevented Celecoxib-induced cell viability inhibition in MLP29 liver cells because of the accumulation of G1 cells and cell death. Death prevented by cocoa had hallmarks of apoptosis such as the sub-G1 peak at flow cytometry and activation of Bax expression, together with down-regulation of Bcl-2, released cytochrome c in the cytosol with activation of Caspase 3, indicating that components of the apoptotic pathway such as Bax or upstream are major targets of cocoa phytochemicals. The protective effect of cocoa against liver cytotoxicity by Celecoxib was probably accounted for by inducing the autophagic process, as shown by enhanced Beclin 1 expression and accumulation of monodansylcadaverine in autolysosomes. This fact suggests that apoptosis was prevented by inducing autophagy. Finally, considering all these findings, we suggest that cocoa can be added to the list of natural chemopreventive agents whose potential in hepatopathy prevention and therapy should be evaluated.

  10. Influence of freezable/non-freezable water and sucrose on the viability of Theobroma cacao somatic embryos following desiccation and freezing.

    Science.gov (United States)

    Fang, Jong-Yi; Sacandé, Moctar; Pritchard, Hugh; Wetten, Andy

    2009-06-01

    Encapsulated cocoa (Theobroma cacao L.) somatic embryos subjected to 0.08-1.25 M sucrose treatments were analyzed for embryo soluble sugar content, non-freezable water content, moisture level after desiccation and viability after desiccation and freezing. Results indicated that the higher the sucrose concentration in the treatment medium, the greater was the extent of sucrose accumulation in the embryos. Sucrose treatment greatly assisted embryo post-desiccation recovery since only 40% of the control embryos survived desiccation, whereas a survival rate of 60-95% was recorded for embryos exposed to 0.5-1.25 M sucrose. The non-freezable water content of the embryos was estimated at between 0.26 and 0.61 g H(2)O g(-1)dw depending on the sucrose treatment, and no obvious relationship could be found between the endogenous sucrose level and the amount of non-freezable water in the embryos. Cocoa somatic embryos could withstand the loss of a fraction of their non-freezable water without losing viability following desiccation. Nevertheless, the complete removal of potentially freezable water was not sufficient for most embryos to survive freezing.

  11. Over-expression of a cacao class I chitinase gene in Theobroma cacao L. enhances resistance against the pathogen, Colletotrichum gloeosporioides.

    Science.gov (United States)

    Maximova, Siela N; Marelli, Jean-Philippe; Young, Ann; Pishak, Sharon; Verica, Joseph A; Guiltinan, Mark J

    2006-09-01

    Theobroma cacao L. plants over-expressing a cacao class I chitinase gene (TcChi1) under the control of a modified CaMV-35S promoter were obtained by Agrobacterium-mediated transformation of somatic embryo cotyledons. Southern blot analysis confirmed insertion of the transgene in eight independent lines. High levels of TcChi1 transgene expression in the transgenic lines were confirmed by northern blot analysis. Chitinase activity levels were measured using an in vitro fluorometric assay. The transgene was expressed at varying levels in the different transgenic lines with up to a sixfold increase of endochitinase activity compared to non-transgenic and transgenic control plants. The in vivo antifungal activity of the transgene against the foliar pathogen Colletotrichum gloeosporioides was evaluated using a cacao leaf disk bioassay. The assay demonstrated that the TcChi1 transgenic cacao leaves significantly inhibited the growth of the fungus and the development of leaf necrosis compared to controls when leaves were wound inoculated with 5,000 spores. These results demonstrate for the first time the utility of the cacao transformation system as a tool for gene functional analysis and the potential utility of the cacao chitinase gene for increasing fungal pathogen resistance in cacao.

  12. Evaluación de 2 dietas experimentales con diferentes niveles de cascarilla de cacao (theobroma cacao l.) en las fases de crecimiento y acabado de cuyes (cavia porcellus l.) de raza andina

    OpenAIRE

    Murillo Crespo, Iveth Geomara

    2008-01-01

    El Ecuador ha sido tradicionalmente uno de los países mayores productores de cacao fino y de aroma. Esta actividad agrícola tuvo una historia relevante en la economía nacional, debido a la generación de fuente de divisas y trabajo para nuestro país por el lapso de varias décadas. Esto ha permitido la implementación y desarrollo de empresas agroindustriales en nuestro país, donde se procesa el cacao (Theobroma cacao L.) hasta obtener semielaborados y otros productos a base de choco...

  13. Préférences alimentaires de Sahlbergella singularis Hagl. (Hemiptera: Miridae vis-à-vis de quelques clones de cacaoyers (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Amang, J.

    2005-01-01

    Full Text Available Feeding Preferences of Sahlbergella singularis Hagl. (Hemiptera: Miridae to some Cocoa (Theobroma cacao L. Clones. The selection of cocoa clones, resistant to Sahlbergella singularis Hagl. was done in the laboratory according to the standardized method of indoor microtests based on the study of mirid feeding preferences. Fourteen cocoa clones were involved. The Sca6 clone was the control. An index (i which expresses the ratio of the number of stings on the clone to that obtained on the control was calculated for each cultivar. Which has enabled to quantify the levels of attractiveness of cocoa clones to S. singularis and to classify these clones in three groups: less attractive clones (i< 1, non different (i= 1 and more attractive (i> 1. The results obtained showed that the mean numbers of feeding stings on the control (tr ranged from 5.49 to 5.62 (5.49≤ tr≤ 5.62 and that obtained on the other clones (tc from 5.29 to 6.18 (5.29≤ tc ≤ 6.18. The Na33 clone had the highest stings mean number (6.18 and IFC 100 the lowest one (5.29. The High Amazonian clone Na33 was the most attractive and the clones ICS100, IFC100, (exotic trinitario, Sca12 (catongo and Na32 (High Amazonian were less attractive. On the other hand the clones IFC1363, IFC1362, IFC1374 (catongo, UPA337, T60/887, ICS1 and IMC60 (High Amazonians and ICS95 (exotic trinitario were non different. The reactivity seemed not depending on the origin of the clone. Save the High Amazonian clone Na33 which was the most attractive there were among non different and less attractive clones as well exotic trinitario, catongo as High Amazonians.

  14. Colletotrichum gloeosporioides s.l. associated with Theobroma cacao and other plants in Panama: multilocus phylogenies distinguish host-associated pathogens from asymptomatic endophytes.

    Science.gov (United States)

    Rojas, Enith I; Rehner, Stephen A; Samuels, Gary J; Van Bael, Sunshine A; Herre, Edward A; Cannon, Paul; Chen, Rui; Pang, Junfeng; Wang, Ruiwu; Zhang, Yaping; Peng, Yan-Qiong; Sha, Tao

    2010-01-01

    Colletotrichum interacts with numerous plant species overtly as symptomatic pathogens and cryptically as asymptomatic endophytes. It is not known whether these contrasting ecological modes are optional strategies expressed by individual Colletotrichum species or whether a species' ecology is explicitly pathogenic or endophytic. We explored this question by inferring relationships among 77 C. gloeosporioides s.l. strains isolated from asymptomatic leaves and from anthracnose lesions on leaves and fruits of Theobroma cacao (cacao) and other plants from Panamá. ITS and 5'-tef1 were used to assess diversity and to delineate operational taxonomic units for multilocus phylogenetic analysis. The ITS and 5'-tef1 screens concordantly resolved four strongly supported lineages, clades A-D: Clade A includes the ex type of C. gloeosporioides, clade B includes the ex type ITS sequence of C. boninense, and clades C and D are unidentified. The ITS yielded limited resolution and support within all clades, in particular the C. gloeosporioides clade (A), the focal lineage dealt with in this study. In contrast the 5'-tef1 screen differentiated nine distinctive haplotype subgroups within the C. gloeosporioides clade that were concordant with phylogenetic terminals resolved in a five-locus nuclear phylogeny. Among these were two phylogenetic species associated with symptomatic infections specific to either cacao or mango and five phylogenetic species isolated principally as asymptomatic infections from cacao and other plant hosts. We formally describe two new species, C. tropicale and C. ignotum, that are frequent asymptomatic associates of cacao and other Neotropical plant species, and epitypify C. theobromicola, which is associated with foliar and fruit anthracnose lesions of cacao. Asymptomatic Colletotrichum strains isolated from cacao plants grown in China included six distinct C. gloeosporioides clade taxa, only one of which is known to occur in the Neotropics.

  15. The Theobroma cacao B3 domain transcription factor TcLEC2 plays a duel role in control of embryo development and maturation.

    Science.gov (United States)

    Zhang, Yufan; Clemens, Adam; Maximova, Siela N; Guiltinan, Mark J

    2014-04-24

    The Arabidopsis thaliana LEC2 gene encodes a B3 domain transcription factor, which plays critical roles during both zygotic and somatic embryogenesis. LEC2 exerts significant impacts on determining embryogenic potential and various metabolic processes through a complicated genetic regulatory network. An ortholog of the Arabidopsis Leafy Cotyledon 2 gene (AtLEC2) was characterized in Theobroma cacao (TcLEC2). TcLEC2 encodes a B3 domain transcription factor preferentially expressed during early and late zygotic embryo development. The expression of TcLEC2 was higher in dedifferentiated cells competent for somatic embryogenesis (embryogenic calli), compared to non-embryogenic calli. Transient overexpression of TcLEC2 in immature zygotic embryos resulted in changes in gene expression profiles and fatty acid composition. Ectopic expression of TcLEC2 in cacao leaves changed the expression levels of several seed related genes. The overexpression of TcLEC2 in cacao explants greatly increased the frequency of regeneration of stably transformed somatic embryos. TcLEC2 overexpressing cotyledon explants exhibited a very high level of embryogenic competency and when cultured on hormone free medium, exhibited an iterative embryogenic chain-reaction. Our study revealed essential roles of TcLEC2 during both zygotic and somatic embryo development. Collectively, our evidence supports the conclusion that TcLEC2 is a functional ortholog of AtLEC2 and that it is involved in similar genetic regulatory networks during cacao somatic embryogenesis. To our knowledge, this is the first detailed report of the functional analysis of a LEC2 ortholog in a species other then Arabidopsis. TcLEC2 could potentially be used as a biomarker for the improvement of the SE process and screen for elite varieties in cacao germplasm.

  16. Theobroma cacao increases cells viability and reduces IL-6 and sVCAM-1 level in endothelial cells induced by plasma from preeclamptic patients.

    Science.gov (United States)

    Rahayu, Budi; Baktiyani, Siti Candra Windu; Nurdiana, Nurdiana

    2016-01-01

    This study aims to investigate whether an ethanolic extract of Theobroma cacao bean is able to increase cell viability and decrease IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Endothelial cells were obtained from human umbilical vascular endothelial cells. At confluency, endothelial cells were divided into six groups, which included control (untreated), endothelial cells exposed to plasma from normal pregnancy, endothelial cells exposed to 2% plasma from preeclamptic patients (PP), endothelial cells exposed to PP in the presence of ethanolic extract of T. cacao (PP+TC) at the following three doses: 25, 50, and 100 ppm. The analysis was performed in silico using the Hex 8.0, LigPlus and LigandScout 3.1 software. Analysis on IL-6 and sVCAM-1 levels were done by enzyme linked immunosorbent assay (ELISA). We found that seven of them could bind to the protein NFκB (catechin, leucoanthocyanidin, niacin, phenylethylamine, theobromine, theophylline, and thiamin). This increase in IL-6 was significantly (Pcacao extract. Plasma from PP significantly increased sVCAM-1 levels compared to untreated cells. This increase in sVCAM-1 was significantly attenuated by all doses of the extract. In conclusion, T. cacao extract prohibits the increase in IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Therefore this may provide a herbal therapy for attenuating the endothelial dysfunction found in preeclampsia. Copyright © 2016 International Society for the Study of Hypertension in Pregnancy. Published by Elsevier B.V. All rights reserved.

  17. Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao.

    Science.gov (United States)

    Liu, Yi; Shi, Zi; Maximova, Siela N; Payne, Mark J; Guiltinan, Mark J

    2015-06-25

    The flavan-3-ols catechin and epicatechin, and their polymerized oligomers, the proanthocyanidins (PAs, also called condensed tannins), accumulate to levels of up to 15 % of the total weight of dry seeds of Theobroma cacao L. These compounds have been associated with several health benefits in humans. They also play important roles in pest and disease defense throughout the plant. In Arabidopsis, the R2R3 type MYB transcription factor TT2 regulates the major genes leading to the synthesis of PA. To explore the transcriptional regulation of the PA synthesis pathway in cacao, we isolated and characterized an R2R3 type MYB transcription factor MYBPA from cacao. We examined the spatial and temporal gene expression patterns of the Tc-MYBPA gene and found it to be developmentally expressed in a manner consistent with its involvement in PAs and anthocyanin synthesis. Functional complementation of an Arabidopsis tt2 mutant with Tc-MYBPA suggested that it can functionally substitute the Arabidopsis TT2 gene. Interestingly, in addition to PA accumulation in seeds of the Tc-MYBPA expressing plants, we also observed an obvious increase of anthocyanidin accumulation in hypocotyls. We observed that overexpression of the Tc-MYBPA gene resulted in increased expression of several key genes encoding the major structural enzymes of the PA and anthocyanidin pathway, including DFR (dihydroflavanol reductase), LDOX (leucoanthocyanidin dioxygenase) and BAN (ANR, anthocyanidin reductase). We conclude that the Tc-MYBPA gene that encodes an R2R3 type MYB transcription factor is an Arabidopsis TT2 like transcription factor, and may be involved in the regulation of both anthocyanin and PA synthesis in cacao. This research may provide molecular tools for breeding of cacao varieties with improved disease resistance and enhanced flavonoid profiles for nutritional and pharmaceutical applications.

  18. Present spatial diversity patterns of Theobroma cacao L. in the neotropics reflect genetic differentiation in pleistocene refugia followed by human-influenced dispersal.

    Science.gov (United States)

    Thomas, Evert; van Zonneveld, Maarten; Loo, Judy; Hodgkin, Toby; Galluzzi, Gea; van Etten, Jacob

    2012-01-01

    Cacao (Theobroma cacao L.) is indigenous to the Amazon basin, but is generally believed to have been domesticated in Mesoamerica for the production of chocolate beverage. However, cacao's distribution of genetic diversity in South America is also likely to reflect pre-Columbian human influences that were superimposed on natural processes of genetic differentiation. Here we present the results of a spatial analysis of the intra-specific diversity of cacao in Latin America, drawing on a dataset of 939 cacao trees genotypically characterized by means of 96 SSR markers. To assess continental diversity patterns we performed grid-based calculations of allelic richness, Shannon diversity and Nei gene diversity, and distinguished different spatially coherent genetic groups by means of cluster analysis. The highest levels of genetic diversity were observed in the Upper Amazon areas from southern Peru to the Ecuadorian Amazon and the border areas between Colombia, Peru and Brazil. On the assumption that the last glaciation (22,000-13,000 BP) had the greatest pre-human impact on the current distribution and diversity of cacao, we modeled the species' Pleistocene niche suitability and overlaid this with present-day diversity maps. The results suggest that cacao was already widely distributed in the Western Amazon before the onset of glaciation. During glaciations, cacao populations were likely to have been restricted to several refugia where they probably underwent genetic differentiation, resulting in a number of genetic clusters which are representative for, or closest related to, the original wild cacao populations. The analyses also suggested that genetic differentiation and geographical distribution of a number of other clusters seem to have been significantly affected by processes of human management and accompanying genetic bottlenecks. We discuss the implications of these results for future germplasm collection and in situ, on farm and ex situ conservation of cacao.

  19. Present spatial diversity patterns of Theobroma cacao L. in the neotropics reflect genetic differentiation in pleistocene refugia followed by human-influenced dispersal.

    Directory of Open Access Journals (Sweden)

    Evert Thomas

    Full Text Available Cacao (Theobroma cacao L. is indigenous to the Amazon basin, but is generally believed to have been domesticated in Mesoamerica for the production of chocolate beverage. However, cacao's distribution of genetic diversity in South America is also likely to reflect pre-Columbian human influences that were superimposed on natural processes of genetic differentiation. Here we present the results of a spatial analysis of the intra-specific diversity of cacao in Latin America, drawing on a dataset of 939 cacao trees genotypically characterized by means of 96 SSR markers. To assess continental diversity patterns we performed grid-based calculations of allelic richness, Shannon diversity and Nei gene diversity, and distinguished different spatially coherent genetic groups by means of cluster analysis. The highest levels of genetic diversity were observed in the Upper Amazon areas from southern Peru to the Ecuadorian Amazon and the border areas between Colombia, Peru and Brazil. On the assumption that the last glaciation (22,000-13,000 BP had the greatest pre-human impact on the current distribution and diversity of cacao, we modeled the species' Pleistocene niche suitability and overlaid this with present-day diversity maps. The results suggest that cacao was already widely distributed in the Western Amazon before the onset of glaciation. During glaciations, cacao populations were likely to have been restricted to several refugia where they probably underwent genetic differentiation, resulting in a number of genetic clusters which are representative for, or closest related to, the original wild cacao populations. The analyses also suggested that genetic differentiation and geographical distribution of a number of other clusters seem to have been significantly affected by processes of human management and accompanying genetic bottlenecks. We discuss the implications of these results for future germplasm collection and in situ, on farm and ex situ

  20. Efecto de las cepas nativas Paecilomyces sp. (Bainier y Lecanicillium sp. (Zimm en el control de Carmenta foraseminis Eichlin (Lepidoptera: Sesiidae en cultivos de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Wilmer Figueroa Medina

    2013-07-01

    Full Text Available El pasador del fruto, Carmenta foraseminis Eichlin, es un insecto que ha acentuado su ataque en cultivos de cacao (Theobroma cacao L. en los últimos años en Norte de Santander (Colombia. El objetivo de este estudio fue evaluar la patogenicidad de las cepas nativas Giav-3 Paecilomyces sp. y Giav-4 Lecanicillium sp. sobre larvas de C. foraseminis. Para el efecto, se realizaron aislamientos a partir de muestras de suelo recolectadas en el municipio de Tibú, Norte de Santander. Después de obtenidos los cultivos puros se procedió a la caracterización macroscópica y microscópica para la identificación del género de los aislados mediante claves taxonómicas. La infección fue realizada mediante inmersión de larvas en las suspensiones de los aislados en concentraciones de 0, 10(6, 10(7 y 10(8 conidios/ml. En ambos aislados se observó una tendencia lineal respecto a la mortalidad, la cual fue directamente proporcional a las concentraciones del inóculo. La CL50 y CL90 para Giav-3 fue de 10(6.95 y 10(8.70 conidios/ml y para Giav-4 de 10(6.6 y 10(8.04 conidios/ml, respectivamente. Lo cual indica que esta última requirió la menor concentración de inóculo para eliminar el 50% y 90% de la población tratada, lo que supone una mayor efectividad contra las larvas.

  1. Selección de genotipos de cacao (Theobroma cacao L. con resistencia a escoba de bruja (Moniliophthora perniciosa en Los Ríos, Ecuador

    Directory of Open Access Journals (Sweden)

    Omar Miguel Tarqui Freire

    2017-07-01

    Full Text Available El Programa de Mejoramiento del Cacao y el Café en el INIAP EET-Pichilingue ha estado estudiando, durante varios años, los genotipos de cacao más altos (Theobroma cacao L. caracterizados por la resistencia genética a las principales enfermedades, especialmente la escoba de brujas (Moniliophthora perniciosa Factor limitante para su cultivo en varios países de América Central y del Sur. El objetivo de la investigación fue identificar y seleccionar los clones de cacao con una baja incidencia de la enfermedad de la escoba de brujas. Se probaron 21 genotipos (14 resultantes de Amazonas x Amazonas y (4 de Amazonas x Cruces Nacionales. Entre la población derivada de cruces nacionales vs. nacionales, no se encontraron genotipos mostrando resistencia a la enfermedad. Además, se seleccionó INIAPT 074 del cruce entre CCN 51 x B 60 y TIP 1 y TAP 6 como clones de control. Se evaluaron las siguientes características: Número de mazorcas sanas (MS, Peso fresco (PF, Número de mazorcas enfermas (ME, Número de escobas vegetativas (EBveg, Número de escobas portadoras (EBcojin y Número de chirimoyas. Un análisis de componentes principales y un análisis de conglomerados se realizaron utilizando el método de Ward y se construyó un dendrograma para determinar la similitud entre las características productivas y sanitarias. Se determinó que los genotipos resultantes del cruce amazónico x amazónico: INIAPT 527, INIAPT 560 e INIAPT 526 presentaron menor incidencia de escobas y se identificaron como fuentes de resistencia genética a Moniliophthora perniciosa.

  2. Evaluación sensorial de cacao (Theobroma cacao L. cultivado en la región del sur del departamento de Bolívar (Colombia

    Directory of Open Access Journals (Sweden)

    Johana Andrea Guzmán Duque

    2014-12-01

    Full Text Available El departamento de Bolívar (Colombia presenta condiciones aptas tanto agrícolas como culturales para el desarrollo productivo de cacao de fino aroma. Esta actividad ofrece una oportunidad conveniente para su desarrollo sostenible, económico y de proyección social. La presente investigación evaluó las características sensoriales del cacao Theobroma cacao L. en seis municipios del sur de Bolívar para determinar atributos propios y diferencias significativas entre estas regiones; para esto se realizó un muestreo de granos secos y mazorcas de cacao, de los clones más representativos de cada municipio. El proceso se llevó a cabo con 18 jueces capacitados para detectar, describir y discriminar propiedades  sensoriales en el cacao, quienes evaluaron las muestras a través de cuatro pruebas sensoriales específicas diseñadas para realizar la caracterización organoléptica del cacao de Bolívar, seleccionando para este fin las pruebas descriptivas de perfil de sabor y análisis cuantitativo y las pruebas discriminativas de ordenamiento y escalar de control. El análisis físico y sensorial del grano reveló la correlación entre las condiciones agroecológicas y tecnológicas (especialmente aquellos que tienen que ver con las operaciones de fermentación y/o beneficio con las cualidades sensoriales que éste posee en sus atributos de sabor y aroma.

  3. Evaluación del potencial biofertilizante de bacterias diazótrofas aisladas de suelos con cultivo de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Adriana Zulay Argüello-Navarro

    2014-09-01

    Full Text Available La adaptabilidad del cacao (Theobroma cacao L. en condiciones adversas permite sugerir que la microbiota asociada con la rizosfera desempeña una función importante para la nutrición y el desarrollo de la planta. En el trabajo se evaluó el potencial biofertilizante de bacterias fijadoras de nitrógeno (diazótrofas aisladas de suelos cacaoteros por la técnica de diluciones seriadas. Las bacterias se aislaron en medios semiselectivos (NFb, JMV, LGI, JNFb. Los aislados puros se caracterizaron morfológica y bioquímicamente y complementariamente se evaluó la capacidad de fijación biológica de nitrógeno (FBN por el método de Micro-Kjeldahl. Los aislados con mejor capacidad de fijación de nitrógeno fueron seleccionados para evaluar su potencial promotor de crecimiento durante 120 días en plantas de cacao clon CCN 51 establecidas a partir de semillas. El análisis de datos mostró que las plantas de cacao respondieron efectivamente a los tratamientos con bacterias donde las variables de crecimiento y N (% foliar incrementaron significativamente, en comparación con el testigo. Se destacó el aporte de los aislados DKA2J24, DKB3J73 presuntamente del género Burkholderia sp. y DKA1L3 semejante al género Gluconacetobacter sp., todos con un gran potencial como biofertilizantes en la prueba de bioensayo.

  4. Chemical, physico-chemical and sensory characterization of mixed açai (Euterpe oleracea and cocoa´s honey (Theobroma cacao jellies

    Directory of Open Access Journals (Sweden)

    Biano Alves de Melo Neto

    2013-06-01

    Full Text Available Four formulations of mixed açaí (Euterpe oleracea (A and cocoa´s honey (Theobroma cacao (CH jellies were prepared according to the following proportions: T1 (40% A:60% CH, T2 (50% A:50% CH, T3 (60% A: 40% CH and T4 (100% A - control. All formulations were prepared using a rate 60:40 (w/w of sucrose and pulp, plus 0.5% pectin and the products reached to average of 65% soluble solids content. The jellies were analyzed by chemical and physicochemical (titratable acidity, pH, soluble solid content, dry matter, total protein, lipids, vitamin C and calories and sensory characteristics; also were evaluated levels of P, K, Ca, Mg, Fe, Zn, Cu and Mn. It was used a hedonic scale of 7 points to evaluate the attributes: overall impression, spreadability, brightness, flavor, texture and color, and also was verified the purchase intention score. The titratable acidity and pH ranged from 0.46 to 0.64% and 3.35 to 3.64, respectively, that are within the range found at most fruit jellies. The soluble solids content ranged between 65.2 and 65.5 ºBrix. The sensory acceptance results showed that all treatments (T1, T2, T3 and T4 presented means of sensory attributes above 4, demonstrating good acceptance of the product, but the treatment T1 presented the higher scores for the evaluated attributes. Cocoa´s honey added a positive influence on the attributes of color, texture and spreadability.

  5. Variabilidad genética de Moniliophthora perniciosa (Stahel Aime y Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae en variedades de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Carolina Osorio-Solano

    2012-04-01

    Full Text Available Moniliophthora perniciosa, agente causante de la ‘escoba de bruja’ en cacao (Theobroma cacao, presenta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cercanas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos encaminados al manejo de este patógeno y el desarrollo de materiales resistentes de cacao. En este estudio se analizaron 12 aislamientos del hongo obtenidos de diferentes materiales de cacao. Cada una de las muestras se evaluó con marcadores moleculares que tienen como blanco una región del ADN ribosomal (ADNr nuclear conocida como ITS (Internal Transcribed Spacer, una región intergénica (IGS-1 y cinco secuencias simples repetidas (SSR. El marcador IGS-1 permitió la determinación del biotipo C, no obstante se encontró una variabilidad genética evidente dentro de este biotipo, aún no registrada. El análisis de la diversidad genética de M. perniciosa por medio de marcadores microsatélite arrojó un valor total de 0.4260, una heterocigosidad total de 0.6143 y un índice de información polimórfica (PIC de 0.3407, valores considerados de rango medio a alto para los aislamientos estudiados y que estiman la variabilidad genética presente en M. perniciosa.

  6. Understanding the genetic diversity, spatial genetic structure and mating system at the hierarchical levels of fruits and individuals of a continuous Theobroma cacao population from the Brazilian Amazon

    Science.gov (United States)

    Silva, C R S; Albuquerque, P S B; Ervedosa, F R; Mota, J W S; Figueira, A; Sebbenn, A M

    2011-01-01

    Understanding the mating patterns of populations of tree species is a key component of ex situ genetic conservation. In this study, we analysed the genetic diversity, spatial genetic structure (SGS) and mating system at the hierarchical levels of fruits and individuals as well as pollen dispersal patterns in a continuous population of Theobroma cacao in Pará State, Brazil. A total of 156 individuals in a 0.56 ha plot were mapped and genotyped for nine microsatellite loci. For the mating system analyses, 50 seeds were collected from nine seed trees by sampling five fruits per tree (10 seeds per fruit). Among the 156 individuals, 127 had unique multilocus genotypes, and the remaining were clones. The population was spatially aggregated; it demonstrated a significant SGS up to 15 m that could be attributed primarily to the presence of clones. However, the short seed dispersal distance also contributed to this pattern. Population matings occurred mainly via outcrossing, but selfing was observed in some seed trees, which indicated the presence of individual variation for self-incompatibility. The matings were also correlated, especially within (r̂p(m)=0.607) rather than among the fruits (r̂p(m)=0.099), which suggested that a small number of pollen donors fertilised each fruit. The paternity analysis suggested a high proportion of pollen migration (61.3%), although within the plot, most of the pollen dispersal encompassed short distances (28 m). The determination of these novel parameters provides the fundamental information required to establish long-term ex situ conservation strategies for this important tropical species. PMID:21139632

  7. DAMPAK APLIKASI INSEKTISIDA PERMETRIN TERHADAP HAMA PENGISAP BIJAIJ HELOPELTIS SPP. (HEMIPTERA: MIRIDAE DAN ARTROPODA NON-TARGET PADA PERTANAMAN KAKAO (THEOBROMA CACAO L.

    Directory of Open Access Journals (Sweden)

    Rosma Hasibuan

    2014-08-01

    Full Text Available Impact of Permethrin-Insecticide Application on Mirid Pest of Cocoa Helopeltis spp. (Hemiptera: Miridae and on Non-target  Arthropods in Cocoa Plantations (Theobroma cacao L.. Cocoa mirid bugs, Helopeltis spp., (Hemiptera: Miridae are the most important pest of cocoa in Indonesia. A field study was conducted to investigate the effect of permethrin on cocoa mirids and non-target arthropods at a cocoa plantation in specific place. A randomized complete block design was used in which each of four blocks consisted of 5 treatments (4 concentrations of permethrin; 50; 100; 200; and 250 ppm and control. The results indicated that the application of permethrin significantly increased the cocoa mirids mortaliiy throughout all sprayed cocoa trees (up to 100% 72 h after application. Even at 1 h after application, the percentage of Cocoa mirids mortality 29.2% - 53.9% on cocoa trees sprayed with permethrin at concentrations of 50 - 250 ppm was significantly higher than that on control plant (3.6%. At 72 h after treatments, application of permethrin at concentrations of 200 and 250 ppm caused a complete kill (mortalty of 100% in the test mirids. Meanwhile, ground cloths caught at least 22 fanilies of abore-ground arthropods that were found killed by permethrin applications. Moreover, the number of non-target arthropods killed by permethrin at concentrations of 100 - 250 ppm (27.3 - 85.3 individuals/ground cloth were signifcantly higher than that on control trees. These results demonstrated that despite high efficacy of permethrin in controlling of cocoa mirids (Hetopeltis spp., its application also had adverse effects on non-target arthropods incocoa plantations.

  8. Variabilidad genética de Moniliophthora perniciosa (Stahel Aime y Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae en variedades de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Osorio Solano Carolina

    2012-11-01

    Full Text Available

    Moniliophthora perniciosa, agente causante de la 'escoba de bruja' en cacao (Theobroma cacao, presen- ta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cer- canas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos encaminados al manejo de este patógeno y el desarrollo de materiales resistentes de cacao. En este estudio se analizaron 12 aislamientos del hongo obtenidos de diferentes materiales de cacao. Cada una de las muestras se evaluó con marcadores moleculares que tienen como blanco una región del ADN ribosomal (ADNr nuclear conocida como ITS (Internal Trans- cribed Spacer, una región intergénica (IGS-1 y cinco secuencias simples repetidas (SSR. El marcador IGS-1 permitió la determinación del biotipo C, no obstante se encontró una variabilidad genética evi- dente dentro de este biotipo, aún no registrada. El análisis de la diversidad genética de M. perniciosa por medio de marcadores microsatélite arrojó un valor total de 0.4260, una heterocigosidad total de

    0.6143 y un Indice de información polimórfica (PIC de 0.3407, valores considerados de rango medio a

    alto para los aislamientos estudiados y que estiman la variabilidad genética presente en M. perniciosa.

  9. Colombia a Source of Cacao Genetic Diversity As Revealed by the Population Structure Analysis of Germplasm Bank of Theobroma cacao L.

    Science.gov (United States)

    Osorio-Guarín, Jaime A; Berdugo-Cely, Jhon; Coronado, Roberto Antonio; Zapata, Yeny Patricia; Quintero, Constanza; Gallego-Sánchez, Gerardo; Yockteng, Roxana

    2017-01-01

    Beans of the species Theobroma cacao L., also known as cacao, are the raw material to produce chocolate. Colombian cacao has been classified as a fine flavor cacao that represents the 5% of cacao world's production. Colombian genetic resources from this species are conserved in ex situ and in-field germplasm banks, since T. cacao has recalcitrant seeds to desication and long-term storage. Currently, the collection of T. cacao of the Colombian Corporation of Agricultural Research (CORPOICA) has approximately 700 germplasm accessions. We conducted a molecular analysis of Corpoica's cacao collection and a morphological characterization of some accessions with the goal to study its genetic diversity and population structure and, to select interesting accessions for the cacao's breeding program. Phenotypic evaluation was performed based on 18 morphological traits and 4 biochemical traits. PCA analysis of morphological traits explained 60.6% of the total variation in seven components and 100% of the total variation of biochemical traits in four components, grouping the collection in 4 clusters for both variables. We explored 565 accessions from Corpoica's germplasm and 252 accessions from reference populations using 96 single nucleotide polymorphism (SNP) molecular markers. Molecular patterns of cacao Corpoica's collection were obtained amplifying specific alleles in a Fluidigm platform that used integrated circuits of fluids. Corpoica's collection showed highest genetic diversity [Expected Heterozygosity (HE = 0.314), Observed Heterozygosity (HO = 0.353)] that is reduced when reference populations were included in the dataset (HE = 0.294, HO = 0.261). The collection was divided into four clusters based on population structure analysis. Cacao accessions from distinct groups showed some taxonomic concordance and reflected their geographic origins. For instance, accessions classified as Criollo were clearly differentiated in one group and we identified two new Colombian

  10. Genome-wide analysis reveals divergent patterns of gene expression during zygotic and somatic embryo maturation of Theobroma cacao L., the chocolate tree.

    Science.gov (United States)

    Maximova, Siela N; Florez, Sergio; Shen, Xiangling; Niemenak, Nicolas; Zhang, Yufan; Curtis, Wayne; Guiltinan, Mark J

    2014-07-16

    Theobroma cacao L. is a tropical fruit tree, the seeds of which are used to create chocolate. In vitro somatic embryogenesis (SE) of cacao is a propagation system useful for rapid mass-multiplication to accelerate breeding programs and to provide plants directly to farmers. Two major limitations of cacao SE remain: the efficiency of embryo production is highly genotype dependent and the lack of full cotyledon development results in low embryo to plant conversion rates. With the goal to better understand SE development and to improve the efficiency of SE conversion we examined gene expression differences between zygotic and somatic embryos using a whole genome microarray. The expression of 28,752 genes was determined at 4 developmental time points during zygotic embryogenesis (ZE) and 2 time points during cacao somatic embryogenesis (SE). Within the ZE time course, 10,288 differentially expressed genes were enriched for functions related to responses to abiotic and biotic stimulus, metabolic and cellular processes. A comparison ZE and SE expression profiles identified 10,175 differentially expressed genes. Many TF genes, putatively involved in ethylene metabolism and response, were more strongly expressed in SEs as compared to ZEs. Expression levels of genes involved in fatty acid metabolism, flavonoid biosynthesis and seed storage protein genes were also differentially expressed in the two types of embryos. Large numbers of genes were differentially regulated during various stages of both ZE and SE development in cacao. The relatively higher expression of ethylene and flavonoid related genes during SE suggests that the developing tissues may be experiencing high levels of stress during SE maturation caused by the in vitro environment. The expression of genes involved in the synthesis of auxin, polyunsaturated fatty acids and secondary metabolites was higher in SEs relative to ZEs despite lack of lipid and metabolite accumulation. These differences in gene

  11. Colombia a Source of Cacao Genetic Diversity As Revealed by the Population Structure Analysis of Germplasm Bank of Theobroma cacao L.

    Science.gov (United States)

    Osorio-Guarín, Jaime A.; Berdugo-Cely, Jhon; Coronado, Roberto Antonio; Zapata, Yeny Patricia; Quintero, Constanza; Gallego-Sánchez, Gerardo; Yockteng, Roxana

    2017-01-01

    Beans of the species Theobroma cacao L., also known as cacao, are the raw material to produce chocolate. Colombian cacao has been classified as a fine flavor cacao that represents the 5% of cacao world’s production. Colombian genetic resources from this species are conserved in ex situ and in-field germplasm banks, since T. cacao has recalcitrant seeds to desication and long-term storage. Currently, the collection of T. cacao of the Colombian Corporation of Agricultural Research (CORPOICA) has approximately 700 germplasm accessions. We conducted a molecular analysis of Corpoica’s cacao collection and a morphological characterization of some accessions with the goal to study its genetic diversity and population structure and, to select interesting accessions for the cacao’s breeding program. Phenotypic evaluation was performed based on 18 morphological traits and 4 biochemical traits. PCA analysis of morphological traits explained 60.6% of the total variation in seven components and 100% of the total variation of biochemical traits in four components, grouping the collection in 4 clusters for both variables. We explored 565 accessions from Corpoica’s germplasm and 252 accessions from reference populations using 96 single nucleotide polymorphism (SNP) molecular markers. Molecular patterns of cacao Corpoica’s collection were obtained amplifying specific alleles in a Fluidigm platform that used integrated circuits of fluids. Corpoica’s collection showed highest genetic diversity [Expected Heterozygosity (HE = 0.314), Observed Heterozygosity (HO = 0.353)] that is reduced when reference populations were included in the dataset (HE = 0.294, HO = 0.261). The collection was divided into four clusters based on population structure analysis. Cacao accessions from distinct groups showed some taxonomic concordance and reflected their geographic origins. For instance, accessions classified as Criollo were clearly differentiated in one group and we identified two new

  12. The beneficial endophyte Trichoderma hamatum isolate DIS 219b promotes growth and delays the onset of the drought response in Theobroma cacao.

    Science.gov (United States)

    Bae, Hanhong; Sicher, Richard C; Kim, Moon S; Kim, Soo-Hyung; Strem, Mary D; Melnick, Rachel L; Bailey, Bryan A

    2009-01-01

    Theobroma cacao (cacao) is cultivated in tropical climates and is exposed to drought stress. The impact of the endophytic fungus Trichoderma hamatum isolate DIS 219b on cacao's response to drought was studied. Colonization by DIS 219b delayed drought-induced changes in stomatal conductance, net photosynthesis, and green fluorescence emissions. The altered expression of 19 expressed sequence tags (ESTs) (seven in leaves and 17 in roots with some overlap) by drought was detected using quantitative real-time reverse transcription PCR. Roots tended to respond earlier to drought than leaves, with the drought-induced changes in expression of seven ESTs being observed after 7 d of withholding water. Changes in gene expression in leaves were not observed until after 10 d of withholding water. DIS 219b colonization delayed the drought-altered expression of all seven ESTs responsive to drought in leaves by > or = 3 d, but had less influence on the expression pattern of the drought-responsive ESTs in roots. DIS 219b colonization had minimal direct influence on the expression of drought-responsive ESTs in 32-d-old seedlings. By contrast, DIS 219b colonization of 9-d-old seedlings altered expression of drought-responsive ESTs, sometimes in patterns opposite of that observed in response to drought. Drought induced an increase in the concentration of many amino acids in cacao leaves, while DIS 219b colonization caused a decrease in aspartic acid and glutamic acid concentrations and an increase in alanine and gamma-aminobutyric acid concentrations. With or without exposure to drought conditions, colonization by DIS 219b promoted seedling growth, the most consistent effects being an increase in root fresh weight, root dry weight, and root water content. Colonized seedlings were slower to wilt in response to drought as measured by a decrease in the leaf angle drop. The primary direct effect of DIS 219b colonization was promotion of root growth, regardless of water status, and an

  13. Improving Nutritional Quality of Cocoa Pod (Theobroma cacao) through Chemical and Biological Treatments for Ruminant Feeding: In vitro and In vivo Evaluation.

    Science.gov (United States)

    Laconi, Erika B; Jayanegara, Anuraga

    2015-03-01

    Cocoa pod is among the by-products of cocoa (Theobroma cacao) plantations. The aim of this study was to apply a number of treatments in order to improve nutritional quality of cocoa pod for feeding of ruminants. Cocoa pod was subjected to different treatments, i.e. C (cocoa pod without any treatment or control), CAm (cocoa pod+1.5% urea), CMo (cocoa pod+3% molasses), CRu (cocoa pod+3% rumen content) and CPh (cocoa pod+3% molasses+Phanerochaete chrysosporium inoculum). Analysis of proximate and Van Soest's fiber fraction were performed on the respective treatments. The pods were then subjected to an in vitro digestibility evaluation by incubation in rumen fluid-buffer medium, employing a randomized complete block design (n = 3 replicates). Further, an in vivo evaluation of the pods (35% inclusion level in total mixed ration) was conducted by feeding to young Holstein steers (average body weight of 145±3.6 kg) with a 5×5 latin square design arrangement (n = 5 replicates). Each experimental period lasted for 30 d; the first 20 d was for feed adaptation, the next 3 d was for sampling of rumen liquid, and the last 7 d was for measurements of digestibility and N balance. Results revealed that lignin content was reduced significantly when cocoa pod was treated with urea, molasses, rumen content or P. chrysosporium (pCAm>CRu>CMo. Among all treatments, CAm and CPh treatments significantly improved the in vitro dry matter and organic matter digestibility (p<0.05) of cocoa pod. Average daily gain of steers receiving CAm or CPh treatment was significantly higher than that of control (p<0.01) with an increase of 105% and 92%, respectively. Such higher daily gain was concomitant with higher N retention and proportion of N retention to N intake in CAm and CPh treatments than those of control (p<0.05). It can be concluded from this study that treatment with either urea or P. chrysosporium is effective in improving the nutritive value of cocoa pod.

  14. Population dynamics of epiphytic mycoparasites of the genera Clonostachys and Fusarium for the biocontrol of black pod (Phytophthora palmivora) and moniliasis (Moniliophthora roreri) on cocoa (Theobroma cacao).

    Science.gov (United States)

    Hoopen, G Martijn ten; Rees, Robert; Aisa, Philo; Stirrup, Tim; Krauss, Ulrike

    2003-05-01

    Mycoparasites collected from aerial parts of the cocoa plant (Theobroma cacao) have shown great promise in the control of black pod, caused by Phytophthora palmivora, and moniliasis, caused by Moniliophthora roreri. However, the ecology of epiphytic mycoparasites is still poorly understood although it has a direct bearing on applied biocontrol practices, ranging from the identification and isolation of promising biocontrol candidates to formulation needs and required application frequency. One objective of this study was to determine the natural abundance of mycoparasites on cocoa flowers and pods in relation to crop development stage and cultivar. For this purpose, native mycoparasites were detected on cocoa flowers and pods using the precolonised plate baiting technique. Furthermore, the survival of an applied Clonostachys rosea isolate on cocoa pods on shaded and non-shaded trees was compared as well as the recolonisation patterns of surface-sterilised pods by native mycoparasites under these conditions. Clonostachys spp. were the most commonly isolated native mycoparasites, followed by Fusarium spp. No differences in the occurrence of native, epiphytic mycoparasites were observed between the three main cocoa cultivars, 'Criollo', 'Forastero' and 'Trinitario', nor between clones within these groups. Thus, a single biocontrol inoculum can be suitable for application to cultivar mixtures of cocoa commonly grown together in a field. Different susceptibility classes of segregating F1 populations of hybrids with resistance against M. roreri and P. palmivora supported similar population levels and taxonomic assemblages of mycoparasites. Therefore, we reject the hypothesis that these antagonists mediate resistance. Mycoparasite abundance and genetic disease resistance to black pod and moniliasis are independent phenomena and should lead to additive effects if employed simultaneously in an integrated disease management programme. The survival of applied C. rosea was not

  15. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions.

