WorldWideScience

Sample records for theobroma

  1. Theobroma cacao L.:

    OpenAIRE

    Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin

    2003-01-01

    1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...

  2. Sulphur depletion altered somatic embryogenesis in Theobroma ...

    African Journals Online (AJOL)

    Somatic embryogenesis is a useful tool for Theobroma cacao improvement and propagation. Depending on culture medium composition, different morphogenetic structures (including somatic embryo) occur in response to alteration of genes expression patterns and biochemical changes. The effect of SO42- ion deficiency ...

  3. Emerging resistance against different fungicides in Lasiodiplodia theobromae, the cause of mango dieback in Pakistan

    Directory of Open Access Journals (Sweden)

    Rehman ur Ateeq

    2015-01-01

    Full Text Available Dieback of mango caused by Lasiodiplodia theobromae is among several diseases responsible for low crop production in Pakistan. To further complicate the issue, resistance in L. theobromae is emerging against different fungicides. L. theobromae was isolated from diseased samples of mango plants collected from various orchards in the Multan District. The efficacy of different fungicides viz. copper oxychloride, diethofencarb, pyrachlostrobin, carbendazim, difenoconazole, mancozeb, and thiophanate-methyl was evaluated in vitro using a poison food technique. Thiophanate-methyl at all concentrations was found to be the most effective among five systemic fungicides against L. theobromae, followed by carbendazim, difenoconazole and diethofencarb. The fungicides, i.e., thiophanate-methyl, difenoconazole, carbendazim and diethofencarb showed maximum efficacy with increasing concentration. The isolates of L. theobromae showed some resistance development against the tested fungicides when compared with previous work. These investigations provide new information about chemical selection for the control of holistic disease in mango growing zones of Pakistan.

  4. Data from proteome analysis of Lasiodiplodia theobromae (Botryosphaeriaceae

    Directory of Open Access Journals (Sweden)

    Carla C. Uranga

    2017-08-01

    Full Text Available Trunk disease fungi are a global problem affecting many economically important fruiting trees. The Botryosphaeriaceae are a family of trunk disease fungi that require detailed biochemical characterization in order to gain insight into their pathogenicity. The application of a modified Folch extraction to protein extraction from the Botryosphaeriaceae Lasiodiplodia theobromae generated an unprecedented data set of protein identifications from fragmentation analysis and de novo peptide sequencing of its proteome. This article contains data from protein identifications obtained from a database-dependent fragmentation analysis using three different proteomics algorithms (MSGF, Comet and X! Tandem via the SearchGUI proteomics pipeline program and de novo peptide sequencing. Included are data sets of gene ontology annotations using an all-Uniprot ontology database, as well as a Saccharomyces cerevisiae-only and a Candida albicans-only ontology database, in order to discern between those proteins involved in common functions with S. cerevisiae and those in common with the pathogenic yeast C. albicans. Our results reveal the proteome of L. theobromae contains more ontological categories in common to C. albicans, yet possesses a much wider metabolic repertoire than any of the yeasts studied in this work. Many novel proteins of interest were identified for further biochemical characterization and annotation efforts, as further discussed in the article referencing this article (1. Interactive Cytoscape networks of molecular functions of identified peptides using an all-Uniprot ontological database are included. Data, including raw data, are available via ProteomeXchange with identifier PXD005283.

  5. Repression of calcitonin gene-related peptide expression in trigeminal neurons by a Theobroma cacao extract☆

    Science.gov (United States)

    Abbey, Marcie J.; Patil, Vinit V.; Vause, Carrie V.; Durham, Paul L.

    2008-01-01

    Ethnopharmacological relevance Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. Aim of the study To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Results Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24 h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Conclusions Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation. PMID:17997062

  6. Repression of calcitonin gene-related peptide expression in trigeminal neurons by a Theobroma cacao extract.

    Science.gov (United States)

    Abbey, Marcie J; Patil, Vinit V; Vause, Carrie V; Durham, Paul L

    2008-01-17

    Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation.

  7. Factors controlling phenol content on Theobroma cacao callus culture

    International Nuclear Information System (INIS)

    Quiñones-Galvez, Janet; HernándezTorre, Martha de la; Quirós Molina, Yemeys; Capdesuñer Ruiz, Yanelis; Trujillo Sánchez, Reinaldo

    2016-01-01

    Theobroma cacao L. is known in folk medicine as an antiseptic, diuretic and antiparasitic. Foods derived from this plant are rich in natural products of high added value, including phenolic compounds. As in vitro cultivation handle is an alternative source for the production of these metabolites. The present study was conducted to obtain phenolic compounds from callus culture with embryogenic structures. Culture conditions (agitation, light and glucose) were established to increase the concentration of phenols in calluses and elicitors to achieve the increase in callus and excretion into the culture area. The accumulation of phenolic compounds was favored with the additional supplement of glucose, growth in agitation and darkness. The addition of random hydroxylated cyclodextrins allowed the increase in the specific yield of phenols and biomass. (author)

  8. Cryopreservation of cocoa (Theobroma cacao L.) somatic embryos by vitrification.

    Science.gov (United States)

    Adu-Gyamfi, Raphael; Wetten, Andy

    2012-01-01

    Losses of cultivated cocoa (Theobroma cacao L.) due to diseases and continued depletion of forests that harbour the wild progenitors of the crop make ex situ conservation of cocoa germplasm of paramount importance. In order to enhance security of in situ germplasm collections, 2-3 mm floral-derived secondary somatic embryos were cryopreserved by vitrification. This work demonstrates the most uncomplicated clonal cocoa cryopreservation. Optimal post-cryostorage survival (74.5 percent) was achieved by 5 d preculture of SSEs on 0.5 M sucrose medium followed by 60 min dehydration in cold PVS2. To minimise free radical related cryo-injury, cation sources were removed from the embryo development solution and/or the recovery medium, the former treatment resulting in a significant benefit. After optimisation with cocoa genotype AMAZ 15, the same protocol was effective across all five additional cocoa genotypes tested. For the multiplication of clones, embryos regenerated following cryopreservation were used as explant sources, and vitrification was found to maintain their embryogenic potential.

  9. Association mapping of fruit, seed and disease resistance traits in Theobroma cacao L

    Science.gov (United States)

    An association mapping approach was employed to find markers for color, size, girth and mass of fruits; seed number and butterfat content; and resistance to black pod and witches’ broom diseases in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms...

  10. Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.

    Science.gov (United States)

    Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ~4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification pr...

  11. Altered physiology, cell structure and gene expression of Theobroma cacao seedlings submitted to Cu toxicity

    Science.gov (United States)

    Theobroma cacao seedlings from the genotype CCN 51 were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16 and 32 mg Cu L-1) in nutrient solution. When doses were equal or higher than 8 mg Cu L-1, after 24 h of treatment application, leaf gas exch...

  12. Genetic diversity and spatial structure in cacao (Theobroma cacao L.) germplasm from Bolivia

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important economic crop widely cultivated in the Bolivian Amazon. The germplasm group used by the Bolivian farmers was called “Cacao Nacional Boliviano” (CNB). Wild cacao populations are also found in the Beni River and in the valleys of Andes foot hills. Using DNA...

  13. Molecular genetic diversity in a core of cocoa ( Theobroma cacao L ...

    African Journals Online (AJOL)

    This study aimed to assess the genetic variability in groups of 11 clones of Theobroma cacao L., from different geographical regions, based on microsatellite markers, with the interest to characterize germplasm for breeding. The products of the amplification of these materials with 15 simple sequence repeat (SSR) markers ...

  14. Responses of seedlings of tropical woody plants to environmental stresses with emphasis on Theobroma cacao and Hevea brasiliensis

    Energy Technology Data Exchange (ETDEWEB)

    Sena Gomes, A.R.

    1987-01-01

    Relative humidity, flooding, temperature, wind, and SO/sub 2/ variously influenced physiological processes and growth of tropical woody plants, with emphasis on three Theobroma cacao varieties and three Hevea brasiliensis families. Stomata were smaller and more numerous in Theobroma than in Hevea. In Theobroma, but not Heavea, stomatal frequency decreased from the leaf base to the apex and from the midrib outward. Stomata of Theobroma cacao var. Catongo opened in high relative humidity (RH) and closed in low RH. The more open stomata in high RH were associated with high rates of photosynthesis, low leaf water potential, high water use efficiency (WUE), and low transpiration rate (TR). Variations in TR and WUE were correlated with changes in vapor pressure deficit. Other responses included stomatal closure, decreased chlorophyll content, leaf epinasty, production of hypertrophied lenticels and adventitious roots, and acceleration of ethylene production. Responses to flooding varied with species, Theobroma varieties and Hevea families. Effects of temperature regimes on growth varied with species, varieties and families, plant parts, growth parameters, and time of harvesting. Optimal temperatures for dry weight increase of stems or roots of Theobroma cacao var. Comum were 22.2 C; and 33.3 C for dry weight increase or relative growth rates of leaves or seedlings. Optimal temperatures for growth varied for Hevea families. Wind injured leaves of Theobroma cacao, with more injury by wind of 6.0 than 3.0 m s/sup -1/. Stomata were more open on windy than on calm days, but tended to close at high wind speeds. Wind lowered transpiration rate but the reduction was not correlated with leaf dehydration. SO/sub 2/ at 0.5, 1.0, or 1.5 ppm for 24 h did not injure Theobroma leaves but reduced dry weight increment of leaves of var. Catongo but not Catongo/Sial.

  15. Cocoa Bean (Theobroma cacao L.Drying Kinetics Cinética del Secado de Cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Ndukwu MacManus Chinenye

    2010-12-01

    Full Text Available Cocoa (Theobroma cacao L. is widely produced in West Africa and South America and is a great economic tree crop, with so many industrial uses. In this work, the experimental drying kinetics of foreign species was investigated, and the experiments were carried out under isothermal conditions, using heated batch drier at 55, 70 and 81 ºC. The moisture ratio data obtained from change of moisture content with the drying time was fit to two thin layer drying model with good results. A faster drying process was observed at a higher drying temperature resulting in higher drying rates which is advantageous when evaluating costs. Fick’s second law of diffusion was used to predict effective diffusivity using experimental data assuming that the variation of diffusivity with temperature can be expressed by an Arrhenius type function, and the values of diffusivity obtained ranged from 6.137 x 10-10 to 2.1855 x 10-9 m2 s-1 for the temperature used. The Arrhenius constant (D is predicted at 8.64 x 10-4 m2 s-1 while the activation energy was predicted at 39.94 kJ mol-1.El cacao (Theobroma cacao L. es ampliamente producido en el Oeste de África y Sudamérica y es un cultivo de gran importancia económica, con muchos usos industriales. En este trabajo se investigó la cinética del secado experimental de especies foráneas, y se realizaron experimentos bajo condiciones isotérmicas, usando un secador discontinuo en caliente a 55, 70 y 81 °C. Los datos de relación de humedad obtenidos desde el cambio de contenido de humedad con el tiempo de secado se ajustaron a un modelo de secado de dos capas delgadas con buenos resultados. Se observó un proceso de secado más rápido a una temperatura de secado mayor resultando en mayores tasas de secado, lo que es ventajoso al evaluar costos. La segunda ley de difusión de Fick se usó para predecir difusividad efectiva usando datos experimentales, asumiendo que la variación de difusividad con la temperatura puede ser

  16. BIOTRANSFORMATION OF FERULIC ACID BY THE PHYTOPATHOGENIC FUNGI Colletotrichum acutatum AND Lasiodiplodia theobromae

    Directory of Open Access Journals (Sweden)

    Manuel Alejandro Numpaque

    2016-01-01

    Full Text Available The microbial transformation of ferulic acid (FA offers a cleaner, more economical alternative for the natural production of flavorings and fragrances. In the present study, the biotransformation of FA using the filamentous phytopathogenic fungi Colletotrichum acutatum and Lasiodiplodia theobromae was researched. Initially, the toxicity of FA against both fungi was evaluated; the FA displayed a moderate toxicity (total inhibition at concentrations ≥ 2000 mg L-1 and apparently a detoxification mechanism was present. Afterwards, the microorganisms were incubated with the substrate at room conditions using a Czapek-Dox culture medium. The results demonstrated that the FA was mainly converted to 4-vinylguaiacol, reaching the highest abundance within the first 48 hours. To a lesser extent, acetovanillone, ethylguaiacol, and vanillin, among others, were produced. Interestingly, the compounds generated in the biotransformation of FA with C. acutatum and L. theobromae have been used as flavorings. Based on the identified metabolites, a possible metabolic pathway was proposed.