    Science.gov (United States)

    Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire

    2008-10-30

    Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species.Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories.A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database.To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection.A large collection of new genetic markers was provided by this ESTs collection. This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high density gene map of T. cacao

  16. Variabilidad genética de Moniliophthora perniciosa (Stahel Aime y Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae en variedades de cacao (Theobroma cacao L. Genetic variability of Moniliophthora perniciosa (Stahel Aime & Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae in varieties of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Carolina Osorio-Solano

    2012-04-01

    Full Text Available Moniliophthora perniciosa, agente causante de la ‘escoba de bruja’ en cacao (Theobroma cacao, presenta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cercanas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos encaminados al manejo de este patógeno y el desarrollo de materiales resistentes de cacao. En este estudio se analizaron 12 aislamientos del hongo obtenidos de diferentes materiales de cacao. Cada una de las muestras se evaluó con marcadores moleculares que tienen como blanco una región del ADN ribosomal (ADNr nuclear conocida como ITS (Internal Transcribed Spacer, una región intergénica (IGS-1 y cinco secuencias simples repetidas (SSR. El marcador IGS-1 permitió la determinación del biotipo C, no obstante se encontró una variabilidad genética evidente dentro de este biotipo, aún no registrada. El análisis de la diversidad genética de M. perniciosa por medio de marcadores microsatélite arrojó un valor total de 0.4260, una heterocigosidad total de 0.6143 y un índice de información polimórfica (PIC de 0.3407, valores considerados de rango medio a alto para los aislamientos estudiados y que estiman la variabilidad genética presente en M. perniciosa.Moniliophthora perniciosa, the founder agent of the ‘witch’s broom’ on cocoa (Theobroma cacao L. is one of the most important diseases in cocoa plantations, causing economic losses close to 70% worldwide and 40% nationwide. It shows a high genetic variability and discrepancies in its taxonomy. Characterization of the genetic diversity of biotypes is important for projects aimed towards the handling of this pathogen and the development of resistant cocoa materials. Twelve isolations of the fungus were analyzed in this study from different

  17. Datos experimentales de la cinética del secado y del modelo matemático para pulpa de cupuaçu (Theobroma grandiflorum en rodajas Kinetic drying experimental data and mathematical model for cupuaçu pulp (Theobroma grandiflora slices

    Directory of Open Access Journals (Sweden)

    Abraham Damian Giraldo-Zuniga

    2010-03-01

    Full Text Available En este trabajo fueron obtenidos experimentalmente la cinética del secado de la pulpa de cupuaçu en forma de rodajas con espesor de 0,5 cm. El secado fue realizado utilizándose un secador laboratorial de bandejas, a las temperaturas de 50, 60 y 70 ºC y a la velocidad del aire de secado de 1,5 m/s. De acuerdo con los datos de la cinética del secado se puede observar que cuanto mayor es la temperatura del secado mayor es la velocidad del secado. El tiempo requerido para secar el producto hasta una humedad del 20%, fueron 9,2, 8,1 y 7,3 horas para las temperaturas de secado de 50, 60 y 70 ºC respectivamente. Las curvas experimentales del secado fueron ajustados al modelo difusional de Fick considerándose la muestra como una lámina infinita y al modelo de Page. Los dos modelos se ajustaron bien a los datos experimentales. Los coeficientes de difusión del modelo de Fick variaron de 1.171 a 1.561 m/s².This work examined experimentally the kinetics of drying cupuaçu pulp (Theobroma grandiflorum slices. The experimental runs were driven in a laboratory dryer, at temperatures of 50, 60 and 70 ºC and an air drying velocity of 1.5 m/s. According to the kinetics study, increasing the temperature led to a decrease in drying time. The required drying times were 9.2, 8.1 and 7.3 hours for drying temperatures of 50, 60 and 70 ºC respectively. The experimental drying curves were adjusted to Fick's diffusional model for an infinite lamina with shrinkage and Page model. The diffusion coefficients of the Fick model varied between 1.171 and 1.561 m/s².

  18. Characterization of Cocoa (Theobroma cacao L. Farming Systems in the Norte de Santander Department and Assessment Their Sustainability / Caracterización de los Sistemas de Producción de Cacao (Theobroma cacao L. en el Departamento de Norte de Santander

    Directory of Open Access Journals (Sweden)

    Jesús Arturo Ramírez Sulvarán

    2014-03-01

    Full Text Available The cocoa (Theobroma cacao L. based economyhas been considered a valid alternative to support sustainable development in northeastern Colombia. However, there is a lack of information about the cocoa production systems in the region which is needed for the implementation of effective plans to improve their performance and sustainability. Four of the main cocoa producing municipalities in the Norte de Santanderdepartment were considered for this study: Teorama, Bucarasica, Cúcuta and San Calixto. These entities were selected due to their adequate security conditions, availability of field assistants and departmental representativeness in cocoa production. The objective was to obtain basic information for local, specific and participatory actions for the sustainability of the cocoa production systems and to improve the living conditions of farmers. The methodology used was based on the farming system approach, considering the socioeconomic, technological and agro-ecologicalcomponents, and their relationships, and evaluating themaccording to the principles of sustainable agriculture. The phases covered were: (1 analysis of secondary data, (2 formulation and evaluation of sustainability indicators, (3 design, implementation and analysis of survey data and (4 validation by the farmers of the obtained information and the prioritization of problems. The results indicate that there is only one cocoa production system of a family-mercantile type, with low technology. Most farmers havelow incomes and basic needs such as health, education and public services are not met. They do not employ the agronomic and postharvest practices recommended by specialists. The water and soil resources are being degraded. In general, the farming system leans towards unsustainability and it is vital that integrative actions be taken to change this situation. / Se considera que el desarrollo de una economía basada en el cacao (Theobroma cacao L

  19. Obtención de embriones somáticos primarios de theobroma cacao en clones de interés regional para el departamento norte de santander, colombia.

    Directory of Open Access Journals (Sweden)

    Luz Stella Monsalve-González

    2005-01-01

    Full Text Available The somatic Embryogenesis is the formation of an embryo from a somatic cell. (23 This method ofregeneration is recognized anywhere in the world like most efficient for the micropropagation of vegetal species, allowing to obtain great amounts of sowing material, which is a necessity in the country for the renovation of plantations of Theobroma cacao. This job looks for a solution alternative, because the optimal conditions are evaluated to establish primary somatic embryos in 4 genotypes of regional interest (THS-565, ICS-95, CCN-51 and IMC-67. Two environmental conditions, two means of culture, and two types of explantes were evaluated. For the four genotypes in study, the greater values of induction to formation of embryogenic callus appeared in the means that contained 2,4D - TDZ like hormonal balance and glucose like carbon source. The Estaminoides presents one better formation of callus, nevertheless, in Petaloides they obtain greater number of somatic embryos and better development of such. The combination Kinetina-2,4 D favors the Somatic Embryogenic of Low frequency for ICS-95, IMC-67, TSH-565; where as clone CCN-51 is favored in the middle with 6BAP-2,4D. The results showed a high dependency of the genotype, thus the environmental conditions, the hormonal balance and the embryogenic frequency is different for each one from the clones, being ICS-95 and IMC-67 those that better behavior presented, and TSH 565 and CCN-51 had a smaller answer in the evaluated treatments.

  20. Duas proteínas (TcTIA6 e TcTIA7 envolvidas na biossíntese da tiamina codificadas pelo genoma do Theobroma cacao L

    Directory of Open Access Journals (Sweden)

    Juliano Oliveira SANTANA

    2017-09-01

    Full Text Available A tiamina funciona como um cofator para atividades de várias enzimas que atuam no metabolismo de carboidratos e aminoácidos. Este trabalho objetivou analisar através de técnicas de bioinformática os genes responsáveis pela biossíntese da tiamina codificadas pelo genoma do Theobroma cacao L. Foram encontrados dois genes, um no cromossomo 6 e outro no 7, sendo nomeados TcTIA6 e TcTIA7. O alinhamento múltiplo da TcTIA6 e TcTIA7 revelou alta identidade com a proteína da Arabidopis thaliana e seu direcionamento é destinado para a rota secretora do cloroplasto. Foram observados motifs conservados na região C-terminal, indicando participação no mecanismo de reparo de DNA. Analisando o dendrograma ficou evidenciado que os genes estudados tiveram um ancestral comum com Gossypium raimondii. As análises mostraram que as proteínas TcTIA6 e TcTIA7 provavelmente são bifuncionais, uma vez que estão envolvidas na biossíntese da tiamina e na estabilidade da molécula de DNA.

  1. Theobromine, the primary methylxanthine found in Theobroma cacao, prevents malignant glioblastoma proliferation by negatively regulating phosphodiesterase-4, extracellular signal-regulated kinase, Akt/mammalian target of rapamycin kinase, and nuclear factor-kappa B.

    Science.gov (United States)

    Sugimoto, Naotoshi; Miwa, Shinji; Hitomi, Yoshiaki; Nakamura, Hiroyuki; Tsuchiya, Hiroyuki; Yachie, Akihiro

    2014-01-01

    Theobromine, a caffeine derivative, is the primary methylxanthine produced by Theobroma cacao. We previously showed that methylxanthines, including caffeine and theophylline, have antitumor and antiinflammatory effects, which are in part mediated by their inhibition of phosphodiesterase (PDE). A member of the PDE family, PDE4, is widely expressed in and promotes the growth of glioblastoma, the most common type of brain tumor. The purpose of this study was to determine whether theobromine could exert growth inhibitory effects on U87-MG, a cell line derived from human malignant glioma. We show that theobromine treatment elevates intracellular cAMP levels and increases the activity of p38 mitogen-activated protein kinase and c-Jun N-terminal kinase, whereas it attenuates p44/42 extracellular signal-regulated kinase activity and the Akt/mammalian target of rapamycin kinase and nuclear factor-kappa B signal pathways. It also inhibits cell proliferation. These results suggest that foods and beverages containing cocoa bean extracts, including theobromine, might be extremely effective in preventing human glioblastoma.

  2. Discovery and mapping of a new expressed sequence tag-single nucleotide polymorphism and simple sequence repeat panel for large-scale genetic studies and breeding of Theobroma cacao L.

    Science.gov (United States)

    Allegre, Mathilde; Argout, Xavier; Boccara, Michel; Fouet, Olivier; Roguet, Yolande; Bérard, Aurélie; Thévenin, Jean Marc; Chauveau, Aurélie; Rivallan, Ronan; Clement, Didier; Courtois, Brigitte; Gramacho, Karina; Boland-Augé, Anne; Tahi, Mathias; Umaharan, Pathmanathan; Brunel, Dominique; Lanaud, Claire

    2012-01-01

    Theobroma cacao is an economically important tree of several tropical countries. Its genetic improvement is essential to provide protection against major diseases and improve chocolate quality. We discovered and mapped new expressed sequence tag-single nucleotide polymorphism (EST-SNP) and simple sequence repeat (SSR) markers and constructed a high-density genetic map. By screening 149 650 ESTs, 5246 SNPs were detected in silico, of which 1536 corresponded to genes with a putative function, while 851 had a clear polymorphic pattern across a collection of genetic resources. In addition, 409 new SSR markers were detected on the Criollo genome. Lastly, 681 new EST-SNPs and 163 new SSRs were added to the pre-existing 418 co-dominant markers to construct a large consensus genetic map. This high-density map and the set of new genetic markers identified in this study are a milestone in cocoa genomics and for marker-assisted breeding. The data are available at http://tropgenedb.cirad.fr.

  3. Efecto de la temperatura y tiempo de tostado en los caracteres sensoriales y en las propiedades químicas de granos de cacao (Theobroma cacao L.) procedente de Uchiza, San Martín – Perú para la obtención de NIBS

    OpenAIRE

    Aldave Palacios, Gladis Josefina

    2016-01-01

    Estudia las variedades de cacao (Theobroma cacao L.) CCN-51 e ICS-6, procedentes del distrito de Uchiza, provincia de Tocache, departamento de San Martín, en Perú. Efectúa el tratamiento térmico de tostado a las temperaturas de 120 y 130 °C por 40 y 50 minutos, los nibs de cacao (granos de cacao tostados y pelados) son evaluados sensorialmente por seis jueces entrenados. La evaluación estadística mediante la prueba no paramétrica de Wilcoxon no halla diferencia significativa entre los tratami...

  4. Tc-cAPX, a cytosolic ascorbate peroxidase of Theobroma cacao L. engaged in the interaction with Moniliophthora perniciosa, the causing agent of witches' broom disease.

    Science.gov (United States)

    Camillo, Luciana Rodrigues; Filadelfo, Ciro Ribeiro; Monzani, Paulo Sérgio; Corrêa, Ronan Xavier; Gramacho, Karina Peres; Micheli, Fabienne; Pirovani, Carlos Priminho

    2013-12-01

    The level of hydrogen peroxide (H2O2) in plants signalizes the induction of several genes, including that of ascorbate peroxidase (APX-EC 1.11.1.11). APX isoenzymes play a central role in the elimination of intracellular H2O2 and contribute to plant responses to diverse stresses. During the infection process in Theobroma cacao by Moniliophthora perniciosa oxidative stress is generated and the APX action recruited from the plant. The present work aimed to characterize the T. cacao APX involved in the molecular interaction of T. cacao-M. perniciosa. The peroxidase activity was analyzed in protein extracts from cocoa plants infected by M. perniciosa and showed the induction of peroxidases like APX in resistant cocoa plants. The cytosolic protein of T. cacao (GenBank: ABR68691.2) was phylogenetically analyzed in relation to other peroxidases from the cocoa genome and eight genes encoding APX proteins with conserved domains were also analyzed. The cDNA from cytosolic APX was cloned in pET28a and the recombinant protein expressed and purified (rTc-cAPX). The secondary structure of the protein was analyzed by Circular Dichroism (CD) displaying high proportion of α-helices when folded. The enzymatic assay shows stable activity using ascorbate and guaiacol as an electron donor for H2O2 reduction. The pH 7.5 is the optimum for enzyme activity. Chromatographic analysis suggests that rTc-cAPX is a homodimer in solution. Results indicate that the rTc-cAPX is correctly folded, stable and biochemically active. The purified rTc-cAPX presented biotechnological potential and is adequate for future structural and functional studies. Copyright © 2013 The Authors. Published by Elsevier Masson SAS.. All rights reserved.

  5. Atividade Antioxidante do Extrato Seco de Cacau Orgânico (Theobroma cacao - Estudo de Estabilidade e Teste de Aceitação de Cremes Acrescidos Deste Extrato

    Directory of Open Access Journals (Sweden)

    Silas Arandas Monteiro e Silva

    2013-12-01

    Full Text Available Os frutos de cacau (Theobroma cacao são conhecidos mundialmente pela sua riqueza em ácidos graxos e compostos fenólicos com poder antioxidante, sendo que em sua constituição é possível relatar mais de 50% em ácidos graxos de cadeia média que o torna matéria-prima passível de ser explorada pela indústria alimentícia, farmacêutica e cosmética. Este trabalho teve como objetivo estudar o poder antioxidante do extrato seco de cacau orgânico, obter formulações cosméticas acrescidas deste extrato, promovendo os estudos de estabilidade, ensaios reológicos e a investigação de cristais-líquidos, bem como realizar o teste de aceitação das mesmas. O extrato vegetal foi avaliado quanto seu poder antioxidante pelo método de sequestro radicalar DPPH. Formulações cosméticas foram obtidas e amostras foram submetidas a ensaios físico-químicos de estabilidade (caracterização organoléptica, teste de centrífuga e determinação dos valores de pH, caracterização reológica, assim como análises em microscopia de luz polarizada. As preparações estáveis também foram avaliadas quanto a sua aceitabilidade por provadores. A partir dos resultados apresentados pôde-se constatar a atividade antioxidante do extrato seco de cacau orgânico e obter preparações cosméticas, constituídas deste ativo a 5%, com comportamento pseudoplástico associado à tixotropia e providas de cristais líquidos lamelares. Verificou-se também que a concentração de cera autoemulsionante interferiu na aceitação do produto cosmético.

  6. ESTUDIO DE LA DIVERSIDAD GENÉTICA DE 20 ACCESIONES DE CACAO (Theobroma cacao L. MEDIANTE AP-PCR DE LA COLECCIÓN DEL CENTRO DEL CACAO DE AROMA TENGUEL EN LA FINCA EXPERIMENTAL LA BUSETA

    Directory of Open Access Journals (Sweden)

    Mercedes Susana Carranza Patiño

    2008-06-01

    Full Text Available El presente estudio consistió en determinar la diversidad genética basada en los marcadores RAPD´s (Random Amplification of Polymorphic DNA de 20 accesiones de cacao (Theobroma cacao L.de la variedad Nacional, con características de productividad, y niveles de resistencia, susceptibilidad y tolerancia a las rincipales enfermedades causadas por hongos como Ceratocistys fimbriata, Moniliophtora roreri y Crinipelis perniciosa. Este germoplasma de cacao se encuentra localizado en el Centro de Cacao de Aroma Tenguel, en la Finca Experimental “La Buseta” propiedad de la Universidad Técnica Estatal de Quevedo. La extracción de ADN se la realizó utilizando el protocolo de Doyle & Doyle (1990 con algunas modificaciones. 14 oligonucleótidos fueron utilizados para la obtención de marcadores RAPD´s, de los cuales 9 amplificaron productos reproducibles OPA-15, OPC-07, OPC-9, OPC-4, OPC-3, OPC-1, OPA-12 OPC-13 y OPA-7. Los productos de amplificación fueron migrados en geles de agarosa al 1.2% a 90 voltios por una hora. Los marcadores moleculares fueron analizados por medio de una matriz de datos binarios para calcular las distancias genéticas. Los nueve cebadores utilizados generaron 67 bandas de las cuales 59 (88% fueron polimórficas. El dendrograma mostró dos grupos A y B, en el grupo A se incluyo dos accesiones, y en el grupo B se encuentran los 18 restantes el cual incluye 2 subgrupos B1 y B2 en el subgrupo B1 se incluye la accesión (L-22-H-40, y en el subgrupo B2 están incluidas las accesiones que poseen características de productividad. El nivel de diversidad más alto se obtuvo con los oligonucleótidos OPC 04 (0.80, OPC 07 (0.82. El cebador OPC 01 (0.37 reportó el nivel más bajo. Las accesiones (L-22-H-40 (O.75, (L-34-H-07 (0.86 y el (L-42-H-60 (0.72 presentaron los niveles de variabilidad más altos, siendo los valores más bajos los mostrados por las accesiones (L-26-H-64 (O.48 y (L-23-H63 (O.47. El valor de la diversidad

  7. Análisis y estimación de parámetros e índices de crecimiento del árbol de Maraco (Theobroma bicolorH.B.K. a primera floración

    Directory of Open Access Journals (Sweden)

    Hernández G. María Soledad

    1995-12-01

    Full Text Available El maraco (Theobroma bicolor H.B.K. es un frutal amazónico con alto potencial agroindustrial. Para su inclusión dentro de la economía de mercado regional es indispensable conocer su comportamiento fisiológico durante ta'tase vegetativa con el fin de establecer la eficiencia de acumulación de materia
    seca. Entonces, se hace necesario desarrollar estudios que conduzcan a un mayor conocimiento de la especie, permitiendo con ello, generar alternativas para su producción comercial dentro del entorno amazónico. El presente estudio tuvo como objetivo caracterizar el crecimiento vegetativo de la especie a partir del cálculo de las medidas derivadas de crecimiento: Tasa de asimilación neta (TAN, Tasa de crecimiento relativo (TCR, Tasa de crecimiento del cultivo (TCC, Relación del área foliar (RAF, Duración del área foliar (DAF e índice de área foliar (IAF en el árbol de maraco, desde su siembra definitiva en el campo hasta la primera
    floración. Se encontró que el área fotosintética del árbol y su materia seca aumentaron a lo largo de toda la fase vegetativa, con un patrón de crecimiento sigmoidal. Los índices TAN, TCR y TCC se hicieron máximos en el período previo al iniciar de la fase reproductiva, con lo cual se logró, en la planta, el balance carbono/nitrógeno requerido para
    la transición entre una fase y otra. Igualmente, la RAF se hizo máxima para la misma etapa. El análisis de crecimiento permitió cuantificar el crecimiento de la planta, su producción de materia seca y la expansión del área foliar, con lo cual se podrá en adelante, generar prácticas adecuadas de fertilización que promuevan la producción de tejidos fotosintéticos y pigmentos clorofílicos. De igual manera, se podrá establecer la arquitectura de planta ideal que permita la mayor eficiencia en el cultivo para la conversión de la energía radiante en energía química.
    The Maraco is an amazonic fruit with a high potential for

  8. Sulphur depletion altered somatic embryogenesis in Theobroma ...

    African Journals Online (AJOL)

    USER

    2010-08-30

    Aug 30, 2010 ... chemical or characteristic functions of these biomolecules in cells (Saito, 2004). In growing conditions, sulphur defi- ciency challenges plants (explants) to alter the metabolism necessary for growth. Restriction in sulphur not only limits the synthesis of sulphurous amino acids, but will also limit the proteins ...

  9. Cocoa Bean (Theobroma cacao L.) Drying Kinetics

    National Research Council Canada - National Science Library

    Chinenye, Ndukwu MacManus; Ogunlowo, A.S; Olukunle, O.J

    2011-01-01

    .... In this work, the experimental drying kinetics of foreign species was investigated, and the experiments were carried out under isothermal conditions, using heated batch drier at 55, 70 and 81 °C...

  10. Avaliação genética de indivíduos e progênies de cupuaçuzeiro no estado do Pará e estimativas de parâmetros genéticos Genetic evaluation of individuals and progenies of Theobroma grandiflorum in the state of Pará and estimates of genetic parameters

    Directory of Open Access Journals (Sweden)

    Rafael Moysés Alves

    2008-09-01

    seleção recorrente para melhorar, gradativamente, o nível de resistência. Parece suficiente considerar na seleção apenas o número de vassouras, não sendo necessário considerar o peso. A correlação entre resistência no fruto e na inflorescência foi alta (0.84, indicando algum controle genético comum aos dois caracteres. Foram identificadas progênies superiores, simultaneamente, para produção de frutos e resistência à vassoura.This paper deals with the genotypic evaluation of Theobroma grandiflorum progenies in the Pará State for the characters number of fruits (NF in four harvests, intensity of occurrence of witch's broom disease in the inflorescences (WBI and in the fruits (WBF and weight of branches with witch's broom (WWB. Also, it presents estimates of genetic parameters that allow to infer on the genetic control and level of genetic variability in the appraised germplasm. All the characters presented considerable genetic variability, with coefficients of genetic variation varying from 27% to 88% at progenies level and from 38% to 123% at individual level. This reveals excellent possibilities for the selection in that hybrid experimental population. The estimates of individual narrow sense heritabilities, in a harvest, varied from 25% to 54% and the individual repeatabilities for NF was equal at 35%. With the four accomplished harvests the individual heritability increased to 48%, providing selective accuracy of 70%, for the individuals' selection. The gain in efficiency, when using more than five crops is practically worthless. For NF, genetic gains above 60% can be obtained with the selection of the best five individuals. Individuals with annual production of 17 fruits can be selected, value which is much more superior to the general average of 10 fruits, found in the commercial plantations. Superior genetic gains can be obtained with clone propagation of the best individuals in relation to the sexual propagation and for the best individual the

  11. Proteínas da semente de cupuaçu e alterações devidas à fermentação e à torração Proteins of cupuacu seeds (Theobroma grandiflorum Schum and changes during fermentation and roasting

    Directory of Open Access Journals (Sweden)

    Ana Vânia Carvalho

    2008-12-01

    Full Text Available O cupuaçu (Theobroma grandiflorum Schum é um fruto típico da região Norte do Brasil, com grande potencial econômico. Atualmente, é a polpa que mobiliza e sustenta a produção, a industrialização e a comercialização deste fruto. A semente, um subproduto da industrialização da polpa, apresenta teor considerável de proteínas. Entretanto, muito pouco ou nada se conhece acerca de seu perfil eletroforético, de aminoácidos e de principais frações, uma vez que ocorrem alterações protéicas devidas aos processos de fermentação e torração. O objetivo deste estudo consiste em caracterizar as alterações da proteína da semente, da amêndoa fermentada e da amêndoa torrada de cupuaçu, mediante a análise dos perfis eletroforéticos, dos aminogramas característicos e do fracionamento da proteína em diferentes solubilidades. A fermentação e a torração provocaram uma ligeira redução nos teores de proteína total e aminoácidos totais, quando comparados aos teores das sementes não submetidas a essas etapas do processamento. Observou-se, para a semente e a amêndoa fermentada, a presença de quatro bandas protéicas principais de 20,4, 33,6 e 38,7 kDa. Para as amêndoas que foram submetidas ao processo de fermentação e, em seguida, à torração, observou-se a presença de uma única banda protéica forte, com peso molecular aparente de 21,0 kDa. As extrações para fracionamento das proteínas em diferentes solubilidades não resultaram em frações protéicas puras. Observou-se a presença de quatro bandas principais em todas as frações protéicas isoladas, sendo a banda de peso molecular próximo a 21,1 kDa a mais abundante em todos os casos. Esta banda é aparentemente muito semelhante à fração albumina do cacau, que apresenta peso molecular aparente de 21,3 kDa.Cupuacu (Theobroma grandiflorum Schum is a native fruit from northern Brazil with great economic potential. Its productive chain is currently sustained by

  12. Effect of Cocoa ( Theobroma cacao ) Plantation Types on the ...

    African Journals Online (AJOL)

    Journal of Applied Sciences and Environmental Management. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 20, No 1 (2016) >. Log in or Register to get access to full text downloads.

  13. First report of Lasiodiplodia theobromae (Pat.) Griffon & Maubl ...

    African Journals Online (AJOL)

    SARAH

    2014-07-31

    Jul 31, 2014 ... from 3.2 to 3.8 %. (Juillet et al 1955; Moreira 1979;. Vohringer 1987). Briefly, to produce biofuel from jatropha (briefly): (1) first dissolve the lye into the methanol. Shake or swirl until all the lye has dissolved. This may take 10 minutes. It is normal that temperature rises. This mixture is called sodium methoxide.

  14. Heavy metals in soils of cocoa plantation (Theobroma cacao L.)

    Science.gov (United States)

    Cocoa has experienced significant growth in recent years in Peru and the presence of heavy metals in the soils of these plantations is a potential problem for the export of this product. Contents of heavy metals (Cd, Ni, Pb, Fe, Cu, Zn, Mn) in soils from 19 plantations that have been in production f...

  15. Hypoglycemic effects of cocoa (Theobroma cacao L.) autolysates.

    Science.gov (United States)

    Sarmadi, Bahareh; Aminuddin, Farhana; Hamid, Muhajir; Saari, Nazamid; Abdul-Hamid, Azizah; Ismail, Amin

    2012-09-15

    Fat, alkaloid and polyphenol contents of two clones of cocoa (UIT1 and PBC 140) were removed and the remaining powder was autolyzed at pH 3.5 and 5.2. Based on the results, autolysates of UIT produced at pH 3.5 exhibited the highest ability to inhibit α-amylase activity. However, no α-glucosidase inhibition activity was observed under the conditions specified. Autolysates produced under pH 3.5 caused the highest amount of insulin secretion. In streptozotocin-diabetic rats, all cocoa autolysates significantly decreased blood glucose at 4h. To assure that the results from the assays were not due to the polyphenols of cocoa autolysates qualitative and quantitative tests were applied. According to their results cocoa autolysates were found to be free from polyphenols. Analysis of amino acid composition revealed that cocoa autolysates were abundant in hydrophobic amino acids. It can be suggested that besides other compounds of cocoa, its peptides and amino acids could contribute to its health benefits. Copyright © 2012 Elsevier Ltd. All rights reserved.

  16. Propagación del cacao (Theobroma cacao L.).

    OpenAIRE

    Hernández Alvarado, Rocío

    2012-01-01

    México día a día presenta un desafío en la investigación agropecuaria y forestal; porque implica el desarrollo de tecnología rentable, efectiva y práctica, que propicie el aumento de la producción en forma sostenible. Por ello, en el presente trabajo se muestran técnicas para rejuvenecer plantaciones viejas e improductivas de cacao, como alternativas viables, económicas y ecológicas, permitiendo a los productores aumentar la producción e incrementar la rentabilidad del cultivo. La rentabilid...

  17. Review of vegetative propagation of cacao ( Theobroma cacao L ...

    African Journals Online (AJOL)

    Important among the external factors affecting rooting of cacao cuttings are light, temperature, humidity, and the air-moisture relations of the rooting media. The most ... The need is for an effective manipulation of the external environment and a wider exploitation of some technical factors to improve on rooting in cacao.

  18. Review of vegetative propagation of cacao ( Theobroma cacao L ...

    African Journals Online (AJOL)

    However, a clear relationship is noted between the position of cutting on the stock plant and rooting performance; rooting potential increases from the apex to the base of the shoot. Single-node cuttings take longer time to root than multinode cuttings. The physiological condition of cacao cuttings changes with changing ...

  19. KARAKTERISASI ENZIM POLIFENOL OKSIDASE BIJI KAKAO (Theobroma cacao Linn. Characterization of Polyphenol Oxidase Enzyme of Cocoa Beans (Theobroma cacao Linn.

    Directory of Open Access Journals (Sweden)

    G.P. Ganda Putra

    2012-05-01

    max equals to 595,24 U/gram (db of cocoa beans and K equals to 0,20 M; result of SDS- PAGE of enzyme shows protein bands at M� of 11,75; 17,80; 27,80; 36,03 and 131,52 kDa; and finally, optimumcondition of enzyme activity is at the temperature of 53,43oC; pH 5,42 and incubation time of 80,91 minutes. ABSTRAK Telah dilakukan penelitian dengan tujuan untuk: (1 mengetahui karakteristik enzim polifenol oksidase dan (2 menen- tukan kondisi (suhu, pH dan waktu inkubasi optimum aktivitas enzim polifenol oksidase, yang diisolasi dari biji kakao kering. Hasil penelitian berupa kondisi (suhu, pH dan waktu inkubasi optimum aktivitas enzim polifenol oksidase akan diaplikasikan untuk perbaikan mutu biji kakao kering melalui teknik rehidrasi. Penelitian ini dilakukan melalui tahapan: (1 isolasi enzim polifenol oksidase dari 10 sampel biji kakao kering di Provinsi Bali, (2 karakterisasi enzim polifenol oksidase (aktivitas, kinetika enzim, BM dan (3 penentuan kondisi suhu, pH dan waktu inkubasi optimum. Hasil yang diperoleh menunjukkan bahwa: (1 aktivitas enzim polifenol oksidase rata-rata 157,49 ± 58,03 U/gram (bk biji kakao dengan aktivitas maksimum 258,22 U/gram (bk biji kakao dan minimum 59,01 U/gram (bk biji kakao; maks sebesar 595,24 U/gram (bk biji kakao dan K sebesar 0,20 M; hasil SDS-PAGE enzim menunjukkan pita-pita protein yang terbentuk pada BM 11,75; 17,80; 27,80; 36,03 dan 131,52 kDa; dan (2 kondisi optimum aktivitas enzimadalah suhu 53,43oC; pH 5,42 dan waktu inkubasi 80,91 menit.

  20. Proposals to conserve Botryodiplodia theobromae (Lasiodiplodia theobromae) against Sphaeria glandicola, .....Ramularia brunnea against Sphaerella tussilaginis (Mycosphaerella tussilaginis) (Ascomycota: Dothideomycetes)

    Science.gov (United States)

    In the course of updating the scientific names of plant-associated fungi in the U. S. National Fungus Collections Fungal Databases to conform with one scientific name for fungi as required by the International Code of Nomenclature for algae, fungi and plants (ICN, McNeill & al. in Regnum Vegetable 1...

  1. Cocoa Bean (Theobroma cacao L.)Drying Kinetics Cinética del Secado de Cocoa (Theobroma cacao L.)

    National Research Council Canada - National Science Library

    Ndukwu MacManus Chinenye; A.S Ogunlowo; O.J Olukunle

    2010-01-01

    .... In this work, the experimental drying kinetics of foreign species was investigated, and the experiments were carried out under isothermal conditions, using heated batch drier at 55, 70 and 81 ºC...

  2. OPTIMASI ISOLASI LIPASE INDIGENOUS BIJI KAKAO (Theobroma cacao L. The Optimizing of Isolation of Cocoa Bean Indogenous Lipase (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    I D. G. Mayun Permana

    2012-05-01

    Full Text Available The aim of the research is to optimize the isolation method of cocoa bean lipase. The research is held by determining the position of lipase on cocoa bean, varying extraction medium and isolation process. The result shows that the lipase of cocoa bean is   cytosolic enzyme. The defatting process do not increase the lipase activity. Polyphenols inhibit the lipase activity, so that removal of the polyphenol will increase the activity. Blocking the polyphenol with polyvinilpolypirrolidone (PVPP will also increase the activity.The optimum consentration of PVPP is 8 %. The lipase activity will reach the highest when homogenized for 10 menit at 10,000 rpm. The best medium extraction for lipase isolation is 0.15 M phosphate buffer pH 7.5 containing sucrose 0.6 M and CaCl  1.0 mM.   ABSTRAK Penelitian ini bertujuan untuk mengoptimasi isolasi lipase indigenous biji kakao. Optimasi diawali dengan menentukan keberadaan lipase kemudian optimasi medium ekstraksi dan proses ekstraksi. Hasil penelitian menunjukkan bahwa lipase berada dalam sitosol. Penghilangan lemak tidak meningkatkan aktivitas lipase. Senyawa polifenol menghambat aktivitas lipase dan penghilangan polifenol dapat meningkatkan aktivitas lipase. Polyvinilpolypirrolidone (PVPP dapat menghambat polifenol sehingga dapat meningkatkan aktivitas lipase. Konsentrasi PVPP optimum adalah 8 % dari berat biji kakao. Proses homogenisasi optimum diperoleh dalam waktu 10 menit pada kecepatan 10.000 rpm. Medium ekstraksi untuk isolasi lipase biji kakao terbaik adalah bufer fosfat 0,15 M  dan pH 7,5 yang mengandung sukrosa 0,6 M dan 1,0 mM CaCl .

  3. STUDI PEMBUATAN TEH DAUN TANAMAN KAKAO (Theobroma cacao L SEBAGAI MINUMAN PENYEGAR (Production of Tea from Cocoa Leaves (Theobroma cacao L as Refreshment Beverage

    Directory of Open Access Journals (Sweden)

    Supriyanto Supriyanto

    2015-02-01

    kakao kering berkadar air 3-5%. Dilakukan pengamatan dan analisis meliputi kadar air, warna, kadar total polifenol, aktivitas antioksidan dan uji sensoris pada air rebusan teh daun kakao sebagai minuman penyegar. Hasil penelitian menunjukkan bahwa minuman penyegar hasil rebusan teh daun kakao dapat diterima oleh panelis, dan  yang paling disukai adalah air rebusan teh yang dibuat dari daun kakao muda dilayukan 10 menit. Air rebusan tersebut  warnanya sangat coklat, sedikit berbau daun, agak pahit dan sedikit sepat. Bubuk teh daun kakao mengandung total polifenol antara 0,42-0,74 mg/100 g, mempunyai aktivitas antioksidan antara 20,31 – 36,86%. Kata kunci: Daun kakao, pelayuan, umur daun, teh daun kakao, polifenol

  4. Nutritional value and antioxidant capacity of "cocoa honey" (Theobroma cacao L.)

    National Research Council Canada - National Science Library

    Silva, Elias Nascimento da; Ramos, Danilo da Cruz; Menezes, Lígia Miranda; Souza, Alexilda Oliveira de; Lannes, Suzana Caetano da Silva; Silva, Marcondes viana da

    2014-01-01

    Cocoa honey is considered as the liquid portion of cocoa pulp that is released from the fruit soon after it is cut open and can be used before fermentation by simple extraction due to its nutritional characteristics...

  5. The remineralization potential of cocoa (Theobroma cacao bean extract to increase the enamel micro hardness

    Directory of Open Access Journals (Sweden)

    Sulistianingsih Sulistianingsih

    2017-08-01

    Full Text Available Introduction: Remineralization is the process of returning mineral ions into a hydroxyapatite structure characterized by mineral deposition on the enamel surface. The presence of mineral deposition would affect the micro hardness of tooth enamel. The use of fluorine as remineralization agent with side effects such as fluorosis. Cocoa bean extract contains theobromin that can be used as an alternative remineralization ingredients. The objectives was to determine micro hardness email after remineralization using cocoa bean extract as natural material and to compare with fluorine use as synthetic material. Methods: Thirty-six maxillary first premolar tooth crown was cut and planted in the epoxy resin. Teeth were then immersed in demineralization solution at pH 4 for 6 hours. The sample were divided into 2 groups, 18 for the fluorine group and the remaining group of cocoa extract. Vickers microhardness test was used before treatment, after demineralized and after remineralization. Results: Enamel microhardness value before treatment in the fluorine group average value was 376.17 VHN and the cocoa extract group was 357.33 VHN. After demineralization in fluorine group was 268,13 VHN and cocoa extract group was 235,93 VHN. After remineralization in fluorine group was 321,08 VHN and cocoa extract group was 293,86 VHN. The results of the analysis showed that the level of micro hardness email after remineralization was not significantly different in two groups (p > 0.05. Conclusions: Cocoa extract is able to increase the microhardness of enamel so it can act as a substitution for fluorine remineralization.

  6. Fertilizer requirements of cacao (Theobroma cacao L.) in South-Western Nigeria

    NARCIS (Netherlands)

    Wessel, M.

    1971-01-01

    The studies reported on were conducted in the period 1961-1970 when the author was employed by the Cocoa Research Institute of Nigeria at Ibadan, formerly a sub-station of the West African Cocoa Research Institute.

    In the first three chapters information is given on the cacao industry and on

  7. Antimicrobial properties of two novel peptides derived from Theobroma cacao osmotin.

    Science.gov (United States)

    Falcao, Loeni L; Silva-Werneck, Joseilde O; Ramos, Alessandra de R; Martins, Natalia F; Bresso, Emmanuel; Rodrigues, Magali A; Bemquerer, Marcelo P; Marcellino, Lucilia H

    2016-05-01

    The osmotin proteins of several plants display antifungal activity, which can play an important role in plant defense against diseases. Thus, this protein can be useful as a source for biotechnological strategies aiming to combat fungal diseases. In this work, we analyzed the antifungal activity of a cacao osmotin-like protein (TcOsm1) and of two osmotin-derived synthetic peptides with antimicrobial features, differing by five amino acids residues at the N-terminus. Antimicrobial tests showed that TcOsm1 expressed in Escherichia coli inhibits the growth of Moniliophthora perniciosa mycelium and Pichia pastoris X-33 in vitro. The TcOsm1-derived peptides, named Osm-pepA (H-RRLDRGGVWNLNVNPGTTGARVWARTK-NH2), located at R23-K49, and Osm-pepB (H-GGVWNLNVNPGTTGARVWARTK-NH2), located at G28-K49, inhibited growth of yeasts (Saccharomyces cerevisiae S288C and Pichia pastoris X-33) and spore germination of the phytopathogenic fungi Fusarium f. sp. glycines and Colletotrichum gossypi. Osm-pepA was more efficient than Osm-pepB for S. cerevisiae (MIC=40μM and MIC=127μM, respectively), as well as for P. pastoris (MIC=20μM and MIC=127μM, respectively). Furthermore, the peptides presented a biphasic performance, promoting S. cerevisiae growth in doses around 5μM and inhibiting it at higher doses. The structural model for these peptides showed that the five amino acids residues, RRLDR at Osm-pepA N-terminus, significantly affect the tertiary structure, indicating that this structure is important for the peptide antimicrobial potency. This is the first report of development of antimicrobial peptides from T. cacao. Taken together, the results indicate that the cacao osmotin and its derived peptides, herein studied, are good candidates for developing biotechnological tools aiming to control phytopathogenic fungi. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. Biochemical precursor effects on the fatty acid production in cell suspension cultures of Theobroma cacao L.

    Science.gov (United States)

    Parra, O; Gallego, A M; Urrea, A; Rojas, L F; Correa, C; Atehortúa, L

    2017-02-01

    Cocoa butter (CB) is composed of 96% palmitic, stearic, oleic, linoleic and linolenic fatty acids that are responsible for the hardness, texture and fusion properties of chocolate. Through in vitro plant cell culture it is possible to modify CB lipid profiles and to study the fatty acid biosynthesis pathway on a subcellular level, evaluating fundamental aspects to enhance in vitro fatty acid production in a specific and controlled way. In this research, culture media was supplemented with acetate, biotin, pyruvate, bicarbonate and glycerol at three different concentrations and the effects on the biomass production (g/L), cell viability, and fatty acids profile and production was evaluated in in vitro cell suspensions culture. It was found that biotin stimulated fatty acid synthesis without altering cell viability and cell growth. It was also evident a change in the lipid profile of cell suspensions, increasing middle and long chain fatty acids proportion, which are unusual to those reported in seeds; thus implying that it is possible to modify lipid profiles according to the treatment used. According to the results of sucrose gradients and enzyme assays performed, it is proposed that cacao cells probably use the pentose phosphate pathway, mitochondria being the key organelle in the carbon flux for the synthesis of reductant power and fatty acid precursors. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  9. Molecular, Biochemical and Ultrastructural Changes Induced by Pb Toxicity in Seedlings of Theobroma cacao L.

    Science.gov (United States)

    Reis, Graciele Santos Monteiro; de Almeida, Alex-Alan Furtado; de Almeida, Nicolle Moreira; de Castro, Andressa Vieira; Mangabeira, Pedro Antonio Oliveira; Pirovani, Carlos Priminho

    2015-01-01

    Pb is a metal which is highly toxic to plants and animals, including humans. High concentrations of Pb have been observed in beans of T. cacao, as well as in its products. In this work, we evaluated the molecular, biochemical, and ultrastructural alterations in mature leaves and primary roots of seedlings of two progenies of T. cacao, obtained from seed germination in different concentrations of Pb (0, 0.05, 0.1, 0.2, 0.4, 0.8 g L(-1)), in the form of Pb(NO3)2. The progenies resulted from self-fertilization of Catongo and a cross of CCN-10 x SCA-6. The Pb, supplied via seminal, caused alterations in the ultrastructures of the mesophyll cells and in the amount of starch grains in the chloroplasts. The dosage of substances reactive to thiobarbituric acid showed that Pb induced lipid peroxidation. The activity of guaiacol peroxidases and the expression of genes associated to synthetase of phytochelatin, SODcyt and PER increased in response to Pb. In addition, there was alteration in the expression of stress-related proteins. The progeny of CCN-10 x SCA-6 was more tolerant to Pb stress when compared to Catongo, since: (i) it accumulated more Pb in the roots, preventing its translocation to the shoot; (ii) it presented higher activity of peroxidases in the roots, which are enzymes involved in the elimination of excess of reactive oxygen species; and (iii) increased expression of the gene in the phytochelatin biosynthesis route. The results of the proteomic analysis were of paramount importance to differentiate the defense mechanisms used by both progenies of T. cacao.