  17. Inhibition of Acetylcholinesterase and Fatty Acid Composition in Theobroma grandiflorum Seeds

    Directory of Open Access Journals (Sweden)

    Casandra Valentina Itriago

    2017-07-01

    Full Text Available Theobroma grandiflorum is an important fruit tree from Sterculiaceae family, native to the Brazilian Amazon, known in the region as cupuaçu. The seeds have a high fat content (24% with characteristics that resemble those of cocoa (Theobroma cacao butter with potential applications in the cosmetic, pharmaceutical and food industries. The main objective of this work was to explore the seed fats from T. grandiflorum that were analyzed for fatty acid composition by Gas Chromatography with Flame Ionization Detector (GC-FID and to analyze their activity for acetylcholinesterase inhibition. Chromatographic analysis provided detection of nine fatty acids. The major fatty acids found in the species were oleic (40.0%, stearic (32.7%, arachidic (10.4% and palmitic (8.0%. The acetylcholinesterase inhibition by fats from seeds was over 40.48%. DOI: http://dx.doi.org/10.17807/orbital.v0i0.894 

  18. Fatty acid esters produced by Lasiodiplodia theobromae function as growth regulators in tobacco seedlings

    International Nuclear Information System (INIS)

    Uranga, Carla C.; Beld, Joris; Mrse, Anthony; Córdova-Guerrero, Iván; Burkart, Michael D.; Hernández-Martínez, Rufina

    2016-01-01

    The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.

  19. Comparison of Canopy Openness in Different Cocoa (Theobroma cacao) Production Systems in Alto Beni, Bolivia

    OpenAIRE

    Niether, Wiebke; Maldonado, Carla; Silva, Erika; Schneider, Monika; Gerold, Gerhard

    2013-01-01

    Cocoa (Theobroma cacao L.) grows naturally as an understory tree in tropical forests and produces well under shaded and non-shaded conditions. It is cultivated by small scale farmers in South America under various conditions, ranging from monocultures to different kinds of agroforestry systems. While in monocultures it is exposed to direct sunlight, one or various tree species shade the cocoa in agroforestry systems. Also organic cocoa cultivation is becoming more and more popular due to prem...

  20. Fatty acid esters produced by Lasiodiplodia theobromae function as growth regulators in tobacco seedlings

    Energy Technology Data Exchange (ETDEWEB)

    Uranga, Carla C., E-mail: curanga@cicese.edu.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico); Beld, Joris, E-mail: joris.beld@drexelmed.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Mrse, Anthony, E-mail: amrse@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Córdova-Guerrero, Iván, E-mail: icordova@uabc.edu.mx [Universidad Autónoma de Baja California (UABC), Calzada Universidad 14418 Parque Industrial Internacional Tijuana, Tijuana, B.C. 22390 (Mexico); Burkart, Michael D., E-mail: mburkart@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Hernández-Martínez, Rufina, E-mail: ruhernan@cicese.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico)

    2016-04-01

    The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.

  1. In silico analysis of cacao (Theobroma cacao L.) genes that involved in pathogen and disease responses

    Science.gov (United States)

    Agung, Muhammad Budi; Budiarsa, I. Made; Suwastika, I. Nengah

    2017-02-01

    Cocoa bean is one of the main commodities from Indonesia for the world, which still have problem regarding yield degradation due to pathogens and disease attack. Developing robust cacao plant that genetically resistant to pathogen and disease attack is an ideal solution in over taking on this problem. The aim of this study was to identify Theobroma cacao genes on database of cacao genome that homolog to response genes of pathogen and disease attack in other plant, through in silico analysis. Basic information survey and gene identification were performed in GenBank and The Arabidopsis Information Resource database. The In silico analysis contains protein BLAST, homology test of each gene's protein candidates, and identification of homologue gene in Cacao Genome Database using data source "Theobroma cacao cv. Matina 1-6 v1.1" genome. Identification found that Thecc1EG011959t1 (EDS1), Thecc1EG006803t1 (EDS5), Thecc1EG013842t1 (ICS1), and Thecc1EG015614t1 (BG_PPAP) gene of Cacao Genome Database were Theobroma cacao genes that homolog to plant's resistance genes which highly possible to have similar functions of each gene's homologue gene.

  2. Optimized Jasmonic Acid Production by Lasiodiplodia theobromae Reveals Formation of Valuable Plant Secondary Metabolites.

    Directory of Open Access Journals (Sweden)

    Felipe Eng

    Full Text Available Jasmonic acid is a plant hormone that can be produced by the fungus Lasiodiplodia theobromae via submerged fermentation. From a biotechnological perspective jasmonic acid is a valuable feedstock as its derivatives serve as important ingredients in different cosmetic products and in the future it may be used for pharmaceutical applications. The objective of this work was to improve the production of jasmonic acid by L. theobromae strain 2334. We observed that jasmonic acid formation is dependent on the culture volume. Moreover, cultures grown in medium containing potassium nitrate as nitrogen source produced higher amounts of jasmonic acid than analogous cultures supplemented with ammonium nitrate. When cultivated under optimal conditions for jasmonic acid production, L. theobromae secreted several secondary metabolites known from plants into the medium. Among those we found 3-oxo-2-(pent-2-enyl-cyclopentane-1-butanoic acid (OPC-4 and hydroxy-jasmonic acid derivatives, respectively, suggesting that fungal jasmonate metabolism may involve similar reaction steps as that of plants. To characterize fungal growth and jasmonic acid-formation, we established a mathematical model describing both processes. This model may form the basis of industrial upscaling attempts. Importantly, it showed that jasmonic acid-formation is not associated to fungal growth. Therefore, this finding suggests that jasmonic acid, despite its enormous amount being produced upon fungal development, serves merely as secondary metabolite.

  3. Molecular characterisation of a germplasm bank for Theobroma genus using the RAPD technique

    Directory of Open Access Journals (Sweden)

    Yovany Moreno

    2004-07-01

    Full Text Available RAPD markers (Random Amplified Polymorphic DNA were used for analysing 145 individuals (128 T. grandiflorum and 17 T. bicolor from the ex situ Theobroma genus germplasm bank at Instituto Sinchi, located at San José del Guaviare. 5 primers able to generated polymorphism were selected from an initial set of 20, generating 114 bands that enable to us to distinguish between more than 99% of individuals analysed: 57 bands for T. grandiflorum (84.2% polymorphic, 45 bands for T. bicolor (26.7% polymorphic and 12 bands shared between the two species (58.3% polymorphic. A high degree of intra-specific similarity particularly in T. bicolor was established from the similarity matrix obtained by using the Dice index and represented in a UPGMA dendrogram and the principal components analysis (PCA. The comparison of this analysis with a previous morpho-agronomic evaluation of some T. grandiflorum individuals revealed that the groups generated on the basis of its agronomic and morphological traits were heterogeneous at molecular level. The obtained information will be used as a tool in strategies regarding maintenance, enrichment and use of the germplasm bank. Key words: Theobroma grandiflorum, Theobroma bicolour, RAPD, molecular characterisation.

  4. Co-occurrence of pathogenic and non-pathogenic Fusarium decemcellulare and Lasiodiplodia theobromae isolates in cushion galls disease of cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Castillo Daynet Sosa del

    2016-04-01

    Full Text Available Flowery cushion gall of cacao is a disease complex with six types. Fusarium decemcellulare have been isolated from both flowery and green point galls and recognized as the etiological agent of the disease. In the present work we: i identified by ITS-rDNA sequencing and/or taxonomy the cultivable fungal species or Operative Taxonomic Units (OTUs associated with the five symptoms of cushion galls in cacao from Venezuela, and ii determined the gall inducing capacity on cacao peeled seeds after 45 days of inoculation with suspensions of mycelia/ spores from distinct isolate types. The whole isolate collection rendered an abundance of 113 isolates with a richness of 39 OTUs (27 and eight identified at the species or genera levels, respectively, and in unidentified fungi. The dominant recovered species (≈36% were F. decemcellulare and Lasiodiplodia theobromae. Some isolates of F. decemcellulare, L. theobromae, F. equiseti, Fusarium spp., F. solani, F. incarnatum, Rhizocthonia solani and Penicillium sp. were pathogenic. Some other isolates of the first six mentioned taxa behave as non-pathogenic. Furthermore, pathogenic and non-pathogenic isolates can also co-occur within a single plant and gall type. Moreover, 2-5 species within a single gall symptom in a single tree were identified (not necessarily at the same point in the tree, indicating a broad diversity of co-occurring taxa.

  5. Genome size, cytogenetic data and transferability of EST-SSRs markers in wild and cultivated species of the genus Theobroma L. (Byttnerioideae, Malvaceae)

    Science.gov (United States)

    da Silva, Rangeline Azevedo; Souza, Gustavo; Lemos, Lívia Santos Lima; Lopes, Uilson Vanderlei; Patrocínio, Nara Geórgia Ribeiro Braz; Alves, Rafael Moysés; Marcellino, Lucília Helena; Clement, Didier; Micheli, Fabienne

    2017-01-01

    The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR) of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI− bands). The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC) ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted. PMID:28187131

  6. Genome size, cytogenetic data and transferability of EST-SSRs markers in wild and cultivated species of the genus Theobroma L. (Byttnerioideae, Malvaceae.

    Directory of Open Access Journals (Sweden)

    Rangeline Azevedo da Silva

    Full Text Available The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI- bands. The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted.

  7. Reacción a Moniliophthora roreri en Theobroma spp. en Caquetá, Colombia

    Directory of Open Access Journals (Sweden)

    Armando Sterling Cuéllar

    2015-09-01

    Full Text Available El objetivo de este estudio fue evaluar in situ la reacción de 50 materiales genéticos de tres especies de Theobroma(T. cacao, T. grandiflorum y T. bicolor a la inoculación controlada de tres aislados autóctonos de Moniliophthora roreri (agente causal de la moniliasis del cacao en el Departamento de Caquetá (Amazonia colombiana. Las variables incidencia de la enfermedad (IMr, severidad externa (SE y severidad interna (SI, se evaluaron nueve semanas después de la inoculación de mazorcas de 2 a 3 meses de edad con una suspensión de esporas de 1,2 x 105 esporas/mL. La enfermedad se evidenció en las tres especies de Theobroma, sin embargo, ésta no se presentó en 13 de los 50 materiales genéticos evaluados, representados así: seis T. grandiflorum, cinco T. bicolor y dos T. cacao. Los materiales genéticos de T. bicolor y T. grandiflorum fueron los menos afectados comparados con los de T. cacao. Se encontraron diferencias significativas para IMr, SE y SI entre las tres especies de Theobroma y entre los 50 materiales genéticos. Diferencias significativas entre los aislados solo ocurrieron para SE. La incidencia y la severidad de la enfermedad entre materiales genéticos, fueron influenciadas por el patógeno aislado. Los materiales genéticos con menor reacción a M. roreri pueden ser utilizados en programas de mejoramiento por resistencia a la moniliasis.

  8. Caracteriza??o de subst?ncias fen?licas e alcaloides dos res?duos do cupua?u (Theobroma grandiflorum (willd. Ex spreng.) Schum)

    OpenAIRE

    Lima, Milena Campelo Freitas de

    2013-01-01

    Theobroma grandiflorum ? uma esp?cie nativa da Amaz?nia com elevado potencial econ?mico, que pertence ao mesmo g?nero que o cacau (Theobroma cacao). Seu fruto, conhecido como cupua?u, ? o maior no g?nero Theobroma, chegando a atingir at? 4 kg em massa. A base econ?mica dessa esp?cie concentra-se no mesocarpo (polpa), bastante conhecido e comercializado para a produ??o de sucos, n?ctares, sorvetes entre outros. No processo de obten??o da polpa do cupua?u s?o gerados subprodutos que corresponde...

  9. Analise da influencia das fontes de carbono na patogenicidade do Moniliophthora perniciosa pathogenicity em Theobroma cacao

    OpenAIRE

    Fatima Cerqueira Alvim

    2009-01-01

    Resumo: O fungo basidiomiceto hemibiotrófico Moniliophthora perniciosa, agente causal da doença vassoura-de-bruxa (VB) em Theobroma cacao, é o principal patógeno da lavoura cacaueira nas Américas e no Caribe. O presente trabalho apresentou como objetivo primordial identificar proteínas relacionadas com a patogenicidade deste fungo. No primeiro capítulo desta tese foi demonstrado o efeito de diferentes fontes de carbono sobre a morfologia e fisiologia do M, perniciosa. O fungo foi crescido em ...

  10. 1H NMR study of fermented cocoa (Theobroma cacao L.) beans.

    Science.gov (United States)

    Caligiani, Augusta; Acquotti, Domenico; Cirlini, Martina; Palla, Gerardo

    2010-12-08

    This study reports for the first time the metabolic profile of cocoa (Theobroma cacao L.) beans using the (1)H NMR technique applied to polar extracts of fermented cocoa beans. The simultaneous detection and quantification of amino acids, polyalcohols, organic acids, sugars, methylxanthines, catechins, and phenols were obtained by assigning the major signals of the spectra for different varieties of cocoa beans (Forastero, Criollo, and Trinitario) from different countries (Ecuador, Ghana, Grenada, and Trinidad). The data set obtained, representative of all classes of soluble compounds of cocoa, was useful to characterize the fermented cocoa beans as a function of the variety and geographic origin.