  10. Diallel Analysis and Growth Parameters as Selection Tools for Drought Tolerance in Young Theobroma cacao Plants.

    Science.gov (United States)

    Dos Santos, Emerson Alves; Almeida, Alex-Alan Furtado de; Ahnert, Dario; Branco, Marcia Christina da Silva; Valle, Raúl René; Baligar, Virupax C

    2016-01-01

    This study aimed to estimate the combining ability, of T. cacao genotypes preselected for drought tolerance through diallel crosses. The experiment was conducted under greenhouse conditions at the Cacao Research Center (CEPEC), Ilhéus, Bahia, Brazil, in a completely randomized block design, in an experimental arrangement 21 x 2 [21 complete diallel crosses and two water regimes (control and stressed)]. In the control, soil moisture was kept close to field capacity, with predawn leaf water potential (ΨWL) ranging from -0.1 to -0.5 MPa. In the drought regime, the soil moisture was reduced gradually by decreasing the amount of water application until ΨWL reached -2.0 to -2.5 MPa. Significant differences (p cacao crosses, except for SCA-6 x IMC-67, Catongo x SCA, MOC-01 x Catongo, Catongo x IMC-67 and RB-40 x Catongo. Multivariate analysis showed that stem diameter (CD), total leaf area (TLA), leaf dry biomass (LDB), stem dry biomass (SDB), root dry biomass (RDB), total dry biomass (TDB), root length (RL), root volume (RV), root diameter (RD) cacao genotypes in to tolerant and intolerant to soil water deficit.

  11. In vitro seed germination and rootstock establishing for micrografting of Theobroma cacao L

    Science.gov (United States)

    Micrografting has been successfully implemented in several plant species of Acacia, Citrus, Eucalyptus, Havea, Malus, Olea, Opuntia, Prunus and other genera. This technique is employed for plant rejuvenation, true-to-type propagation, genetic improvement, recovery of virus-free plants, testing of po...

  12. [Transmission of cutaneous leishmaniasis associated with cacao (Theobroma cacao) plantations in Tabasco].

    Science.gov (United States)

    Carrada Figueroa, Georgina Del Carmen; Leal Ascencio, Víctor Javier; Jiménez Sastré, Alejandro; López Álvarez, Jorge

    2014-01-01

    Tabasco is the Mexican state that reported the highest number (37.4%) of patients with leishmaniasis during 1990-2011. Close to 90% of these patients lived in Chontalpa, where the municipality of Cunduacán accounted for the majority of the cases. One of the characteristics of this region is that houses are located within cacao plantations. To determine if cacao plantations are a risk factor for leishmaniasis transmission in locations of Cunduacán, Tabasco. We performed an analytical and retrospective study of 115 locations in Cunduacán, analyzing the number of localities with or without patients with leishmaniasis registered between 2000-2011 and, additionally, if they had cacao plantations, using a map where different crops were georeferenced. We measured the magnitude of the association (odds ratio, 95% CI). During the period 2000-2011, cases of leishmaniasis were reported in 77 (67.0%) Cunduacán locations, of these, 55 (71.4%) had cocoa plantations, five (6.5%) of banana, five (6.5%) of cane, and 12 (15.6%) had no crops georeferenced. We found that cocoa crops are a risk factor for the transmission of leishmaniasis (OR: 3.438; 95% CI: 1,526-7,742). The probability of transmission of leishmaniasis in areas with cocoa crops is greater than in communities without this crop.

  13. Respon pertumbuhan bibit kakao (Theobroma cacao L.) terhadap pemberian pupuk guano dan KCl

    OpenAIRE

    Rajagukguk, Pispa

    2015-01-01

    Addition of Guano in Cultivation of Cacao Seedling is the one of step to use organic fertilizer that comes from animal feces in the world. For that purpose addition guano aims to increase growth of Cacao in Cultivation of Seedling. This research had been conducted at experimental field of Fakultas Pertanian USU in October 2013 - January 2014 using factorial randomized block design with two factor, i.e. addition dose of Guano (0, 75 , 150 , 225 g/polibag) and dose of KCl (0 , ...

  14. Respon Pertumbuhan Bibit Kakao (Theobroma Cacao L.) TerhadapPemberian Pupuk Guano Dan KCl

    OpenAIRE

    Rajagukguk, Pispa; Siagian, Balonggu; Rosanty lahay, Ratna

    2015-01-01

    Addition of guano in cultivation of cacao seedling is the one step to use organic fertilizer thatcomes from animal feces and it is used to add soil nutrient for the growth of cocoa seedlings, aswell addition of KCl is used to add soil nutrient too. For that purpose addition guano and KCl aimsto increase growth of cacao in cultivation of seedling. This research had been conducted atexperimental field of agriculture fakulty University of North Sumatera in October 2013 - January2014 using factor...

  15. Molecular, physiological and biochemical responses of Theobroma cacao L. genotypes to soil water deficit.

    Science.gov (United States)

    Santos, Ivanildes C Dos; Almeida, Alex-Alan Furtado de; Anhert, Dário; Conceição, Alessandro S da; Pirovani, Carlos P; Pires, José L; Valle, Raúl René; Baligar, Virupax C

    2014-01-01

    Six months-old seminal plants of 36 cacao genotypes grown under greenhouse conditions were subjected to two soil water regimes (control and drought) to assess, the effects of water deficit on growth, chemical composition and oxidative stress. In the control, soil moisture was maintained near field capacity with leaf water potentials (ΨWL) ranging from -0.1 to -0.5 MPa. In the drought treatment, the soil moisture was reduced gradually by withholding additional water until ΨWL reached values of between -2.0 to -2.5 MPa. The tolerant genotypes PS-1319, MO-20 and MA-15 recorded significant increases in guaiacol peroxidase activity reflecting a more efficient antioxidant metabolism. In relation to drought tolerance, the most important variables in the distinguishing contrasting groups were: total leaf area per plant; leaf, stem and total dry biomass; relative growth rate; plant shoot biomass and leaf content of N, Ca, and Mg. From the results of these analyses, six genotypes were selected with contrasting characteristics for tolerance to soil water deficit [CC-40, C. SUL-4 and SIC-2 (non-tolerant) and MA-15, MO-20, and PA-13 (tolerant)] for further assessment of the expression of genes NCED5, PP2C, psbA and psbO to water deficit. Increased expression of NCED5, PP2C, psbA and psbO genes were found for non-tolerant genotypes, while in the majority of tolerant genotypes there was repression of these genes, with the exception of PA-13 that showed an increased expression of psbA. Mutivariate analysis showed that growth variables, leaf and total dry biomass, relative growth rate as well as Mg content of the leaves were the most important factor in the classification of the genotypes as tolerant, moderately tolerant and sensitive to water deficit. Therefore these variables are reliable plant traits in the selection of plants tolerant to drought.

  16. Food Fingerprinting: Characterization of the Ecuadorean Type CCN-51 of Theobroma cacao L. Using Microsatellite Markers.

    Science.gov (United States)

    Herrmann, Luise; Felbinger, Christine; Haase, Ilka; Rudolph, Barbara; Biermann, Bernhard; Fischer, Markus

    2015-05-13

    The cocoa type "Colección Castro Naranjal 51" (CCN-51) is known for its resistance to specific climate conditions and its high yield, but it shows a weaker flavor profile and therefore is marketed as bulk cocoa. In a previous study, the two cocoa types Arriba and CCN-51 could easily be distinguished, but differences among the CCN-51 samples were observed. This was unexpected, as CCN-51 is reported to be a clone. To confirm whether CCN-51 is a pure clone, 10 simple sequence repeats (SSR) located on the nuclear genome were used to analyze various CCN-51 samples in comparison to the cocoa varieties Arriba and Criollo. As expected, there are differences in the SSR pattern among CCN-51, Arriba, and Criollo, but a variability within the CCN-51 sample set was detected as well. The previously described sequence variation in the chloroplast genome was confirmed by a variability in the microsatellite loci of the nuclear genome for a comprehensive cultivar collection of CCN-51 of both bean and leaf samples. In summary, beneath somaclonal variation, misidentification of plant collections and also sexual reproduction of CCN-51 can be suggested.

  17. Genetic identification of Theobroma cacao L. trees with high Criollo ancestry in Soconusco, Chiapas, Mexico.

    Science.gov (United States)

    Vázquez-Ovando, J A; Molina-Freaner, F; Nuñez-Farfán, J; Ovando-Medina, I; Salvador-Figueroa, M

    2014-12-12

    Criollo-type cacao trees are an important pool of genes with potential to be used in cacao breeding and selection programs. For that reason, we assessed the diversity and population structure of Criollo-type trees (108 cultivars with Criollo phenotypic characteristics and 10 Criollo references) using 12 simple sequence repeat (SSR) markers. Cultivars were selected from 7 demes in the Soconusco region of southern Mexico. SSRs amplified 74 alleles with an average of 3.6 alleles per population. The overall populations showed an average observed heterozygosity of 0.28, indicating heterozygote deficiency (average fixation index F = 0.50). However, moderate allelic diversity was found within populations (Shannon index for all populations I = 0.97). Bayesian method analysis determined 2 genetic clusters (K = 2) within individuals. In concordance, an assignment test grouped 37 multilocus genotypes (including 10 references) into a first cluster (Criollo), 54 into a second (presumably Amelonado), and 27 admixed individuals unassigned at the 90% threshold likely corresponding to the Trinitario genotype. This classification was supported by the principal coordinate analysis and analysis of molecular variance, which showed 12% of variation among populations (FST = 0.123, P < 0.0001). Sampled demes sites (1- 7) in the Soconusco region did not show any evidence of clustering by geographic location, and this was supported by the Mantel test (Rxy = 0.54, P = 0.120). Individuals with high Criollo lineage planted in Soconusco farms could be an important reservoir of genes for future breeding programs searching for fine, taste, flavor, and aroma cocoa.

  18. Molecular cloning and expression analysis of the sucrose transporter gene family from Theobroma cacao L.

    Science.gov (United States)

    Li, Fupeng; Wu, Baoduo; Qin, Xiaowei; Yan, Lin; Hao, Chaoyun; Tan, Lehe; Lai, Jianxiong

    2014-08-10

    In this study, we performed cloning and expression analysis of six putative sucrose transporter genes, designated TcSUT1, TcSUT2, TcSUT3, TcSUT4, TcSUT5 and TcSUT6, from the cacao genotype 'TAS-R8'. The combination of cDNA and genomic DNA sequences revealed that the cacao SUT genes contained exon numbers ranging from 1 to 14. The average molecular mass of all six deduced proteins was approximately 56 kDa (range 52 to 66 kDa). All six proteins were predicted to exhibit typical features of sucrose transporters with 12 trans-membrane spanning domains. Phylogenetic analysis revealed that TcSUT2 and TcSUT4 belonged to Group 2 SUT and Group 4 SUT, respectively, and the other TcSUT proteins were belonging to Group 1 SUT. Real-time PCR was conducted to investigate the expression pattern of each member of the SUT family in cacao. Our experiment showed that TcSUT1 was expressed dominantly in pods and that, TcSUT3 and TcSUT4 were highly expressed in both pods and in bark with phloem. Within pods, TcSUT1 and TcSUT4 were expressed more in the seed coat and seed from the pod enlargement stage to the ripening stage. TcSUT5 expression sharply increased to its highest expression level in the seed coat during the ripening stage. Expression pattern analysis indicated that TcSUT genes may be associated with photoassimilate transport into developing seeds and may, therefore, have an impact on seed production. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. Biodiversity and biogeography of the cacao (Theobroma cacao) pathogen Moniliophthora roreri in tropical America

    National Research Council Canada - National Science Library

    Phillips‐Mora, W; Aime, M. C; Wilkinson, M. J

    2007-01-01

    ... . While this basidiomycete has had devastating effects on the cacao tree ( T. cacao ) in tropical America, where it is confined, little is known of its biogeography and intraspecific genetic variability...

  20. Genetic diversity in cocoa ( Theobroma cacao L.) plus trees in Tamil ...

    African Journals Online (AJOL)

    ... highly informative. The Jaccard's similarity coefficient for the SSR data set varied from 0.39 to 1.00. The SSR marker profiles resulted in nine clusters at nearly 54% similarity. From this study, it could be inferred that the diversity exists in cocoa plantations in Tamil Nadu and can be exploited in crop improvement research.

  1. A new glycosylated dihydrophaseic acid from cacao germs (Theobroma cacao L.).

    Science.gov (United States)

    Sannohe, Yumiko; Gomi, Shuichi; Murata, Takashi; Ohyama, Makoto; Yonekura, Kumiko; Kanegae, Minoru; Koga, Jinichiro

    2011-01-01

    Cacao beans are composed of cacao nibs and germs. Although numerous chemical and physiological studies on cacao nib compounds have been reported, there is little information on cacao germ compounds. We therefore analyzed an extract from the cacao germ, and found two compounds that were specific to the germ. One of these two compounds was identified as the new glycosylated abscisic acid metabolite, dihydrophaseic acid-4'-O-6″-(β-ribofuranosyl)-β-glucopyranoside, and the other as the known compound, dihydrophaseic acid-4'-O-β-D-glucopyranoside.

  2. Single nucleotide polymorphisms from Theobroma cacao expressed sequence tags associated with witches' broom disease in cacao.

    Science.gov (United States)

    Lima, L S; Gramacho, K P; Carels, N; Novais, R; Gaiotto, F A; Lopes, U V; Gesteira, A S; Zaidan, H A; Cascardo, J C M; Pires, J L; Micheli, F

    2009-07-14

    In order to increase the efficiency of cacao tree resistance to witches' broom disease, which is caused by Moniliophthora perniciosa (Tricholomataceae), we looked for molecular markers that could help in the selection of resistant cacao genotypes. Among the different markers useful for developing marker-assisted selection, single nucleotide polymorphisms (SNPs) constitute the most common type of sequence difference between alleles and can be easily detected by in silico analysis from expressed sequence tag libraries. We report the first detection and analysis of SNPs from cacao-M. perniciosa interaction expressed sequence tags, using bioinformatics. Selection based on analysis of these SNPs should be useful for developing cacao varieties resistant to this devastating disease.

  3. Genetic diversity of naturalized cacao (Theobroma cacao L.) in Puerto Rico

    Science.gov (United States)

    Identification of genetically diverse cacao with disease resistance, high productivity and desirable organoleptic traits is vitally important to the agricultural crop’s long-term sustainability. Environmental changes, pests and diseases as well as nation’s sovereign property rights have led to a de...

  4. Cacao (Theobroma cacao L.) Resistance Evaluation Againts Black Pod Diseaseand Effectiveness of Inoculation Methods

    OpenAIRE

    Rubiyo Rubiyo; Agus Purwantara; Dedy Suhendy; Trikoesoemaningtyas Trikoesoemaningtyas; Satriyas Ilyas; Sudarsono Sudarsono

    2008-01-01

    The general objective of this experiment was to standardize method of resistance evaluation of cacao germplasm against Phytophthora palmivora, the pathogen causing black pod disease in cacao. The sepecific objectives were to evaluate (1) effects of inoculum type and pod injury, (2) effects of inoculum type and seedling injury, and (3) effects of genetic background of cacao seedlings on infection of P. palmivora. In this experiment, effectiveness of either zoospora or mycellia was evaluated as...

  5. Proximate Composition, Extraction, and Purification of Theobromine from Cacao Pod Husk (Theobroma Cacao L.

    Directory of Open Access Journals (Sweden)

    Van Tang Nguyen

    2017-04-01

    Full Text Available The aims of this study were to determine the proximate composition of cacao pod husk as well as the optimal conditions for extraction and purification of theobromine from cacao pod husk. The results indicated that cacao pod husk had high contents of moisture and carbohydrate (87.06% and 11.03% by fresh weight, respectively, but low contents of crude protein, crude lipid, and ash (0.31%, 0.12%, and 1.48% by fresh weight, respectively. The optimal conditions for extraction of theobromine from cacao pod husk were of 70% ethanol, with an extraction time of 90 min, and 1 as the number of extractions. A concentration of 10% by volume of 10% lead acetate solution was the best selection for purification of the crude extracts containing theobromine from cacao pod husk. Under these optimal conditions, theobromine content obtained from cacao pod husk was 6.79 mg/100 g dry weight. The finding from this study is a valuable contribution for obtaining theobromine from an abundant, inexpensive, renewable, and sustainable source for potential application in the nutraceutical, medical, and pharmaceutical industries.

  6. Cacao (Theobroma cacao L. Resistance Evaluation Againts Black Pod Diseaseand Effectiveness of Inoculation Methods

    Directory of Open Access Journals (Sweden)

    Rubiyo Rubiyo

    2008-07-01

    Full Text Available The general objective of this experiment was to standardize method of resistance evaluation of cacao germplasm against Phytophthora palmivora, the pathogen causing black pod disease in cacao. The sepecific objectives were to evaluate (1 effects of inoculum type and pod injury, (2 effects of inoculum type and seedling injury, and (3 effects of genetic background of cacao seedlings on infection of P. palmivora. In this experiment, effectiveness of either zoospora or mycellia was evaluated as inoculation sources for pod, leaf and stem of cacao clone GC 7 and Sca 12. Part of the tested cacao pods, leaves, and stems were injured prior to P. palmivora inoculation while the others were not. Observations were conducted on diameter of the necrosed symptoms on inoculated cacao pods, number of necrosed spot on inoculated leaf, and the length of necrosed symptoms on stem of tested cacao seedlings. Results of the experiment indicated inoculation using mycelia of P. palmivora was more effective than zoospora and injuring the tested cacao pods and seedlings before P. palmivora inoculation can be used to prediction the resistance of tested cacao clones against P. Palmivora infection. Results of resistance prediction using detached pod assay was similar to that of using seedling assay; therefore, seedling assay could be used as an alternattive method of resistance evaluation. Cacao F1 hybrids derived from TSH 858 x Sca 12 showed some resistance against P. palmivora and they might potentially result in high yielding lines.Key words: Phytophthora palmivora, cacao breeding, germplasm evaluation, inoculation standardization, pod assay, seedling assay.

  7. Proteome analysis during pod, zygotic and somatic embryo maturation of Theobroma cacao.

    Science.gov (United States)

    Niemenak, Nicolas; Kaiser, Edward; Maximova, Siela N; Laremore, Tatiana; Guiltinan, Mark J

    2015-05-15

    Two dimensional electrophoresis and nano-LC-MS were performed in order to identify alterations in protein abundance that correlate with maturation of cacao zygotic and somatic embryos. The cacao pod proteome was also characterized during development. The recently published cacao genome sequence was used to create a predicted proteolytic fragment database. Several hundred protein spots were resolved on each tissue analysis, of which 72 variable spots were subjected to MS analysis, resulting in 49 identifications. The identified proteins represent an array of functional categories, including seed storage, stress response, photosynthesis and translation factors. The seed storage protein was strongly accumulated in cacao zygotic embryos compared to their somatic counterpart. However, sucrose treatment (60 g L(-1)) allows up-regulation of storage protein in SE. A high similarity in the profiles of acidic proteins was observed in mature zygotic and somatic embryos. Differential expression in both tissues was observed in proteins having high pI. Several proteins were detected exclusively in fruit tissues, including a chitinase and a 14-3-3 protein. We also identified a novel cacao protein related to known mabinlin type sweet storage proteins. Moreover, the specific presence of thaumatin-like protein, another sweet protein, was also detected in fruit tissue. We discuss our observed correlations between protein expression profiles, developmental stage and stress responses. Copyright © 2015 Elsevier GmbH. All rights reserved.

  8. Pod Characteristics of Cocoa (Theobroma Cacao L.) Related to Cocoa Pod Borer Resistance (Conopomorpha Cramerella Snell.)

    OpenAIRE

    Agung Wahyu Soesilo; Surip Mawardi; Witjaksono .; Woerjono Mangoendidjojo

    2015-01-01

    AbstractThe characteristics of pod related to cocoa pod borer resistance (CPB, Conopomorpha cramerella Snell.) had been identified in a series study. This research has objective to evaluate performance of the characteristics using more diverse of genetic background to select criteria for selection. Genetic materials for this study were 25 cocoa clones which be planted in Central Sulawesi for resistant evaluation. Field evaluation of the resistance were assessed using the variable of the perce...

  9. Proximate Composition, Extraction, and Purification of Theobromine from Cacao Pod Husk (Theobroma Cacao L.)

    OpenAIRE

    Van Tang Nguyen; Nghia Huu Nguyen

    2017-01-01

    The aims of this study were to determine the proximate composition of cacao pod husk as well as the optimal conditions for extraction and purification of theobromine from cacao pod husk. The results indicated that cacao pod husk had high contents of moisture and carbohydrate (87.06% and 11.03% by fresh weight, respectively), but low contents of crude protein, crude lipid, and ash (0.31%, 0.12%, and 1.48% by fresh weight, respectively). The optimal conditions for extraction of theobromine from...

  10. EVALUASI MEDIA DAN FREKUENSI PENYIRAMAN TERHADAP PERTUMBUHAN BIBIT KAKAO (Theobroma cacao L

    Directory of Open Access Journals (Sweden)

    Reki Hendrata

    2010-03-01

    Full Text Available are oftentimes met by problem of availability  irrigating water. The aims  of this research was  to study the know influence of media and frequency of sprinkler irrigation  to growth of seed of cocoa plant, the best of media and also frequency of optimum sprinkler it to growth of seed. The research was conducted in month of April until July 2007 in  Wonocatur, Banguntapan subdistrict, Bantul Regency.The experiment was arranged in a  factorial completete romdomed design with two factor. The first factor were media ( M consisted to by 4 level, namely M1 : latosol soil , M2 : latosol soil + organic munure (2:1, M3 : sphagnum, and M4 : sphagnum + organic munure (2:1. The factor second  of sprinkler frequency irrigation (P, consisted of  3 level, with  P1 : 1 day, P2 : 2 day  and P3 : 3 day once, so that obtained  12 combination of treatment three repeated. The results showed that the kinds of media have an in with high seed, leaf amount, diamater, and the length root seed. The media  sphagnum + organic manure (M4 give influence tend to compared  by better could be leaf amount, high, and the diameter. The media organic  manure (M2 which were give effect tend to compared  by better of length root grow. The sprinkler irigation  3 day once (P3 show better effect to length root grow  seed, although was not  interakasion.

  11. Toward The identification Of candidate genes involved in black pod disease resistance in Theobroma cacao L.

    Science.gov (United States)

    Increasing yield, quality and disease resistance are important objectives for cacao breeding programs. Some of the diseases, such as black pod rot (Phytophtora spp), frosty pod (Moniliophthora roreri) and witches’ broom (M. perniciosa), produce significant losses in all or in some of the various pro...

  12. Consumer perception, health information, and instrumental parameters of cupuassu (Theobroma grandiflorum) goat milk yogurts.

    Science.gov (United States)

    Costa, Marion P; Monteiro, Maria Lucia G; Frasao, Beatriz S; Silva, Vitor L M; Rodrigues, Bruna L; Chiappini, Claudete C J; Conte-Junior, Carlos A

    2017-01-01

    Although the demand for goat milk products has been growing, they have lower consumer acceptability than products derived from cow milk. However, the addition of cupuassu pulp can be used to improve the formulation of these products. For this reason, the aim of this study was to investigate the influence of new goat milk yogurt manufactured with cupuassu pulp on physicochemical properties, consumers' perceptions, and overall consumer acceptance. In addition, the effect of antioxidant health information on consumer acceptance and purchase intention of cupuassu goat milk yogurts was evaluated. The results demonstrated a positive expectation regarding linking and familiarity to goat milk products and products with cupuassu pulp. The pH, total phenolic content, lightness, redness, yellowness, and apparent viscosity were potentially affected by the addition of cupuassu, with the highest concentration of cupuassu (10%) exhibiting the greatest changes in parameters. Based on principal component analysis, partial least squares regression, and just-about-right and penalty analysis, the addition of cupuassu pulp improved some sensory attributes of goat milk yogurt, such as cupuassu aroma, cupuassu flavor, yellow color, consistency, and viscosity, which positively influenced product acceptance. In addition, antioxidant health information increased the acceptance and purchase intention of cupuassu goat milk yogurts. Taking into account the parameters investigated in this study, the best scoring formulation was goat milk yogurt with 10% cupuassu pulp. Our results suggest that cupuassu pulp can be considered a potential ingredient to improve the sensory and texture properties of goat milk yogurt. Furthermore, the antioxidant health information could be a sensory strategy to increase the acceptance of cupuassu goat milk yogurts. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  13. Kajian Fermentasi dan Suhu Pengeringan pada Mutu Kakao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Rita Hayati

    2012-10-01

    Full Text Available A study on the Fermentation and drying temperature in cacao quality was carried out. From result of research was fermentation 8 day at temperature 60 0C representing best treatment from all treatment. However accelerate drying the higher content 1.32%/hours and the decrease amount equal to 0.39%/hours. The best colour of quality cacao was produced using the fermentation (8 day and drying temperature (40 0C. It met the standard attributes rating the higher the texture was fermentation (4 day and drying temperature (60 0 C. However the fermentation 6 day and drying temperature 60 0C with high panelist acceptance.

  14. Sintesis Sabun Lunak Yang Mengandung Polihidroksi Dari Minyak Biji Kakao (Theobroma cacao,L

    Directory of Open Access Journals (Sweden)

    Chairul Saleh

    2016-06-01

    Full Text Available The research about synthesis of  Soft Soap Containing polyhydroxy from Cocoa seed Oil, beginning with the manufacture of the polyhydroxy compound wherein the polyhydroxy compound is obtained through a process of epoxidation and hydroxylation by reacting oils cocoa beans with peroxide acetic acids (peroxy acetate was obtained from the reaction of glacial acetic acid with hydrogen peroxide with an acid catalyst sulfate followed by oxirane ring opening process (hydrolysis at a temperature of 40-45  oC for 2 hours, the results obtained with the reaction yield of 60 %. In the form of a mixture of soft soap is obtained by saponification of compounds polyhydroxy with Potassium Hydroxide at a temperature 70-75  oC for 1 hour with a yield of  86,45  %.  Polyhydroxy compound and soap from the cocoa bean oil was analyzed by FT-IR spectrophotometer. Respectively iodine from the cocoa bean oil 102,93mg I / gram of oil and polyhydroxy compound is 20,21 mg I / gram of oil. HLB of soap Software of oil and polyhydroxy cocoa beans from the cocoa bean oil is determined by titration method and obtained HLB of soft soap from the cocoa bean oil was 8.74 while the polyhydroxy from cacao seed oil is 10,94. Keywords: Cocoa bean oil, Polyhydroxy compound, Soft soap polyhydroxy.

  15. Top Grafting Performance of Some Cocoa (Theobroma cacao L. Clones as Affected by Scion Budwood Number

    Directory of Open Access Journals (Sweden)

    Fakhrusy Zakariyya

    2015-12-01

    Full Text Available Reducing budwood number is an efficient effort to overcome problemsrelated with limited scion materials. The objective of this research was to studythe effect of scion budwood number in some clones on the performance of graftedcocoa seedlings. The research was conducted at Kaliwining Research Station,Indonesian Coffee and Cocoa Research Institute, Jember, Indonesia at an elevationof 48 m above sea level. Layout for this study used factorial with 2 factors inrandomized complete block design, with four replications for every treatment.The first factor was clone type, namely MCC 02 and Sulawesi 1; whereas the secondfactor was number of grafted scion budwood, namely one, two, and three graftedbudwoods. There was no interaction between clone and number of scion budwoodfor variables of shoot length, stem girth, content of total chlorophyll, chlorophylla, and chlorophyll b. Meanwhile, there was interaction for stomatal conductanceand stomatal diffusion resistance. Clone significantly affected photosynthesisand stomatal diffusion resistance, while number of scion budwood affected significantlythe shoot length. Photosynthesis activity of MCC 02 was higher comparedto Sulawesi 1. In average, stomatal diffusion resistance of Sulawesi 1 was higherthan MCC 02. The shoot length of one grafted budwood was higher than thetwo or three grafted budwood.

  16. Bioactive compounds in different cocoa (Theobroma cacao, L cultivars during fermentation

    Directory of Open Access Journals (Sweden)

    Jaqueline Fontes Moreau Cruz

    2015-06-01

    Full Text Available One component that contribute to the flavor and aroma of chocolate are the polyphenols, which have received much attention due to their beneficial implications to human health. Besides bioactive action, polyphenols and methylxantines are responsible for astringency and bitterness in cocoa beans. Another important point is its drastic reduction during cocoa processing for chocolate production and the difference between cultivars. Thus, the present study aimed to evaluate the modifications in monomeric phenolic compounds and methylxanthines during fermentation of three cocoa cultivars grown in southern Bahia. Cocoa beans from three cultivars were fermented and sun dried and monomeric phenolic compounds and methylxantines were determinated. The results showed that each cultivar have different amounts of phenolic compounds and the behaviour of them is different during fermentation. The amount of methylxantines varied but there was not a pattern for methylxantines behavior during process. In addition a huge reduction in phenolic compounds could be observed after drying. Differently of phenolic compounds, methylxantines did not have great modification after sun drying. So, the differences observed in this study between cultivars, take to the conclusion that the compounds studied in those cocoa cultivars have different behavior during fermentation and drying, which consequently, give to these cultivars differences in sensory characteristics.

  17. Competitividad de las organizaciones productoras de cacao (Theobroma cacao l en el sureste de Nicaragua

    Directory of Open Access Journals (Sweden)

    Norman Javier Saballos

    2018-02-01

    Full Text Available Se identificó los factores relacionados a la competitividad de las organizaciones de productores que comercializaron cacao durante el 2014, en la región sureste de Nicaragua. Para identificar los factores relacionados a la competitividad, se estudiaron a través de la “Cadena de Valor” cada una de las actividades primarias y de apoyo, así los indicadores de la competitividad; la productividad, calidad del producto, costos, cuota de mercado, permanencia en el mercado y la rentabilidad. El estudio se realizó mediante encuestas a representantes de siete organizaciones.

  18. Localization and identification of phenolic compounds in Theobroma cacao L. somatic embryogenesis.

    Science.gov (United States)

    Alemanno, L; Ramos, T; Gargadenec, A; Andary, C; Ferriere, N

    2003-10-01

    Cocoa breeders and growers continue to face the problem of high heterogeneity between individuals derived from one progeny. Vegetative propagation by somatic embryogenesis could be a way to increase genetic gains in the field. Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. This study was conducted to investigate the phenolic composition of cocoa flowers (the explants used to achieve somatic embryogenesis) and how it changes during the process, by means of histochemistry and conventional chemical techniques. In flowers, all parts contained polyphenolics but their locations were specific to the organ considered. After placing floral explants in vitro, the polyphenolic content was qualitatively modified and maintained in the calli throughout the culture process. Among the new polyphenolics, the three most abundant were isolated and characterized by 1H- and 13C-NMR. They were hydroxycinnamic acid amides: N-trans-caffeoyl-l-DOPA or clovamide, N-trans-p-coumaroyl-l-tyrosine or deoxiclovamide, and N-trans-caffeoyl-l-tyrosine. The same compounds were found also in fresh, unfermented cocoa beans. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. Given the antioxidant nature of these compounds, they could reflect the stress status of the tissues.

  19. Effectiveness of calcium chloride in reduction of shoot necrosis incocoa (Theobroma cacao L. in vitro propagation

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2012-05-01

    Full Text Available Various efforts have been developed for the optimization of the various stages in vitro micropropagation. The maturation stage and pre-acclimatization plantlets is an important stages that must be considered to produce vigorous plants and ready to be planted in the field. The purpose of this study was to reduced shoot tip necrosis in cocoa planlets to obtaine vigorous planlets from in vitro propagation through the addition of Calcium Chloride (CaCl2. The study used two stages of embryogenic development. The first was embryo maturation stage and the second was the shoot growth development stage. The study was arranged factorially in experiment design of Completely Randomized Design consisting of two factors i.e. concentration of CaCl2 consisted of 0, 50, 100, 150, and 200 mg/l and clones consisted of Sulawesi 1 and Sca 6. Each experiment was repeated three times, so the number of combination trials were 5x2x3=30 experimental units. The parameters observed included shoot growth percentage and vigorous planlets percentage. The results showed that the addition of CaCl2 at a concentration of 150 mg/l during maturition stage increased the embryos performance and percentage of shoot tip. However, it could not prevent the shoot tip necrosis. Whereas, the addition at a concentration of 50 mg/l during the shoot m growth development stage could reduced necrosis, suggested to increase the quality of in vitro planlets.Key words: Cocoa, necrosis, calcium chloride, somatic embryogenesis, embryos, planlets, in vitro.

  20. Localization and Identification of Phenolic Compounds in Theobroma cacao L. Somatic Embryogenesis

    OpenAIRE

    ALEMANNO, L.; Ramos, T.; GARGADENEC, A.; Andary, C.; FERRIERE, N.

    2003-01-01

    Cocoa breeders and growers continue to face the problem of high heterogeneity between individuals derived from one progeny. Vegetative propagation by somatic embryogenesis could be a way to increase genetic gains in the field. Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. This study was conducted to investigate the phenolic composition of cocoa flowers (the explants used to achieve somatic embryogenesis) and how it changes during the process, by m...

  1. Effectiveness of calcium chloride in reduction of shoot necrosis incocoa (Theobroma cacao L.) in vitro propagation

    OpenAIRE

    Sulistyani Pancaningtyas

    2012-01-01

    Various efforts have been developed for the optimization of the various stages in vitro micropropagation. The maturation stage and pre-acclimatization plantlets is an important stages that must be considered to produce vigorous plants and ready to be planted in the field. The purpose of this study was to reduced shoot tip necrosis in cocoa planlets to obtaine vigorous planlets from in vitro propagation through the addition of Calcium Chloride (CaCl2). The study used two stages of embryogenic ...

  2. Numerous clones resistant to Phytophthora palmivora in the "Guiana" genetic group of Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Jean-Marc Thevenin

    Full Text Available Cocoa black pod rot, a disease caused by Stramenopiles of the genus Phytophthora, and particularly by the pan-tropical species P. palmivora, causes serious production losses worldwide. In order to reduce the impact of these pests and diseases, preference is given to genetic control using resistant varieties and, to that end, breeders seek sources of resistance in wild cocoa trees. For instance, surveys of spontaneous cocoa trees in French Guiana between 1985 and 1995 led to the collection of abundant plant material forming a particular genetic group (the "Guiana" group. Following numerous one-off studies demonstrating the merits of this group as a source of resistance to Phytophthora, this article presents the results of a comprehensive study assessing the resistance of 186 "Guiana" clones in relation to the Guianan strain (GY 27 of P. palmivora. This study, undertaken in French Guiana, using an efficient methodology (ten series of tests and a statistical test adapted to the ordinal nature of the data confirmed that the "Guiana" genetic group does indeed constitute an important source of resistance to P. palmivora, though with some variations depending on the demes of origin. Numerous clones (59 proved to be as resistant as the SCAVINA 6 resistance control, whilst nine were statistically more resistant. The "Resistant" and "Moderately Resistant" Guianan clones totalled 108 (58% of the total tested. Some of the clones more resistant than SCAVINA 6 could be incorporated into numerous cocoa breeding programmes, particularly those that also display other notable qualities. The same applies for numerous other clones equivalent to SCAVINA 6, especially the "elite"' clones GU 134-B, GU 139-A and GU 285-A.

  3. The age of chocolate: a diversification history of Theobroma and Malvaceae

    Science.gov (United States)

    Dated molecular phylogenies of broadly distributed lineages can help to compare patterns of diversification in different parts of the world. An explanation for greater Neotropical diversity compared to other parts of the tropics is that it was an accident of the Andean orogeny. Using dated phylogeni...

  4. Impact of fermentation on nitrogenous compounds of cocoa beans (Theobroma cacao L.) from various origins.

    Science.gov (United States)

    Hue, C; Gunata, Z; Breysse, A; Davrieux, F; Boulanger, R; Sauvage, F X

    2016-02-01

    Tangential filtration technique was used to separate and quantify three different fractions of nitrogenous compounds depending on their molecular size, during cocoa fermentation. On every phenotype and origin analyzed, protein profile of non-fermented samples was similar. During fermentation course, proteins get degraded with a concomitant increase in amino acids content. Peptides between 3 and 10 kDa were observed at low levels. A strong correlation between amino acids and ammonia nitrogen, a fermentation marker was found. Attention was drawn on each fraction, and enabled to point out other phenomenon occurring during fermentation. The migration of some nitrogenous compounds towards the bean shell during fermentation was demonstrated. Acetone treatment of cocoa powder prior to SDS-PAGE led to losses of nitrogenous compounds. This result gives clues on the tanning phenomenon carried out by polyphenols on nitrogenous compounds, phenomenon which increases during fermentation. Copyright © 2015. Published by Elsevier Ltd.

  5. Streptomyces cameroonensis sp. nov., a Geldanamycin Producer That Promotes Theobroma cacao Growth.

    Science.gov (United States)

    Boudjeko, Thaddée; Tchinda, Romaric Armel Mouafo; Zitouni, Mina; Nana, Joëlle Aimée Vera Tchatchou; Lerat, Sylvain; Beaulieu, Carole

    2017-03-31

    The taxonomy of an actinobacterial strain, designated JJY4(T), was established using a polyphasic approach. JJY4(T) was isolated from the rhizosphere of Chromolaena odorata in Yaoundé (Cameroon) during a project for the selection of biological control agents. Strain JJY4(T) exhibited antimicrobial activities against bacteria, fungi, and oomycetes. Strain JJY4(T) also exhibited the traits of plant growth-promoting rhizobacteria such as the solubilization of inorganic phosphate, production of siderophores and indole-3-acetic acid, and 1-aminocyclopropane-1-carboxylate deaminase activity. In planta assays performed on cocoa plantlets confirmed that strain JJY4(T) exhibited strong abilities to promote plant growth and protect against Phytophthora megakarya, the main causal agent of cocoa pod rot. The formation of rugose-ornamented spores in spiral spore chains by strain JJY4(T) is a typical feature of members found in the Streptomyces violaceusniger clade and, similar to some members of the clade, strain JJY4(T) produces geldanamycin. A phylogenetic analysis based on 16S rRNA gene sequences confirmed this classification and suggests that strain JJY4(T) be added to the subclade constituted of the type strains Streptomyces malaysiensis DSM 41697(T) and Streptomyces samsunensis DSM 42010(T). However, DNA-DNA relatedness and physiological characteristics allowed for the differentiation of strain JJY4(T) from its closest phylogenetic relatives. Based on these results, strain JJY4(T) (=NRRL B-65369, =NBRC 112705) appears to represent a novel species in the S. violaceusniger clade for which the proposed name is Streptomyces cameroonensis sp. nov.

  6. Use of secondary somatic embryos promotes genetic fidelity in cryopreservation of cocoa (Theobroma cacao L.)

    National Research Council Canada - National Science Library

    Fang, Jong-Yi; Wetten, Andy; Adu-Gyamfi, Raphael; Wilkinson, Mike; Rodriguez-Lopez, Carlos

    2009-01-01

    .... An effective encapsulation-dehydration based cryopreservation system has been developed for cocoa but because the somatic embryos used for freezing arise after a protracted period of callus culture...

  7. Determination of Selection Index of Cocoa (Theobroma Cacao L.) Yield Traits Using Regression Methods

    OpenAIRE

    Setyawan, Bayu; Taryono; Mitrowihardjo, Suyadi

    2016-01-01

    The increasing chocolate consumption has not been followed by growing production of dry cocoa beans. In order to support the increase in cocoa production, planting materials with high yield are needed. The objective of this research was to determine the components of cocoa traits affecting weight of dry cocoa beans, and set a selection index for superior cocoa trees. The experiment material were four cocoa hybrid populations of which their family ancestry were unknown, and were planted on Sam...

  8. Chemical evaluation and digestibility of cocoa (Theobroma cacao) byproducts fed to goats.

    Science.gov (United States)

    Aregheore, E M

    2002-07-01

    A study was undertaken to evaluate and compare the chemical composition of the cocoa byproducts CPH (cocoa pod husk), CS (cocoa shell) and CD (cocoa dust), and to establish a rational use of CS and CD in the diets of growing goats. CD had a high crude protein (CP) content of 15.9%, while CS and CPH had 13.8% and 6.7%, respectively. The byproducts were high in crude fibre (CF) content. Among the byproducts, CD had the highest ether extract value (22.0%). Fifteen growing goats, 18-20 months of age, with pre-experimental body weights of 20.9 +/- 0.33 kg, were randomly allotted to three diets in growth studies. In diet 1, dried brewers' grain (DBG) served as the control, while the other two diets had CS or CD plus DBG. The dry matter intake (DMI) was 570, 530 and 486 g/head per day for the control, CS + DBG and CD + DBG diets, respectively. The growth rate differed significantly among the goats offered the diets (p < 0.05). Dry matter (DM), crude protein (CP), crude fibre (CF), organic matter (OM) and gross energy (GE) digestibility were significantly higher (p < 0.05) in the goats on the control diet than in those on CS + DBG or CD + DBG. The DM, CP and OM in the CS + DBG diet were more digestible (p < 0.05) than those in the CD + DBG diet. The inclusion of DBG in the CS and CD diets improved their use by the goats.

  9. Investigation of Endophytic Fungi Towards Vascular Streick Dieback Oncobasidium theobromae on Seedling of Cocoa Plant

    OpenAIRE

    7.Nur, Amin; Muslim, Salam; ", Asman; Ryan; Muh. Danial, Rahim

    2016-01-01

    Endophytic fungi are able to infect a wide range of host plant, which this is in some cases in plants associated to endophytes have shown increased resistance to plant pathogens, particularly fungal pathogens. The research aimed to investigate of endophytic fungi e.g Aspergillus sp, Beauveria sp, Culvularia sp, and Trichoderma sp isolated from healthy branches of cocoa plant towards vascular streak dieback disease on Seedling of cocoa plant in the field condition. All of fungal endophytes is...

  10. The 1,3,7,9-tetramethyluric acid content of cupu (Theobroma grandiflorum Schum.)

    OpenAIRE

    Baumann, T. W.; Wanner, H.