  11. Potencial de actividad antioxidante de extractos fenólicos de Theobroma cacao L. (cacao)

    OpenAIRE

    Quiñones Gálvez, Janet; Trujillo Sánchez, Reinaldo; Capdesuñer Ruiz, Yanelis; Quirós Molina, Yemeys; Hernández de la Torre, Martha

    2013-01-01

    Introducción: Theobroma cacao L. (cacao), familia Sterculiaceae, es una planta rica en fenoles, los cuales en las plantas son de especial interés por su potente actividad antioxidante, dada esencialmente por sus propiedades redox, que pueden desempeñar un papel importante en la absorción y neutralización de los radicales libres. Objetivos: seleccionar un clon promisorio en la producción de compuestos fenólicos, determinar los órganos con mayor contenido de fenoles, establecer el cultivo in vi...

  12. Presencia de metales pesados en cultivo de cacao (Theobroma cacao L.) orgánico

    OpenAIRE

    Huamaní-Yupanqui, Hugo Alfredo; Huauya-Rojas, Miguel ángel; Mansilla-Minaya, Luis Germán; Florida-Rofner, Nelino; Neira-Trujillo, Gilmer Milton

    2012-01-01

    La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...

  13. Presence of heavy metals in organic cacao (theobroma cacao l.) crop

    OpenAIRE

    HuamanI-Yupanqui, Hugo Alfredo; Huauya-Rojas, Miguel Ángel; Mansilla-Minaya, Luis Germán; Florida-Rofner, Nelino; Neira-Trujillo, Gilmer Milton

    2013-01-01

    La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...

  14. Fertilisation minérale du cacaoyer ( Theobroma cacao L.) en Côte d ...

    African Journals Online (AJOL)

    En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point ...

  15. Comparison of two cacao (Theobroma cacao L.) clones for the effect of pollination intensity on fruit set and seed content

    NARCIS (Netherlands)

    Falque, M.; Lesdalons, C.; Eskes, A.B.

    1996-01-01

    We compared the influence of pollination intensity (PI) on fruit set and seed number per pod in two cacao (Theobroma cacao L.) clones, IFC5 (Forastero Lower-Amazon Amelonado), which is self-compatible and known to produce a high number of seeds per pod under open pollination, and SCA6 (Forastero

  16. The influence of formulation on Trichoderma biological activity and frosty pod rot disease management in Theobroma cacao

    Science.gov (United States)

    Frosty pod rot (FPR), caused by Moniliophthora roreri is responsible for significant losses in Theobroma cacao. Due to the limited options for FPR management, biological control methods using Trichoderma are being studied. Combinations of three formulations and two Trichoderma isolates were studied ...

  17. Molecular characterization of an earliest cacao (Theobroma cacao L.) collection from Peruvian Amazon using microsatllite DNA markers

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is indigenous to the Amazon region of South America. The Peruvian Amazon harbors a large number of diverse cacao populations. Since the 1930s, several numbers of populations have been collected from the Peruvian Amazon and maintained as ex situ germplasm repositories in ...

  18. Influence of culture media and environmental factors on mycelial growth and sporulation of Lasiodiplodia theobromae (Pat.) Griffon and Maubl.

    Science.gov (United States)

    Saha, A; Mandal, P; Dasgupta, S; Saha, D

    2008-05-01

    Lasiodiplodia theobromae, a common tea (Camellia sinensis) pathogen, usually does not sporulate or sporulates poorly in common media, which makes spore production difficult. In this study the effects of culture media, carbon source, nitrogen source, temperature, pH and light on mycelial growth and sporulation were evaluated. Among several carbon sources tested, glucose and sucrose were found superior for growth. Potassium nitrate supplemented media showed maximum growth amongst the tested inorganic nitrogen sources while peptone produced maximum growth among the tested organic nitrogen sources. Tea root extract supplemented potato dextrose agar medium was found to be the most suitable for mycelial growth and sporulation of L. theobromae. The fungus grow at temperatures ranging from 40 to 36 degrees C, with optimum growth at 28 degrees C and no growth was noted at 40 degrees C. There was no significant effect of different light period on growth of L. theobromae, but light enhanced sporulation. The fungus grow at pH 3.0-8.0 and optimum growth was observed at pH 6.0. Tea root extract supplemented potato dextrose agar medium with pH 6.0 was the most suitable for production of conidia of L. theobromae at 28 degrees C. Hence this media may be recommended for inoculum production for further studies.

  19. QTL mapping for resistance to frosty pod and black pod diseases in an f1 population of Theobroma cacao L

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is a native crop of the Americas; however severe losses due to frosty pod (FP) [Moniliophthora roreri (Cif. and Par.)], and black pod (BP) [Phytophthora palmivora (Butl.) Butl.] have reduced cacao in the Americas to only 13.0% of world production. Agronomic practices to co...

  20. Low doses of gamma radiation in the management of postharvest Lasiodiplodia theobromae in mangos

    Directory of Open Access Journals (Sweden)

    Alice Maria Gonçalves Santos

    2015-09-01

    Full Text Available The postharvest life of mango is limited by the development of pathogens, especially fungi that cause rot, among which stands out the Lasiodiplodia theobromae. Several control methods have been employed to minimize the damages caused by this fungus, chemical control can leave residues to man and nature; physical control by the use of gamma radiation in combination with modified atmosphere and cold storage. The use of gamma radiation helps to reduce the severity of the pathogen assist in the ripening process of fruits, even at low doses (0.25, 0.35 and 0.45 kGy chemical properties such as pH, soluble solids, acid ascorbic, titratable acidity and also the quality parameters of the pulp showed no damage that are ideal for trade and consumption of mangoes. This treatment can be extended for use in the management of diseases such as natural infections for penducular rot complex that has as one of L. theobroma pathogens involved.

  1. Characterization of the legumains encoded by the genome of Theobroma cacao L.

    Science.gov (United States)

    Santana, Juliano Oliveira; Freire, Laís; de Sousa, Aurizangela Oliveira; Fontes Soares, Virgínia Lúcia; Gramacho, Karina Peres; Pirovani, Carlos Priminho

    2016-01-01

    Legumains are cysteine proteases related to plant development, protein degradation, programmed cell death, and defense against pathogens. In this study, we have identified and characterized three legumains encoded by Theobroma cacao genome through in silico analyses, three-dimensional modeling, genetic expression pattern in different tissues and as a response to the inoculation of Moniliophthora perniciosa fungus. The three proteins were named TcLEG3, TcLEG6, and TcLEG9. Histidine and cysteine residue which are part of the catalytic site were conserved among the proteins, and they remained parallel in the loop region in the 3D modeling. Three-dimensional modeling showed that the propeptide, which is located in the terminal C region of legumains blocks the catalytic cleft. Comparing dendrogram data with the relative expression analysis, indicated that TcLEG3 is related to the seed legumain group, TcLEG6 is related with the group of embryogenesis activities, and protein TcLEG9, with processes regarding the vegetative group. Furthermore, the expression analyses proposes a significant role for the three legumains during the development of Theobroma cacao and in its interaction with M. perniciosa. Copyright © 2015 Universidade Estadual de Santa Cruz, CNPJ: 40738999/0001-95. Published by Elsevier Masson SAS.. All rights reserved.

  2. Novel proteins from proteomic analysis of the trunk disease fungus Lasiodiplodia theobromae (Botryosphaeriaceae

    Directory of Open Access Journals (Sweden)

    Carla C. Uranga

    2017-06-01

    Full Text Available Many basic science questions remain regarding protein functions in the pathogen: host interaction, especially in the trunk disease fungi family, the Botryosphaeriaceae, which are a global problem for economically important plants, especially fruiting trees. Proteomics is a highly useful technology for studying protein expression and for discovering novel proteins in unsequenced and poorly annotated organisms. Current fungal proteomics approaches involve 2D SDS-PAGE and extensive, complex, protein extraction methodologies. In this work, a modified Folch extraction was applied to protein extraction to perform both de novo peptide sequencing and peptide fragmentation analysis/protein identification of the plant and human fungal pathogen Lasiodiplodia theobromae. Both bioinformatics approaches yielded novel peptide sequences from proteins produced by L. theobromae in the presence of exogenous triglycerides and glucose. These proteins and the functions they may possess could be targeted for further functional characterization and validation efforts, due to their potential uses in biotechnology and as new paradigms for understanding fungal biochemistry, such as the finding of allergenic enolases, as well as various novel proteases, including zinc metalloproteinases homologous to those found in snake venom. This work contributes to genomic annotation efforts, which, hand in hand with genomic sequencing, will help improve fungal bioinformatics databases for future studies of Botryosphaeriaceae. All data, including raw data, are available via the ProteomeXchange data repository with identifier PXD005283. This is the first study of its kind in Botryosphaeriaceae.

  3. JENIS TANAMAN INANG DAN MASA INKUBASI PATOGEN BOTRYODIPLODIA THEOBROMAE PAT. PENYEBAB PENYAKIT KULIT DIPLODIA PADA JERUK

    Directory of Open Access Journals (Sweden)

    Salamiah, Badruzsaufari, dan Muhammad Arsyad .

    2011-11-01

    Full Text Available Alternative hosts and Incubation period of Botryodiplodia theobromae the causal of  diplodia bark diseases on citrus. Citrus is one of the important horticulture commodities in South Kalimantan. Citrus growers in the region encounter diplodia disease caused by a genus of Botryodiplodia.  There is no single method practiced today proved to be effective control for the disease. Insufficient information of the pathogen life cycle is considered to contribute in  the failure of disease management.   Information of the alternative hosts and incubation period of the pathogens is  very crucial in the diseases management. The experiments were carried out at the Laboratory of Plant Diseases and at a Glass House of the Department of Plant Pests and Diseases of the Faculty of Agriculture, Lambung Mangkurat University in Banjarbaru from March – October 2006. The experiments were conducted in three phases, i.e. (1 identification of pathogen, (2 the study of alternative hosts, and (3 the study of incubation periods of the pathogen in the test plants. Results showed that the diplodia disease of citrus “Siam Banjar” was caused by a fungus of the genus Botryodiplodia theobromae.  The pathogen can also  infected chasew  and avocado plants.  The Incubation periods of the pathogen in citrus, chasew, and avocado were  64, 39 and 39 days, respectively.

  4. EFFISIENSI INHIBISI KOROSI BAJA LUNAK DALAM MEDIA ASAM DENGAN INHIBITOR EKSTRAK KULIT BUAH KAKAO (Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Yuli Yetri

    2016-11-01

    Full Text Available Efek inhibisi korosi dan sifat-sifat adsorpsi oleh ekstrak kulit buah kakao (Theobroma cacao  pada baja lunak (mild steel dalam larutan asam 1,5M HCl telah dipelajari menggunakan teknik konvensional metode berat hilang pada variasi waktu, konsentrasi dan suhu. Parameter-parameter termodinamika seperti energi aktivasi, entalpi, entropi dan perubahan energi bebas dihitung. Polarisasi elektrokimia telah dievaluasi untuk memastikan jenis inhibitor. Spektra infrared dan GCMS dilakukan untuk mengetahui senyawa ekstrak yang berperan  dalam proses inhibisi. Morfologi permukaan sampel diamati dengan menggunakan scanning electro microscopy dengan  energy dispersive X-ray spectroscopy (SEM-EDX . Keseluruhan hasil penelitian menunjukkan bahwa ekstrak polar kulit buah coklat  dapat digunakan sebagai inhibitor korosi yang efektif pada baja karbon di lingkungan 1,5M HCl dengan pencapaian efisiensi  inhibisi   terkorosi sebesar 96.26% (weight loss dan 92.08% (Tafel pada konsentrasi ekstrak 2,5% selama768 jam. Mekanisme inhibisi adalah  adsorpsi chemiadsorpsi berdasar tingginya nilai entalpi dan energi bebas.Effisiensi Inhibisi diketahui meningkat dengan peningkatan konsentrasi dari ekstrak serta menurun dengan peningkatan suhu. Kurva polarisasi menunjukkan inhibitor ini berperilaku sebagai inhibitor campuran dengan dominan pada inhibisi katodik. Ekstrak diadsorpsi oleh permukaan mild steel  mengikuti model adsorpsi isotherm Langmuir. Kondisi permukaan mild steel menunjukan terjadinya adsorpsi di permukaan membentuk lapisan tipis di permukaan logam. Penambahan ekstrak kulit buah kakao ke dalam larutan HCl sangat efektif untuk mengurangi serangan korosi di permukaan mild steel.  Kata kunci: Korosi, Inhibitor, Theobroma cacao, Mild steel, Potensiodinamik Corrosion Inhibition Efficiency Mild Steel in Acid Media with Inhibitor Peels Extract of Cacao (Theobroma cacaoABSTRACT Inhibition and adsorption properties of Theobroma cacao peel polar extract

  5. Antioxidant effects of an ozonized theobroma oil formulation on damaged-inflammatory rat skin

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Y.; Diaz, M.F.; Hernandez, F.; Gila, D.; Ga, G.