    1980-01-01

    Resumo Nas sementes do cupuaçu, Vasconcelos et. al. (1975) não encontraram, ao contrário do trabalho de Freise (1935), teobromina nem cafeína, mas sim ácido 1, 3, 7, 9 — tetrametilúrico TMU. Foram determinados os conteúdos do TMU pelo método de diluição isotópico, usando anel marcado; TMU foi sintetizado para este fim. Os conteúdos médios das sementes são apresentados.

  11. Pengaruh Media Tanam dan Pupuk Super Bionik Cair Terhadap Pertumbuhan Bibit Kakao Theobroma cacao L.)

    OpenAIRE

    Napitupulu, Lastri

    2012-01-01

    The purposes of this research was to test the effect of growing media and Super Bionik Liquid fertilizer on tiic growing of cocoa seedling and to find the replacement for top soil as growing in the nursery, which was done at it. Pintu Air IV Gg. Ternak Simalingkar B, Med an from March until July 2004. this research was using Complete Randomized Block Design with 2 treatment, the first factor was growing media consisting of 3 levels: M0 (andosol top soil), Mi (andosol sub soil : sand : compose...

  12. Strategies for Control of Moniliophthora roreri and Moniliophthora perniciosa in Theobroma cacao L.: A Systematic Review

    Directory of Open Access Journals (Sweden)

    Paola Andrea Tirado-Gallego,

    2016-09-01

    Full Text Available One of the most important limitations of cocoa production worldwide is primarily diseases caused by the pathogenic fungi of the genus Moniliophthora sp., especially, Moniliophthora roreri and Moniliophthora perniciosa, causing moniliasis and the witches' broom disease, respectively; both diseases are highly invasive and endemic in cocoa. The objective of this study was to describe the control strategies that can be used to handle the moniliasis and witches' broom diseases. This study was conducted in accor-dance with the Prisma (Preferred Reporting Items for Systematic Reviews and Meta-Analyses statement, for which a systematic literature search in the ScienceDirect, Springer Link and Scopus databases was used. Original investigation articles over the last 12 years were included, inclusion and exclusion criteria were also applied. In countries like Brazil and Costa Rica, the year with most reports of related articles was 2008. The most used strategies for the disease control are the phytosanitation, the copper-based fungicides and biologic agents control of fungus and bacteria, specially, Trichoderma sp. and Bacillus sp. One of the most recommended methodologies on the studied articles was the optimization of treatments employing the combination of physical, biological and chemical agents

  13. Relationship between Physiological Characteristic and Bean Quality on Some Cocoa Clones (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Indah Anita Sari

    2015-12-01

    Full Text Available Photosynthesis is one of the physiological process that influence the bean weight and this process related with the efectiveness of the stomata character and chlorophyll content in the leaves. The research was conducted at Kaliwining Research Station, Indonesian Coffee and Cocoa Research Institute. Design of experiment was randomized complete block design (RCBD consisted of six clones as treatment were Sulawesi 1, Sulawesi 2, Sca 6, ICS 60, TSH 858, ICCRI 03, PA 300. Each treatment was replicated three times.  Stomata resistance diffusion, tranpiration,the content of chlorophyll a, chlorophyll b, chlorophyll total (a+b, bean number and bean weight were observed. The resuts  of experiment showed that  difference in chlorophyll a, chlorophyll b, chlorophyll total (a+b, stomata resistance diffusion, bean number and bean weight existed within  six clones tested. Transpiration rate did not show the significantly different between six clones tested. Sulawesi 1 showed the highest content of chlorophyll a and  ICS 60 and ICCRI 03 showed higher content of chlorophyll b than the other clones. Chlorophyll a, b and total (a+b showed positively influence on bean number and bean weight. Transpiration rate had negatively influence to bean number per pod, on the otherhand it showed positively influence to bean weight. Chlorophyll total (a+b showed high genetic variance (σg2, high phenotypic variance (σf2  and high estimated value of heritability (H.  The chlorophyll a,b had moderate genetic variance, moderate phenotypic variance and high of estimated value of heritability.  Chlorophyll total (a+b could be used a selection criteria based on the value of correlation, genetic variance, phenotypic variance and estimated value of heritability would give high opportunity in selection process. 

  14. Relationships Between Black Pod and Witches'-Broom Diseases in Theobroma cacao.

    Science.gov (United States)

    Thevenin, J-M; Umaharan, R; Surujdeo-Maharaj, S; Latchman, B; Cilas, C; Butler, D R

    2005-11-01

    ABSTRACT Field observations were conducted from 1998 to 2001 at the International Cocoa Genebank, Trinidad, to evaluate 57 cacao clones for resistance to black pod (BP) and witches'-broom (WB) diseases (caused by Phytophthora sp. and Crinipellis perniciosa, respectively). Each month ripe pods were harvested and the number of healthy and diseased was recorded. The number of brooms on vegetative shoots was recorded three times a year on selected branches. Twenty-three clones showed less than 10% of infection for both BP and WB on pods. Among those, eight clones showed an absence of brooms on the observed branches: IMC 6, MAN 15/60 [BRA], PA 67 [PER], PA 195 [PER], PA 218 [PER], PA 296 [PER], PA 303 [PER], and POUND 32/A [POU]. Broad-sense heritability was estimated at 0.38 and 0.57 for WB disease on pods and shoots, respectively, and at 0.51 for BP disease. Genetic correlation between WB disease on pods and on shoots was low and estimated at 0.39, whereas the correlation between WB and BP diseases on pods was 0.48. To choose putative parents for breeding schemes, it is suggested that clones are first assessed for their level of resistance to WB on shoots, and the most promising individuals are screened for BP with a detached pods test. Further studies are needed to confirm whether the level of resistance to WB on pods can be predicted using an early test on seedlings.

  15. Adding value to cocoa (Theobroma cacao L.) germplasm information with domestication history and admixture mapping.

    Science.gov (United States)

    Marcano, Maria; Pugh, Tatiana; Cros, Emile; Morales, Sonia; Portillo Páez, Elvis A; Courtois, Brigitte; Glaszmann, Jean Christophe; Engels, Jan M M; Phillips, Wilbert; Astorga, Carlos; Risterucci, Ange Marie; Fouet, Olivier; González, Ventura; Rosenberg, Kai; Vallat, Isabelle; Dagert, Manuel; Lanaud, Claire

    2007-03-01

    A sound understanding of crop history can provide the basis for deriving novel genetic information through admixture mapping. We confirmed this, by using characterization data from an international collection of cocoa, collected 25 years ago, and from a contemporary plantation. We focus on the trees derived from three centuries of admixture between Meso-American Criollo and South American Forastero genomes. In both cacao sets of individuals, linkage disequilibrium extended over long genetic distances along chromosome regions, as expected in populations derived from recent admixture. Based on loose genome scans, genomic regions involved in useful traits were identified. Fifteen genomic regions involved in seed and fruit weight variation were highlighted. They correspond to ten previously identified QTLs and five novel ones. Admixture mapping can help to add value to genetic resources and thus, help to encourage investment in their conservation.

  16. Theobroma cacao L., the Food of the Gods: a scientific approach beyond myths and claims.

    Science.gov (United States)

    Rusconi, M; Conti, A

    2010-01-01

    Cocoa beans are rich source of polyphenols, contributing about 10% of the dry weight of the whole bean and its derivative chocolate, particularly dark chocolate, is considered one of the major contributors of antioxidants to the American diet after fruits and vegetables. At present the wide variation in cocoa processing and in the content and profile of polyphenols make it difficult to determine to what extent the findings about positive effects expressed in different studies, translate into tangible clinical benefits. Moreover, before claiming any healthy properties to a plant, natural product or food item on human subject, a basic research project approved by scientific and ethical commissions has to be performed. Until now the definition, composition, manufacturing specifications, packaging and labelling of cocoa and chocolate products in Europe, are regulated by "Directive 2000/36/EC of the European parliament and of the council". The definitions take changes in consumer tastes, chocolate composition and labelling into account, but do not consider the real potential of healthy, beneficial and nutraceutical effects. In fact, they fail to establish an official analytical methodology for the quantification of phenolic compounds in cocoa and chocolate. Moreover quantification of these compounds is not used in product classification. This article reviews many qualitative differences of cocoa and chocolate, in particular dark chocolate, aiming to establish the different implications for public health through the use of the analyzed concentration of polyphenols in cocoa products. Copyright 2009 Elsevier Ltd. All rights reserved.

  17. Use of a proteolytic enzyme in cocoa (Theobroma cacao L. processing

    Directory of Open Access Journals (Sweden)

    Edy Sousa de Brito

    2004-08-01

    Full Text Available Protein hydrolysis using an exogenous protease on cocoa nibs was performed to verify the formation of precursors and the effect on cocoa flavour. An experimental design was used to check the influence of temperature (30 to 70 ºC and enzyme : substrate ratio [E/S] (97.5 to 1267.5 U g-1 of protein. The % Degree of Hydrolysis (% DH was affected mainly by [E/S] leading to a 4-fold increase (from 5 to 20 % after 6 hours of treatment. During cocoa nibs roasting, there was a greater consumption of hydrolysis compounds in the sample treated with protease as compared to the control, indicating their participation in the Maillard reaction. An increased perception of chocolate flavour and bitter taste was observed in a product formulated with protease treated cocoa.Foi feita uma hidrólise da proteína dos nibs de cacau usando-se uma protease para verificar a formação de precursores e o efeito sobre o sabor do cacau. Um desenho experimental foi usado para verificar a influência da temperatura (30 a 70 ºC e razão enzima : substrato [E/S] (97,5 a 1267,5 U g-1 de proteína. O grau de hidrólise % (%DH foi afetado principalmente pela [E/S], tendo sofrido um aumento de 4 vezes (de 5 para 20 % após 6 horas de tratamento. Durante a torração dos nibs houve um consumo maior dos compostos de hidrólise na amostra tratada com protease em comparação com o controle, indicando a participação desses compostos na reação de Maillard. Foi observado um aumento na percepção do sabor de chocolate e do gosto amargo em um produto formulado com o cacau tratado com a protease.

  18. Identification of differentially expressed genes involved in self-incompatibility in Theobroma cacao L.

    Science.gov (United States)

    Increasing yield, quality and disease resistance are important objectives for cacao breeding programs. However, self-incompatibility (SI) often restricts progress, as crosses between certain cacao germplasm accessions and breeding lines are only partially successful. Various events are involved in t...

  19. Parentage analysis and outcrossing patterns in cacao (Theobroma cacao L.) farms in Cameroon.

    Science.gov (United States)

    Efombagn, M I B; Sounigo, O; Eskes, A B; Motamayor, J C; Manzanares-Dauleux, M J; Schnell, R; Nyassé, S

    2009-07-01

    The present study investigates the parentage of farm accessions in Cameroon using data from 12 microsatellite loci. Bayesian analysis suggests that 25.5% of the 400 farm accessions studied is still closely related to the traditional Amelonado variety called 'German Cocoa' by the farmers. Another 46.3% of the farm accessions were found to be direct descendants (20.8% first-generation (F1) hybrids and 25.5% selfed genotypes) from 24 parental clones used in biclonal seed gardens (BSGs) established in the 1970s in southern and western Cameroon. Furthermore, 28.3% of farm accessions appeared to descent from uncontrolled pollination events in cacao farms, which could be related to a common practice of cacao growers to use seeds collected in their own farm for new plantings. All farm accessions descending from BSG could be individually related through parentage analysis to the 24 progenitors of the BSG. Only 25% of progenies distributed from BSG corresponded to F1 hybrids combinations originally planned to be released. Significant biparental inbreeding estimates were observed for all 'traditional' farms and for most 'F1 hybrids' farms due to presence of a high proportion of selfed accessions. Biparental inbreeding occurs when plants receive pollen from genetically related neighbors. High levels of outcrossing observed in 'mixed' farms might be explained by the admixture of traditional varieties and BSG progenies. The implications of our finding for management of seed gardens and for further breeding using farm accessions in Cameroon are discussed.

  20. Molecular, Biochemical and Ultrastructural Changes Induced by Pb Toxicity in Seedlings of Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Graciele Santos Monteiro Reis

    Full Text Available Pb is a metal which is highly toxic to plants and animals, including humans. High concentrations of Pb have been observed in beans of T. cacao, as well as in its products. In this work, we evaluated the molecular, biochemical, and ultrastructural alterations in mature leaves and primary roots of seedlings of two progenies of T. cacao, obtained from seed germination in different concentrations of Pb (0, 0.05, 0.1, 0.2, 0.4, 0.8 g L(-1, in the form of Pb(NO32. The progenies resulted from self-fertilization of Catongo and a cross of CCN-10 x SCA-6. The Pb, supplied via seminal, caused alterations in the ultrastructures of the mesophyll cells and in the amount of starch grains in the chloroplasts. The dosage of substances reactive to thiobarbituric acid showed that Pb induced lipid peroxidation. The activity of guaiacol peroxidases and the expression of genes associated to synthetase of phytochelatin, SODcyt and PER increased in response to Pb. In addition, there was alteration in the expression of stress-related proteins. The progeny of CCN-10 x SCA-6 was more tolerant to Pb stress when compared to Catongo, since: (i it accumulated more Pb in the roots, preventing its translocation to the shoot; (ii it presented higher activity of peroxidases in the roots, which are enzymes involved in the elimination of excess of reactive oxygen species; and (iii increased expression of the gene in the phytochelatin biosynthesis route. The results of the proteomic analysis were of paramount importance to differentiate the defense mechanisms used by both progenies of T. cacao.

  1. Numerous clones resistant to Phytophthora palmivora in the "Guiana" genetic group of Theobroma cacao L.

    Science.gov (United States)

    Thevenin, Jean-Marc; Rossi, Vivien; Ducamp, Michel; Doare, Fabien; Condina, Virgile; Lachenaud, Philippe

    2012-01-01

    Cocoa black pod rot, a disease caused by Stramenopiles of the genus Phytophthora, and particularly by the pan-tropical species P. palmivora, causes serious production losses worldwide. In order to reduce the impact of these pests and diseases, preference is given to genetic control using resistant varieties and, to that end, breeders seek sources of resistance in wild cocoa trees. For instance, surveys of spontaneous cocoa trees in French Guiana between 1985 and 1995 led to the collection of abundant plant material forming a particular genetic group (the "Guiana" group). Following numerous one-off studies demonstrating the merits of this group as a source of resistance to Phytophthora, this article presents the results of a comprehensive study assessing the resistance of 186 "Guiana" clones in relation to the Guianan strain (GY 27) of P. palmivora. This study, undertaken in French Guiana, using an efficient methodology (ten series of tests and a statistical test adapted to the ordinal nature of the data) confirmed that the "Guiana" genetic group does indeed constitute an important source of resistance to P. palmivora, though with some variations depending on the demes of origin. Numerous clones (59) proved to be as resistant as the SCAVINA 6 resistance control, whilst nine were statistically more resistant. The "Resistant" and "Moderately Resistant" Guianan clones totalled 108 (58% of the total tested). Some of the clones more resistant than SCAVINA 6 could be incorporated into numerous cocoa breeding programmes, particularly those that also display other notable qualities. The same applies for numerous other clones equivalent to SCAVINA 6, especially the "elite"' clones GU 134-B, GU 139-A and GU 285-A.

  2. A physiological production model for cocoa (Theobroma cacao): model presentation validation and application

    NARCIS (Netherlands)

    Zuidema, P.A.; Leffelaar, P.A.; Gerritsma, W.; Mommer, L.; Anten, N.P.R.

    2005-01-01

    In spite of the economic importance and extensive agronomic literature on cocoa, no physiological production model has been developed for cocoa so far. Such a model would be very useful to compare yields in different climates and cropping systems, and to set the agenda for future agronomic research.

  3. Molecular, physiological and biochemical responses of Theobroma cacao L. genotypes to drought

    Science.gov (United States)

    Six months-old seminal plants of 36 cacao genotypes with distinct morphological, genetical and geographical characteristics were subjected to two water regimes (control and drought) to assess, under greenhouse conditions, the effects of water deficit on growth, chemical composition and oxidative str...

  4. Physiological and biochemical responses of Theobroma cacao L. genotypes submitted to flooding

    Science.gov (United States)

    Flooding is common in lowlands and areas with high rainfall or excessive irrigation. One major effect of this stress is the deprivation of O2 in the root zone, which affects several biochemical and morphophysiological plants processes. This study aimed to elucidate biochemical and physiological char...

  5. Effect of polyethylene glycol 6000 and storage period on seed quality of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Astiti Rahayu

    2014-05-01

    Full Text Available Increased productivity of cocoa needs high quality of cocoa seeds which are generally provided by certified seed gardens located far from smallholders farm, where seed delivery takes long time and may reduce physiological quality of seeds. One effort to maintain the seed quality is by treatment the seeds with polyethylene glycol6000 (PEG 6000. This study was aimed to study the interaction of PEG 6000 concentration and storage period on cocoa seed quality, and to determine the best concentration of PEG 6000 and storage period to maintain cocoa seed quality. The research was conducted in seed storage room, seed laboratory and green houseof PPPPTK, Cianjur. The experimental design used was a factorial completely randomized design and each combination treatment repeated three times. The first factor was concentration of PEG 6000 of 0%, 20%, 40%, and 60%, and the second factor was the storage period of 3 weeks, 6 weeks, 9 weeks, and 12 weeks. The results showed that concentration of PEG 60% with three weeks storage period was able to minimize the number of moldy seeds. The concentration of PEG 20%, 40%, and 60% were able to prevent seed germination in storage until six weeks. Concentration of PEG 6000 20% was able to maintain moisture content, seed germination, and germination rate.Key words:cocoa seed, storage, recalcitrant, PEG

  6. EFEK KONSUMSI MINUMAN BUBUK KAKAO (Theobroma cacao L. BEBAS LEMAK TERHADAP SIFAT ANTIOKSIDATIF LIMFOSIT SUBYEK PEREMPUAN [The Effect of Fat Free Cocoa (Theobroma Cacao L. Powder Drinks Consumption on Antioxidative Activity of Lymphocyte of Women Subjects

    Directory of Open Access Journals (Sweden)

    Erniati1

    2012-06-01

    Full Text Available The health benefits of cocoa both in vivo and in vitro have been reported in many studies. Cocoa is a rich source of flavonoids known to have antioxidant activity, such as catechin, epicatechin and procyanidin. The aim of this research was to evaluate the effect of fat free cocoa powder drink consumption on antioxidative properties and proliferation activities of woman lymphocyte. Healthy woman subjects were divided into cocoa group (n = 9 and control group (n = 9. Cocoa powder drink containing skim milk and sugar was given to the cocoa groups every morning for 25 days. The control group received only water containing skim milk and sugar. Both cocoa and control group received physical medical checkup at the beginning and at the end of the intervention. Their peripheral blood was taken for lymphocyte antioxidant analysis. The measured antioxidant properties consisted of antiradical activity by DPPH method, malonaldehyde (MDA and glutathione levels. The data of cocoa group showed that there was a significant increase (p ≤ 0.05 in antiradical level from 31+11.2 to 40.19+7.42% and glutathione from 48.2±10.5 to 66.7±15.9 μmol/land a decrease in MDA level in the lymphocyte (p < 0.05 from 2.98±2.21 to 1.29±0.33 μmol/las compared to the control group (from 25.77±6.9 to 26.79±6.12%; 34.7±20.7 to 37.8±19.2 μmol/land 3.01±1.53 to 2.069±0.707 μmol/l respectively after consumption of the cocoa powder drink. The results of this research revealed that fat free cocoa powder has a strong antioxidant activity which was manifested up to the blood cells.

  7. ANÁLISIS DE LA ESTRUCTURA ARBÓREA DEL SISTEMA AGROFORESTAL DE CACAO (Theobroma cacao L. EN EL SOCONUSCO, CHIAPAS - MÉXICO Analysis of the Structure Arborea Agroforestry System Cocoa (Theobroma cacao L. in Soconusco, Chiapas - Mexico

    Directory of Open Access Journals (Sweden)

    HUGO A ROA-ROMERO

    Full Text Available Se determinó la abundancia, riqueza, importancia, equidad y diversidad de los árboles encontrados en sistemas agroforestales de cacao, del Soconusco, Chiapas, México. La presente investigación, se desarrolló en la región costera del Soconusco, ubicada al sur del estado de Chiapas; se muestrearon los municipios de Huehuetán, Tapachula y Tuxtla Chico, por ser los más representativos en área sembrada de cacao. En cada municipio, se establecieron al azar siete parcelas temporales de 50 x 50 m cada una, lo que suma en total 5,25 hectáreas , en las cuales se registraron variables como el diámetro a la altura del pecho (DAP: 1,3 m sobre el nivel del suelo, área basal, y sombrío en el cacaotal. Se encontraron 46 especies agrupadas en 21 familias, las especies con el mayor valor de importancia fueron Mangifera indica y Pouteria sapota, convirtiéndose en las especies de sombra más frecuentemente encontradas. La composición florística denotó una mayor similitud en los municipios de Tapachula y Huehuetán, como lo muestra el mayor porcentaje del índice de Jaccard y en lo que respecta a diversidad, el municipio de Tuxtla Chico presentó el mayor valor según el índice de Shannon. Este estudio determina la existencia de una cobertura definitiva de preferencia asociada a los árboles frutales.The abundance, wealth, size, fairness and diversity of trees found in cacao agroforestry systems was determined in Soconusco , Chiapas , Mexico . This research was conducted in the coastal region of Soconusco, located in the southern state of Chiapas . The municipalities of Huehuetán Tapachula and Tuxtla Chico were sampled, as the most representative in area planted with cocoa. In each municipality, were created at random seven parcels temporary 50 x 50 m each, which amount totalling 5.25 hectares , in which there were variables such as the diameter at breast height (DBH: 1.3 m above the soil, basal area, and grim in the cacaotal. We found 46 species grouped into 21 families, species with higher importance were Mangifera indica and Pouteria sapota, becoming species of shade most frequently encountered. The floral composition noted greater similarity in the municipalities of Tapachula and Huehuetán, as shown by the largest percentage index Jaccard and with regard to diversity, the town of Tuxtla Chico presenting the greatest value as the index Shannon . This study determined the existence of a definitive coverage preferably associated with fruit trees.

  8. Microbiological analysis of coliforms and mesophilic aerobic spore formers in gamma irradiated cocoa beans (Theobroma cacao L.); Analise microbiologica de coliformes e aerobicos mesofilos em amendoas de cacau (Theobroma cacao L.) irradiadas com radiacao gama

    Energy Technology Data Exchange (ETDEWEB)

    Barata, Anderson Demetrio; Mansur Netto, Elias [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Faculdade de Farmacia

    1995-12-31

    The presence of coliforms in processed foods is an useful indicator of post-sanitization and post processing contamination, and members of the mesophilic aerobic spore formers have great importance in food spoilage. Spore - forming aerobic bacilli have been observed in fermenting cocoa in Jamaica and West Africa. The results of this work has shown a considerable reduction of the mesophilic aerobic spore formers in irradiated Brazilian Comun Cocoa beans as long as the irradiation dose was increased from 1.05 to 3.99 kGy. The presence of coliforms irradiated has not been found even in the coroa beans with the dose of 1.05 kGy. (author). 4 refs., 1 tab.

  9. Keberhasilan sambungan pada beberapa jenis batang atas dan famili batang bawah kakao (Theobroma cocoa L.. (Grafting performance of some scion clones and root-stock family on cocoa (Theobroma cocoa L.

    Directory of Open Access Journals (Sweden)

    Indah Anita Sari

    2012-08-01

    Full Text Available Differences in performance of grafting seedling were estimated from effect of using the root-stock and scion clones. This research aimed to study the differences of performance of some root-stock and scion clones on grafting seedling. The study used split plot design. First factor was root-stock consisted of ICS 60, Sca 6, Sca 12 and KW 165 and the second factor were 12 scions clones consisted of ICCRI 01, ICCRI 04, ICCRI 05, DR 2, Sulawesi 1, Sulawesi 2, KW 516, KW 514, KW 617, KW 570, KEE 2, and KW 604. There were three replication in each treatment and each replication consisted of 15 samples. Viability, lingkage diameter, ratio of root-stock and scion, hight of shoot, number of leaves and shoot were observed. The study showed that differences of root-stock just affected viability, lingkage diameter, and high of shoot. Scion clones factor affected to all of the characters. Their interaction caused the differences of all characters except of the number of shoot. Root-stock Sca 6 showed the lowest viability and number of the shoot, however root-stock KW 165 and ICS 60 showed the best performance to all parameters. The cluster analysis was done based on growth parameters and viability on lingkage distance of 15. There were three clusters; cluster 1 (KW 570, cluster 2 (ICCRI 04, ICCRI 05, Sulawesi 1, Sulawesi 2, KW 514, KW 165 and cluster 3 (ICCRI 01, DR 2, KW 516, KW 617, KW 604. Correlation analysis showed that main factor which affected the high viability root-stock diameter and diameter ratio of root-stock and scion were used.

  10. Characterization of Cocoa (Theobroma cacao L.) Farming Systems in the Norte de Santander Department and Assessment Their Sustainability / Caracterizacion de los Sistemas de Produccion de Cacao (Theobroma cacao L.) en el Departamento de Norte de Santander

    National Research Council Canada - National Science Library

    Jesús Arturo Ramírez Sulvarán; Alina Katil Sigarroa Rieche; Rómulo Alberto Del Valle Vargas

    2014-01-01

    .... However, there is a lack of information about the cocoa production systems in the region which is needed for the implementation of effective plans to improve their performance and sustainability...

  11. Evaluación in vitro de Microorganismos Nativos por su Antagonismo contra Moniliophthora roreri Cif & Par en Cacao (Theobroma cacao L. In vitro evaluation of Native Microorganisms for their Antagonism against Moniliophthora roreri Cif & Parin Cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Villamil Carvajal

    2012-06-01

    Full Text Available Resumen. La moniliasis, causada por Moniliophthora roreri Cif & Par, se ha convertido en la principal enfermedad limitante de la producción de cacao en Colombia y otros países. Con el objetivo de explorar alternativas para el biocontrol de esta enfermedad, hongos y bacterias aislados de frutos y suelo rizosférico de lotes plantados con cacao fueron evaluados por su antagonismo contra M. roreri. La evaluación se realizó en cajas Petri con PDA, para lo cual se colocó en el centro de las mismas, un disco de 5 mm de diámetro colonizado por el patógeno y a 3 cm del borde, sobre los ejes horizontal y vertical, cada uno de los aislamientos. Los microorganismos nativos que inicialmente mostraron antagonismo fueron posteriormente evaluados in vitro por su capacidad de restringir el crecimiento y esporulación de M. roreri. Los resultados indicaron que de 53 aislamientos de frutos y suelo rizosférico, 7 mostraron antagonismo contra M. roreri y entre ellos los más efectivos fueron los hongos H5 y H20 y la bacteria B3, los hongos para la restricción tanto del crecimiento como de la esporulación y la bacteria para el crecimiento. El hongo H20 inhibió en su totalidad el crecimiento de M. roreri. Estos resultados hacen posible que estos aislamientos sean promisorios para su incorporación al manejo de la enfermedad bajo condiciones de campo. De acuerdo con la caracterización morfológica y las pruebas bioquímicas los hongos pertenecen al género Trichoderma y la bacteria al género Bacillus.Abstract. The moniliasis, caused by Moniliophthora roreri Cif & Par, has become the principal disease limiting cocoa production in Colombia and other countries. With the objective of exploring alternatives for the biocontrol of this disease, fungi and bacteria isolated from cocoa fruits and rhizospheric soil from plots planted to cocoa trees were evaluated for their antagonism against M. roreri. The evaluation was conducted in Petri dishes containing PDA, by placing in the center of the plate a 5 mm PDA disk colonized by the pathogen and at 3 cm of the edge, on the X and Y axis, each of the isolated microorganisms. The isolates which initially showed antagonism were then evaluated in vitro for their capacity to inhibit the growth and sporulation of M. roreri. The results indicated that of the 53 isolated microorganisms, seven showed antagonism against M. roreri and among them the most effective were the fungi H5 and H20 and the bacteria B3, the fungi for the restriction of the growth and sporulation and the bacteria for the growth. The fungus H20 totally inhibited the growth of M. roreri. These results generate the possibility that these promissory isolates can be incorporated to the management of the disease under field conditions. According to the morphological characterization and the biochemical tests both fungi belong to the genus Trichoderma and the bacteria to the genus Bacillus.

  12. Characterization of a stearoyl-acyl carrier protein desaturase gene family from chocolate tree, Theobroma cacao L

    Science.gov (United States)

    Zhang, Yufan; Maximova, Siela N.; Guiltinan, Mark J.

    2015-01-01

    In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP) desaturase (SAD). The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance. PMID:25926841

  13. Bacillus subtilis and Enterobacter cloacae endophytes from healthy Theobroma cacao L. trees can systemically colonize seedlings and promote growth.

    Science.gov (United States)

    Leite, Hianna Almeida Câmara; Silva, Anderson Barbosa; Gomes, Fábio Pinto; Gramacho, Karina Peres; Faria, José Cláudio; de Souza, Jorge Teodoro; Loguercio, Leandro Lopes

    2013-03-01

    Clonal genotypes resistant to fungal diseases are an important component of the cocoa production system in southeastern Bahia state (Brazil), so that technologies for faster production of stronger and healthier plantlets are highly desirable. In this study, the effects of inoculated bacterial endophytes isolated from healthy adult cacao plants on seedlings, and aspects related to inoculation methods, colonization patterns, and photosynthesis were investigated. Sequencing of 16S rRNA, hsp-60, and rpo-B genes placed the wild-type isolates within the species Enterobacter cloacae (isolates 341 and 344) and Bacillus subtilis (isolate 629). Spontaneous rifampicin-resistant (rif(R)) variants for 344 were also produced and tested. Endophytic application was either by immersion of surface sterilized seeds in bacterial suspensions or direct inoculation into soil, 20 days after planting non-inoculated seeds into pots. Results from in vitro recovery of inoculated isolates showed that the wild-type endophytes and rif(R) variants systemically colonized the entire cacao seedlings in 15-20 days, regardless of the inoculation method. Some endophytic treatments showed significant increases in seedlings' height, number of leaves, and dry matter. Inoculation methods affected the combined application of endophytes, which maintained the growth-promotion effects, but not in the same manner as in single applications. Interestingly, the 344-3.2 rif(R) variant showed improved performance in relation to both the wild type and another related variant. Photosynthetic rates and stomatal conductance increased significantly for some endophytic treatments, being partially associated with effects on growth and affected by the inoculation method. The results suggest that E. cloacae and B. subtilis endophytes from healthy adult plants (not transmitted by seeds) were able to promote vegetative growth on cacao seedlings. The development of products for large-scale use in seedlings/plantlets production systems was discussed.

  14. Two Theobroma cacao genotypes with contrasting pathogen tolerance show aberrant transcriptional and ROS responses after salicylic acid treatment.

    Science.gov (United States)

    Fister, Andrew S; O'Neil, Shawn T; Shi, Zi; Zhang, Yufan; Tyler, Brett M; Guiltinan, Mark J; Maximova, Siela N

    2015-10-01

    Understanding the genetic basis of pathogen susceptibility in various crop plants is crucial to increasing the stability of food, feed, and fuel production. Varietal differences in defence responses provide insights into the mechanisms of resistance and are a key resource for plant breeders. To explore the role of salicylic acid in the regulation of defence in cacao, we demonstrated that SA treatment decreased susceptibility to a pod rot pathogen, Phytophthora tropicalis in two genotypes, Scavina 6 and Imperial College Selection 1, which differ in their resistance to several agriculturally important pathogens. Transient overexpression of TcNPR1, a major transcriptional regulator of the SA-dependent plant immune system, also increased pathogen tolerance in cacao leaves. To explore further the genetic basis of resistance in cacao, we used microarrays to measure gene expression profiles after salicylic acid (SA) treatment in these two cacao genotypes. The two genotypes displayed distinct transcriptional responses to SA. Unexpectedly, the expression profile of the susceptible genotype ICS1 included a larger number of pathogenesis-related genes that were induced by SA at 24h after treatment, whereas genes encoding many chloroplast and mitochondrial proteins implicated in reactive oxygen species production were up-regulated in the resistant genotype, Sca6. Sca6 accumulated significantly more superoxide at 24h after treatment of leaves with SA. These experiments revealed critical insights regarding the molecular differences between cacao varieties, which will allow a better understanding of defence mechanisms to help guide breeding programmes. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  15. Gene structure, phylogeny and expression profile of the sucrose synthase gene family in cacao (Theobroma cacao L.).

    Science.gov (United States)

    Li, Fupeng; Hao, Chaoyun; Yan, Lin; Wu, Baoduo; Qin, Xiaowei; Lai, Jianxiong; Song, Yinghui

    2015-09-01

    In higher plants, sucrose synthase (Sus, EC 2.4.1.13) is widely considered as a key enzyme involved in sucrose metabolism. Although, several paralogous genes encoding different isozymes of Sus have been identified and characterized in multiple plant genomes, to date detailed information about the Sus genes is lacking for cacao. This study reports the identification of six novel Sus genes from economically important cacao tree. Analyses of the gene structure and phylogeny of the Sus genes demonstrated evolutionary conservation in the Sus family across cacao and other plant species. The expression of cacao Sus genes was investigated via real-time PCR in various tissues, different developmental phases of leaf, flower bud and pod. The Sus genes exhibited distinct but partially redundant expression profiles in cacao, with TcSus1, TcSus5 and TcSus6, being the predominant genes in the bark with phloem, TcSus2 predominantly expressing in the seed during the stereotype stage. TcSus3 and TcSus4 were significantly detected more in the pod husk and seed coat along the pod development, and showed development dependent expression profiles in the cacao pod. These results provide new insights into the evolution, and basic information that will assist in elucidating the functions of cacao Sus gene family.

  16. Assessing microsatellite linkage disequilibrium in wild, cultivated, and mapping populations of Theobroma cacao L and its impact on association mapping

    Science.gov (United States)

    Linkage disequilibrium (LD) is the nonrandom association of alleles and loci within sets of genetic data and when measured over the genomes of a species can provide important indications for how future association analyses should proceed. This information can be advantageous especially for slow-gro...

  17. Influences of superheated steam roasting on changes in sugar, amino acid and flavour active components of cocoa bean (Theobroma cacao).

    Science.gov (United States)

    Zzaman, Wahidu; Bhat, Rajeev; Yang, Tajul Aris; Easa, Azhar Mat

    2017-10-01

    Roasting is one of the important unit operations in the cocoa-based industries in order to develop unique flavour in products. Cocoa beans were subjected to roasting at different temperatures and times using superheated steam. The influence of roasting temperature (150-250°C) and time (10-50 min) on sugars, free amino acids and volatile flavouring compounds were investigated. The concentration of total reducing sugars was reduced by up to 64.61, 77.22 and 82.52% with increased roasting temperature at 150, 200 and 250°C for 50 min, respectively. The hydrophobic amino acids were reduced up to 29.21, 36.41 and 48.87% with increased roasting temperature at 150, 200 and 250°C for 50 min, respectively. A number of pyrazines, esters, aldehydes, alcohols, ketones, carboxyl acids and hydrocarbons were detected in all the samples at different concentration range. Formation of the most flavour active compounds, pyrazines, were the highest concentration (2.96 mg kg -1 ) at 200°C for 10 min. The superheated steam roasting method achieves the optimum roasting condition within a short duration Therefore, the quality of cocoa beans can be improved using superheated steam during the roasting process. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  18. Cupuassu (Theobroma grandiflorum) pulp, probiotic, and prebiotic: Influence on color, apparent viscosity, and texture of goat milk yogurts

    National Research Council Canada - National Science Library

    Costa, Marion P; Frasao, Beatriz S; Silva, Adriana Cristina O; Freitas, Mônica Q; Franco, Robson M; Conte-Junior, Carlos A

    2015-01-01

    ...; its fiber-rich pulp can provide a different consistency than other fruit pulps. Goat milk is an excellent source of amino acids, fatty acids, and minerals, and is widely used for processing fermented milks, such as yogurt...

  19. The glyceraldehyde-3-phosphate dehydrogenase gene of Moniliophthoraperniciosa, the causal agent of witches' broom disease of Theobroma cacao.

    Science.gov (United States)

    Lima, Juliana O; Pereira, Jorge F; Rincones, Johana; Barau, Joan G; Araújo, Elza F; Pereira, Gonçalo A G; Queiroz, Marisa V

    2009-04-01

    This report describes the cloning, sequence and expression analysis of the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) gene of Moniliophthora perniciosa, the most important pathogen of cocoa in Brazil. Southern blot analysis revealed the presence of a single copy of the GAPDH gene in the M. perniciosa genome (MpGAPDH). The complete MpGAPDH coding sequence contained 1,461 bp with eight introns that were conserved in the GAPDH genes of other basidiomycete species. The cis-elements in the promoter region of the MpGAPDH gene were similar to those of other basidiomycetes. Likewise, the MpGAPDH gene encoded a putative 339 amino acid protein that shared significant sequence similarity with other GAPDH proteins in fungi, plants, and metazoans. Phylogenetic analyses clustered the MPGAPDH protein with other homobasidiomycete fungi of the family Tricholomataceae. Expression analysis of the MpGAPDH gene by real-time PCR showed that this gene was more expressed (~1.3X) in the saprotrophic stage of this hemibiotrophic plant pathogen than in the biotrophic stage when grown in cacao extracts.

  20. The glyceraldehyde-3-phosphate dehydrogenase gene of Moniliophthora perniciosa, the causal agent of witches' broom disease of Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Juliana O. Lima

    2009-01-01

    Full Text Available This report describes the cloning, sequence and expression analysis of the glyceraldehyde-3-phosphate dehydrogenase (GAPDH gene of Moniliophthora perniciosa, the most important pathogen of cocoa in Brazil. Southern blot analysis revealed the presence of a single copy of the GAPDH gene in the M. perniciosa genome (MpGAPDH. The complete MpGAPDH coding sequence contained 1,461 bp with eight introns that were conserved in the GAPDH genes of other basidiomycete species. The cis-elements in the promoter region of the MpGAPDH gene were similar to those of other basidiomycetes. Likewise, the MpGAPDH gene encoded a putative 339 amino acid protein that shared significant sequence similarity with other GAPDH proteins in fungi, plants, and metazoans. Phylogenetic analyses clustered the MPGAPDH protein with other homobasidiomycete fungi of the family Tricholomataceae. Expression analysis of the MpGAPDH gene by real-time PCR showed that this gene was more expressed (~1.3X in the saprotrophic stage of this hemibiotrophic plant pathogen than in the biotrophic stage when grown in cacao extracts.

  1. Development of novel microsatellites from Moniliophthora perniciosa, causal agent of the witches' broom disease of Theobroma cacao.

    Science.gov (United States)

    Silva, Jurema R Q; Figueira, Antonio; Pereira, Gonçalo A G; Albuquerque, Paulo

    2008-07-01

    Moniliophthora perniciosa is the causal agent of the witches' broom disease of cacao. Based on available genomic sequences, we identified 30 new microsatellite loci, which were analysed using 50 isolates from four populations sampled over a wide geographical area in Brazil, including three populations from the Amazon, the fungal putative centre of diversity, plus one from Bahia. Nine loci were polymorphic, with an average of 2.9 alleles per locus. The level of polymorphism observed was low, but these markers may allow the evaluation of pathogen diversity and the establishment of molecular standards for isolate fingerprinting to support cacao breeding. © 2007 The Authors. Journal compilation © 2007 Blackwell Publishing Ltd.

  2. Cupuassu (Theobroma grandiflorum) pulp, probiotic, and prebiotic: Influence on color, apparent viscosity, and texture of goat milk yogurts.

    Science.gov (United States)

    Costa, Marion P; Frasao, Beatriz S; Silva, Adriana Cristina O; Freitas, Mônica Q; Franco, Robson M; Conte-Junior, Carlos A

    2015-09-01

    Cupuassu is an acidic fruit that has a characteristic aroma, flavor, and texture; its fiber-rich pulp can provide a different consistency than other fruit pulps. Goat milk is an excellent source of amino acids, fatty acids, and minerals, and is widely used for processing fermented milks, such as yogurt. However, compared with cow milk yogurts, it is difficult to make goat milk yogurts with a good consistency. Therefore, it is necessary to use certain technological strategies. This study was carried out to investigate the possibility of adding cupuassu pulp, probiotic (Lactobacillus acidophilus LA-5), and prebiotic (inulin) to improve the texture of goat milk yogurt. A total of 6 treatments were performed: natural (N), probiotic (Pro), prebiotic (Pre), synbiotic (S), cupuassu (C), and probiotic with cupuassu (PC). The viability of probiotic in yogurts (Pro, S, and PC) was evaluated. In addition, instrumental analyses (pH, color, apparent viscosity, and texture) were performed to evaluate the influence of these different ingredients on goat milk yogurts. The probiotic bacteria remained viable (≥7 log cfu·mL(-1)) throughout the 28d of refrigerated storage, which exceeded the minimum count required to confer probiotic physiological benefits. The pH levels of the yogurts inoculated with L. acidophilus (Pro, S, and PC) were lower than others yogurts (N, Pre, and C). However, all yogurt samples underwent gradual decreases in pH until 7 to 14d of storage. The lightness (L*) was affected initially by addition of all ingredients (cupuassu pulp, probiotic, and prebiotic). The addition of cupuassu pulp (C and PC) increased the L* during the period of storage. Apparent viscosity and firmness decreased in the PC yogurt. The consistency was highest in the yogurts with added prebiotic (Pre and S) than the other yogurts (N, Pro, C, and PC) at the end of the storage period (d 28). The cohesiveness remained constant in all yogurts (N, Pro, Pre, S, C, and PC). Based on the results obtained from the current study, it was concluded that cupuassu pulp addition improves the texture of goat milk yogurts. Therefore, this pulp could be an important technological strategy for the dairy goat industry. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  3. Breeding Value of Cocoa (Theobroma cacao L. for Pod and Bean Traits: A Consequential Advance in Nigerian Cocoa Breeding Program

    Directory of Open Access Journals (Sweden)

    Daniel Babasola ADEWALE

    2014-06-01

    Full Text Available The understanding of the generated hybrids’ breeding value gives a measure of probable advances in a breeding program. Four cocoa genotypes (testers were crossed with two distinct lines (T65/7 and T86/2. The parents and the hybrids were separately established in randomized complete block design with six replications. The fourteen genotypes were evaluated for pod length (PL, weight (PW, beans/pod (NoB, bean length (BL, width (Bwi and thickness (BT. The treatment, parent, crosses and Line x Tester sources of variation were significant (P ≤ 0.05. Hybrids from the same maternal parent differed significantly (P < 0.05 for the six traits. Contribution to the total variance of PL, PW and Bwi were in the following order: Tester > Line x Tester > Lines. The highest general combining ability (0.42 occurred in T65/7 for PW; the least (-0.081 occurred in T86/2 for PL. Cross combination T65/7xT57/22 produced the highest specific ability of combination (4.33 for NoB. Variance of GCA and SCA were significant (P < 0.05 for the six traits. The GCA/SCA ratios revealed the inheritance of PL, PW, Bwi and BT to be additive. Non-additive gene effect controlled NoB and BL. Heterosis for the six traits ranged between -17.82% for BT (T65/7xT57/22 to 52.40% for PW (T65/7xT53/8. Increased productivity in cocoa is possible through hybrid breeding programs.