    2011-07-01

    The aim of this study was to determine whether a cosmetic formulation elaborated with ozonized theobroma oil may exert beneficial effects in the restoring of the antioxidant activity on the skin of rats previously irradiated with ultraviolet light. 0.5 g of the formulation was applied on the skin of rats for five days. Superoxide dismutase (SOD), glutathione peroxidase (GPx) and catalase (CAT) activity were determined in a homogenate of rat skin. Malondialdehyde (MDA), conjugated dienes (CD) and total hydroperoxide (THP) content were determined as biomarkers of oxidative stress. Using these parameters, antioxidant and oxidant activity, redox index and oxidative stress grade were determined. The total antioxidant activity was significantly increased while the redox index, total oxidant activity and oxidative stress grade decreased significantly in damaged rats treated with the formulation. These results show the antioxidant properties of the cosmetic formulation due to the stimulation of antioxidant enzymes such as SOD and GPx, preventing skin injury induced by ultraviolet irradiation. (Author).

  6. Heavy metal concentrations in cocoa beans (Theobroma cacao L.) originating from East Luwu, South Sulawesi, Indonesia

    Science.gov (United States)

    Assa, A.; Noor, A.; Yunus, M. R.; Misnawi; Djide, M. N.

    2018-03-01

    Concentrations of some heavy metals (Pb, Cu, Cd, As and Hg) were assessed for cocoa beans (Theobroma cacao L) originating from East Luwu, South Sulawesi, Indonesia after five-day fermentation. Consisting of PB 123, BR 25, and MCC 02 cocoa clones, the spectrophotometric analysis showed that concentrations of Pb, Cd, As and Hg in the cocoa beans over the three clones was below the detection limits of 0.100; 0.050, 0.010 and 0.005 mg/kg. For Cu, they were 19.343; 10.391, and 18.594 mg/kg respectively, but still below the maximum critical levels, established by the European Food Safety Authority (EFSA). Concentrations of those five heavy metals in the bean shells were found to be parallel to those in the cocoa beans, except for Pb.

  7. Optimization of spray drying conditions to microencapsulate cupuassu (Theobroma grandiflorum) seed by-product extract.

    Science.gov (United States)

    da Costa, Russany Silva; Teixeira, Camilo Barroso; Gabbay Alves, Taís Vanessa; Ribeiro-Costa, Roseane M; Casazza, Alessandro A; Aliakbarian, Bahar; Converti, Attilio; Silva Júnior, José O C; Perego, Patrizia

    2018-04-16

    Cupuassu (Theobroma grandiflorum Schum.) is a popular Amazonian fruit because of its intense aroma and nutritional value, whose lipid fraction is alternatively used in cosmetics. To preserve active principles and ensure their controlled release, extract was microencapsulated by spray drying. Influence of spray-drying conditions on microencapsulation of cupuassu seed by-product extract was investigated according to a 3 3 -Box Behnken factorial design, selecting inlet temperature, maltodextrin concentration and feed flowrate as independent variables, and total polyphenol and flavonoid contents, antiradical power, yields of drying and microencapsulation as responses. Fitting the results by second-order equations and modelling by Response Surface Methodology allowed predicting optimum conditions. Epicatechin and glycosylated quercetin were the major microencapsulated flavonoids. Microparticles showed satisfactory antiradical power and stability at 5 °C or under simulated gastrointestinal conditions, thus they may be used to formulate new foods or pharmaceuticals.

  8. Molecular characterisation of fungal endophytic morphospecies associated with the indigenous forest tree, Theobroma gileri, in Ecuador.

    Science.gov (United States)

    Thomas, Sarah E; Crozier, Jayne; Catherine Aime, M; Evans, Harry C; Holmes, Keith A

    2008-07-01

    Fungal endophytes were isolated from healthy stems and pods of Theobroma gileri, an alternative host of the frosty pod rot pathogen of cacao. Non-sporulating isolates were grouped into 46 different morphological species according to their colony morphology. Many of these morphospecies were assumed to be basidiomycetes and, therefore, were of particular interest. Basidiomycetous endophytes have received far less attention than ascomycetes and also have potential as biological control agents of the basidiomycetous pathogens of T. cacao: Moniliophthora roreri (frosty pod rot pathogen) and M. perniciosa (witches' broom disease). The morphospecies were further characterised by molecular analyses. Amplification of the nuLSU was undertaken for phylogenetic placement of these non-sporulating cultures and revealed a total of 31 different taxa of which 15 were basidiomycetes belonging to the class Agaricomycetes, and 16 ascomycetes primarily belonging to the Sordariomycetes.

  9. Theobroma cacao: Review of the Extraction, Isolation, and Bioassay of Its Potential Anti-cancer Compounds

    Science.gov (United States)

    Baharum, Zainal; Akim, Abdah Md; Hin, Taufiq Yap Yun; Hamid, Roslida Abdul; Kasran, Rosmin

    2016-01-01

    Plants have been a good source of therapeutic agents for thousands of years; an impressive number of modern drugs used for treating human diseases are derived from natural sources. The Theobroma cacao tree, or cocoa, has recently garnered increasing attention and become the subject of research due to its antioxidant properties, which are related to potential anti-cancer effects. In the past few years, identifying and developing active compounds or extracts from the cocoa bean that might exert anti-cancer effects have become an important area of health- and biomedicine-related research. This review provides an updated overview of T. cacao in terms of its potential anti-cancer compounds and their extraction, in vitro bioassay, purification, and identification. This article also discusses the advantages and disadvantages of the techniques described and reviews the processes for future perspectives of analytical methods from the viewpoint of anti-cancer compound discovery. PMID:27019680

  10. Molecular characterization of 93 genotypes of cocoa (Theobroma cacao L. with random amplified microsatellites RAMs

    Directory of Open Access Journals (Sweden)

    Yacenia Morillo C.

    2014-12-01

    Full Text Available Random amplified microsatellite (RAMs markers six were used to characterize 93 genotypes of cocoa in Tumaco (Colombia. Hundred twenty seven bands were generated. The number of polymorphic loci varied between 11 and 25 for the AG and TG primers, respectively. This study differentiated the 93 genotypes into six groups with a 0.53 similarity, 0.28 mean heterozygosity (He for the population, and 0.12±0.02 genetic differentiation coefficient or Fst. A significant level of genetic diversity was evident in the T. cacao genotypes. This resource would benefit selection programs of individual trees or plant breeding programs. The genotypes clustered in a large proportion in accordance with the collection zone. This characteristic was associated with collection zones and along the rivers in the municipality of Tumaco. The RAM technique proved to be a useful tool for the determination of genetic diversity in Theobroma species.