  4. Association mapping for #Phytophthora# pod rot resistance in a cacao (#Theobroma cacao# L.) population grown in farmers' field

    OpenAIRE

    Efombagn, Mousseni Ives Bruno; Sounigo, Olivier; Courtois, Brigitte; Fouet, Olivier; Jeanneau, Mélanie; Lemainque, Arnaud; Pavek, Sylvana; Lanaud, Claire

    2016-01-01

    Phytophthora pod rot (PPR) caused by the specie Phytophthora megakarya is an important disease of cacao tree. Association mapping identified markers linked to PPR resistance in a cacao population of 260 trees planted under high disease pressure in a single plantation in a farmer's field. These cacao trees were derived from both selfing and full-sib progenies. The resistance traits were assessed through field observations of the natural pod attacks of the disease on the trunk (PRTnk) or the ca...

  5. Efektivitas Bentuk Fisik Ransum Yang Mengandung Pod Kakao (Theobroma cacao L.) Fermentasi Aspergillus niger Terhadap karkas Kelinci Rex Lepas Sapih

    OpenAIRE

    Bancin, Syahril

    2015-01-01

    Livestock rabbit is a commodity that can produce quality meat with high protein content. Feed is an important factor in the livestock business, balanced nutrition will result in higher meat production. Utilization of farm wastes such as cocoa pot into animal feed, decent thing to do because it is not competitive with human foodstuffs. Feed in the form of pellets have several advantages, namely: to increase palatability, waste can be reduced rations due to wastage, can streamline formula pelle...

  6. Pengaruh Waktu Fermentasi dan Efektivitas Adsorben dalam Pembuatan Bioetanol Fuel Grade dari Limbah Pod Kakao (Theobroma Cacao)

    OpenAIRE

    Fauzi, A. Rachman; Haryadi, Didik; Priyanto, Slamet

    2012-01-01

    The scarcity of fuel oil globally will need to use biofuels as a alternative fuel. One of it is bioethanol. Bioethanol is ethanol produced from sugar fermentation. Generally bioethanol made from crops like sugar cane and sweet sorghum. Though the plant has a use value as food. This can cause food prices creeping up highly interest in plants and biofuel producers to process the material into bioethanol. Cocoa plantation commodities whose role is quite important to the national economy. Compone...

  7. KEANEKARAGAMAN MAKROFAUNA TANAH DI KAWASAN PERKEBUNAN COKLAT (Theobroma cacao L. SEBAGAI BIOINDIKATOR KESUBURAN TANAH DAN SUMBER BELAJAR BIOLOGI

    Directory of Open Access Journals (Sweden)

    Endrik Nurrohman

    2015-07-01

    Full Text Available Jenis penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Penelitian ini dilakukan pada tanggal 20-28 Maret 2015 dengan metode jebakan (Pit tfall Trap. Penelitian dilakuka bertujuan untuk mengetahui jenis makrofauna tanah, parameter ekologi, indeks keanekaragaman jenis, dan indeks kemerataan jenis yang terdapat di kawasan perkebunan coklat. Hasil penelitian menunjukkan bahwa makrofauna tanah yang ditemukan terdiri dari jenis Tachita angulata, Cryptocercus garciai, Lymnaea rubiginosa, Odontoponera denticulata, Sigmoria trimaculata, Pirata piratichus, Sitena sp., Grillus sp., Scolopendra gigantea, Forficula auricularia, Hydrochara soror, Leptocarisa acuta, Trigoniulus corallinus, Odontomanchus sp., Lumbricus rubellus, Phyllopaga sp., Componatus arogans, Geophilus sp., Gryllotalpa grillotalpa, Ploiaria sp.. Parameter ekologi makrofauna tanah adalah: (1 Kepadatan berkisar antara 0,25 ind/m2 – 4,75 ind/m2, kepadatan relatif berkisar antara 0,002 - 0,052. kepadatan terendah jenis Grillotalpa grillotalpa dan tertinggi jenis Pirata piraticus (2 Frekuensi berkisar antara 0,16 – 1,00, frekuensi relatif berkisar antara 0,018 – 0,115 dengan nilai frekuensi terendah jenis Grillotalpa grillotalpa dan tertinggi jenis Scolopendra gigantea. (3 Indeks nilai penting tertinggi jenis Pirata piratichus 5,28, terendah Grillotalpa grillotalpa 0,027. Indeks keanekaragaman jenis Shannon wiener (H’ kategori keanekaragaman jenis rendah. Nilai evennes (E populasi cenderung merata. Hail Uji C-Organik tanah sangat tinggi berarti tanah tergolong tanah yang subur. Rendahnya keanekaragaman karena adanya penggunaan pestisida jenis Carbokfuran yang mendominasi. Hasil penelitian ini digunakan sebagai sumber belajar biologi berupa buku petunjuk praktikum.

  8. Environmental Growing Conditions in Five Production Systems Induce Stress Response and Affect Chemical Composition of Cocoa (Theobroma cacao L.) Beans.

    Science.gov (United States)

    Niether, Wiebke; Smit, Inga; Armengot, Laura; Schneider, Monika; Gerold, Gerhard; Pawelzik, Elke

    2017-11-29

    Cocoa beans are produced all across the humid tropics under different environmental conditions provided by the region but also by the season and the type of production system. Agroforestry systems compared to monocultures buffer climate extremes and therefore provide a less stressful environment for the understory cocoa, especially under seasonally varying conditions. We measured the element concentration as well as abiotic stress indicators (polyamines and total phenolic content) in beans derived from five different production systems comparing monocultures and agroforestry systems and from two harvesting seasons. Concentrations of N, Mg, S, Fe, Mn, Na, and Zn were higher in beans produced in agroforestry systems with high stem density and leaf area index. In the dry season, the N, Fe, and Cu concentration of the beans increased. The total phenolic content increased with proceeding of the dry season while other abiotic stress indicators like spermine decreased, implying an effect of the water availability on the chemical composition of the beans. Agroforestry systems did not buffer the variability of stress indicators over the seasons compared to monocultures. The effect of environmental growing conditions on bean chemical composition was not strong but can contribute to variations in cocoa bean quality.

  9. Investigations on the Aroma of Cocoa Pulp (Theobroma cacao L.) and Its Influence on the Odor of Fermented Cocoa Beans.

    Science.gov (United States)

    Chetschik, Irene; Kneubühl, Markus; Chatelain, Karin; Schlüter, Ansgar; Bernath, Konrad; Hühn, Tilo

    2017-03-29

    The odor-active constituents of cocoa pulp have been analyzed by aroma extract dilution analysis (AEDA) for the first time. Pulps of three different cocoa varieties have been investigated. The variety CCN51 showed low flavor intensities, in terms of flavor dilution (FD) factors, in comparison to varieties FSV41 and UF564, for which floral and fruity notes were detected in higher intensities. To gain first insights on a molecular level of how the cocoa pulp odorants affected the odor quality of cocoa beans during fermentation, quantitative measurements of selected aroma compounds were conducted in pulp and bean at different time points of the fermentation. The results showed significantly higher concentrations of 2-phenylethanol and 3-methylbutyl acetate in pulp than in the bean during the different time steps of the fermentation, whereas the reverse could be observed for the odorants linalool and 2-methoxyphenol. The findings of this study constitute a basis for further investigations on the aroma formation of cocoa during fermentation.

  10. Relationship between fermentation index and other biochemical changes evaluated during the fermentation of Mexican cocoa (Theobroma cacao) beans.

    Science.gov (United States)

    Romero-Cortes, Teresa; Salgado-Cervantes, Marco Antonio; García-Alamilla, Pedro; García-Alvarado, Miguel Angel; Rodríguez-Jimenes, Guadalupe del C; Hidalgo-Morales, Madeleine; Robles-Olvera, Víctor

    2013-08-15

    During traditional cocoa processing, the end of fermentation is empirically determined by the workers; consequently, a high variability on the quality of fermented cocoa beans is observed. Some physicochemical properties (such as fermentation index) have been used to measure the degree of fermentation and changes in quality, but only after the fermentation process has concluded, using dried cocoa beans. This would suggest that it is necessary to establish a relationship between the chemical changes inside the cocoa bean and the fermentation conditions during the fermentation in order to standardize the process. Cocoa beans were traditionally fermented inside wooden boxes, sampled every 24 h and analyzed to evaluate fermentation changes in complete bean, cotyledon and dried beans. The value of the fermentation index suggested as the minimal adequate (≥1) was observed at 72 h in all bean parts analyzed. At this time, values of pH, spectral absorption, total protein hydrolysis and vicilin-class globulins of fermented beans suggested that they were well fermented. Since no difference was found between the types of samples, the pH value could be used as a first indicator of the end of the fermentation and confirmed by evaluation of the fermentation index using undried samples, during the process. © 2013 Society of Chemical Industry.

  11. Correlation of Diplodia (Lasiodiplodia theobromae) infection, huanglongbing, ethylene production, fruit removal force and pre-harvest fruit drop

    Science.gov (United States)

    One symptom of citrus huanglongbing (HLB) disease is excessive pre-harvest fruit drop. As the severity of HLB has progressed through commercial citrus groves in Florida, pre-harvest fruit drop has increased, resulting in significant loss of yield. A greater incidence of Diplodia infection was recent...

  12. Comparación sensorial del cacao (Theobroma cacao L. Nacional fino de aroma cultivado en diferentes zonas del Ecuador

    Directory of Open Access Journals (Sweden)

    Eddyn Solórzano Chavez

    2015-12-01

    Full Text Available La presente investigación tuvo como objetivo comparar el perfil sensorial de muestras de cacao de varias zonas productoras del país. Con este propósito el Laboratorio de Calidad Integral de Cacao y Chocolate de la Estación Experimental Tropical Pichilingue del INIAP, recibió muestras de 11 asociaciones de productores. Un panel de cinco miembros con experiencia en degustación de pasta de cacao (licor produjo datos para los siguientes componentes del sabor: cacao, acidez, amargor, astringencia, caramelo, floral, frutal, nuez y verde. El análisis comparativo de las muestras se llevó a cabo mediante la prueba no paramétrica de Kruskal & Wallis. El grado de asociación de distintos pares de variables se examinó mediante un análisis correlacional. La relación entre muestras también se exploró mediante el análisis multivariado de componentes principales. Este análisis condujo a la identificación de las variables originales que más aportaron a la varianza de los dos primeros componentes principales. Diferencias estadísticamente significativas entre muestras se detectaron solo para el sabor a cacao. Las correlaciónes más altas se dieron entre las variables frutal y verde, frutal y astringencia, frutal y amargor, y frutal y nuez, la mayoría de signo negativo. Las variables con más aportación a la varianza (35.20% del primer componente principal fueron frutal, verde y amargor. Acidez, floral y nuez hicieron la mayor aportación al segundo componente principal. La aparente estructuración de dos grupos muestrales en el plano definido sugiere semejanzas y diferencias en su perfil sensorial.

  13. Deciphering the Theobroma cacao self-incompatibility system: from genomics to diagnostic markers for self-compatibility.

    Science.gov (United States)

    Lanaud, Claire; Fouet, Olivier; Legavre, Thierry; Lopes, Uilson; Sounigo, Olivier; Eyango, Marie Claire; Mermaz, Benoit; Da Silva, Marcos Ramos; Loor Solorzano, Rey Gaston; Argout, Xavier; Gyapay, Gabor; Ebaiarrey, Herman Ebai; Colonges, Kelly; Sanier, Christine; Rivallan, Ronan; Mastin, Géraldine; Cryer, Nicholas; Boccara, Michel; Verdeil, Jean-Luc; Efombagn Mousseni, Ives Bruno; Peres Gramacho, Karina; Clément, Didier; Wilson, Zoe

    2017-10-13

    Cocoa self-compatibility is an important yield factor and has been described as being controlled by a late gameto-sporophytic system expressed only at the level of the embryo sac. It results in gametic non-fusion and involves several loci. In this work, we identified two loci, located on chromosomes 1 and 4 (CH1 and CH4), involved in cocoa self-incompatibility by two different processes. Both loci are responsible for gametic selection, but only one (the CH4 locus) is involved in the main fruit drop. The CH1 locus acts prior to the gamete fusion step and independently of the CH4 locus. Using fine-mapping and genome-wide association studies, we focused analyses on restricted regions and identified candidate genes. Some of them showed a differential expression between incompatible and compatible reactions. Immunolocalization experiments provided evidence of CH1 candidate genes expressed in ovule and style tissues. Highly polymorphic simple sequence repeat (SSR) diagnostic markers were designed in the CH4 region that had been identified by fine-mapping. They are characterized by a strong linkage disequilibrium with incompatibility alleles, thus allowing the development of efficient diagnostic markers predicting self-compatibility and fruit setting according to the presence of specific alleles or genotypes. SSR alleles specific to self-compatible Amelonado and Criollo varieties were also identified, thus allowing screening for self-compatible plants in cocoa populations. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  14. Characterization of a stearoyl-acyl carrier protein desaturase gene family from chocolate tree, Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Yufan eZhang

    2015-04-01

    Full Text Available In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP desaturase (SAD. The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance.

  15. Effect of Cryopreservation and Post-Cryopreservation Somatic Embryogenesis on the Epigenetic Fidelity of Cocoa (Theobroma cacao L.)

    National Research Council Canada - National Science Library

    Adu-Gyamfi, Raphael; Wetten, Andy; Marcelino Rodríguez López, Carlos

    2016-01-01

    .... Previous studies have shown that the encapsulation-dehydration cryopreservation methodology imposes no significant extra mutational load since embryos carrying high levels of genetic variability...

  16. CONTRIBUIÇÃO AO ESTUDO ANATÔMICO DA FOLHA E DO CAULE DO CACAUEIRO (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    NAKAYAMA L.H.I

    1996-01-01

    Full Text Available O presente estudo teve como objetivo descrever a anatomia da folha e do caule adulto enfatizando a caracterização dos tricomas e das estruturas secretoras do cacaueiro. Foram analisadas amostras de caule e folhas (limbo e pecíolo, correspondente ao 3º nó, além de folhas novas de 5cm de comprimento. A lâmina foliar é hipoestomática, com estômatos do tipo anomocítico. Em ambas as faces do limbo ocorrem quatro tipos de tricomas: sendo dois tectores e dois glandulares. Na epiderme adaxial estão presentes as glândulas secretoras de mucilagem. O mesofilo é dorsiventral; o parênquima paliçádico é formado por duas ou três camadas. O parênquima lacunoso apresenta células coletoras. Ao longo do mesofilo predomina feixes colaterais envolvidos por bainha esclerenquimática que se estende até as epidermes. O padrão de venação é do tipo Camptodroma com ramificações mistas Brochidrodomas e Eucamptodromos. O pecíolo e o caule apresentam a epiderme com os tricomas descritos para o limbo; No parênquima cortical e medular do pecíolo e caule, há células contendo grãos de amido, idioblastos contendo drusas e canais de mucilagem. O sistema vascular ao longo do pecíolo se diferencia quanto a organização. O caule apresenta camadas de clorênquima, e de colênquima. Ocorre a esclerificação das células deste último, com o desenvolvimento. Segue-se um anel descontínuo de fibras do floema primário. A medula é ampla e se esclerifica com o desenvolvimento.

  17. Effect of Cryopreservation and Post-Cryopreservation Somatic Embryogenesis on the Epigenetic Fidelity of Cocoa (Theobroma cacao L.).

    Science.gov (United States)

    Adu-Gyamfi, Raphael; Wetten, Andy; Marcelino Rodríguez López, Carlos

    2016-01-01

    While cocoa plants regenerated from cryopreserved somatic embryos can demonstrate high levels of phenotypic variability, little is known about the sources of the observed variability. Previous studies have shown that the encapsulation-dehydration cryopreservation methodology imposes no significant extra mutational load since embryos carrying high levels of genetic variability are selected against during protracted culture. Also, the use of secondary rather than primary somatic embryos has been shown to further reduce the incidence of genetic somaclonal variation. Here, the effect of in vitro conservation, cryopreservation and post-cryopreservation generation of somatic embryos on the appearance of epigenetic somaclonal variation were comparatively assessed. To achieve this we compared the epigenetic profiles, generated using Methylation Sensitive Amplified Polymorphisms, of leaves collected from the ortet tree and from cocoa somatic embryos derived from three in vitro conditions: somatic embryos, somatic embryos cryopreserved in liquid nitrogen and somatic embryos generated from cryoproserved somatic embryos. Somatic embryos accumulated epigenetic changes but these were less extensive than in those regenerated after storage in LN. Furthermore, the passage of cryopreserved embryos through another embryogenic stage led to further increase in variation. Interestingly, this detected variability appears to be in some measure reversible. The outcome of this study indicates that the cryopreservation induced phenotypic variability could be, at least partially, due to DNA methylation changes. Phenotypic variability observed in cryostored cocoa somatic-embryos is epigenetic in nature. This variability is partially reversible, not stochastic in nature but a directed response to the in-vitro culture and cryopreservation.

  18. Development in nursery of different clones of cupuaçu tree (Theobroma grandiflorum (Wild. Ex Spreng. Schum

    Directory of Open Access Journals (Sweden)

    D. Franciskievicz

    2013-11-01

    Full Text Available This work aimed to present the results of initial development in nursery of 4 genetic materials of cupuaçu trees, being one a material without selection (control and three clones of cupuaçu tree resistant to the fungus Moniliophthora perniciosa, causal agent of Witches' Broom. The seeds from Embrapa Amazônia Oriental (Belém - PA were put in seed bed for germination. After 25 days of seedling emergence these were transplanted in to plastic bags, arranged in a shade house (60%, and containing agricultural substrate and forest humus (1: 3. At the end of 130 days after sowing were compared the patterns of development of girth, height and relation height / girth in a randomized block design consisting of 4 treatments and 4 replicates, each replicate consisting of 16 seedlings. Results were subjected to analysis of variance (ANOVA and the averages compared by Tukey (5%. The values ​​obtained to girth not differ, presented as overall mean 5.08 mm, however in relation to height cultivar 215 (31cm excelled on the cultivar 174 (25 cm and control (23 cm, however their average not differ of material 186 (27 cm. As regards the height / girth the values ​​obtained for the control and cultivars 175, 186 and 215, were respectively, 4.6, 5.2, 5.1 and 5.9 cm / mm, being cultivar 215 different to control.

  19. Behavior of introduced regional clones of Theobroma cacao toward the infection Moniliophthora roreri in three different regions of Colombia

    Directory of Open Access Journals (Sweden)

    Jaimes Yeirme

    2011-08-01

    Full Text Available

    Moniliasis (frosty pod rot, caused by Moniliophthora roreri, is the most limiting disease of cacao bean production in Colombia. Disease control has focused primarily on the implementation of cultural methods, which are inefficient and increase costs of production. A promising alternative for the control of M. roreri is the genetic approach, involving the search for plants with known resistance in the field. The aim of this study was to evaluate the behavior of 13 regional clones of Corpoica Selection Colombia (SCC, ten regional Fedecacao clones (with the initial F, three clones Caucasia (CAU and 13 introduced clones for resistance to M. roreri, by monitoring symptoms and signs of the pathogen in fruits of the cacao at three experimental sites located in Arauquita (Arauca, San Vicente and Rionegro (Santander. To estimate the degree of susceptibility or resistance of each clone, the pathogen was inoculated into fruits 75-5 days old. Eight weeks later, the variables Incidence, Internal Severity Index and External Severity Index were evaluated. In the three experimental sites, the ICS clone 95 behaved as a resistant plant with ISI ranging from 1.4 to 1.9. In the other clones tested, susceptibility varied according to altitude and environmental conditions. However, the ICS clone 95 showed partial resistance, varying the spread of the pathogen in the plant tissue.

  20. Assessing genetic diversity in java fine-flavor cocoa (theobroma cacao l.) Germplasm by simple sequence repeat (ssr) markers

    Science.gov (United States)

    Indonesia is the 3rd largest cocoa producing countries in the world, with an annual cacao bean production of 572,000 tons. The currently cultivated cacao varieties in Indonesia were inter-hybrids of various clones introduced from the Americas since the 16th century. Among them, “Java cocoa” is a wel...

  1. Five-year agronomic and phenotypic data summary for a replicated cacao (Theobroma cacao L.) germplasm collection

    Science.gov (United States)

    Loss of genetic diversity found in centers of origin necessitates the establishment of ex situ germplasm collections for long-term conservation. Cacao genetic resources have been acquired, preserved and evaluated at the USDA-ARS, Tropical Agriculture Research Station in Mayaguez (TARS), Puerto Rico...

  2. Characterization of polyphenol oxidase in two cocoa (Theobroma cacao L. cultivars produced in the south of Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Adrielle Souza Leão MACEDO

    2016-01-01

    Full Text Available Abstract The reactions leading to the formation of precursors of chocolate flavor are performed by endogenous enzymes present in the cocoa seed. Polyphenol oxidase (PPO presence and activity during fermentation of cocoa beans is responsible for the development of flavor precursors and is also implicated in the reduction of bitterness and astringency. However, the reliability of cocoa enzyme activities is complicated due to variations in different genotypes, geographical origins and methods of fermentation. In addition, there is still a lack of systematic studies comparing different cocoa cultivars. So, the present study was designed to characterize the activity of PPO in the pulp and seeds of two cocoa cultivars, PH 16 and TSH 1188. The PPO activity was determined spectrophotometrically and characterized as the optimal substrate concentration, pH and temperature and the results were correlated with the conditions during the fermentation process. The results showed the specificity and differences between the two cocoa cultivars and between the pulp and seeds of each cultivar. It is suggested that specific criteria must be adopted for each cultivar, based on the optimal PPO parameters, to prolong the period of maximum PPO activity during fermentation, contributing to the improvement of the quality of cocoa beans.

  3. Flavanols, proanthocyanidins and antioxidant activity changes during cocoa (Theobroma cacao L.) roasting as affected by temperature and time of processing.

    Science.gov (United States)

    Ioannone, F; Di Mattia, C D; De Gregorio, M; Sergi, M; Serafini, M; Sacchetti, G

    2015-05-01

    The effect of roasting on the content of flavanols and proanthocyanidins and on the antioxidant activity of cocoa beans was investigated. Cocoa beans were roasted at three temperatures (125, 135 and 145 °C), for different times, to reach moisture contents of about 2 g 100 g(-1). Flavanols and proanthocyanidins were determined, and the antioxidant activity was tested by total phenolic index (TPI), ferric reducing antioxidant power (FRAP) and total radical trapping antioxidant parameter (TRAP) methods. The rates of flavanol and total proanthocyanidin loss increased with roasting temperatures. Moisture content of the roasted beans being equal, high temperature-short time processes minimised proanthocyanidins loss. Moisture content being equal, the average roasting temperature (135 °C) determined the highest TPI and FRAP values and the highest temperature (145 °C) determined the lowest TPI values. Moisture content being equal, low temperature-long time roasting processes maximised the chain-breaking activity, as determined by the TRAP method. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Adaptability of promissory clones of national cocoa (Theobroma cacao L. in the Arosemena Tola Canton from Equator

    Directory of Open Access Journals (Sweden)

    Guillermo Armando Pérez Garcia

    2017-07-01

    Full Text Available The research was conducted in order to evaluate the adaptability of three promissory clones of National cocoa proposed by the Autonomous Equatorian Institute of Agricultural Research to the ecological conditions of the Arosemena Tola canton, belonging to the Napo province, Equator. To carry out to this objective a random blocks design was made, where the treatments consisted on the promissory clones, EET-95, EET-96 and EET-103 compared with the clone CCN-51 used as control. Morphological and agronomic indicators were determined. The promissory clones have characteristic of adaptability to the conditions study, in particular the clone EET-103, with high index of seeds, similar values of fruit index and yield that the control, but with higher quality and lower content of heavy metals in the seeds.

  5. In vitro hypoglycemic and cholesterol lowering effects of dietary fiber prepared from cocoa (Theobroma cacao L.) shells.

    Science.gov (United States)

    Nsor-Atindana, John; Zhong, Fang; Mothibe, Kebitsamang Joseph

    2012-10-01

    Three dietary fiber (DF) powders; soluble dietary fiber (SDF), insoluble dietary fiber (IDF) and total dietary fiber (TDF) were prepared from cocoa bean shells (CBS) by enzymatic treatment. These DFs were evaluated for their effects on glucose adsorption, glucose diffusion, starch hydrolysis, cholesterol binding, sodium cholate binding and oil binding capacities using in vitro model systems by simulating gastric intestinal conditions. The results showed that SDF generally exhibited significantly (p 0.05) glucose dialysis retardation index (GDRI) and oil binding capacity, when compared with IDF and TDF which both showed similar effects. Moreover, it was discovered that the three CBS dietary fiber powders contained intrinsic antioxidants (phenolic compounds). The study suggested that CBS could be an alternative cheap source of DF with additional benefits. Thus, CBS fibers could be incorporated as low calorie bulk ingredients in high-fiber diet to reduce calorie and cholesterol levels and control blood glucose level.

  6. Characterization of a stearoyl-acyl carrier protein desaturase gene family from chocolate tree, Theobroma cacao L.

    Science.gov (United States)

    Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J

    2015-01-01

    In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP) desaturase (SAD). The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance.

  7. Aflatoxins and ochratoxin A in different cocoa clones (Theobroma cacao L.) developed in the southern region of Bahia, Brazil.

    Science.gov (United States)

    Maciel, Leonardo Fonseca; Felício, Ana Lúcia de Souza Madureira; Miranda, Lucas Caldeirão Rodrigues; Pires, Tassia Cavalcante; Bispo, Eliete da Silva; Hirooka, Elisa Yoko

    2017-11-21

    Brazil is the sixth largest producer of cocoa beans in the world, after Côte d'Ivoire, Ghana, Indonesia, Nigeria and Cameroon. The southern region of Bahia stands out as the country's largest producer, accounting for approximately 60% of production. Due to damage caused by infestation of the cocoa crop with the fungus Moniliophthora perniciosa, which causes 'witch's broom disease', research in cocoa beans has led to the cloning of species that are resistant to the disease; however, there is little information about the development of other fungal genera in these clones, such as Aspergillus, which do not represent a phytopathogenicity problem but can grow during the pre-processing of cocoa beans and produce mycotoxins. Thus, the aim of this work was to determine the presence of aflatoxin (AF) and ochratoxin A (OTA) in cocoa clones developed in Brazil. Aflatoxin and ochratoxin A contamination were determined in 130 samples from 13 cocoa clones grown in the south of Bahia by ultra-performance liquid chromatography with a fluorescence detector. The method was evaluated for limit of detection (LOD) (0.05-0.90 μg kg-1), limit of quantification (0.10-2.50 μg kg-1) and recovery (RSD) (89.40-95.80%) for AFB1, AFB2, AFG1, AFG2 and OTA. Aflatoxin contamination was detected in 38% of the samples in the range of

  8. Crude cacao Theobroma cacao extract reduces mutagenicity induced by benzo[a]pyrene through inhibition of CYP1A activity in vitro.

    Science.gov (United States)

    Ohno, Marumi; Sakamoto, Kentaro Q; Ishizuka, Mayumi; Fujita, Shoichi

    2009-08-01

    Polyphenols have been shown to have potent antioxidant activity, and therefore, food containing polyphenols is expected to contribute to the prevention of cancer. However, food contains not only polyphenols but also various other constituents. We used the Ames test to investigate the effects of crude extracts of whole cacao products, which are known to be rich in polyphenols, on the mutagenicity of benzo[a]pyrene (B[a]P) in Salmonella typhimurium strain TA 98 and tert-butyl hydroperoxide (t-BuOOH) in S. typhimurium strain TA 102. B[a]P induces mutagenicity by metabolic activation and t-BuOOH induces it by generation of free radicals. While white chocolate did not modulate the numbers of revertant colonies produced by B[a]P treatment, milk chocolate and cacao powder extracts did. On the other hand, surprisingly, none of the cacao products tested affected the number of revertant colonies when t-BuOOH was used as the mutagen. At maximum concentration (13.25 mg cacao powder/ml), the crude cacao powder extract reduced ethoxyresorufin O-deethylase activity to 17.4% of the control, suggesting that whole cacao products inhibit cytochrome P450 (CYP) 1A activity. In conclusion, inhibition of CYP1A activity by cacao products may prevent DNA damage by reducing metabolic activation of carcinogens. Copyright 2009 John Wiley & Sons, Ltd.

  9. DESEMPENHO E DIGESTIBILIDADE DE OVINOS ALIMENTADOS COM FARELO DE CACAU (Theobroma cacao L. EM DIFERENTES NÍVEIS DE SUBSTITUIÇÃO

    Directory of Open Access Journals (Sweden)

    Cristina Mattos Veloso

    2006-10-01

    Full Text Available O objetivo deste trabalho foi avaliar o desempenho e digestibilidade aparente de ovinos alimentados com dietas contendo farelo de cacau em substituição ao concentrado (milho e farelo de soja. Utilizaram-se dezesseis ovinos Santa Inês, fêmeas, não prenhes, não lactantes, com peso médio inicial de 25 kg e aproximadamente doze meses de idade, mantidos em baias individuais. O experimento teve a duração de 78 dias, sendo 15 de período pré-experimental e 63 dias de período experimental. Forneceram-se as dietas em mistura completa, na proporção 50:50% (volumoso:concentrado,sendo utilizado como volumoso o feno da parte aérea da mandioca, com níveis de inclusão de farelo de cacau no concentrado de 0%, 10%, 20% e 30%. Forneciam-se dietas pela manhã, sendo ajustadas de forma a sobrar 10%. Semanalmente, coletaram-se as sobras e amostras de alimentos para análises laboratoriais. Avaliaram-se o consumo, o ganho médio diário de peso, a conversão alimentar e a digestibilidade aparente. A inclusão do farelo de cacau não promoveu diferença nos consumos de matéria seca, proteína bruta e fibra em detergente neutro, no ganho de peso médio diário,na conversão alimentar e digestibilidade dos nutrientes. O consumo de fibra em detergente ácido aumentou linearmente com a inclusão do farelo de cacau na dieta. PALAVRAS-CHAVE: Alimentação, concentrado, confinamento, ruminante, subproduto.

  10. Changes in physical and chemical characteristics of fermented cocoa(Theobroma cacaobeans with manual and semi-mechanized transfer, between fermentation boxes

    Directory of Open Access Journals (Sweden)

    Pedro. P. Peláez

    2016-01-01

    Full Text Available The aim of this study was to evaluate variation in the physical and chemical properties of fermented cocoa beans with cocoa beans transfer between wooden fermentation boxes manually (M and semi - mechanized (SM way. Mass temperature, moisture, pH, and total acidity of the cotyledon and pulp; the total polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content in fresh, fermented, and dried beans; and percentage of fermented beans and time required to move beans during fermentation were determined. The cocoa used grew in the Pachiza district of the San Martin region of Peru. Cocoa sampling w as each 0, 48, 72, 96, 120, 144, and 168 h of fermentation. The cocoa mass temperature was highest with both removal systems after 96 h of fermentation. M cotyledon and pulp samples had the highest moisture content and titratable acidity, while cotyledon a nd pulp pH with both systems were statistically equal. In contrast, fermented beans had a higher polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content with SM. SM produced the greatest amount of fermentation (91.67% and required the s hortest amount of time to move beans (78.56 min. In conclusion, the system of fermentation of cocoa beans with SM was faster and produced fermented grains with high chemical quality.

  11. Antitumor activity against murine lymphoma L5178Y model of proteins from cacao (Theobroma cacao L.) seeds in relation with in vitro antioxidant activity.

    Science.gov (United States)

    Preza, Ana M; Jaramillo, María E; Puebla, Ana M; Mateos, Juan C; Hernández, Rodolfo; Lugo, Eugenia

    2010-10-20

    Recently, proteins and peptides have become an added value to foodstuffs due to new knowledge about its structural analyses as related to antioxidant and anticancer activity. Our goal was to evaluate if protein fractions from cacao seeds show antitumor activity on lymphoma murine L5178Y model. The antioxidant activity of these fractions was also evaluated with the aim of finding a correlation with the antitumor activity. Differential extraction of proteins from unfermented and semi-fermented-dry cacao seeds was performed and characterized by SDS-PAGE and FPLC size-exclusion chromatography. Antitumor activity was evaluated against murine lymphoma L5178Y in BALB/c mice (6 × 104 cells i.p.), with a treatment oral dose of 25 mg/kg/day of each protein fraction, over a period of 15 days. Antioxidant activity was evaluated by the ABTS+ and ORAC-FL assays. Albumin, globulin and glutelin fractions from both cacao seed type were obtained by differential solubility extraction. Glutelins were the predominant fraction. In the albumin fraction, polypeptides of 42.3 and 8.5 kDa were found in native conditions, presumably in the form of two peptide chains of 21.5 kDa each one. The globulin fraction presented polypeptides of 86 and 57 kDa in unfermented cacao seed that produced the specific-cacao aroma precursors, and after fermentation the polypeptides were of 45 and 39 kDa. The glutelin fraction presented proteins >200 kDa and globulins components cacao seed, it was observed that the albumin fraction showed antitumoral activity, since it caused significant decreases (p cacao protein fractions with their identification, supporting the traditional use of the plant. The albumin fraction showed antitumor and free radical scavenging capacity, however both activities were not correlated. The protein fractions could be considered as source of potential antitumor peptides.

  12. Identification of candidate genes involved in witches’ broom disease resistance in a segregating mapping population of Theobroma cacao L. in Brazil

    Science.gov (United States)

    Witches’ broom disease (WBD) caused by the fungus Moniliophthora perniciosa is responsible for considerable economic losses for cacao producers in the Americas. Protective fungicides are ineffective, and disease management involving repeated phytosanitary removals increases labor costs. The best al...

  13. Restriction enzyme improves the efficiency of genetic transformations in Moniliophthora perniciosa, the causal agent of witches’ broom disease in Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Francis Julio Fagundes Lopes

    2008-02-01

    Full Text Available The presence of restriction enzymes in the transformation mixture improved the efficiency of transformation in Moniliophthora perniciosa. The influence of the vector shape (linear or circular, the patterns of plasmid integration in genomic sites and the influence of the promoter used to express the gene marker were also analyzed. The addition of BamHI or NotI increased the number of transformants by 3-10-fold and 3-fold, respectively, over the control without added enzyme. The use of pre-linearized plasmid did not increase the transformation efficiency in comparison with the circular plasmid. However, the frequency of multi-copy transformants increased significantly. The transformation procedure here reported resulted in better production of protoplasts and transformation efficiency. In addition, the time necessary for the detection of the first transformants and the number of insertions were reduced.A presença de enzima de restrição na mistura de transformação aumentou a eficiência da transformação em Moniliophthora perniciosa. A influência da forma do vetor (linear ou circular, o padrão de integração do plasmídeo nos sítios genômicos e a influência do promotor usado para expressar o gene marcador foram também analisados. A adição de BamHI ou NotI aumentou o número de transformantes 3-10 vezes e 3 vezes, respectivamente, em relação ao controle sem a adição da enzima. O uso de plasmídeos pré-linearizados não aumentou a eficiência da transformação quando comparado à eficiência obtida com plasmídeos circulares. No entanto, a freqüência de transformantes multi-cópias aumentou significativamente. Juntos os procedimentos reportados aqui resultaram em processos mais eficientes de produção de protoplastos e transformação, onde o tempo necessário para o aparecimento dos transformantes e o número de inserções múltiplas foi reduzido.

  14. The effectiveness of betel leaf (Piper betle Linn extract gel and cocoa bean (Theobroma cacao L extract gel application against the hardness of enamel surface in vitro.

    Directory of Open Access Journals (Sweden)

    Juni Jekti Nugroho

    2017-04-01

    Full Text Available Objective : Nowadays several ways  have been evolved  to increase the hardness of the enamel surface as an effort to prevent caries. One of the alternatives that can be used is application of gel with herbal basic material. Material and Methods : The use of herbal basic material is preferred by people because the side effects are relatively small compared to synthetic drugs. Piper betle and cocoa beans are medicinal plants that is often used by people to inhibit caries. This is because piper betle and cocoa beans contain hardness that may influence the enamel surface. The purpose of this research was to determine the effect of piper betle extract gel and cocoa bean extract gel against the hardness of enamel surface. The samples, maxillary first premolar teeth, which has been extracted and does not have caries, were divided into 3 treatment groups: piper betle extract gel, cocoa bean extract gel, and distilled water as a negative control. Each treatment group consisted of 8 samples. The samples are decoronated in cemento-enamel junction (CEJ areas and planted on orthoplast blocks with labial surface facing up. Samples were applied in labial enamel surface to 5, 15 and 35 minutes period times. Samples before and after the application in each treatment group were measured using Universal Hardness Tester. Data were collected and analyzed using ANNOVA Repeated test. Results : Showed there were significant differences (p 0.05 of enamel surface hardness before and after the application of piper betel extract gel and distilled water. Conclusion : Therefore it can be concluded that cocoa been extract gel is more effective to increase the hardness of email surface.

  15. In vitro production of biotrophic-like cultures of Crinipellis perniciosa, the causal agent of witches' broom disease of Theobroma cacao.

    Science.gov (United States)

    Meinhardt, Lyndel W; Bellato, Cláudia de M; Rincones, Johana; Azevedo, Ricardo A; Cascardo, Julio C M; Pereira, Gonçalo A G

    2006-03-01

    Witches' broom disease (WBD) of cacao, caused by the hemibiotrophic fungus, Crinipellis perniciosa, exhibits a succession of symptoms that are caused by the biotrophic phase of the fungus. However, the study of this biotrophic phase is limited by its exclusive growth inside the plant or in the presence of callus. Here we report for the first time a method for the growth and maintenance of the biotrophic-like phase of C. perniciosa on a defined medium with metabolites found in the diseased tissues. Our results suggest that glycerol is a key carbon source for this interaction. This is a crucial achievement toward understanding the biology of this fungus during the infectious phase of WBD.

  16. Shade tree diversity and aboveground carbon stocks in Theobroma cacao agroforestry systems: implications for REDD+ implementation in a West African cacao landscape.

    Science.gov (United States)

    Dawoe, Evans; Asante, Winston; Acheampong, Emmanuel; Bosu, Paul

    2016-12-01

    The promotion of cacao agroforestry is one of the ways of diversifying farmer income and creating incentives through their inclusion in REDD+ interventions. We estimated the aboveground carbon stocks in cacao and shade trees, determined the floristic diversity of shade trees and explored the possibility of implementing REDD+ interventions in cacao landscapes. Using replicated multi-site transect approach, data were collected from nine 1-ha plots established on 5 km long transects in ten cacao growing districts in Ghana West Africa. Biomass of cacao and shade trees was determined using allometric equations. One thousand four hundred and one (1401) shade trees comprising 109 species from 33 families were recorded. Total number of species ranged from 34 to 49. Newbouldia laevis (Bignoniacea) was the most frequently occurring specie and constituted 43.2 % of all shade trees. The most predominant families were Sterculiaceae and Moraceae (10 species each), followed by Meliaceae and Mimosaceae (8 species each) and Caesalpiniacaea (6 species). Shannon diversity indices (H', Hmax and J') and species richness were low compared to other similar studies. Shade tree densities ranged from 16.2 ± 3.0 to 22.8 ± 1.7 stems ha(-1) and differed significantly between sites. Carbon stocks of shade trees differed between sites but were similar in cacao trees. The average C stock in cacao trees was 7.45 ± 0.41 Mg C ha(-1) compared with 8.32 ± 1.15 Mg C ha(-1) in the shade trees. Cacao landscapes in Ghana have the potential of contributing to forest carbon stocks enhancement by increasing the stocking density of shade trees to recommended levels.

  17. POPULATION OF HELICOTYLENCHUS sp AND APHELENCHUS sp NEMATODES IN THE RHIZOSPHERE OF CACAO (Theobroma cacao L.) UNDER TRADITIONAL AND IMPROVED FOREST MANAGEMENT SYSTEMS

    Science.gov (United States)

    Nematode population associated with cocoa rhizosphere was investigated at field experiment at Tropical Crop Institute (ICT) Tarapoto, San Martin-Peru. This study was carried out under two cacao management systems: traditional management system (ST) and under improved forest management system (SBB). ...

  18. ATRIBUTOS FÍSICOS-QUÍMICOS Y SENSORIALES DE LAS ALMENDRAS DE QUINCE CLONES DE CACAO NACIONAL (Theobroma cacao L. EN EL ECUADOR

    Directory of Open Access Journals (Sweden)

    Jaime Fabian Vera Chang

    2015-03-01

    Full Text Available La investigación se realizó en la Finca Experimental “La Represa” propiedad de la Universidad Técnica Estatal de Quevedo y en el Laboratorio de Calidad de Cacao de la EET-Pichilingue-INIAP con una duración de cuatro meses (febrero-junio/2013. El objetivo fue caracterizar los atributos físico-químicos de almendras y sensoriales de pastas de quince clones de cacao; doce de tipo Nacional y tres testigos (CCN-51, EET-103 e IMC-67. Se utilizó un diseño completamente al azar con tres repeticiones. Las variables estudiadas fueron: índices de semilla y mazorca, número de almendras, peso de 100 semillas, porcentaje y pH de testa. Para la valoración química se registró: grasa, energía, y ceniza. Los atributos sensoriales (sabores, acidez, amargor, astringencia, dulce, cacao, floral, frutal, nuez y otros sabores se evaluaron usando una escala ordinal de 0 a 5; además, de los defectos crudo/verde y moho. Se realizó el análisis de Componentes Principales. El mayor índice de mazorca correspondió al DIRCYT-C129 (34.36 g; el DIRCYT-C103 tuvo mayor índice de semilla (1.65 g; en el peso de 100 semillas y contenido de grasa no hubo diferencias significativas (p>0.05; aunque CCN-51 fue ligeramente superior (41.44%. En atributos físicos fueron superiores los clones EET-103, CCN-51 y IMC-67. Todos los clones presentaron características químicas similares. El DIRCYT-C225 presentó el mejor perfil sensorial “sabor Arriba o floral”, con alto potencial para la industria chocolatera.

  19. Evaluación microbiológica y sensorial de fermentados de pozol blanco, con cacao (Theobroma cacao y coco (Cocos nucifera

    Directory of Open Access Journals (Sweden)

    Román Jiménez Vera

    2010-06-01

    Full Text Available El pozol es una bebida de maíz que se consume en el sureste de México y en algunos países de Centroamérica. Se puede consumir recién elaborado o fermentado. Tradicionalmente se consume solo (pozol blanco, aunque también es común agregarle cacao o coco. En este trabajo se evaluaron cambios microbiológicos durante la fermentación natural a temperatura ambiental, de tres tipos de pozol: blanco, con cacao y coco. La concentración de bacterias coliformes disminuyó a partir del tercer día de fermentación y a los 12 días se obtuvo una concentración de 2,20 log UFC/g. En las bacterias lácticas se observó el mayor crecimiento; ellas alcanzaron una concentración de 8,00 log UFC/g a los 3 días de fermentación que se mantuvo durante los 9 días siguientes. Se realizaron pruebas de nivel de agrado y preferencia con 31 jueces consumidores. La adición de ingredientes como el cacao o el coco no mejoraron el nivel de agrado entre los consumidores evaluados (p > 0,05. El pozol blanco y fresco fue el preferido (32 %. En el futuro, estos resultados pueden ser utilizados para clasificar al pozol como una bebida funcional, debido a la presencia de bacterias lácticas en concentración similar a la encontrada en el yogur.

  20. Breeding Value of Cocoa (Theobroma cacao L. for Pod and Bean Traits: A Consequential Advance in Nigerian Cocoa Breeding Program

    Directory of Open Access Journals (Sweden)

    Daniel Babasola ADEWALE

    2014-06-01

    Full Text Available The understanding of the generated hybrids’ breeding value gives a measure of probable advances in a breeding program. Four cocoa genotypes (testers were crossed with two distinct lines (T65/7 and T86/2. The parents and the hybrids were separately established in randomized complete block design with six replications. The fourteen genotypes were evaluated for pod length (PL, weight (PW, beans/pod (NoB, bean length (BL, width (Bwi and thickness (BT. The treatment, parent, crosses and Line x Tester sources of variation were significant (P ≤ 0.05. Hybrids from the same maternal parent differed significantly (P < 0.05 for the six traits. Contribution to the total variance of PL, PW and Bwi were in the following order: Tester > Line x Tester > Lines. The highest general combining ability (0.42 occurred in T65/7 for PW; the least (-0.081 occurred in T86/2 for PL. Cross combination T65/7xT57/22 produced the highest specific ability of combination (4.33 for NoB. Variance of GCA and SCA were significant (P < 0.05 for the six traits. The GCA/SCA ratios revealed the inheritance of PL, PW, Bwi and BT to be additive. Non-additive gene effect controlled NoB and BL. Heterosis for the six traits ranged between -17.82% for BT (T65/7xT57/22 to 52.40% for PW (T65/7xT53/8. Increased productivity in cocoa is possible through hybrid breeding programs.

  1. Model Pengelolaan Agroforestri Kakao (Theobroma Cacao L. terhadap Kontribusi Pendapatan Rumah Tangga (Suatu Kasus di Kecamatan Anyar Kabupaten Serang Provinsi Banten

    Directory of Open Access Journals (Sweden)

    Sri Wahyuningsih

    2017-03-01

    Full Text Available The research aims to analyze the management of cocoa agroforestry, labor allocation and household income of farmers in cocoa agroforestry management activities as well as the contribution of agroforestry to household income of cocoa farmers in the Anyar District Serang Regency Banten Province. The method used in this research is a survey using two stage cluster sampling method. Samples taken are as many as 60 farmer of 400 populations scattered from cocoa agroforestry farmers in the Anyar District Serang Regency Banten Province. The results showed that the management of cocoa agroforestry in the Anyar District during year 1 to year 7 consists of 5 stages, namely : land clearing, planting, maintenance, harvesting and post-harvest. Average allocation of labor in the cocoa agroforestry management activities in the Anyar District is at 440,18 HOK/Ha/Year with the following composition : 1,21 HOK/Ha/Year in the planting stage, 132,5 HOK/Ha/Year in the maintenance stage, 145,22 HOK/Ha/Year in the harvesting stage and 161,25 HOK/Ha/year in the post-harvest stage. Average household income of cocoa agroforestry farmers in the Anyar District is Rp. 84.451.377/Year which includes income from cocoa agroforestry is Rp. 26.880.210/Year by contributing to the household income of farmers by 31,83%/Year and income from non-cocoa agroforestry is Rp. 57.571.167/Year by contributing to the household income of farmers by 68,17%/Year.

  2. EVALUASI KESESUAIAN LAHAN DAN OPTIMASI PENGGUNAAN LAHAN UNTUK PENGEMBANGAN TANAMAN KAKAO (Theobroma cacao L. (Studi Kasus di Kecamatan Batee dan Kecamatan Padang Tiji Kabupaten Pidie Propinsi Aceh

    Directory of Open Access Journals (Sweden)

    Dewi Sri Jayanti

    2013-08-01

    Full Text Available The research was conducted to find out the classification of land suitability and the influences of land characterization for cacao; and to optimize the land use based on the classification of land suitability. This classification was derived from physical and chemical properties of land and by overlaying maps which suitable with the requirements of cacao’s growth using ArcGIS. The suitable level for cacao was optimized using QM for windows to obtain the optimal land. The classification of land suitability in Batee District were: S1 (very suitable was 35,42 % (2.572,662 ha; S2 (suitable was 20,31 % (1.922,737 ha and N (not suitable was 44,27 % (3.572,008 ha, respectively. The classification of land suitability in Padang Tiji District were: S1 (very suitable was 2,72 % (306,173 ha; S2 (suitable was 92,50 % (10.429,770 ha and N (not suitable was 4,79 % (539,606 ha, respectively. Based on the linear programming, the results showed that the optimal land was 3.475,065 ha with the maximum profit was Rp 29.756.057.638,21. This production begun at the 7th year. The actual land areas in Batee and Padang Tiji Districts were 4.495,359 ha and 10.735,943 ha, respectively. This results implied that there was still the availability of land that could be used to develop cacao. Keywords: the land suitability, cacao, linear programming, optimization.   ABSTRAK Tujuan dari penelitian ini adalah untuk mengetahui kelas kesesuaian lahan tanaman kakao; mengetahui pengaruh karakteristik lahan untuk pengembangan kakao dan memperoleh tingkat kelayakan usahatani; dan optimalisasi penggunaan lahan berdasarkan kelas kesesuaian lahan. Kelas kesesuaian lahan didapatkan dengan mencocokkan sifat fisik dan kimia dari lahan usahatani serta mengoverlaikan peta-peta yang sesuai dengan persyaratan tumbuh tanaman kakao dengan ArcGIS. Selanjutnya dihitung tingkat kelayakan usahatani kakao dan dilakukan optimasi menggunakan QM for Windows untuk mendapatkan lahan optimum dengan keuntungan maksimum. Kelas kesesuaian lahan yang didapatkan di Kecamatan Batee: kelas S1 (sangat sesuai sebesar 35,42% (2.572,622 ha; S2 (sesuai sebesar 20,31% (1.922,737 ha dan N (tidak sesuai sebesar 44,27% (3.572,008 ha; serta di Kecamatan Padang Tiji: kelas S1 (sangat sesuai sebesar 2,72% (306,173 ha; S2 (sesuai sebesar 92,50% (10.429,770 ha; dan N (tidak sesuai sebesar 4,79% (539,606 ha. Hasil analisis program linier menunjukkan bahwa luas lahan yang optimal digunakan seluas 3.475,065 ha. Keuntungan maksimum yang dapat diperoleh dengan luas lahan 3.475,065 ha adalah Rp 29.756.057.638,21 dimulai pada tahun produksi ke-7. Luas lahan aktual saat ini di Kec. Batee seluas 4.495,359 ha dan di Kec. Padang Tiji seluas 10.735,943 ha yang merupakan sumberdaya yang dapat ditingkatkan. Hal ini berarti masih besarnya ketersediaan lahan yang dapat dimanfaatkan untuk pengembangan tanaman kakao. Kata kunci: kesesuaian lahan, tanaman kakao, program linier, optimasi.

  3. The content of polyphenolic compounds in cocoa beans (Theobroma cacao L.), depending on variety, growing region, and processing operations: a review.

    Science.gov (United States)

    Oracz, Joanna; Zyzelewicz, Dorota; Nebesny, Ewa

    2015-01-01

    Polyphenols form the largest group of compounds among natural antioxidants, which largely affect the overall antioxidant and anti-free radical activity of cocoa beans. The qualitative and quantitative composition of individual fractions of polyphenolic compounds, even within one species, is very diverse and depends on many factors, mainly on the area of cocoa trees cultivation, bean maturity, climatic conditions during growth, and the harvest season and storage time after harvest. Thermal processing of cocoa beans and cocoa derivative products at relatively high temperatures may in addition to favorable physicochemical, microbiological, and organoleptic changes result in a decrease of polyphenols concentration. Technological processing of cocoa beans negatively affects the content of polyphenolic compounds.

  4. Multi-element, multi-compound isotope profiling as a means to distinguish the geographical and varietal origin of fermented cocoa (Theobroma cacao L.) beans.

    Science.gov (United States)

    Diomande, Didier; Antheaume, Ingrid; Leroux, Maël; Lalande, Julie; Balayssac, Stéphane; Remaud, Gérald S; Tea, Illa

    2015-12-01

    Multi-element stable isotope ratios have been assessed as a means to distinguish between fermented cocoa beans from different geographical and varietal origins. Isotope ratios and percentage composition for C and N were measured in different tissues (cotyledons, shells) and extracts (pure theobromine, defatted cocoa solids, protein, lipids) obtained from fermented cocoa bean samples. Sixty-one samples from 24 different geographical origins covering all four continental areas producing cocoa were analyzed. Treatment of the data with unsupervised (Principal Component Analysis) and supervised (Partial Least Squares Discriminant Analysis) multiparametric statistical methods allowed the cocoa beans from different origins to be distinguished. The most discriminant variables identified as responsible for geographical and varietal differences were the δ(15)N and δ(13)C values of cocoa beans and some extracts and tissues. It can be shown that the isotope ratios are correlated with the altitude and precipitation conditions found in the different cocoa-growing regions. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. Development of a nopal fiber (Opuntia ficus-indica and powdered cocoa (Theobroma cacao added beef patties, nutritive, physicochemical and sensory characteristics

    Directory of Open Access Journals (Sweden)

    F.H. Chamorro-Ramirez

    2013-12-01

    Full Text Available The objective of this work was to evaluate addition effect of 3% of nopal fiber (FN and cacao powder (CA on the physicochemical, nutritional content and sensory acceptation of patty meat. A total of 144 patties were elaborated in three different batches: Control (TC no addition; FN with 3% of FN; and CA with 3% of CA. Physicochemical tests (pH, Aw, texture (TPA and instrumental color (CIE-Lab at different storage times (0, 2, 7, 14 and 28 days, besides to nutritional content and acceptation test. pH increased in all the treatments at 28 days of storage, where CA addition decreased luminosity (P>0.05 and maintained higher a* values (P0.05. FN or CA addition increased fiber content (P<0.05. Patties with FN showed a moderate acceptation. Since addition of FN or CA did not decreased consumer acceptation, these can be employed as ingredients in the development of functional foods.

  6. Eficiencia fisiológica de uso de NPK en clones autoincompatible y autocompatible de cacao (Theobroma cacao L. en Colombia

    Directory of Open Access Journals (Sweden)

    Yina Jazbleidi Puentes-Páramo

    2016-06-01

    Full Text Available La investigación tuvo como objetivo evaluar la eficiencia fisiológica de N-P-K en clones de cacao de sabor y aroma autocompatible (CCN-51, ICS-95 y autoincompatible: (TSH-565, ICS-39, con la finalidad de determinar la capacidad de producción de grano seco por unidad de nutriente absorbido. Se utilizó un diseño en bloques completos al azar con cinco tratamientos y cuatro repeticiones, los tratamientos fueron diseñados a partir del nivel de fertilidad natural del suelo (TR-Tratamiento de referencia y sobre este el 25, 50, 75 y 100% más de Nitrógeno-Fósforo-Potasio (N-P-K, correspondiente al T1, T2, T3 y T4. Los resultados evidencian que hay diferencias altamente significativas entre clones para los nutrientes N-P-K absorbidos, exhibiendo mayor absorción de nitrógeno, seguido de potasio y por ultimo fósforo, en este sentido, el clon autocompatible CCN-51 mostro mayor habilidad de absorción para la mayoría de nutrientes, excepto fósforo, sin embargo, no es generalizada la mayor habilidad para clones autocompatibles con respecto a clones autoincompatibles.  La mayor eficiencia fisiológica de uso de nutrientes N-P-K se presentó en el tratamiento uno y la menor capacidad de producción de grano seco de cacao por unidad de nutriente se presentó con la dosis nutricional más alta en el tratamiento cuatro, lo cual sugiere que a mayor dosis disminuye la eficiencia fisiológica de uso de nitrógeno, fósforo y potasio de los clones.

  7. ANÁLISIS DE LA ESTRUCTURA ARBÓREA DEL SISTEMA AGROFORESTAL DE CACAO (Theobroma cacao L. EN EL SOCONUSCO, CHIAPAS - MÉXICO

    Directory of Open Access Journals (Sweden)

    Hugo Alexander Roa Romero

    2009-09-01

    Full Text Available Se determinó la abundancia, riqueza, importancia, equidad y diversidad de los árboles encontrados en sistemas agroforestales de cacao, del Soconusco, Chiapas, México. La presente investigación, se desarrolló en la región costera del Soconusco, ubicada al sur del estado de Chiapas; se muestrearon los municipios de Huehuetán, Tapachula y Tuxtla Chico, por ser los más representativos en área sembrada de cacao. En cada municipio, se establecieron al azar siete parcelas temporales de 50 x 50 m cada una, lo que suma en total 5,25 hectáreas, en las cuales se registraron variables como el diámetro a la altura del pecho (DAP: 1,3 m sobre el nivel del suelo, área basal, y sombrío en el cacaotal. Se encontraron 46 especies agrupadas en 21 familias, las especies con el mayor valor de importancia fueron Mangifera indica y Pouteria sapota, convirtiéndose en las especies de sombra más frecuentemente encontradas. La composición florística denotó una mayor similitud en los municipios de Tapachula y Huehuetán, como lo muestra el mayor porcentaje del índice de Jaccard y en lo que respecta a diversidad, el municipio de Tuxtla Chico presentó el mayor valor según el índice de Shannon. Este estudio determina la existencia de una cobertura definitiva de preferencia asociada a los árboles frutales.

  8. IDENTIFICACIÓN DE ÁRBOLES POTENCIALES DE (THEOBROMA CACAO. L EN SIUNA Y ROSITA, JUNIO 2009 – JUNIO 2010

    Directory of Open Access Journals (Sweden)

    Oscar Montalván Castellón

    2013-10-01

    Full Text Available La investigación se orientó a la selección de árboles potenciales de cacao, caracterizando los ambientes para los cuales se describió el comportamiento productivo de los árboles potenciales y los resistentes a plagas y enfermedades. Se estudiaron  15 unidades de producción, 8 en la comunidad el Carao, dos en el Guayabo, dos en Rosa Grande y una en Floripón del municipio de Siuna, una en el Zopilote y una en Santa Rita del municipio de Rosita. Esta investigación servirá  como una herramienta base para nuevos estudios y un instrumento para el mejoramiento del cultivo del cacao a nivel municipal y regional, donde sean beneficiarios los productores inmersos en el proceso de mejoramiento del cultivo. Se identificó un total de 78 árboles potenciales, y se caracterizaron los ambientes, comportamiento productivo,  resistencia a plaga y enfermedades, características agroecológicas y morfológicas.Entre los principales resultados sobresale  la producción promedio por árbol, este se comportó de la manera siguiente: entre 3.11 a 4.6 kilogramos por árbol en los tipos angoletas, 3.1 a 4.00 kilogramos en los amelonados, 3.11 a 4.7 en los cundeamor y 0.6 kilogramos en los calabacín. La mayoría de los árboles evaluados presentaron afectaciones por plagas y enfermedades como: Moniliasis, mazorca negra, Cherelle wild y gusanos en los frutos, así como afectaciones por tandas en ramas.SummaryThe research focused on the selection of potential cacao trees, characterizing the environments that describes the productive behaviour of these trees and those that are resistant to plagues and diseases. 15 productive units were analized, distribuited as followed: 8 in the community of Carao, 2 in Guayabo, 2 in Rosa Grande, 1 in Floripon   –municipality of Siuna-, 1 in Zopilote and 1 in Santa Rosa –municipality of Rosita-.This research will serve as a tool for the development of other researches, and as an instrument to improve the cacao production at a municipal and regional level, where the direct beneficiaries will be the producers who are involved in the process of crop improvement. A total of 78 potential cacao trees were identified, and the environments were characterized, also the productive behaviour, the resistance to plagues and diseases, as well as the agroecological and morphological characteristics. Among the main results it’s important to mention the prevalence of the average production per tree, which behaved as follows: between 3.11 to 4.6 kg per tree in angoletas type, 3.1 to 4.00 kg in amelonados, 3.11 to 4.7 kg in cundeamor and 0.6 kg in the calabacin type. Most trees presented damages by plagues and diseases such as: Moniliasis, black-cob, wild Cherelle and worms in the fruits, as well as branches affectations.

  9. ANÁLISIS ESPACIAL DE LA INCIDENCIA DE ENFERMEDADES EN DIFERENTES GENOTIPOS DE CACAO (Theobroma cacao L.) EN EL YOPAL (CASANARE), COLOMBIA

    OpenAIRE

    Néstor Julián CÁRDENAS PARDO; Aquiles DARGHAN; Miguel Darío SOSA RICO; Alia RODRIGUEZ

    2017-01-01

    Las enfermedades “pudrición negra del fruto” y “moniliasis” son reportadas como limitantes en plantaciones de cacao en Colombia. Fueron evaluados los patrones espaciales de incidencia para estas dos enfermedades en un cultivo de cacao durante un monitoreo de trece semanas en campo. Semivariogramas e interpolación kriging fueron usados para analizar el comportamiento espacial de “pudrición negra del fruto”, los estadísticos Join Count e Índice de Moran se emplearon para ...

  10. Determinacion de parámetros y simulación matemática del proceso de secado de cacao (Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Fanny Villamizar de Borrero

    2011-06-01

    Full Text Available Estudio sobre la producción de cacao en Colombia, y el incremento notable, debido principalmente al aumento en el área cultivada y a los mayores rendimientos por hectárea obtenidos.

  11. Comparison of polyphenol concentration and composition between genetically diverse cacao (Theobroma cacao L.) accessions selected for high yield and disease resistance

    Science.gov (United States)

    There is abundant evidence that consumption of cacao and dark chocolate promotes human health and that the main cacao components contributing positive health effects are polyphenols. The polyphenols in cacao bean constitute 12–18% dry weight of the whole bean and are predominantly catechins (37% w/w...

  12. Pengaruh Konsentrasi Pyraclostrobin terhadap Kandungan Protein, Lemak dan Fenolik Total Biji Kakao (Theobroma cacao L.) Klon ICCRI 04 dan Scavina 6

    OpenAIRE

    Siniwi, Ratnasani Ambarwati; Susila Putra, Eka Tarwaca; Respatie, Dyah Weny

    2017-01-01

    Produksi dan kualitas kakao di Indonesia saat ini mengalami penurunan karena serangan hama Phytophtora palmivora. Salah satu upaya yang dilakukan adalah dengan aplikasi fungisida berbahan aktif pyraclostrobin sebagai penanganan penyakit oleh Phytophtora palmivora sekaligus sebagai Plant Growth Reguator. Penelitian ini bertujuan untuk menentukan konsentrasi pyraclostrobin yang optimum dalam perbaikan kandungan protein, lemak, dan fenolik total biji kakao pada setiap set penelitian  klon ICCRI ...

  13. Shade tree diversity and aboveground carbon stocks in Theobroma cacao agroforestry systems: implications for REDD+ implementation in a West African cacao landscape

    Directory of Open Access Journals (Sweden)

    Evans Dawoe

    2016-08-01

    Full Text Available Abstract Background The promotion of cacao agroforestry is one of the ways of diversifying farmer income and creating incentives through their inclusion in REDD+ interventions. We estimated the aboveground carbon stocks in cacao and shade trees, determined the floristic diversity of shade trees and explored the possibility of implementing REDD+ interventions in cacao landscapes. Using replicated multi-site transect approach, data were collected from nine 1-ha plots established on 5 km long transects in ten cacao growing districts in Ghana West Africa. Biomass of cacao and shade trees was determined using allometric equations. Results One thousand four hundred and one (1401 shade trees comprising 109 species from 33 families were recorded. Total number of species ranged from 34 to 49. Newbouldia laevis (Bignoniacea was the most frequently occurring specie and constituted 43.2 % of all shade trees. The most predominant families were Sterculiaceae and Moraceae (10 species each, followed by Meliaceae and Mimosaceae (8 species each and Caesalpiniacaea (6 species. Shannon diversity indices (H’, Hmax and J’ and species richness were low compared to other similar studies. Shade tree densities ranged from 16.2 ± 3.0 to 22.8 ± 1.7 stems ha−1 and differed significantly between sites. Carbon stocks of shade trees differed between sites but were similar in cacao trees. The average C stock in cacao trees was 7.45 ± 0.41 Mg C ha−1 compared with 8.32 ± 1.15 Mg C ha−1 in the shade trees. Conclusions Cacao landscapes in Ghana have the potential of contributing to forest carbon stocks enhancement by increasing the stocking density of shade trees to recommended levels.

  14. ANÁLISIS DE LA ESTRUCTURA ARBÓREA DEL SISTEMA AGROFORESTAL DE CACAO (Theobroma cacao L. EN EL SOCONUSCO, CHIAPAS - MÉXICO

    Directory of Open Access Journals (Sweden)

    HUGO A. ROA-ROMERO

    2009-01-01

    Full Text Available Se determinó la abundancia, riqueza, importancia, equidad y diversidad de los árboles encontrados en sistemas agroforestales de cacao, del Soconusco, Chiapas, México. La presente investigación, se desarrolló en la región costera del Soconusco, ubicada al sur del estado de Chiapas; se muestrearon los municipios de Huehuetán, Tapachula y Tuxtla Chico, por ser los más representativos en área sembrada de cacao. En cada municipio, se establecieron al azar siete parcelas temporales de 50 x 50 m cada una, lo que suma en total 5,25 hectáreas, en las cuales se registraron variables como el diámetro a la altura del pecho (DAP: 1,3 m sobre el nivel del suelo, área basal, y sombrío en el cacaotal. Se encontraron 46 especies agrupadas en 21 familias, las especies con el mayor valor de importancia fueron Mangifera indica y Pouteria sapota, convirtiéndose en las especies de sombra más frecuentemente encontradas. La composición florística denotó una mayor similitud en los municipios de Tapachula y Huehuetán, como lo muestra el mayor porcentaje del índice de Jaccard y en lo que respecta a diversidad, el municipio de Tuxtla Chico presentó el mayor valor según el índice de Shannon. Este estudio determina la existencia de una cobertura definitiva de preferencia asociada a los árboles frutales.

  15. ANÁLISIS DE LA ESTRUCTURA ARBÓREA DEL SISTEMA AGROFORESTAL DE CACAO (Theobroma cacao L. EN EL SOCONUSCO, CHIAPAS - MÉXICO

    Directory of Open Access Journals (Sweden)

    Roa Romero Hugo Alexander

    2009-12-01

    Full Text Available Se determinó la abundancia, riqueza, importancia, equidad y diversidad de los árboles encontrados en sistemas agroforestales de cacao, del Soconusco, Chiapas, México. La presente investigación, se desarrolló en la región costera del Soconusco, ubicada al sur del estado de Chiapas; se muestrearon los municipios de Huehuetán, Tapachula y Tuxtla Chico, por ser los más representativos en área sembrada de cacao. En cada municipio, se establecieron al azar siete parcelas temporales de 50 x 50 m cada una, lo que suma en total 5,25 hectáreas, en las cuales se registraron variables como el diámetro a la altura del pecho (DAP: 1,3 m sobre el nivel del suelo, área basal, y sombrío en el cacaotal. Se encontraron 46 especies agrupadas en 21 familias, las especies con el mayor valor de importancia fueron Mangifera indica y Pouteria sapota, convirtiéndose en las especies de sombra más frecuentemente encontradas. La composición florística denotó una mayor similitud en los municipios de Tapachula y Huehuetán, como lo muestra el mayor porcentaje del índice de Jaccard y en lo que respecta a diversidad, el municipio de Tuxtla Chico presentó el mayor valor según el índice de Shannon. Este estudio determina la existencia de una cobertura definitiva de preferencia asociada a los árboles frutales.

  16. El polisulfuro de calcio en el manejo de la moniliasis Moniliophthora roreri (Cif & Par. Evans et al. del cacao Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Sandra Ramírez González

    2011-05-01

    Full Text Available El cacao es severamente afectado por el hongo Moniliophthora roreri (Cif & Par. Evans et al., el cual daña los frutos y puede ocasionar pérdidas totales y su control es principalmente cultural. El objetivo del trabajo es determinar la efectividad del polisulfuro de calcio (PC como alternativa para su manejo. El patógeno fue aislado y cultivado in vitro y se evaluó el efecto del PC sobre la germinación y formación de conidias; en el campo, sobre frutos se asperjó PC antes y después de la inoculación con M. roreri y se determinó la incidencia e índices de severidad interna y externa. En una plantación de cacao se asperjó PC y se determinó su incidencia y producción. El PC in vitro inhibió el crecimiento y la formación de conidias; la aplicación de PC antes o después de la inoculación artificial con M. roreri sobre frutos inhibe completamente el desarrollo de la enfermedad; con aspersiones de PC en plantaciones de cacao la incidencia de la enfermedad fue de 0,53%, mientras que fue de 21% con manejo cultural y del 69,6% con testigo de inoculación natural; la producción de cacao seco/año fue de un 90,6% más con PC que en el testigo de inoculación natural, por lo que resulta viable integrar PC en el manejo deM. roreri.

  17. Evaluación microbiológica y sensorial de fermentados de pozol blanco, con cacao (Theobroma cacao y coco (Cocos nucifera

    Directory of Open Access Journals (Sweden)

    Román Jiménez Vera

    2010-07-01

    Full Text Available El pozol es una bebida de maíz que se consume en el sureste de México y en algunos países de Centroamérica. Se puede consumir recién elaborado o fermentado. Tradicionalmente se consume solo (pozol blanco, aunque también es común agregarle cacao o coco. En este trabajo se evaluaron cambios microbiológicos durante la fermentación natural a temperatura ambiental, de tres tipos de pozol: blanco, con cacao y coco. La concentración de bacterias coliformes disminuyó a partir del tercer día de fermentación y a los 12 días se obtuvo una concentración de 2,20 log UFC/g. En las bacterias lácticas se observó el mayor crecimiento; ellas alcanzaron una concentración de 8,00 log UFC/g a los 3 días de fermentación que se mantuvo durante los 9 días siguientes. Se realizaron pruebas de nivel de agrado y preferencia con 31 jueces consumidores. La adición de ingredientes como el cacao o el coco no mejoraron el nivel de agrado entre los consumidores evaluados (p > 0,05. El pozol blanco y fresco fue el preferido (32 %. En el futuro, estos resultados pueden ser utilizados para clasificar al pozol como una bebida funcional, debido a la presencia de bacterias lácticas en concentración similar a la encontrada en el yogur.

  18. Restriction enzyme improves the efficiency of genetic transformations in Moniliophthora perniciosa, the causal agent of witches’ broom disease in Theobroma cacao

    OpenAIRE

    Francis Julio Fagundes Lopes; Marisa Vieira de Queiroz; Juliana de Oliveira Lima; Viviane Aline Oliveira Silva; Elza Fernandes Araújo

    2008-01-01

    The presence of restriction enzymes in the transformation mixture improved the efficiency of transformation in Moniliophthora perniciosa. The influence of the vector shape (linear or circular), the patterns of plasmid integration in genomic sites and the influence of the promoter used to express the gene marker were also analyzed. The addition of BamHI or NotI increased the number of transformants by 3-10-fold and 3-fold, respectively, over the control without added enzyme. The use of pre-lin...

  19. EFECTO DEL TIPO Y TIEMPO DE FERMENTACIÓN EN LA CALIDAD FÍSICA Y QUÍMICA DEL CACAO (Theobroma cacao L. TIPO NACIONAL

    Directory of Open Access Journals (Sweden)

    Rubén Darío Rivera Fernández

    2012-07-01

    Full Text Available La presente investigación tuvo como objetivo evaluar los tipos de fermentadores y los diferentes tiempos de fermentación usados por los productores de cacao de la zona norte y central de la provincia de Manabí-Ecuador. Se estudiaron cuatro fermentadores: saco de yute, montón, caja de madera y tina plástica, con una capacidad para almacenar 60 kg de cacao y tiempos de fermentación de 2 a 5 días; además, se evaluó un testigo (sin fermentar. El diseño fue bloques completos al azar en arreglo factorial aditivo con tres réplicas. Los datos se analizaron mediante análisis de varianza con la prueba de Tukey al 5% de probabilidades. Se analizaron variables físicas: porcentaje de granos fermentados, violeta y pizarrosos (prueba de corte; y químicas: polifenoles (fotometría 760 nm, acidez volátil (arrastre de vapor y teobromina-cafeína (Cromatografía Líquida de Alta resolución, HPLC. El análisis de los resultados muestra que el tiempo de fermentación a diferencia del tipo de fermentador, tuvo influencia sobre las variables físicas y químicas analizadas. El aumento del porcentaje de granos fermentados y la disminución de los granos violetas ocurrieron desde el inicio hasta el final de la fermentación. La calidad química mejora con la reducción de la concentración de compuestos alcaloides y polifenoles, lo que repercute sobre las características organolépticas del cacao tipo Nacional. De los fermentadores y los tiempos utilizados por los productores se presentan las mejores características de calidad entre los cuatro y cinco días de fermentación en cajas de madera.

  20. Changes in physical and chemical characteristics of fermented cocoa (Theobroma cacao beans with manual and semi-mechanized transfer, between fermentation boxes

    Directory of Open Access Journals (Sweden)

    Pedro. P. Peláez

    2016-06-01

    Full Text Available The aim of this study was to evaluate variation in the physical and chemical properties of fermented cocoa beans with cocoa beans transfer between wooden fermentation boxes manually (M and semi-mechanized (SM way. Mass temperature, moisture, pH, and total acidity of the cotyledon and pulp; the total polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content in fresh, fermented, and dried beans; and percentage of fermented beans and time required to move beans during fermentation were determined. The cocoa used grew in the Pachiza district of the San Martin region of Peru. Cocoa sampling was each 0, 48, 72, 96, 120, 144, and 168 h of fermentation. The cocoa mass temperature was highest with both removal systems after 96 h of fermentation. M cotyledon and pulp samples had the highest moisture content and titratable acidity, while cotyledon and pulp pH with both systems were statistically equal. In contrast, fermented beans had a higher polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content with SM. SM produced the greatest amount of fermentation (91.67% and required the shortest amount of time to move beans (78.56 min. In conclusion, the system of fermentation of cocoa beans with SM was faster and produced fermented grains with high chemical quality.

  1. SPATIAL STRUCTURE OF Theobroma subincanumMart. AND Theobromaspeciosum Willd. ex Spreng.IN THE PARQUE NACIONAL DO JURUENA, MATO GROSSO STATE, BRAZIL

    Directory of Open Access Journals (Sweden)

    Juliana de Freitas Encinas Dardengo

    Full Text Available ABSTRACT Analysis of the spatial distribution is a very useful tool to understand the ecological behavior of the species in that it provides information that underlies management strategies and influences the population structure. To study the horizontal structure of the species T. speciosum (Cacaui and T. subincanum (Cupui in the "Parque Nacional do Juruena", Mato Grosso state, a 200 x 160 m grid was implemented and divided into 40 adjacent 20 x 40 m subplots. All individuals of the species under study that had DBH > 1 cm were measured. The following parameters were analyzed: number of individuals, density, total height, basal area, diametric distribution, and spatial distribution. The research sampled 165 T. speciosum trees (51.56 ind.ha-1 and 34 T. subincanum (10.62 ind.ha-1, with an average diameter of 6.72 cm and 12.44 respectively, the T. speciosum individuals showed an aggregated distribution pattern, while the T. subincanum individuals presented a random pattern. The diametric distribution of T. speciosum followed an exponential distribution in a reverse-J shaped pattern, behavior expected for a forest environment with little anthropic pressure, while T. subincanum did not follow the same pattern, though the species demonstrated to be well established in the area, with significant number of individuals in all diameter classes, thus,the results indicate the importance of conservation areas established in order to safeguard the natural environment from the pressures of anthropic actions, and also the need for studies in the region of the Amazon biome.

  2. Impacto de las condiciones de beneficio sobre los compuestos precursores de aroma en granos de cacao (Theobroma cacao L del clon CCN-51.

    Directory of Open Access Journals (Sweden)

    Andrea Pallares Pallares

    2016-01-01

    Full Text Available Abstract The influence of the days of fermentation and drying in the aroma compounds (volatile fraction of cocoa beans CCN-51 was evaluated. The method used was Gas ChromatographyMass Spectrometry, coupled to Head Space Solid Phase Micro Extraction (HS-SPMEGC-GS. A multifactorial experimental design was created, containing 15 experiments per repetition. The fermentation technique was microfermentation in boxes, while drying was achieved by exposing the samples to the sun. A Principal Component Analysis (PCA allowed to explain 68% of the total variability associated with aroma characteristics (volatile compounds. Both, desirable and undesirable compounds were identified throughout the processes of fermentation and drying. The benefit process (fermentation and drying was divided in stages depending on the degree of fermentation. The desirable compounds identified were: 3-methy-1-butanol, 2-phenyl-ethanol, benzaldehyde, phenyl acetaldehyde, ethylhexanoate, ethyl benzoate, ethylphenyl acetate and 2-phenyl ethyl acetate, which are associated with odoriferous notes very nice (chocolate, candy, sweet, nutty, honey, fruity, floral. Finally, a pre-treatment of cocoa beans CCN-51 prior to fermentation was proposed to be incorporated during the benefit of the beans as it seems to enhance the formation of desirable aroma compounds.

  3. Flavor Profile of Clone CCN 51 Cocoa (Theobroma cacao L. Produced in Three Farms Municipality of San Vicente de Chucurí

    Directory of Open Access Journals (Sweden)

    Lucas Fernando Quintana Fuentes

    2011-04-01

    Full Text Available Colombia is one of the bigger producers of cocoa in America, the production is consumed in the totally in internal form. The department of Santander is me bigger producer of cocoa in Colombia and the municipality of San Vicente de Chucuri is considered the cocoa capital of the country. Actually theColombian federation of cocoa (Fedecacao together with the Unad have an agreement of cooperation for the strengthening of the evaluating capacity of the sensorial quality of the cocoa.In the process of evaluation of the sensorial quality of the cocoa liqueur (clone CNN 51 we established the needs in accordance to the current regulations for the implementation of a panel of trained judges, from the preselection, selection, specific training, training evaluation and the evaluation of the final samples ofthree representative farms in where is cultivated the clone CCN 51 in San Vicente del Chucuri.We conform a group of eleven trained judges and we obtained the sensorial profile of flavor for the samples for three representative farms of the municipality.

  4. Theobroma cacao L., "The food of the gods": Quality determinants of commercial cocoa beans, with particular reference to the impact of fermentation

    NARCIS (Netherlands)

    Líma, L.J.R.; Almeida, M.H.; Nout, M.J.R.; Zwietering, M.H.

    2011-01-01

    The quality of commercial cocoa beans, the principal raw material for chocolate production, relies on the combination of factors that include the type of planting material, the agricultural practices, and the post-harvest processing. Among these, the fermentation of the cocoa beans is still the most

  5. Evaluación de fungicidas sistémicos y de contacto en el control de la moniliasis (Moniliophthora roreri) del cacao (Theobroma cacao).

    OpenAIRE

    Quevedo Damián, Isaí

    2012-01-01

    La moniliasis causada por Moniliophthora roreri, es una de las enfermedades más destructivas del cacao en América. Afecta exclusivamente al fruto en cualquier etapa de desarrollo, causando pérdidas de hasta el 100% de la producción. Las prácticas culturales han sido el método más aplicado para el combate de la enfermedad, por lo que la selección de fungicidas adecuados contra M. roreri que puedan ser incluidos en programas de manejo de la enfermedad. El objetivo de la presente investigación f...

  6. High-performance liquid chromatography separation and purification of cacao (Theobroma cacao L.) procyanidins according to degree of polymerization using a diol stationary phase.

    Science.gov (United States)

    Kelm, Mark A; Johnson, J Chris; Robbins, Rebecca J; Hammerstone, John F; Schmitz, Harold H

    2006-03-08

    A new chromatographic approach for separating cacao procyanidins according to their degree of polymerization has been developed. It utilizes diol stationary phase columns operating in normal phase mode with a binary gradient of acidified acetonitrile and methanol-water. Performance of the diol stationary phase was evaluated on an analytical scale utilizing classical chromatographic conditions for the normal phase separation of procyanidins according to their degree of polymerization. The new separation approach was developed on an analytical scale but further extended to the preparative scale. These newly developed analytical and preparative high-performance liquid chromatography procedures were successfully applied to the separation, as well as isolation, of cacao procyanidins from unfermented cacao seeds. The degree of polymerization associated with each molecular weight fraction was determined by mass spectrometry.

  7. ESTUDO PROSPECTIVO DA FERMENTAÇÃO DO CACAU (Theobroma cacao L. SOB O ENFOQUE EM PEDIDOS DE PATENTES DEPOSITADOS NO MUNDO ENTRE 1899 A 2012

    Directory of Open Access Journals (Sweden)

    Adrielle Souza Leão Macêdo

    2014-07-01

    Full Text Available O cacaueiro tem importância econômica no contexto internacional por ser um commodity de participação relevante no comércio mundial de produtos agrícolas tanto em importações quanto exportações. As etapas de beneficiamento do cacau, principalmente a fermentação, devem ser conduzidas com excelência para garantir a  uniformidade das amêndoas de cacau e chocolates de alta qualidade. Este estudo tem por objetivo identificar patentes depositadas que tratam de  fermentação  do cacau. A pesquisa foi realizada nas bases de Espacenet (EP, utilizando como palavras-chave cocoa*and fermentation*. Foram encontradas 75 patentes depositadas nessa base de dados e nenhuma no Brasil (INPI. Observou-se que nos anos de 1991 e 2012, foram depositadas 48 patentes de novas tecnologias, métodos e equipamentos aplicáveis ao processo de fermentação de cacau, provavelmente pelo incentivo recebido pelos pesquisadores das áreas. O Reino Unido, Rússia e Estados Unidos, apesar de não produzir cacau, apresentam-se como países com maior investimento em relação à esta tecnologia de processamento.

  8. Identification of candidate genes involved in Witches' broom disease resistance in a segregating mapping population of Theobroma cacao L. in Brazil.

    Science.gov (United States)

    Royaert, Stefan; Jansen, Johannes; da Silva, Daniela Viana; de Jesus Branco, Samuel Martins; Livingstone, Donald S; Mustiga, Guiliana; Marelli, Jean-Philippe; Araújo, Ioná Santos; Corrêa, Ronan Xavier; Motamayor, Juan Carlos

    2016-02-11

    Witches' broom disease (WBD) caused by the fungus Moniliophthora perniciosa is responsible for considerable economic losses for cacao producers. One of the ways to combat WBD is to plant resistant cultivars. Resistance may be governed by a few genetic factors, mainly found in wild germplasm. We developed a dense genetic linkage map with a length of 852.8 cM that contains 3,526 SNPs and is based on the MP01 mapping population, which counts 459 trees from a cross between the resistant 'TSH 1188' and the tolerant 'CCN 51' at the Mars Center for Cocoa Science in Barro Preto, Bahia, Brazil. Seven quantitative trait loci (QTL) that are associated with WBD were identified on five different chromosomes using a multi-trait QTL analysis for outbreeders. Phasing of the haplotypes at the major QTL region on chromosome IX on a diversity panel of genotypes clearly indicates that the major resistance locus comes from a well-known source of WBD resistance, the clone 'SCAVINA 6'. Various potential candidate genes identified within all QTL may be involved in different steps leading to disease resistance. Preliminary expression data indicate that at least three of these candidate genes may play a role during the first 12 h after infection, with clear differences between 'CCN 51' and 'TSH 1188'. We combined the information from a large mapping population with very distinct parents that segregate for WBD, a dense set of mapped markers, rigorous phenotyping capabilities and the availability of a sequenced genome to identify several genomic regions that are involved in WBD resistance. We also identified a novel source of resistance that most likely comes from the 'CCN 51' parent. Thanks to the large population size of the MP01 population, we were able to pick up QTL and markers with relatively small effects that can contribute to the creation and selection of more tolerant/resistant plant material.

  9. Major phytopathogens and strains from cocoa (Theobroma cacao L.) are differentiated by MALDI-MS lipid and/or peptide/protein profiles.

    Science.gov (United States)

    Dos Santos, Fábio Neves; Tata, Alessandra; Belaz, Kátia Roberta Anacleto; Magalhães, Dilze Maria Argôlo; Luz, Edna Dora Martins Newman; Eberlin, Marcos Nogueira

    2017-03-01

    Phytopathogens are the main disease agents that promote attack of cocoa plantations in all tropical countries. The similarity of the symptoms caused by different phytopathogens makes the reliable identification of the diverse species a challenge. Correct identification is important in the monitoring and management of these pests. Here we show that matrix-assisted laser desorption ionization mass spectrometry (MALDI-MS) in combination with multivariate data analysis is able to rapidly and reliably differentiate cocoa phytopathogens, namely Moniliophthora perniciosa, Phytophthora palmivora, P. capsici, P. citrophthora, P. heveae, Ceratocystis cacaofunesta, C. paradoxa, and C. fimbriata. MALDI-MS reveals unique peptide/protein and lipid profiles which differentiate these phytopathogens at the level of genus, species, and single strain coming from different hosts or cocoa tissues collected in several plantations/places. This fast methodology based on molecular biomarkers is also shown to be sufficiently reproducible and selective and therefore seems to offer a suitable tool to guide the correct application of sanitary defense approaches for infected cocoa plantations. International trading of cocoa plants and products could also be efficiently monitored by MALDI-MS. It could, for instance, prevent the entry of new phytopathogens into a country, e.g., as in the case of Moniliophthora roreri fungus that is present in all cocoa plantations of countries bordering Brazil, but that has not yet attacked Brazilian plantations. Graphical Abstract Secure identification of phytopathogens attacking cocoa plantations has been demonstrated via typical chemical profiles provided by mass spectrometric screening.

  10. ANÁLISIS ESPACIAL DE LA INCIDENCIA DE ENFERMEDADES EN DIFERENTES GENOTIPOS DE CACAO (Theobroma cacao L. EN EL YOPAL (CASANARE, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Néstor Julián CÁRDENAS PARDO

    2017-01-01

    Full Text Available Las enfermedades “pudrición negra del fruto” y “moniliasis” son reportadas como limitantes en plantaciones de cacao en Colombia. Fueron evaluados los patrones espaciales de incidencia para estas dos enfermedades en un cultivo de cacao durante un monitoreo de trece semanas en campo. Semivariogramas e interpolación kriging fueron usados para analizar el comportamiento espacial de “pudrición negra del fruto”, los estadísticos Join Count e Índice de Moran se emplearon para estudiar el comportamiento espacial de “moniliasis”. La incidencia de “pudrición negra del fruto” presentó estructura de dependencia espacial de acuerdo a los semivariogramas durante el tiempo de evaluación, mientras que la autocorrelación espacial de sitios de infección de “moniliasis” se distribuyó de forma aleatoria entre las plantas de cacao según el Índice de Moran. El rango de dispersión estimado de “pudrición negra del fruto” varió entre 21,74 y 40,23 m y los mapas kriging evidenciaron el progreso espacio-temporal de la enfermedad durante las semanas evaluadas. Las condiciones experimentales dadas y la aproximación de los análisis espaciales, contribuyeron al entendimiento de la dinámica espacial de dos enfermedades limitantes en tres clones de cacao en la Orinoquía Colombiana.

  11. Identification of candidate genes involved in Witches' broom disease resistance in a segregating mapping population of Theobroma cacao L. in Brazil

    NARCIS (Netherlands)

    Royaert, Stefan; Jansen, J.; Silva, da Daniela Viana; Jesus Branco, de Samuel Martins; Livingstone, Donald S.; Mustiga, Guiliana; Marelli, Jean Philippe; Araújo, Ioná Santos; Corrêa, Ronan Xavier; Motamayor, Juan Carlos

    2016-01-01

    Background: Witches' broom disease (WBD) caused by the fungus Moniliophthora perniciosa is responsible for considerable economic losses for cacao producers. One of the ways to combat WBD is to plant resistant cultivars. Resistance may be governed by a few genetic factors, mainly found in wild

  12. Diversity of endophytic fungal community of cacao (Theobroma cacao L.) and biological control of Crinipellis perniciosa, causal agent of Witches' Broom Disease.

    Science.gov (United States)

    Rubini, Marciano R; Silva-Ribeiro, Rute T; Pomella, Alan W V; Maki, Cristina S; Araújo, Welington L; Dos Santos, Deise R; Azevedo, João L

    2005-01-01

    The basidiomycete fungus Crinipellis perniciosa (Stahel) Singer is the causal agent of Witches' Broom Disease of Cacao (Theobromacacao L.) which is the main factor limiting cacao production in the Americas. Pod losses of up to 90% are experienced in affected areas as evidenced by the 50% drop in production in Bahia province, Brazil following the arrival of the C. perniciosa in the area in 1989. The disease has proven particularly difficult to control and many farmers in affected areas have given up cacao cultivation. In order to evaluate the potential of endophytes as a biological control agent of this phytopathogen, the endophytic fungal community of resistant and susceptible cacao plants as well as affected branches was studied between 2001 and 2002. The fungal community was identified by morphological traits and rDNA sequencing as belonging to the genera Acremonium, Blastomyces, Botryosphaeria, Cladosporium, Colletotrichum, Cordyceps, Diaporthe, Fusarium, Geotrichum, Gibberella, Gliocladium, Lasiodiplodia, Monilochoetes, Nectria, Pestalotiopsis, Phomopsis, Pleurotus, Pseudofusarium, Rhizopycnis, Syncephalastrum, Trichoderma, Verticillium and Xylaria. These fungi were evaluated both in vitro and in vivo by their ability to inhibit C. perniciosa. Among these, some were identified as potential antagonists, but only one fungus (Gliocladium catenulatum) reduced the incidence of Witches' Broom Disease in cacao seedlings to 70%.

  13. Regeneration of somatic embryos in Theobroma cacao L. in temporary immersion bioreactor and analyses of free amino acids in different tissues.

    Science.gov (United States)

    Niemenak, Nicolas; Saare-Surminski, Katja; Rohsius, Christina; Ndoumou, Denis Omokolo; Lieberei, Reinhard

    2008-04-01

    The present study aimed at developing temporary immersion bioreactor techniques for multiplication of cacao somatic embryos. Temporary Immersion System (TIS), i.e. flooding of plant tissue at regular time intervals provides an efficient way to propagate plants. Somatic embryos were regenerated in twin flask bioreactors. The TIS proved to be suitable for mass regeneration of somatic embryos and for their subsequent direct sowing. The number of embryos after 3 months of culture was significantly higher in TIS cultures than in the solid medium variant. TIS also improved embryo development regarding the conversion to torpedo shaped forms. Matured embryos derived from TIS and pre-treated with 6% sucrose were converted into plants after direct sowing. Additionally to the influence of culture conditions on the development of somatic embryogenesis the content and composition of free amino acids were analysed. The content of free amino acids in somatic embryos rose as immersion frequency increased. The endogenous free GABA content in embryogenic callus was significantly higher than in non-embryogenic callus.

  14. Theobroma cacao L., "The food of the Gods": quality determinants of commercial cocoa beans, with particular reference to the impact of fermentation.

    Science.gov (United States)

    Lima, Lídia J R; Almeida, M Helena; Nout, M J Rob; Zwietering, Marcel H

    2011-09-01

    The quality of commercial cocoa beans, the principal raw material for chocolate production, relies on the combination of factors that include the type of planting material, the agricultural practices, and the post-harvest processing. Among these, the fermentation of the cocoa beans is still the most relevant since it is the process whereby the precursors of the cocoa flavor arise. The formation of these precursors depends on the activity of different microbial groups on the beans pulp. A comparison of fermentations in different countries showed that a well-defined microbial succession does not always take place and that the role of Bacillus spp. in this process remains unclear. Considering the overriding importance of the fermentation to achieve high quality commercial cocoa beans, we discuss the need of addressing the impact of the farming system, the ripeness state of the pods, and the role of microbial interactions on the fermentation in future research. In addition, the problem of high acidification cocoa beans, aspects dealing with the volatile fraction of the flavor, and the cocoa butter properties, all were identified as critical aspects that need further investigation. The standardization of the microbiological methods and the application of metagenomic approaches would magnify the knowledge in this domain.

  15. Near infra-red characterization of changes in flavan-3-ol derivatives in cocoa (Theobroma cacao L.) as a function of fermentation temperature.

    Science.gov (United States)

    Hue, Clotilde; Brat, Pierre; Gunata, Ziya; Samaniego, Ivan; Servent, Adrien; Morel, Gilles; Kapitan, André; Boulanger, Renaud; Davrieux, Fabrice

    2014-10-15

    Flavan-3-ols were successfully extracted from cocoa by the Fast-Prep device and analyzed by HPLC-DAD, and their identifications were confirmed by injection of authentic standards. (-)-Epicatechin was the most abundant component with an average of 9.4 mg/g dried cocoa powder. More than 700 cocoa samples were used to calibrate the NIRS. An efficient calibration model was developed to accurately determine any flavan-3-ol compound of ground dried cocoa beans (SEP = 2.33 mg/g in the case of total flavan-3-ols). This performance enabled NIRS to be used as an efficient and easy-to-use tool for estimating the level of targeted compounds. The analysis of the PLS loadings of the model and pure epicatechin spectra gave proof that NIRS was calibrated on an indirect strong correlation resulting in the changes in flavan-3-ols during fermentation and their interaction with some major components, such as proteins. Total flavan-3-ol concentration fell from an average of 33.3 mg/g for unfermented samples to an average of 6.2 mg/g at the end of fermentation. Changes in flavan-3-ol content were dependent upon the origin and highly correlated to the fermentation level expressed as the sum of temperatures (average R(2) = 0.74), a good marker of the fermentation process and of the heterogeneity of the batch.

  16. Enzymatic activity of proteases and its isoenzymes in fermentation process in cultivars of cocoa (Theobroma cacao L. produced in southern Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Luciane Santos SOUSA

    Full Text Available Abstract The fermentation of cocoa seeds envolves microbial processes and the action of enzymes. To identify the possible differences in the cocoa fermentation process, with regards to proteolysis, this study has the objective of determining protease activity (under predetermined conditions and its isoenzymes in two cocoa cultivars (PH-16 and HRT-1188 in different cocoa fermentation times, in addition to establishing the microbial load (molds and yeasts and aerobic mesophilic. Protease and its isoenzymes were extracted and partially purified and the enzymatic activities determined by spectrophotometry. The results showed that the proteases activity was higher at 66h of fermentation for both cultivars. When the isoenzymes activity was evaluated, the results demonstrated similar activity behavior for both cultivars, with regards to the isoenzymes aminopeptidase and carboxypeptidase, although the behavior of the endoprotease isoenzyme activity proved to be a little different for TSH-1188 cultivar. Concerning microbiological analyses, the results indicate that the period after molds and yeast counting reduction is consistent with the period of protease activity increase.

  17. Farelo de cacau (Theobroma cacao L. e torta de dendê (Elaeis guineensis, Jacq na alimentação de cabras em lactação: consumo e produção de leite Effects of feeding cocoa meal (Theobroma cacao L. and palm kernel cake (Elaeis guineensis, Jacq on milk intake and yield for lactating goats

    Directory of Open Access Journals (Sweden)

    Herymá Giovane de Oliveira Silva

    2005-10-01

    Full Text Available Foram avaliados o consumo e a produção de leite de cabras recebendo dietas contendo farelo de cacau (FC ou torta de dendê (TD em substituição ao milho e ao farelo de soja da ração concentrada. Foram utilizadas cinco cabras da raça Saanen, com produção média diária de 2,0 kg de leite e aos 60 dias de lactação, distribuídas em um quadrado latino 5 x 5. Os períodos experimentais tiveram duração de 14 dias, em que os dez primeiros foram destinados à adaptação e os quatro últimos, à coleta de amostras. As rações foram isoprotéicas, com 13,2% de proteína bruta. As dietas constituíram-se de 36% de volumoso (silagem de milho e 64% de concentrado na matéria seca. Os tratamentos consistiram de concentrado à base de milho e soja com 0, 15 e 30% de FC ou TD. Os consumos de matéria seca, matéria orgânica, proteína bruta, nutrientes digestíveis totais, carboidratos totais e carboidratos não-fibrosos reduziram com a inclusão de 30% de FC. Os consumos de fibra em detergente neutro e extrato etéreo (EE não foram alterados pelas dietas. O consumo de fibra em detergente ácido diferiu apenas entre os tratamentos com 30% de TD e 30% de FC, sendo 0,94 e 0,59% do peso vivo animal, respectivamente. O tratamento com 30% de FC proporcionou menor produção de leite (1,208 kg/dia, se assemelhando apenas ao tratamento com inclusão de 30% de TD quando a produção foi corrigida para 3,5% de gordura. O FC e a TD apresentam viabilidade de uso como alternativa na dieta de cabras em lactação em até 9,13 e 18,81% da matéria seca, respectivamente.The effects of replacing corn and soybean meal with cocoa meal (CF or palm kernel cake (PKC in the concentrate on milk intake and yield of goats were evaluated. Five Saanen goats, averaging 2 kg daily milk yield at 60 days of lactation, were assigned to a 5 x 5 Latin square experimental design. The experiment lasted 14 days, with 10 days for adaptation period and four days for sample collection. Diets contained: 36% of roughage (corns silage and 64% of concentrate, dry matter basis, formulated toyield 13.2% of crude protein. The treatments were as follows: 0, 15 and 30% CF or PKC, all with concentrate (corn and soybean meal. Dry matter, organic matter, crude protein, total digestible nutrients, total carbohydrates and nonfiber carbohydrates intakes decreased as affected by the highest replacement level (30% CF. No significant differences on neutral detergent fiber and ether extract intake were observed. Acid detergent fiber intake differed only between 30% PKC and 30% CF-based diets, with 0.94 and 0.59% body weight, respectively. The 30% CF-based diet showed lower milk production value, as kg/dia (1.208 kg, but similar to 30% PKC-based diet, when corrected for 3.5% fat. Replacing corn and soybean with CF and PKC in the diet of lactating goats is viable up to 9.13 and 18.81% dry matter, respectively.

  18. Cinética de secagem da polpa cupuaçu (Theobroma grandiflorum pré desidratada por imersão-impregnação Kinetic drying of cupuaçu pulp (Theobroma grandiflorum pre-dehydrated by immersion-impregnation

    Directory of Open Access Journals (Sweden)

    Luty Gomezcaceres Perez

    2013-03-01

    Full Text Available A desidratação osmótica é uma operação unitária importante para transformar os frutos perecíveis em novos produtos com valor agregado e com maior vida de prateleira. A aplicação dos modelos matemáticos confiáveis permite prever o comportamento dos diversos fenômenos que ocorrem durante o processo de secagem, o que implica na redução do custo operacional. A polpa do cupuaçu é comumente usada para preparar sucos e sorvetes, mas durante a safra é produzida em grande quantidade, que muitas vezes, é descartada devido ao custo de produção ser mais alto do que o da comercialização. O objetivo desse estudo foi investigar o efeito da solução binária e da ternária na taxa da secagem por convecção e avaliar a adequação dos modelos matemáticos na descrição das curvas da secagem do cupuaçu. No experimento, a pré-desidratação foi feita com solução binária (sacarose a 40 ºBrix e ternária (80% de sacarose/20% de cloreto de sódio, durante três horas em temperatura ambiente, seguida pela secagem convencional na estufa (ar circulante a 65 ºC, até peso constante. Os dados experimentais foram ajustados utilizando os modelos de Page e Midilli, Kucuk e Yapar. A solução binária usada na pré-secagem reduziu o tempo da subseqüente secagem convencional. Com variação de 99,64 a 99,77% no coeficiente de determinação (R², o modelo de Page apresentou o melhor ajuste aos dados experimentais.The osmotic dehydration is an important unitary operation to transform the perishable fruits in new products with added value and longer shelf life. The application of reliable mathematical models allows prediction the behavior of various phenomena that occur during the drying process, which implies in reduction of operating cost. The cupuaçu pulp is commonly used to prepare juices and ice creams, but during the crop it is produced in large quantity, which is often discarded because of the cost of production is higher than the selling price. The aim of this study was to investigate the effect of binary and ternary solutions at the rate of convective drying and evaluate the adequacy of mathematical models to describe the drying curves of the cupuaçu. In the experiment, osmotic dehydration was carried out with binary (sucrose at 40 ºBrix and ternary (80% sucrose/20% sodium chloride solutions for three hours at room temperature, followed by conventional drying in an oven (air-circulating at 65 °C to constant weight. The experimental data were adjusted using the models of Page and Midilli, Kucuk and Yapar. The binary solution used during pre-drying, reduced the time of the subsequent conventional drying. Varying from 99.64 to 99.77% in the coefficient of determination (R², the Page model showed a better adjustment to experimental data.

  19. Study of root and leaf rachis of Spathelia excelsa: phytochemistry and activity against fungus Moniliophthora perniciosa associated with cupuassu (Theobroma grandiflorum); Estudo em raiz e raquis foliar de Spathelia excelsa: fitoquimica e atividade frente ao fungo Moniliophthora perniciosa associado ao cupuacuzeiro (Theobroma grandiflorum)

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Loretta Ennes de; Lima, Maria da Paz; Maximo, Ariane da Costa; Pereira, Elaine Cristina da Silva; Moreira, Wagner Alan dos Santos [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil). Coordenacao de Pesquisas em Tecnologia e Inovacao; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Quimica; Veras, Solange de Mello [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias; Souza, Maria Geralda de, E-mail: mdapaz@inpa.gov.br [Empresa Brasileira de Pesquisa Agropecuaria (EMBRAPA), Manaus, AM (Brazil)

    2012-07-01

    The chemical composition of Spathelia excelsa (Krause) R. S. Cowan and Brizicky was investigated and the limonoids harrisonin (1) and deacetylspathelin (2), alkaloids folinin and casimiroin mixture (3a,b), plus a further casimiroin (3b) were identified in methanol extract from root. The CH{sub 2}Cl{sub 2} extract from the rachis yielded protolimonoid 3{beta}-angeloyl-21,24-epoxy-7{alpha},21{alpha},23{alpha},25-tetrahydroxy-4{alpha},4{beta},8{beta},10{beta}-tetramethyl -25-dimethyl-14,18-cyclo-5{alpha},13{alpha},14{alpha},17{alpha}-cholestane (4), and methanol extract, the limonoids limonin diosphenol (5) and perforatin (6), as well as the chromone biflorin (7). Harrisonin and biflorin were isolated for the first time in this genus. On the antifungal assay against witches' broom (Moniliophthora perniciosa) compound 3b was found to be active. (author)

  20. Fosfito de potássio na indução de resistência a Verticillium dahliae Kleb., em mudas de cacaueiro (Theobroma cacao L. Effect of potassium phosphite on the induction of resistance in cocoa seedlings (Theobroma cacao L. against Verticillium dahliae Kleb

    Directory of Open Access Journals (Sweden)

    Pedro Martins Ribeiro Júnior

    2006-08-01

    Full Text Available Há vários relatos da utilização de fosfitos no controle de doenças de plantas, por meio de ação direta, antifúngica e indireta por indução de resistência. Essa atuação como indutor é questionada, não sendo encontradas, em muitos desses trabalhos, evidências de respostas de defesa ativadas pelos sais de fosfito. Com o presente trabalho, objetivou-se estudar o efeito de doses (0,62; 1,25; 2,5 e 5 mL.L-1 de água de fosfito de potássio na indução de resistência em mudas de cacaueiro a V. dahliae, além de investigar os possíveis mecanismos envolvidos na resposta de defesa. Foram realizados experimentos no Laboratório de Fisiologia do Parasitismo e casa-de-vegetação do Departamento de Fitopatologia UFLA. A aplicação foliar do fosfito foi realizada 7 dias antes das inoculações e as avaliações de severidade foram realizadas aos 20, 30, 40, 50 e 60 dias após a inoculação. Foi realizado também um experimento para verificar o efeito tóxico direto e outro para avaliar a atividade das enzimas peroxidases e polifenoloxidases e a concentração de lignina. O tratamento com o fosfito de potássio (1,25 mL.L-1 de água proporcionou 10% de redução na área abaixo da curva de progresso da severidade da murcha-de-Verticillium (AACPD, 60 dias após aplicação foliar, não diferindo de nenhuma das doses, nem da testemunha. Todas as doses utilizadas apresentaram efeito fungitóxico, inibindo a germinação de V. dahliae. A aplicação do fosfito de potássio (1,25 mL.L-1 de água não induziu aumento na atividade das enzimas peroxidases e polifenoloxidases em relação à testemunha. Plantas tratadas com esse produto apresentaram um pequeno incremento na concentração de lignina, não apresentando diferença significativa da testemunha absoluta.There are several reports concerning with the use of phosphites for controlling of plant diseases, through direct action, antifungal, and indirect, by resistance induction. The performance of phosphites as inducer of resistance is questioned, not finding in many of those papers, evidences of defense responses activated by these salts. The present work aimed at studying the effect of doses (0.62; 1.25; 2.5 and 5.0 mL.L-1 of water of potassium phosphite on the protection of cocoa seedlings against V. dahliae, besides investigating the possible mechanisms involved in the defense response. Experiments were accomplished at the laboratory of Physiopathology and in a greenhouse at the Plant Pathology Department - UFLA. Foliar applications of phosphite were carried out 7 days before inoculation and severity assessments at 20, 30, 40, 50 and 60 days after inoculation. Experiments were also set to verify the toxic effect of phosphites and to evaluate the action of the enzymes peroxidases and polyphenoloxidases and the lignin content. The treatment with the potassium phosphite (1.25 mL.L-1 of water provided only 10% reduction in the area under the disease progress curve (AUDPC, 60 days after spraying, not differing from none of the doses, nor from the dose zero. All the used doses presented antifungal effect, inhibiting the germination of V. dahliae conidia. The application of the potassium phosphite (1.25 mL.L-1 of water did not induce increase in the activities of the enzymes peroxidases and polyphenoloxidases in relation to the control. Treated plants with that product presented a small increment in the lignin content, not presenting a significant difference to the absolute control.

  1. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L. In vitro effect of essential oils of three Lippia species on Moniliophthora roreri (Cif. and Par. Evans et al., causative agent of moniliasis of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Betty Stefany Lozada

    2012-04-01

    Full Text Available Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aislado M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibición del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. origanoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno, g-terpineno, acetato de timilo, carvacrol, b-mirceno, trans-b-cariofileno. Diferencias significativas (P The in vitro antifungal effect of five essential oils (EOs (EO1, EO2, EO3, EO4 and EO5 extracted from Lippia origanoides, L. citriodora and L. alba on isolates of Monilia (Moniliophthora roreri was evaluated. Lippia plants were collected at five locations in Colombia, and monilia isolates were obtained from infected cocoa fruits collected in San Vicente de Chucurí, Santander, Colombia. The fungi strains (M1, M2, M3, M4 and M5 were characterized by morphology, germination and growth in culture media. Antifungal activity of different concentrations of EOs was evaluated against the M2 and the isolated strain of M. roreri (ATCC 64239 determining their effect on germination and mycelial growth inhibition. The five essential oils studied inhibited 100% germination and micelial growth when they were used at concentrations from 800 to 1000 µg/ml. Concentrations of 200 µg/ml also showed an effect on fungal isolates, being the EOs obtained from L. origanoides (EO2 and EO3 the most active. These were mainly composed of thymol, p-cymene, g-terpinene, timilo acetate, carvacrol, b-myrcene, trans- b-caryophyllene. Significant differences (P < 0.05 on susceptibility were observed between the two fungal strains studied, being generally more susceptible the isolated M2 that the ATCC strain. The EOs of L. origanoides are candidates for use as biofungicides possible to control the moniliasis. Future studies oriented to determinate the in vivo antifungal activity of these EOs and its major components are required.

  2. Composição florística de plantas daninhas em agrossistemas de cupuaçuzeiro (Theobroma grandiflorum e pupunheira (Bactris gasipaes Floristic composition of weeds in agrosystems of cupuaçu (Theobroma grandiflorum and peach palm (Bactris gasipaes

    Directory of Open Access Journals (Sweden)

    L.S.A. Souza

    2003-08-01

    Full Text Available A interferência das plantas daninhas nos sistemas agroflorestais varia com a espécie e a densidade de infestação da planta daninha. Este trabalho foi realizado na Fazenda Experimental da Universidade Federal do Amazonas, em monocultivo de cupuaçuzeiro e pupunheira e em sistema agroflorestal (SAF com estas duas espécies. Havia seis espécies de monocotiledôneas e 15 de dicotiledôneas, e as cinco famílias com maior n��mero de espécies, em ordem decrescente, foram Poaceae, Euphorbiaceae, Fabaceae, Cyperaceae e Verbenaceae. As espécies Desmodium incanun, Cyperus rotundus, Clidemia sp. e Spermacoce verticillata ocorreram nos três cultivos. O maior coeficiente de similaridade de plantas daninhas ocorreu entre os cultivos de cupuaçuzeiro e pupunheira (54,5% e o menor entre o sistema agroflorestal e a pupunha (32,0%. Quanto à freqüência, Stachytarpheta cayennensis apresentou 33% de freqüência na área de SAF; Eclipta alba, 44% de freqüência na área de cultivo de cupuaçuzeiro e na área de cultivo de pupunheira; e D. incanun, C. rotundus e Clidemia sp. apresentaram 44% de freqüência.The interference of weeds in agro-forestry systems production factors varies according to species and infestation density. This assay was conducted at the Federal University of Amazonas Experimental Farm, using separate cupuaçu and peach palm plantations and an agro-forestry system (AFS of both species. Six monocotyledonous and fifteen dicotyledonous species were identified. The major five families with the most number of species were Poaceae, Euphorbiaceae, Fabaceae, Cyperaceae and Verbenaceae, in decreasing order. Desmodium incanun, Cyperus rotundus, Clidemia sp. and Spermacoce verticillata were found in the tree cropping systems. The highest weed similarity coefficient was found between the cupuaçu and peach palm plantations (54.50% and the lowest between the AFS and peach palm plantation (32.00%. Starchytapheta cayennensis frequency was 33% in the AFS area; 44% for Eclipta alba in the cupuaçu plantation; and 44% in the peach palm area for D. incanun, C. rotundus and Clidemia sp.

  3. Caracterización fisicoquímica y fisiológica del fruto de maraco (Theobroma bicolor H.B.K. durante su desarrollo Physicochemical and physiological characterization of the fruit of macaro (Theobroma bicolor H.B.K. during its development

    Directory of Open Access Journals (Sweden)

    Hernández G. María Soledad

    1998-12-01

    Full Text Available El presente estudio tuvo como objetivo caracterizar fisiológicamente el desarrollo y la maduración del fruto de maraca y encontrar parámetros que permitan su adecuado manejo en pre y poscosecha. Las muestras de los frutos requeridos para el trabajo procedieron del Centro Experimental El Trueno del Instituto Amazónico de Investigaciones Científicas SINCHI. Los análisis de laboratorio se llevaron a cabo en el Laboratorio de Postcosecha de la Planta de Vegetales del ICTA de la Universidad Nacional. Para alcanzar los objetivos se determinaron los cambios fisiológicos y fisicoquímicos más importantes durante la fase reproductiva del cultivo, estableciéndose la curva del patrón respiratorio y las variaciones de pH, acidez (% Acido cítrico, grados brix (%, azúcares reductores y totales (mg glu/100 g pulpa, vitamina C (mg Acido ascórbico/100g pulpa e índice de madurez. La fase de madurez comercial se contempló desde los 83 días, donde la respiración mostró valores muy bajos; sólo a los 113 días, al finalizar el estudio se observó un incremento de la intensidad respiratoria, condición característica de los frutos clirnatéricos. Este comportamiento estuvo acompañado de un ascenso del pH y descenso de la acidez; hubo un aumento significativo de los grados brix y azúcares reductores y totales.

    This study was carried out to characterize the physiological developement and maturity of maraco fruit in arder to determine an adequate harvest and postharvest handling of the fruit. It was measured the physiological and physicochemical changes during the reproductive stage of the plant. It was determined a respiratory curve of either pH, acidity, brix, reduced and total sugars, vitamin C and maturity index variations. The commercial ripening stage was considered from 83 day, where the respiratory intensity showed the lowest value to the day 113. At this point it was observed an increase of the respiratory intensity, indicative of the climateric condition of maraco's fruit. This behavior was also accompanied with an increase in
    pH, brix and total and reduced sugars.

  4. Associação micorrízica e teores de nutrientes nas folhas de cupuaçuzeiro (Theobroma grandiflorum e guaranazeiro (Paullinia cupana de um sistema agroflorestal em Manaus, Amazonas Arbuscular mycorrhizal association and foliar nutrient concentrations of cupuassu (Theobroma grandiflorum and guaraná (Paullinia cupana plants in an agroforestry system in Manaus, AM, Brazil

    Directory of Open Access Journals (Sweden)

    A. N. Oliveira

    2004-12-01

    Full Text Available As micorrizas arbusculares podem ser importantes na nutrição das plantas em solos ácidos e de baixa fertilidade, como são os da Amazônia de modo geral. Avaliaram-se a colonização radicular por fungos micorrízicos arbusculares (FMAs nativos e os teores de nutrientes em cupuaçuzeiro e guaranazeiro em um sistema agroflorestal no município de Manaus, Amazonas. Dez plantas de cada espécie foram selecionadas, das quais foram coletadas amostras de raiz, folha e solo durante o período seco e chuvoso da região de Manaus. Os guaranazeiros e os cupuaçuzeiros apresentaram maior colonização radicular por FMAs na época chuvosa. Os teores foliares de Ca, Mg, K, P, Zn, Cu e Mn nas duas espécies não foram influenciados pelas épocas de amostragem. O teor de Fe nas folhas dos cupuaçuzeiros foi maior na época chuvosa, enquanto o dos guaranazeiros, na época seca. A colonização micorrízica correlacionou-se com a concentração foliar de Ca, Mg, P e Cu nos cupuaçuzeiros e com a de Ca, Fe, Zn e Cu nos guaranazeiros.Arbuscular mycorrhiza can be important for plant nutrition in acid and low fertility soils such as those of the Amazon. The present study evaluated the mycorrhizal colonization by native arbuscular mycorrhizal fungi (AMF and nutrient concentrations of cupuassu and guarana leaves in an agroforestry system in Manaus, Amazonas State, Brazil. Ten plants of each species were selected, of which the roots, soil and leaves were sampled during the rainy and dry seasons. Guarana and cupuassu trees presented higher levels of AMF colonization during the rainy season. Ca, Mg, K, P, Zn, Cu, and Mn concentrations in both species were not affected by the season. Fe concentration was higher during the rainy season in the cupuassu leaves, but higher in the dry season in the guarana leaves. Mycorrhizal colonization correlated with Ca, Mg, P, and Cu concentrations in cupuassu plants and with Ca, Fe, Zn, and Cu in guarana plants.

  5. Protein (Viridiplantae): 307209 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 629:876 ... 214909:876 ... 3640:876 ... 3641:876 ... Uncharacterized protein TCM_006973 Theobroma cacao MCFDVQIFEKSGCERN...DASRSLEIPPHFVRTHLPKRIPTRAVLRGPSGDYWKITMCKQDRSTIMQHGWQQFYQNHCLGDKDFLVLRYNGNMCFDVQIFEKSGCERNCVSITRTHQDSTEKIKEE

  6. Protein (Viridiplantae): 200103 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 629:910 ... 214909:910 ... 3640:910 ... 3641:910 ... Uncharacterized protein isoform 1 Theobroma cacao MALGWKWLIPAPPSIQPSPKIIFSLNTPSSSPL...SATLPPCSSPLSVSHPSSVFISSLSWSSSSLLAVGLPLALTRGSAPLSQLWVFPSLSTALSRGSSPRSQPLSAVGLPL...SLSRGSAPLSQPFTRRSAPLSQPLSPVGLPLSLNLSPMGLPLSLSRSPVGLPLSLSRSHPWVCPSLSAALTRGSAPLSQPLSPVFPSLSVV

  7. Protein (Viridiplantae): 963384 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 38:11123 3629:11123 ... 214909:11123 ... 3640:11123 ... 3641:11123 ... Uncharacterized protein isoform 2 Theobroma cacao MLQIPL...LFFFISSFIKEVAATQPPQHLSQLLRILNARGESILSPGAKQGLIPLAIPLAKSSSGAVTALLRWPTAPA

  8. heterosis and heritability estimates of purine alkaloids and ...

    African Journals Online (AJOL)

    ACSS

    ols dont l'héritabilité serait de nature cytoplasmique. Mots Clés: Caffein, catechin, Theobroma cacao. INTRODUCTION. Cocoa (Theobroma cacao L.) is an important allogamous tropical tree crop, whose centre of diversity is considered to be in ...

  9. Fungal species associated with Vigna unguiculata (L.) Walp ...

    African Journals Online (AJOL)

    Aspergillus niger Van Tieghem, Botryodiplodia theobromae (Pat) Novel, Fusarium oxysporum Schlecht and Rhizopus stolonifer Ehrenb ex Link were isolated from both blotter and agar methods. Botryodiplodia theobromae had the highest mean occurrence (42.37%) followed by Fusarium oxysporum (30.02%), Aspergillus ...

  10. Facilitating the use of alternative capsid control methods towards sustainable production of organic cocoa in Ghana

    NARCIS (Netherlands)

    Ayenor, G.K.; Huis, van A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.

    2007-01-01

    Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma

  11. A Comparative Study of the Physicochemical Characteristics of ...

    African Journals Online (AJOL)

    Purpose: To investigate the physicochemical characteristics of shea butter and theobroma fats using wool fat as a standard base in the formulation of topical applications. Methods: Aqueous emulsions of shea butter and theobroma fats were made using wool fat as a standard base. Physical parameters such as absorption ...

  12. The pathogenesis-related protein PR-4b from Theobroma cacao presents RNase activity, Ca(2+) and Mg(2+) dependent-DNase activity and antifungal action on Moniliophthora perniciosa.

    Science.gov (United States)

    Pereira Menezes, Sara; de Andrade Silva, Edson Mario; Matos Lima, Eline; Oliveira de Sousa, Aurizângela; Silva Andrade, Bruno; Santos Lima Lemos, Livia; Peres Gramacho, Karina; da Silva Gesteira, Abelmon; Pirovani, Carlos Priminho; Micheli, Fabienne

    2014-06-11

    The production and accumulation of pathogenesis-related proteins (PR proteins) in plants in response to biotic or abiotic stresses is well known and is considered as a crucial mechanism for plant defense. A pathogenesis-related protein 4 cDNA was identified from a cacao-Moniliophthora perniciosa interaction cDNA library and named TcPR-4b. TcPR-4b presents a Barwin domain with six conserved cysteine residues, but lacks the chitin-binding site. Molecular modeling of TcPR-4b confirmed the importance of the cysteine residues to maintain the protein structure, and of several conserved amino acids for the catalytic activity. In the cacao genome, TcPR-4b belonged to a small multigene family organized mainly on chromosome 5. TcPR-4b RT-qPCR analysis in resistant and susceptible cacao plants infected by M. perniciosa showed an increase of expression at 48 hours after infection (hai) in both cacao genotypes. After the initial stage (24-72 hai), the TcPR-4b expression was observed at all times in the resistant genotypes, while in the susceptible one the expression was concentrated at the final stages of infection (45-90 days after infection). The recombinant TcPR-4b protein showed RNase, and bivalent ions dependent-DNase activity, but no chitinase activity. Moreover, TcPR-4b presented antifungal action against M. perniciosa, and the reduction of M. perniciosa survival was related to ROS production in fungal hyphae. To our knowledge, this is the first report of a PR-4 showing simultaneously RNase, DNase and antifungal properties, but no chitinase activity. Moreover, we showed that the antifungal activity of TcPR-4b is directly related to RNase function. In cacao, TcPR-4b nuclease activities may be related to the establishment and maintenance of resistance, and to the PCD mechanism, in resistant and susceptible cacao genotypes, respectively.

  13. The pathogenesis-related protein PR-4b from Theobroma cacao presents RNase activity, Ca2+ and Mg2+ dependent-DNase activity and antifungal action on Moniliophthora perniciosa

    Science.gov (United States)

    2014-01-01

    Background The production and accumulation of pathogenesis-related proteins (PR proteins) in plants in response to biotic or abiotic stresses is well known and is considered as a crucial mechanism for plant defense. A pathogenesis-related protein 4 cDNA was identified from a cacao-Moniliophthora perniciosa interaction cDNA library and named TcPR-4b. Results TcPR-4b presents a Barwin domain with six conserved cysteine residues, but lacks the chitin-binding site. Molecular modeling of TcPR-4b confirmed the importance of the cysteine residues to maintain the protein structure, and of several conserved amino acids for the catalytic activity. In the cacao genome, TcPR-4b belonged to a small multigene family organized mainly on chromosome 5. TcPR-4b RT-qPCR analysis in resistant and susceptible cacao plants infected by M. perniciosa showed an increase of expression at 48 hours after infection (hai) in both cacao genotypes. After the initial stage (24-72 hai), the TcPR-4b expression was observed at all times in the resistant genotypes, while in the susceptible one the expression was concentrated at the final stages of infection (45-90 days after infection). The recombinant TcPR-4b protein showed RNase, and bivalent ions dependent-DNase activity, but no chitinase activity. Moreover, TcPR-4b presented antifungal action against M. perniciosa, and the reduction of M. perniciosa survival was related to ROS production in fungal hyphae. Conclusion To our knowledge, this is the first report of a PR-4 showing simultaneously RNase, DNase and antifungal properties, but no chitinase activity. Moreover, we showed that the antifungal activity of TcPR-4b is directly related to RNase function. In cacao, TcPR-4b nuclease activities may be related to the establishment and maintenance of resistance, and to the PCD mechanism, in resistant and susceptible cacao genotypes, respectively. PMID:24920373

  14. Estudo em raiz e ráquis foliar de spathelia excelsa: fitoquímica e atividade frente ao fungo Moniliophthora perniciosa associado ao cupuaçuzeiro (Theobroma grandiflorum

    Directory of Open Access Journals (Sweden)

    Loretta Ennes de Carvalho

    2012-01-01

    Full Text Available The chemical composition of Spathelia excelsa (Krause R. S. Cowan & Brizicky was investigated and the limonoids harrisonin (1 and deacetylspathelin (2, alkaloids folinin and casimiroin mixture (3a, b, plus a further casimiroin (3b were identified in methanol extract from root. The CH2Cl2 extract from the rachis yielded protolimonoid 3β-angeloyl-21,24-epoxy-7α,21α,23α,25-tetrahydroxy-4α,4β,8β,10β-tetramethyl-25-dimethyl-14,18-cyclo-5α,13α,14α,17α-cholestane (4, and methanol extract, the limonoids limonin diosphenol (5 and perforatin (6, as well as the chromone biflorin (7. Harrisonin and biflorin were isolated for the first time in this genus. On the antifungal assay against witches' broom (Moniliophthoraperniciosa compound 3b was found to be active.

  15. Aplicacion de Antagonistas Microbianos para el Control Biologico de Moniliophthora roreri Cif & Par en Theobroma cacao L. Bajo Condiciones de Campo / Application of Microbial Antagonists for the Biological Control of Moniliophthora roreri Cif & Par in

    National Research Council Canada - National Science Library

    Jorge Enrique Villamil Carvajal; Silvio Edgar Viteri Rosero; William Luciano Villegas Orozco

    2015-01-01

    .... roreri under field conditions. The treatments were: T1, fungus H5; T2, fungus H20; T3, bacteria B3; T4, control. The variables evaluated on the cocoa fruits were incidence and external and internal severity...

  16. Embriogénesis somática secundaria en el genotipo de cacao (Theobroma cacao L.) inifap 1 y su descripción histológica

    OpenAIRE

    A. Alejandro-Lázaro; A. Azpeitia-Morales; L. Sáenz-Carbonell; F . Mirafuentes Hernández

    2015-01-01

    La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS) en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de l...

  17. Volatile composition of some Brazilian fruits: umbu-caja (Spondias citherea), camu-camu (Myrciaria dubia), Araça-boi (Eugenia stipitata), and Cupuaçu (Theobroma grandiflorum).

    Science.gov (United States)

    Franco, M R; Shibamoto, T

    2000-04-01

    Twenty-one volatile compounds were identified for the first time by GC-MS in umbu-caja and in camu-camu, plus 30 volatile compounds were identified in araça-boi samples. Terpenic compounds predominated among the volatile compounds in these fruit samples, with the major compounds being identified as cis-beta-ocimene and caryophyllene in the northeastern fruit; alpha-pinene and d-limonene were the most abundant volatile compounds in the headspace of the Amazonian fruit camu-camu. Sesquiterpenes were the most abundant compounds in the araça-boi sample, with germacrene D presenting a higher relative percentage. The chemical class of esters predominated in the cupuaçu sample. Ethyl butyrate and hexanoate were the major compounds in the headspace of this Amazonian fruit.

  18. Efecto del pH, la luz y la concentración de sacarosa en la Embriogénesis somática de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Lisette Valverde Cerdas

    2016-03-01

    Full Text Available Se llevó a cabo una investigación con el fin de establecer la metodología adecuada para inducir embriogénesis somática en cacao, a partir de semillas maduras. Se estudió el efecto del pH, la luz y la concentración de sacarosa sobre la respuesta embriogénica. Los dos cultivares mostraron diferente respuesta morfogénica y en ambos, estuvo influenciada por el pH, la luz y la concentración de sacarosa. La mejor respuesta embriogénica se obtuvo con un pH de 6,7. El número de embriones producidos fue mayor bajo condiciones de oscuridad que en presencia de luz. La formación de callo y la diferenciación de embriones somáticos estuvo directamente influenciada por la concentración de azúcar en el medio de cultivo. La mayor cantidad de embriones se obtuvo con niveles de sacarosa entre 4% y 6% para el híbrido UF-613xIMC-67 y niveles entre 2% y 4% de sacarosa para el cultivar CATIE-1000. Se presento una embriogénesis somática directa. Los resultados obtenidos sugieren la necesidad de continuar realizando estudios con esta especie.

  19. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Lozada Betty Stefany

    2012-11-01

    Full Text Available

    Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aisla- do M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibi- ción del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. ori- ganoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno,

    y-terpineno, acetato de timilo, carvacrol, 1-mirceno, trans-1ccariofileno. Diferencias significativas (P <

    0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en gene- ral más susceptible el aislado M2 que la cepa ATCC. Los AEs de L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.

  20. Embriogénesis somática secundaria en el genotipo de cacao (Theobroma cacao L. inifap 1 y su descripción histológica

    Directory of Open Access Journals (Sweden)

    A. Alejandro-Lázaro

    2015-01-01

    Full Text Available La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de las fitohormonas ácido 2,4-Diclorofenoxiácetico (2,4-D y thidiazuron (TDZ son importantes para inducir la embriogénesis somática (ES primaria en cacao. Adicionalmente para generar la ESS se han utilizado fitohormonas. En la presente investigación, fueron establecidos cuatro tratamientos con fregmentos de cotiledón, con 2,4-D y TDZ en forma combinada e independiente, incluyendo un testigo sin fitohormonas. Los resultados mostraron, que los fragmentos de cotiledón cultivados sin fitohormonas favorece la ESS, obteniendo un promedio de seis embriones somáticos secundarios (ESs a los 210 días de cultivo contra uno para el tratamiento suplementado con TDZ. El meristemo apical y radicular se presentó en un periodo de 240 días, se observaron embriones somáticos con estructuras externas como: cotiledones, ápices y raíces. Los resultados mostraron que la exclusión del 2,4-D y el thidiazuron no son importantes para inducir la ESS. El mayor número de ESs se encontró en un medio desprovisto de fitohormonas por lo que esta información es relevante, debido a que los explantes de cotiledones procedentes de embriones somáticos primarios, generan mayor número de ESs en esta especie. Estos resultados constituyen el primer reporte de la inducción de la ESs sin fitohormonas.

  1. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Betty Stefany Lozada

    2012-04-01

    Full Text Available Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aislado M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibición del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. origanoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno, g-terpineno, acetato de timilo, carvacrol, b-mirceno, trans-b-cariofileno. Diferencias significativas (P < 0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en general más susceptible el aislado M2 que la cepa ATCC. Los AEs de L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.

  2. Diseño, construcción y evaluación de un prototipo para desgrasar cacao (Theobroma cacao L.) a una escala pequeña.

    OpenAIRE

    Lira Morales, Francisco Alfonso

    2010-01-01

    La grasa es el producto derivado del cacao de mayor valor económico (Beckett 2000), esta se obtiene mediante un proceso de prensado hidráulico de vaso caliente (Bailey 1984) a una presión de 500 kg/cm2 (Yanes 1994). La tecnología del prensado se enfoca a capacidades industriales por lo que son inaccesibles para productores de cacao. El objetivo general de la investigación fue construir un prototipo para extraer grasa a la escala de un productor de una hectárea de cacao. El primer objetivo esp...

  3. DESENVOLVIMENTO DE CALOS EM EXPLANTES DE CUPUAÇUZEIRO (Theobroma grandiflorum Schum. EM FUNÇÃO DA CONCENTRAÇÃO DE AUXINAS E DO MEIO LÍQUIDO

    Directory of Open Access Journals (Sweden)

    FERREIRA MARIA DAS GRAÇAS RODRIGUES

    2001-01-01

    Full Text Available Objetivou-se estudar o efeito da concentração de auxina e do meio líquido sobre o desenvolvimento de calos de cupuaçuzeiro. Segmentos de eixos embrionários e cotilédones, obtidos de frutos de cupuaçu dos tipos Mamorana e Redondo, foram cultivados em 4 meios de cultura diferentes: 1 meio MS (50%, suplementado com 2,4-D (1; 2; 4; 8 mg/L; 2 sais N6 (SIGMA (4 g/L, acrescidos de 2,4-D (0; 2; 4 mg/L e ANA (0; 3; 5 mg/L; 3 igual ao anterior, suplementado apenas com ANA (3 mg/L; e 4 meio MS, acrescido com ANA (1 mM. Calos com aspecto branco e brilhante foram observados em segmentos de eixos embrionários e cotilédones, cultivados nas menores concentrações de meio 1 (1 e 2 mg/L, enquanto nas maiores concentrações (4 e 8 mg/L se observou a formação de calos e massa calosa branco-opaca, em eixos embrionários e em segmentos cotiledonares, estas estruturas tornaram-se escuras dentro de oito semanas. Usando o meio 2, um grande número de raízes foram formadas, enquanto o mesmo meio suplementado apenas com ANA (3; 5 mg/L originou uma massa calosa. A combinação de ANA e 2,4-D, 3 e 2 mg/L, respectivamente, promoveu a formação de calos brancos e raízes. A transferência das culturas para meio líquido, sem regulador de crescimento, promoveu aumento de tamanho dos explantes e escurecimento dos mesmos. O cultivo desses explantes no meio 3 resultou no aparecimento de calos amarelos, com aspecto friável, que permaneceram com a mesma aparência no meio 4.

  4. Efeito da temperatura e taxa de cisalhamento nas propriedades de escoamento da polpa de Cupuaçu (T. grandiflorum Schum integral Effect of temperature and shear rate in the properties of whole flow Cupuassu pulp (Theobroma grandiflorum

    Directory of Open Access Journals (Sweden)

    Gilvanete Maria Ferreira

    2008-06-01

    Full Text Available O comportamento reológico da polpa de cupuaçu integral foi determinado na faixa de temperatura de 10 a 60ºC. Os efeitos da temperatura e da taxa de deformação foram avaliados por meio de testes em cisalhamento estacionário. As análises reológicas foram conduzidas num reômetro Thermo Haake RheoStress 1. Os reogramas foram descritos pelos modelos reológicos de Ostwald-de-Waelle e o de Herschel-Bulkley. As curvas de escoamento mais bem ajustadas pelo modelo de Ostwald-de-Waelle. O produto apresentou comportamento pseudoplástico, e o índice de comportamento de fluxo (n decresceu com o aumento da temperatura. O efeito da temperatura sobre a viscosidade aparente foi descrita por uma equação tipo Arrhenius e discutida em termos de energia de ativação. Essa energia aumentou com o aumento da taxa de deformação, sendo obtidos valores na faixa de 1 a 2 kcal/gmol.The rheological behavior of the entire cupuassu pulp was determined in the temperature range 10 - 60ºC. The effects of temperature and deformation rate were evaluated by means of shear flow tests. Rheometry analyses were conducted with a Thermo Haake RheoStress 1 system. Rheograms were described by models by Ostwald-of-Waelle and Herschel-Bulkley. The Ostwald-of-Waelle model successfully represented pulp flow behavior. The product presented shear-thinning behavior and the flow behavior index (n decreased with the increase of temperature. The effect of temperature on the apparent viscosity in cupuassu pulp was described by an Arrhenius equation and discussed in terms of activation energy. The increase in shear rate caused an energy increase, and values were obtained in the range of a line from 1 to 2 kcal/gmol.

  5. Evaluación de la irritabilidad vaginal causada por supositorios vaginales formulados a partir de aceite de teobroma ozonizado - Evaluation of vaginal irritability caused by formulated vaginal suppositories with ozonized theobroma oil

    OpenAIRE

    Maritza F. Díaz; Rosa I Meneau; Piña, Yoenia C.; Garcia,Gastón.

    2009-01-01

    ResumenEl aceite de teobroma ozonizado presenta actividad antifungicidacontra la Candida albicans. Se realizó un estudio para determinar laposible irritabilidad vaginal de supositorios vaginales OZONOL®,formulados a partir de diferentes porcientos de aceite de teobromaozonizado. Los ensayos se realizaron en conejos albinos hembrassiguiendo las técnicas descritas en los procedimientos normalizadosde trabajo establecidos en el Centro de Investigaciones yEvaluaciones Biológicas de la Universidad...

  6. Aproveitamento tecnológico do "mel de cacau" (Theobroma cacao L na produção de geleia sem adição de açúcar

    Directory of Open Access Journals (Sweden)

    Carine Oliveira dos Santos

    2014-09-01

    Full Text Available O "mel de cacau" é uma denominação regional do líquido transparente extraído da polpa do cacau, que cobre as sementes, antes do processo de fermentação do cacau. Este material é atrativo do ponto de vista de seus aspectos sensorial e tecnológico; entretanto, seu uso para o consumo ainda é restrito. O propósito deste estudo foi produzir geleia dietética usando o "mel de cacau" e realizar a caracterização química e sensorial dos produtos. Para a preparação das geleias, foram usados os seguintes ingredientes: pectina de baixo grau de metoxilação, polidextrose, sorbitol, maltitol, fosfato tricálcico, sorbato de potássio e cacau em pó. As geleias dietéticas estudadas foram: F1 (0,0015% taumatina e 0,005% sucralose; F2 (0,0015% taumatina e 0,002% acessulfame-k; F3 (0,005% sucralose e 0,002% acessulfame-k. Foi produzido, também, um tratamento-controle (com 40,0% de sacarose. Os dados químicos e sensoriais foram analisados por ANOVA, teste de Tukey e Mapa de Preferência Interno (MDPREF. O tratamento F3 (sucralose e acessulfame-k foi a geleia dietética preferida dos consumidores. Esta diferiu significativamente (p<0.05 dos tratamentos F1 (taumatina e sucralose e F2 (taumatina e acessulfame-k em relação aos atributos cor, aroma de chocolate, gosto doce, gosto ácido, sabor de chocolate e consistência; obteve, também, maior nota para intenção de compra. O uso do adoçante taumatina mostrou-se inadequado por não prover doçura à geleia de "mel de cacau". Os resultados indicaram a viabilidade do aproveitamento tecnológico do "mel de cacau" como matéria-prima na preparação de geleia dietética, que apresentou boas características sensoriais e nutricionais.

  7. Análise fitoquímica e determinação das atividades antioxidantes e vasculogênica dos extratos aquosos padronizados de Coffea arabica e Theobroma cacao

    OpenAIRE

    Silva, Liana Ludielli da

    2005-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina. Programa de Pós-Graduação em Biotecnologia Estudos vêm sendo realizados visando correlacionar a composição química e a atividade biológica de diversos alimentos inseridos na dieta humana, entre eles o café e o cacau. O Brasil é o maior produtor e exportador mundial de café, caracterizando-se também como um grande consumidor (70% da população consomem esta bebida). Com relação ao cacau, o Brasil ocupa o 5º lugar como produtor ...

  8. Cambios en la características físicas y químicas de granos de cacao (Theobroma cacao) fermentados con transferencia manual y semi-mecanizada, entre las cajas de fermentación

    OpenAIRE

    Peláez, Pedro. P.; Saulo Guerra; David Contreras

    2016-01-01

    The aim of this study was to evaluate variation in the physical and chemical properties of fermented cocoa beans with cocoa beans transfer between wooden fermentation boxes manually (M) and semi-mechanized (SM) way. Mass temperature, moisture, pH, and total acidity of the cotyledon and pulp; the total polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content in fresh, fermented, and dried beans; and percentage of fermented beans and time required to move beans during fermenta...

  9. OBTENÇÃO E UTILIZAÇÃO DA ENZIMA POLIFENOLOXIDASE EXTRAÍDA DE POLPA DE PINHA (Annona squamosa L. MADURA NO MELHORAMENTO DO SABOR DO CACAU (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    LIMA ELIZA DOROTEA POZZOBON DE ALBUQUERQUE

    2001-01-01

    Full Text Available O presente trabalho teve como objetivo estudar a obtenção e a utilização da enzima polifenoloxidase (PPO extraída de polpa de pinha madura na redução do teor de compostos polifenólicos com a finalidade de diminuir a adstringência e o amargor das amêndoas de cacau processadas na forma de "nibs". A PPO foi extraída com tampão fosfato de potássio 0,025M (pH 7,5, adicionando sulfato de amônio para a precipitação da enzima. O material em pó obtido foi denominado de enzima parcialmente purificada, sendo que a análise de atividade enzimática foi realizada, utilizando-se de catecol como substrato. As características bioquímicas apresentadas foram pH de estabilidade de 6,0 a 6,5 e temperatura de estabilidade de 10 a 30°C. Os "nibs" foram autoclavados (121°C por 15 minutos e não autoclavados de amêndoas cruas insuficientemente fermentadas e secas, da mesma origem, sendo embebidas em 25 mL de uma solução da enzima contendo 200 unidades/min/mL, durante 30; 60; 90; 210 e 360 minutos, a 23°C e pH 6,0. Os "nibs" foram homogeneizados com a solução de enzima a cada 15 minutos, secos, moídos e desengordurados. Após o tratamento enzimático durante 210 minutos realizado nos "nibs" de cacau desengordurado não autoclavados foi possível observar diminuição de 15% nas concentrações de fenóis totais, 15% de taninos, 10% de flavan-3-ois e 18% de antocianidinas. Os "nibs" de cacau desengordurado autoclavados apresentaram diminuição de 25% nas concentrações de fenóis totais, 26% de taninos, 23% de flavan-3-ois e 51% de antocianidinas.

  10. Prefactibilidad técnico-económica para el procesamiento del arazá (Eugenia stipitata Me Vaugh y del copoazú (Theobroma grandiflorum WiII. ex Spreng, en la zona de colonización de San José del Guaviare Technic and economic feasibillty for the arazá (Eugenia stipitata me vaugh and the copoazu (theobroma grandiflorum will ex spreng at the Guaviare region

    Directory of Open Access Journals (Sweden)

    Barrera Jaime A.

    1996-06-01

    Full Text Available A partir de la metodología de evaluación financiera de proyectos de inversión, se analizó la rentabilidad y sensibilidad de un proyecto de agroindustrialización del arazá y del copoazú en la zona de colonizaciónde San José del Guaviare. Basados en su buen comportamiento agronómico y características de olor y sabor agradables, se plantea el montaje de una planta procesadora de frutas en la región, de tal modo, que los posibles productores y usuarios de un programa de fomento puedan asegurar la venta de sus productos a precios adecuados, tanto para productores como para procesadores. Mediante la simulación del proceso comercial de obtención y almacenamiento de pulpas, se estableció la calidad técnica y se estimaron los posibles resultados económicos que se podrían obtener en su producción. Los resultados muestran que los procesos de transformación generados para las especies garantizan un retorno económico adecuado y los rendimientos obtenidos en planta permiten la viabilidad económica del proyecto, lo cual garantiza al inversionista menores riesgos y favorables alternativas de inversión para la región. La sensibilidad del proyecto es alta, lo cual implica un estricto manejoy administración del proyecto para obtener los resultados esperados. Igualmente, se demuestra que la implementación de una planta procesadora de frutas garantiza para los agricultores un poder de compra estable, con lo cual se evitarían las trabas comunes que conlleva la comercialización agrícola en la región.
    This study was carry out in arder to analize the feasibility of the araza and the copoazu transformation at the Guaviare department in the colombian amazonic region. These crops are very interesting for the agroindustry as a result of their great productitivity capacity in the poor amazonic soils, and their fruits organoleptics characteristics. The transfomation will lead either crop productors and agroindustrialmen to obtain profit from these fruits trees. It was simulated the agroindustrial pulp transformation procedure to get more information about commercial technics and economics results that would be receive from a transformation pulp plant at the region. The results demonstrated the project will have a great viability with adequate economic return to the investors. That will conduct to new investments alternatives for the region taking care of a good administration of the project to attain the expecting results. The plant at the region will guarantee power sales for the farmers to lower the commercial problems. Also it will supply permanently raw materials for the pulp plant.

  11. Redução de aminoácidos em polpas de bacuri (Platonia insignis Mart, cupuaçu (Theobroma grandiflorum Willd ex-Spreng Schum e murici (Byrsonima crassifolia L. processado (aquecido e alcalinizado Amino acids reduction in processed (heated and alkalinized pulps of bacuri (Platonia insignis Mart, cupuaçu (Theobroma grandiflorum Willd ex-Spreng Schum and murici (Byrsonima crassifolia L.

    Directory of Open Access Journals (Sweden)

    Alexandre Porte

    2010-09-01

    Full Text Available A literatura científica é pobre a respeito de frutas da Amazônia, como o murici, e suas características químicas devem ser estudadas. Por isso, esta pesquisa teve por proposta determinar o perfil aminoacídico das polpas de bacuri, cupuaçu e murici sob diferentes valores de pH (3,3, 5,8, 8,0 e 12,0, sem aquecimento ou com aquecimento por 12 horas/100 ºC com agitação e refluxo. Valores de pH, glicose, frutose e sacarose também foram determinados nas polpas sem aquecimento. Os nutrientes foram determinados por CLAE (Cromatografia Líquida de Alta Eficiência. As polpas de bacuri, cupuaçu e murici apresentaram valores de pH 3,2, 3,6 e 3,35, respectivamente. A sacarose foi, quantitativamente, o principal carboidrato nas polpas de cupuaçu (38,34% e bacuri (36,93%, sendo que os teores de frutose e glicose foram similares, tanto na polpa de cupuaçu (8,93% e 9,03% como na de bacuri (12,63% e 11,65%, respectivamente. Em contraste, a polpa de murici foi quase isenta de sacarose (0,57%, mas não de frutose (11,51% ou glicose (11,39%. Nas polpas sem aquecimento, os principais aminoácidos foram: ácido glutâmico (46,6 mg/kg, ácido aspártico (28,8 mg/kg e arginina (25,3 mg/kg na polpa de bacuri; ácido aspártico (56,3 mg/kg, ácido glutâmico (44,0 mg/kg e alanina (24,2 mg/kg na polpa de cupuaçu; prolina (73,5 mg/kg, ácido glutâmico (23,7 mg/kg e ácido aspártico (23,5 mg/kg na polpa de murici. O aquecimento reduziu as concentrações de todos os aminoácidos nas 3 polpas. O meio fortemente alcalino (pH 12 produziu a maior degradação de aminoácidos. Lisina foi mais sensível ao aquecimento do que outros aminoácidos em pH 12.Scientific literature presents few studies about fruits of the Amazonia, like murici, and yours chemical characteristics should be studied. Therefore, amino acid profiles of the bacuri, cupuaçu and murici pulps were determined under different values of pH (3.3, 5.8, 8.0 and 12.0 with heating (12 hours/100 ºC, with stirring and refluxing or without heating. Glucose, fructose, sucrose and pH values also were obtained in the pulps without heating. All nutrients were analised by HPLC. The pHs were: 3.2, 3.6 and 3.35 in the bacuri, cupuaçu and murici pulps, respectively. Sucrose (38.34% and 36.93% was the major carbohydrate while fructose (8.93% and 12.63% and glucose (9.03% and 11.65% shown similar percentages in the cupuaçu and bacuri pulps. Murici pulp was almost free of sucrose (0.57%, but not of fructose (11.51% or glucose (11.39%. In the pulps without heating the major amino acids were: glutamic acid (46.6 mg/kg, aspartic acid (28.8 mg/kg and arginine (25.3 mg/kg in the bacuri pulp; aspartic acid (56.3 mg/kg, glutamic acid (44.0 mg/kg and alanine (24.2 mg/kg in the cupuaçu pulp; proline (73.5 mg/kg, glutamic acid (23.7 mg/kg and aspartic acid (23.5 mg/kg in the murici pulp. The heating of the 3 pulps decresead the concentration of all amino acids. The medium strongly alkaline (pH 12 produced more degradation of the amino acids than others pHs. Lysine was more sensible to the heating than others amino acids in pH 12.

  12. African Journal of Biotechnology - Vol 15, No 44 (2016)

    African Journals Online (AJOL)

    .) ... Molecular genetic diversity in a core of cocoa (Theobroma cacao L.) clones with potential for selection of disease resistance, plant height and fruit production · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT ...

  13. A physiological production model for cacao : results of model simulations

    NARCIS (Netherlands)

    Zuidema, P.A.; Leffelaar, P.A.

    2002-01-01

    CASE2 is a physiological model for cocoa (Theobroma cacao L.) growth and yield. This report introduces the CAcao Simulation Engine for water-limited production in a non-technical way and presents simulation results obtained with the model.

  14. Comparative study of cocoa-sweat and that of pure honey

    African Journals Online (AJOL)

    USER

    2010-05-17

    2003). Performance and some Haematological indices of Cockerel Chicks fed Cocoa. (Theobroma cacao) pod husk meal. ASSETS series A. 3(2): 11-12. Sanusi RA, Oluyole KA (2005). A review of the Cocoa sub-sector of the.

  15. Fungi associated with maize seed discolouration and abnormalities ...

    African Journals Online (AJOL)

    Cephalosporium acremonium and Nigrospora oryzae were also associated with purple/pink discolouration while Dreschslera maydis, Fusarium semitectum, Curvuluaria lunata and Colletotrichum graminicola were observed on seeds with brown spots. Botryodiplodia theobromae was more predominant on blackened seeds ...

  16. Purity assessment of condensed tannin fractions by nuclear magnetic resonance (NMR) spectroscopy

    Science.gov (United States)

    Unambiguous investigation of condensed tannin (CT) structure-activity relationships in biological systems requires the use of highly enriched CT fractions of defined chemical purity. Purification of CTs from Sorghum bicolor, Trifolium repens, Theobroma cacao, Lespedeza cuneata, Lotus pedunculatus, a...

  17. First report of grapevine dieback caused by Lasiodiplodia ...

    African Journals Online (AJOL)

    First report of grapevine dieback caused by Lasiodiplodia theobromae and Neoscytalidium dimidiatum in Basrah, Southern Iraq. Abdullah H Al-Saadoon, Mohanad KM Ameen, Muhammed A Hameed, Adnan Al-Badran, Zulfiqar Ali ...

  18. Nutritional content explains the attractiveness of cacao to crop raiding Tonkean macaques

    National Research Council Canada - National Science Library

    Erin P. RILEY Barbara TOLBERT Wartika R. FARIDA

    2013-01-01

    .... 2008 we collected fruit samples from 13 species known to be important Tonkean macaque foods and compared their nutritional value to that of cacao Theobroma cacao, an important cash crop in Sulawesi...

  19. Browse Title Index

    African Journals Online (AJOL)

    Cola nitida and Cola acuminata) and Cocoa (Theobroma cacao), Abstract ... Vol 15, No 1 (2017), Farmers' perception on the effects of climate change on groundnut production in Obi Local Government Area of Benue ...

  20. Relationship between five climatic parameters and somatic ...

    African Journals Online (AJOL)

    Relationship between five climatic parameters and somatic embryogenesis from sporophytic floral explants of Theobroma cacao L. AE Issal, A Traore, JL Konan, J Mpika, E Minyaka, JAK Ngoran, A Sangare ...

  1. African Journal of Biotechnology - Vol 12, No 12 (2013)

    African Journals Online (AJOL)

    -S-methyl and a phosphorylated mannan oligosaccharide-based product against Moniliophthora perniciosa in Theobroma cacao · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  2. Protein (Viridiplantae): 475206 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ansion stage, E expanded cotyledon stage, D bilateral stage Theobroma cacao MAGTSLS...m I assembly, thylakoid membrane organization, RNA modification, 4 anthesis, petal differentiation and exp

  3. Author Details

    African Journals Online (AJOL)

    Starch Beads and their Application as Drug Release Materials Abstract PDF · Vol 6, No 1 (2013) - Articles Studying the Characteristics of Polystyrene- Modified Cocoa (Theobroma cacao) Wood Cellulose Acetate Membrane Abstract PDF.

  4. Polyphenol content and antioxidant activity of several seeds and nuts

    National Research Council Canada - National Science Library

    Padilla, F C; Rincón, A M; Bou-Rached, L

    2008-01-01

    ..., cataracts and oxidative stress dysfunctions. The objective of this work was to evaluate total polyphenol content and antioxidant activity of several seeds, nuts, or grains such as Theobroma cacao, Canpsiandra comosa Benth (chiga...

  5. The graft copolymerisation of acrylamide onto cellulose using ...

    African Journals Online (AJOL)

    Theobroma cacao) wood meal have been produced using hydroquinone enhanced Fe2+/H2O2 redox system. The addition of hydroquinone to the redox system affected the effectiveness of the redox system to initiate graft copolymer formation.

  6. Comparative Assessment of Pathogenicity of Storage Rot Causing ...

    African Journals Online (AJOL)

    L)Schott) corms were assessed for their potency in causing rot of the corms during storage. The isolates were Sclerotium rolfsii Sacc., Botryodiplodia theobromae Pat., Fusarium solanii (Mart) Sac., Fusarium SP. and Rhizopus stolonifer (Ehren ...

  7. Fungal Planet description sheets: 371–399

    NARCIS (Netherlands)

    Crous, P.W.; Wingfield, M.J.; Le Roux, J.J.; Richardson, D.M.; Strasberg, D.; Shivas, R.G.; Alvarado, P.; Edwards, J.; Moreno, G.; Sharma, R.; Sonawane, M.S.; Tan, Y.P.; Altés, A.; Barasubiye, T.; Barnes, C.W.; Blanchette, R.A.; Boertmann, D.; Bogo, A.; Carlavilla, J.R.; Cheewangkoon, R.; Daniel, R.; Beer, de Z.W.; Jesús Yáñez-Morales, de M.; Doung, T.A.; Fernández-Vicente, J.; Geering, A.D.W.; Guest, D.I.; Held, B.W.; Keykoop, M.; Hubka, V.; Ismail, A.M.; Kajale, S.C.; Khemmuk, W.; Kolařík, M.; Kurli, R.; Lebeuf, R.; Lévesque, C.A.; Lombard, L.; Magista, D.; Manjón, J.L.; Marincowitz, S.; Mohedano, J.M.; Nováková, A.; Oberlies, N.H.; Otto, E.C.; Paguigan, N.D.; Pascoe, I.G.; Pérez-Butrón, J.L.; Perrone, G.; Rahi, P.; Raja, H.A.; Rintoul, T.; Sanhueza, R.M.V.; Scarlett, K.; Shouche, Y.S.; Shuttleworth, L.A.; Taylor, P.W.J.; Thorn, R.G.; Vawdrey, L.L.; Solano-Vidal, R.; Voitk, A.; Wong, P.T.W.; Wood, A.R.; Zamora, J.C.; Groenewald, J.Z.

    2015-01-01

    Novel species of fungi described in the present study include the following from Australia: Neoseptorioides eucalypti gen. & sp. nov. from Eucalyptus radiata leaves, Phytophthora gondwanensis from soil, Diaporthe tulliensis from rotted stem ends of Theobroma cacao fruit, Diaporthe vawdreyi from

  8. Metodologies per l'estudi de compostos fenòlics i alcaloides en el cacau (theobroma cacao) i la garrofa (ceratonia siliqua L.): bextracció, caracterització i avaluació de la digestibilitat en model in-vitro

    OpenAIRE

    Ortega Olivé, Nàdia

    2010-01-01

    Actualment hi ha un especial interès pels compostos fenòlics dels aliments en àmbits de la nutrició, salut i medicina en base a diferents evidències que suggereixen que poden actuar com a potents antioxidants i/o moduladors de funcions biològiques claus en els mamífers. Paral·lelament, hi ha una demanda per part dels consumidors en quant a la informació dels aliments que s'ingereix, de les necessitats nutricionals així com de la millora de salut. Tots aquest conceptes juntament amb la definic...

  9. Aplicación de Antagonistas Microbianos para el Control Biológico de Moniliophthora roreri Cif & Par en Theobroma cacao L. Bajo Condiciones de Campo / Application of Microbial Antagonists for the Biological Control of Moniliophthora roreri Cif & Par in

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Villamil Carvajal

    2014-12-01

    Full Text Available Resumen. En Colombia, las pérdidas ocasionadas porMoniliophthora roreri Cif & Par en el cultivo de cacao continúansiendo considerables. El objetivo del presente estudio fue investigarla actividad antagónica de dos aislamientos autóctonos deTrichoderma sp. y uno de Bacillus sp. ante M. roreri, en condicionesde campo. Los tratamientos fueron: T1, hongo H5; T2, hongo H20;T3, bacteria B3 y T4, testigo. Se evaluó incidencia y severidadexterna e interna en los frutos. Los resultados de severidad externae interna mostraron que respecto al control la disminucióndel daño en los frutos fue del 19,5 y 11,2% en el T1, del 28 y19,5% en el T2 y del 13,5 y 8,5% en el T3, respectivamente condiferencias estadísticas a favor del T2. Se concluye que entre lostres antagonistas evaluados, el hongo H20 (Trichoderma sp. tieneel mayor potencial para el control de la moniliasis del cacao encondiciones de campo. / Abstract. In Colombia, the economic losses caused byMoniliophthora roreri Cif & Par in the cocoa cultivation continuebeing considerable. The objective of this study was to investigatethe antagonistic activity of two indigenous isolates of Trichodermasp and one of Bacillus sp. over M. roreri under field conditions. Thetreatments were: T1, fungus H5; T2, fungus H20; T3, bacteria B3; T4,control. The variables evaluated on the cocoa fruits were incidenceand external and internal severity. The results of the externaland internal severity showed that with respect to the control thedamage reduction on the cocoa fruits was 19,5 and 11,2% in T1,28 and 19,5% in T2, and 13,5 and 8,5% in T3, respectively withstatistical differences in favor of T2. It is concluded that amongthe three evaluated antagonists, the fungus H20 (Trichoderma sp.has the greatest potential for the biocontrol of frosty pod rot in thecocoa cultivation under field conditions.

  10. Determinação de compostos de massa molecular alta em folhas de plantas da Amazônia

    Directory of Open Access Journals (Sweden)

    Siqueira Denilson Soares de

    2003-01-01

    Full Text Available The fractIons of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae, caapi (Banisteriopsis caapi - Malpighiaceae, cocoa (Theobroma cacao - Sterculiaceae, Brazil nut (Bertholletia excelsa - Lecytidaceae, cupuaçu (Theobroma grandiflorum - Sterculiaceae, marupá (Simaruba amara - Simaroubaceae and rubber tree (Hevea brasiliensis - Euphorbiaceae, were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data (¹H and 13C NMR, IR.

  11. Determination of high molecular mass compounds from Amazonian plant's leaves; Determinacao de compostos de massa molecular alta em folhas de plantas da Amazonia

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de [Universidade Federal, Rio de Janeiro, RJ (Brazil). Inst. de Quimica]. E-mail: ladetec@iq.gov.br; Cabral, Jose Augusto; Ferreira, Carlos Alberto Cid [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil); Simoneit, Bernd R.T. [Oregon State Univ., Corvallis, OR (United States). College of Oceanic and Atmospheric Sciences. Petroleum and Environmental Geochemistry Group; Elias, Vladimir O. [Analytical Solution, Rio de Janeiro, RJ (Brazil)

    2003-10-01

    The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ({sup 1}H and {sup 13}C NMR, IR). (author)

  12. Protocol for isolation of Moniliophthora roreri (Cif and Par Evans et al. from cacao fruits cv. `National' in the Ecuadorian Amazonia

    Directory of Open Access Journals (Sweden)

    Karina Carrera-Sánchez

    2014-07-01

    Full Text Available Moniliophthora roreri is a pathogen of cocoa (Theobroma cacao L. that causes high economic losses in Ecuador. This paper is intended to present a protocol for the isolation of the pathogen from cocoa fruits cv. `National', showing signs and symptoms of disease. The fruits were collected on farms of Napo (Ecuador. By wet chamber, it was able to induce profusely, sporulation on the surface of selected lesions. The isolations were performed from conidia directly located on the surface of fruits with brown powdery appearance. Isolation procedures and suggested of possible applications are presented.   Key words: amazonia, basidiomycetes, fungi, moniliasis, Theobroma cacao L.

  13. Comparative study on the effects of aqueous extracts of viscum ...

    African Journals Online (AJOL)

    Methods: Graded doses (400, 800, 1600 and 3200mg/kg body weight) of aqueous extracts of mistletoe from three different host plants, coffee (Coffee arabica), kola (Kola nitida), cocoa (Theobromae cacao), were administered orally to wistar albino rats for 14 days. Full haematological parameters were evaluated on whole ...

  14. Extraction and Activity of Polyphenol Oxidase from Kolanuts ( Cola ...

    African Journals Online (AJOL)

    The activity of polyphenol oxidase was investigated in kolanuts (Cola nitida and Cola acuminata) as well as cocoa (Theobroma cacao). Spectrophotometric method was used to assay the enzyme activity and the kinetic constants - maximum enzyme velocity (Vmax) and Michealis - Menten constant (Km). The maximum ...

  15. The draft genome of a diploid cotton Gossypium raimondii

    DEFF Research Database (Denmark)

    Wang, Kunbo; Wang, Zhiwen; Li, Fuguang

    2012-01-01

    identified 2,355 syntenic blocks in the G. raimondii genome, and we found that approximately 40% of the paralogous genes were present in more than 1 block, which suggests that this genome has undergone substantial chromosome rearrangement during its evolution. Cotton, and probably Theobroma cacao...

  16. Physico-chemical properties of topsoil under indigenous and exotic ...

    African Journals Online (AJOL)

    This study evaluated selected physico-chemical properties of topsoil under monoculture plantation of an indigenous tree species - Nauclea diderrichii, and those of four exotic tree species – Theobroma cacao, Gmelina arborea, Pinus caribaea and Tectona grandis, located in Omo Biosphere Reserve, Ogun State, Nigeria.

  17. Yield performance and bean quality traits of cacao propagated by grafting and somatic embryo-derived cuttings

    Science.gov (United States)

    Cacao (Theobroma cacao) has great potential as a component of a small tropical farming system. It adapts to a wide range of soils of climatic conditions, grows well under minimum tillage, adapts to temporary intercropping, has the potential of being sold in local and export markets and the pods are ...

  18. Unexpected Genome Variability at Multiple Loci Suggests Cacao Swollen Shoot Virus Comprises Multiple, Divergent Molecular Variants.

    Science.gov (United States)

    Cacao swollen shoot virus (CSSV) [Badnavirus, Caulimoviridae] causes swollen shoot disease of Theobroma cacao L. in West Africa. Since ~2000, various diagnostic tests have failed to detect CSSV in ~50-70% of symptomatic cacao plants, suggesting the possible emergence of new, previously uncharacteriz...

  19. Phytophthora megakarya and P. palmivora, closely related causal agents of cacao black pod induce similar reactions when infecting pods of a susceptible cacao genotype

    Science.gov (United States)

    Phytophthora megakarya (Pmeg) and Phytophthora palmivora (Ppal) cause black pod rot of Theobroma cacao. Of these two clade 4 species; Pmeg is more virulent and is displacing Ppal on cacao in many cacao production areas in Africa. To understand the advantages Pmeg has over Ppal, we compared symptom...

  20. Soil physical and chemical properties of cacao farms in the south western region of cameroon

    Science.gov (United States)

    The low macro nutrient content (K, Ca and Mg) in soils under cacao is one of the major causes of the poor cacao (Theobroma cacao L) yields. Efforts were made to assess the major physical and chemical properties of soils from some important cacao zones of the South West Region of Cameroon in order t...

  1. Coffee vs. Cacao: A Case Study from the Vietnamese Central Highlands

    Science.gov (United States)

    Ha, Dang Thanh; Shively, Gerald

    2005-01-01

    Mr. Nam, the vice chair of a village in Dak Lak province of Vietnam, was keen to protect farmers in his village from the sharp decline in prices of coffee ("Coffea canephora" Pierre ex Froehner). He did this by encouraging farmers in his village to plant cacao ("Theobroma cacao" L. subsp. "cacao"). Cacao was suitable…

  2. Macro and micro nutrient uptake parameters and use efficiency in cacao genotypes influenced by deficient to excess levels of soil K

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important economic crop for many of the tropical countries. Adequate levels of soil K are essential for good growth and achieving high cocoa bean yields. Soils under cacao invariably have low levels of plant available K to support good cacao growth. Growth chamber ex...

  3. Combination of RNAseq and SNP nanofluidic array reveals the center of genetic diversity of cacao pathogen Moniliophthora roreri in the upper Magdalena Valley of Colombia and its clonality

    Science.gov (United States)

    Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR) disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population ma...

  4. Nitrogen forms and levels influence on growth and nutrition of cacao

    Science.gov (United States)

    Ammonium and nitrate are the major forms of N present in tropical soils. A climatically controlled growth chamber experiment was conducted to assess the influence of forms (NO3-, NH4+, and mix of NO3- + NH4+) and levels (1.5 to 12.0 mM) of N on the growth and nutrition of cacao (Theobroma cacao L). ...

  5. Pathogenicity of Fungi Associated With the Cocoyam Root Rot Blight ...

    African Journals Online (AJOL)

    These were Aspergillus niger Thom and Raper, Botryodiplodia theobromae Pat., Fusarium solani (Mart.) Sacc., Pythium myriotylum Dresch., Rhizoctonia solani Kuhn, Rhizopus nigricans Ehhrenb., Trichoderma harzianum Rifai and Sclerotium rolfsii Sacc. The results showed that P. myriotylum was the most frequently ...

  6. Aspergillus oryzae NRRL 35191 from coffee, a non-toxigenic endophyte with the ability to synthesize kojic acid

    Science.gov (United States)

    Aspergillus oryzae was isolated as an endophyte from coffee leaves and found to produce kojic acid in culture. When inoculated in cacao seedlings (Theobroma cacao L.), A. oryzae grew endophytically and synthesize kojic acid in planta. Cacao seedlings inoculated with A. oryzae produced higher levels...

  7. Detection and Management of Mango Dieback Disease in the United Arab Emirates

    Science.gov (United States)

    Saeed, Esam Eldin; Sham, Arjun; A. Al Shurafa, Khawla; S. Al Naqbi, Tahra; Iratni, Rabah; El-Tarabily, Khaled; F. AbuQamar, Synan

    2017-01-01

    Mango is affected by different decline disorders causing significant losses to mango growers. In the United Arab Emirates (UAE), the pathogen was isolated from all tissues sampled from diseased trees affected by Lasiodiplodia theobromae. Symptoms at early stages of the disease included general wilting appearance of mango trees, and dieback of twigs. In advanced stages, the disease symptoms were also characterized by the curling and drying of leaves, leading to complete defoliation of the tree and discolouration of vascular regions of the stems and branches. To substantially reduce the devastating impact of dieback disease on mango, the fungus was first identified based on its morphological and cultural characteristics. Target regions of 5.8S rRNA (ITS) and elongation factor 1-α (EF1-α) genes of the pathogen were amplified and sequenced. We also found that the systemic chemical fungicides, Score®, Cidely® Top, and Penthiopyrad®, significantly inhibited the mycelial growth of L. theobromae both in vitro and in the greenhouse. Cidely® Top proved to be a highly effective fungicide against L. theobromae dieback disease also under field conditions. Altogether, the morphology of the fruiting structures, molecular identification and pathogenicity tests confirm that the causal agent of the mango dieback disease in the UAE is L. theobromae. PMID:29053600

  8. International Journal of Biological and Chemical Sciences - Vol 8 ...

    African Journals Online (AJOL)

    Phenolic content and heritability of resistance in four hybrid populations of Theobroma cacao L. after leaves inoculation with Phytophthora megakarya Bras. et Grif · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ML Ondobo, P Effa Onomo, PF Djocgoue, J Manga ...

  9. Proximate composition of some agricultural wastes in Nigeria and ...

    African Journals Online (AJOL)

    The proximate composition of five agricultural wastes were determined and latter subjected to low temperature conversion process in the presence of nitrogen atmosphere.These agricultural wastes are Cocos nucifera husk,Theobroma cacao pod, Kola nitida pods and Plantago major peels(ripe and unripe peels). All the ...

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 303 ... Vol 24, No 1 (2016), Mass Loss and Nutrient Release through Leaching in Tectona grandis and Theobroma cacao leaf litter in Ile-Ife, Nigeria, Abstract PDF. A I Odiwe, C F Akinye, O O Agboola. Vol 19, No 1 (2011), Microcystin-RR Like Toxin Identified in the Cyanobacterium Anabaena flos-aquae ...

  11. Author Details

    African Journals Online (AJOL)

    Akinye, C F. Vol 24, No 1 (2016) - Articles Mass Loss and Nutrient Release through Leaching in Tectona grandis and Theobroma cacao leaf litter in Ile-Ife, Nigeria Abstract PDF. ISSN: 0855-4307. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  12. Mass Loss and Nutrient Release through Leaching in Tectona ...

    African Journals Online (AJOL)

    User

    West African Journal of Applied Ecology, vol. 24(1), 2016: 43–58. Mass Loss and Nutrient Release through Leaching in Tectona grandisand Theobroma cacao leaf litter in Ile-Ife, Nigeria. A. I. Odiwe*, C. F. Akinye and O. O. Agboola. Department of Botany, Faculty of Science, Obafemi Awolowo University, Ile-Ife,. 22005, Osun ...

  13. Standardization of growth and fermentation criteria of Lasiodiplodia ...

    African Journals Online (AJOL)

    GREGO

    2007-03-19

    Mar 19, 2007 ... Full Length Research Paper. Standardization of growth and fermentation criteria of. Lasiodiplodia theobromae for production of jasmonic acid. Pinakin C. Dhandhukia and Vasudev R. Thakkar*. B & R Doshi School of Biosciences, Sardar Patel Maidan, Sardar Patel University, Vadatal Road, Bakrol, India.

  14. Effects of interacting variables on the release properties of ...

    African Journals Online (AJOL)

    Purpose: The individual and interaction effects of formulation variables on the release of suppositories were investigated using a 23 factorial experimental design. The variables studied were nature of base (B), type of drug (D), and presence of surfactant (S). Method: Suppositories were formulated with theobroma oil and ...

  15. The antagonistic activity of Trichoderma virens strain TvSUT10 ...

    African Journals Online (AJOL)

    In this current study, the beneficial filamentous fungi, Trichoderma virens, isolated from cassava field were investigated for antagonistic mode of action against Lasiodiplodia theobromae, the causal agent of cassava stem rot in Thailand. In vitro screening using the dual culture technique was undertaken to assess the ...

  16. Biological control of Black Pod Disease and Seedling Blight of cacao caused by Phytophthora Species using Trichoderma from Aceh Sumatra

    Science.gov (United States)

    The cocoa tree, Theobroma cacao L., suffers large yield losses in Aceh Indonesia to the disease black pod rot, caused by Phytophthora spp. Despite having the largest area under cacao production in Sumatra, farmers in the Aceh region have low overall production because of losses to insect pests and b...

  17. Rapidly disintegrating vagina retentive cream suppositories of progesterone: development, patient satisfaction and in vitro/in vivo studies.

    Science.gov (United States)

    Bendas, Ehab Rasmy; Basalious, Emad B

    2016-01-01

    Our objective was to develop novel vagina retentive cream suppositories (VRCS) of progesterone having rapid disintegration and good vaginal retention. VRCS of progesterone were prepared using oil in water (o/w) emulsion of mineral oil or theobroma oil in hard fat and compared with conventional vaginal suppositories (CVS) prepared by hard fat. VRCS formulations were tested for content uniformity, disintegration, melting range, in vitro release and stability studies. The most stable formulation (VRCS I) was subjected to scaling-up manufacturing and patients' satisfaction test. The rapid disintegration, good retentive properties are applicable through the inclusion of emulsified theobroma oil rather than hydrophilic surfactant into the hard fat bases. The release profile of progesterone from VRCS I showed a biphasic pattern due to the formation of progesterone reservoir in the emulsified theobroma oil. All volunteers involved in patients' satisfaction test showed high satisfactory response to the tested formulation (VRCS). The in vivo pharmacokinetic study suggests that VRCS of progesterone provided higher rate and extent of absorption compared to hard fat based suppositories. Our results proposed that emulsified theobroma oil could be promising to solve the problems of poor patients' satisfaction and variability of drug absorption associated with hard fat suppositories.

  18. Antifungal Effects Of Botanical Leaf Extracts On Tuber Rots Of Yam ...

    African Journals Online (AJOL)

    The fungicidal effects of dry and fresh leaf extracts of Axardirachta indica (L) and Ocimum grattissimum on the rot of yam tubers were investigated. Fusaruim oxysporium, Rhjzopus stolonifer, Botryodiplodia theobromae and Aspergillus Niger (root pathogens) were isolated from the rotted yam. Both dry and fresh leaf extracts ...

  19. Soil effect on polyphenols content and antioxidant capacity of new ...

    African Journals Online (AJOL)

    Polyphenols have gained much interest recently due to their antioxidant capacity and possible benefits to human health. Cocoa (Theobroma cacao) is a rich source of polyphenols and has higher antioxidant activity than teas and red wines. Cocoa and its derived products contain different types of polyphenols and possess ...

  20. Antioxidants in mangrove plants and endophytic fungal associations

    Digital Repository Service at National Institute of Oceanography (India)

    Ravindran, C.; Naveenan, T.; Varatharajan, G.R.; Rajasabapathy, R.; Meena, R.M.

    .R., R.T. Silva-Ribeiro, A.M.V. Pomella, C.S. Maki, W.L. Araújo, D.R. dos Santos and J.L. Azevedo. 2005. Diversity of endophytic fungal community of cacao (Theobroma cacao L.) and biological control of Crinipellis perniciosa, causal agent of Witches...