  11. Characterization of the Proteome of Theobroma cacao Beans by Nano-UHPLC-ESI MS/MS.

    Science.gov (United States)

    Scollo, Emanuele; Neville, David; Oruna-Concha, M Jose; Trotin, Martine; Cramer, Rainer

    2018-02-01

    Cocoa seed storage proteins play an important role in flavour development as aroma precursors are formed from their degradation during fermentation. Major proteins in the beans of Theobroma cacao are the storage proteins belonging to the vicilin and albumin classes. Although both these classes of proteins have been extensively characterized, there is still limited information on the expression and abundance of other proteins present in cocoa beans. This work is the first attempt to characterize the whole cocoa bean proteome by nano-UHPLC-ESI MS/MS analysis using tryptic digests of cocoa bean protein extracts. The results of this analysis show that >1000 proteins could be identified using a species-specific Theobroma cacao database. The majority of the identified proteins were involved with metabolism and energy. Additionally, a significant number of the identified proteins were linked to protein synthesis and processing. Several proteins were also involved with plant response to stress conditions and defence. Albumin and vicilin storage proteins showed the highest intensity values among all detected proteins, although only seven entries were identified as storage proteins. A comparison of MS/MS data searches carried out against larger non-specific databases confirmed that using a species-specific database can increase the number of identified proteins, and at the same time reduce the number of false positives. The results of this work will be useful in developing tools that can allow the comparison of the proteomic profile of cocoa beans from different genotypes and geographic origins. Data are available via ProteomeXchange with identifier PXD005586. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. The Age of Chocolate: a biogeographic history of Theobroma and Malvaceae

    Directory of Open Access Journals (Sweden)

    James Edward Richardson

    2015-11-01

    Full Text Available Dated molecular phylogenies of broadly distributed lineages can help to compare patterns of diversification in different parts of the world. An explanation for greater Neotropical diversity compared to other parts of the tropics is that it was an accident of the Andean orogeny. Using dated phylogenies, of chloroplast ndhF and nuclear DNA WRKY sequence datasets, generated using BEAST we demonstrate that the diversification of the genera Theobroma and Herrania occurred from 12.7 (11.6-14.9 [95% HPD] million years ago (Ma and thus coincided with Andean uplift from the mid-Miocene and that this lineage had a faster diversification rate than other major clades in Malvaceae. We also demonstrate that Theobroma cacao, the source of chocolate, diverged from its most recent common ancestor 9.9 (7.7-12.9 95% HPD Ma, in the mid-to late-Miocene, suggesting that this economically important species has had ample time to generate significant within-species genetic diversity that is useful information for a developing chocolate industry. In addition, we address questions related to the latitudinal gradient in species diversity within Malvaceae. A faster diversification rate is an explanation for the greater species diversity at lower latitudes. Alternatively, tropical conditions may have existed for longer and occupied greater areas than temperate ones meaning that tropical lineages have had more time and space in which to diversify. Our dated molecular phylogeny of Malvaceae demonstrated that at least one temperate lineage within the family diverged from tropical ancestors then diversified at a rate comparable with many tropical lineages in the family. These results are consistent with the hypothesis that Malvaceae are more species rich in the tropics because tropical lineages within the family have existed for longer and occupied more space than temperate ones, and not because of differences in diversification rate.

  13. Insight into the Wild Origin, Migration and Domestication History of the Fine Flavour Nacional Theobroma cacao L. Variety from Ecuador

    OpenAIRE

    Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire

    2012-01-01

    Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative ...

  14. Theobroma cacao

    Indian Academy of Sciences (India)

    Although, several paralogous genes encoding different isozymes of Sus have been identified and characterized in multiple plant genomes, to date detailed information about the Sus genes is lacking for cacao. This study reports the identification of six novel Sus genes from economically important cacao tree. Analyses of the ...

  15. THEOBROMA CACAO

    African Journals Online (AJOL)

    Mimi

    Protein, reducing sugars, non-reducing sugars and total sugars decreased significantly .... The principal factors .... Statgraphics software version 3.0 (STSC, Inc., Rockville, MD, USA) was used to ..... Cervantes E and ME Jaramillo-Flores Dynamics of volatile and non-volatile ... processes using principal components analysis.

  16. Theobroma cacao

    African Journals Online (AJOL)

    SAM

    2014-07-16

    Jul 16, 2014 ... 1Laboratory of Plant Physiology, Department of Biological Sciences, Higher Teacher's Training College. P. O. Box 47. Yaounde .... ground material was centrifuged at 6000 g for 20 min. The ..... Coffee, cocoa, tea. 20:97-115.

  17. A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6.

    Science.gov (United States)

    Saski, Christopher A; Feltus, Frank A; Staton, Margaret E; Blackmon, Barbara P; Ficklin, Stephen P; Kuhn, David N; Schnell, Raymond J; Shapiro, Howard; Motamayor, Juan Carlos

    2011-08-16

    The fermented dried seeds of Theobroma cacao (cacao tree) are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS) II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105) span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map assembly. A comparison between the two T. cacao

  18. Identification of yeasts Isolated from processed and frozen cocoa (Theobroma cacao pulp for wine production

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Trindade

    1999-01-01

    Full Text Available The alternative use of cocoa (Theobroma cacao for wine production was tested. The pulp samples, obtained from Formosa farm, Itacaré, Brazil, were diluted, homogenized and inoculated on Sabouraud dextrose agar medium (SDA and incubated at 28º C for 5-8 days. Selected colonies were tested for the ability to ferment cocoa pulp and divided into fermentative, non-fermentative and weak/late fermentative species. Isolates characterized as fermentative were further tested in a small-scale wine production plant and identified. Species from the genus Brettanomyces constituted the main fermentative yeasts, with the exception of two Kloeckera apis samples. The final wine product was normally pale or clear, making clarification unnecessary, and with a sweet or dry pleasant flavor. The predominance of Brettanomyces species in cocoa pulp indicated its ecological importance in this environment and pointed to an active role of Brettanomyces in the deterioration process of the processed cocoa pulp.O uso alternativo de cacau (Theobroma cacao para produção de vinho foi testado. A polpa de cacau foi obtida da Fazenda Formosa, Itacaré, Brasil. As amostras de polpa foram diluídas, homogeneizadas e inoculadas em meio de Sabouraud dextrose e incubadas a 28°C por 5-8 dias. Colônias selecionadas foram testadas quanto à habilidade de fermentar a polpa de cacau e divididas em fermentadoras, não-fermentadoras e fermentadoras lentas. As amostras fermentadoras foram identificadas e testadas para produção de vinho de cacau em escala piloto. A maioria das amostras fermentadoras pertencem ao gênero Brettanomyces, com exceção de duas amostras de Kloeckera apis. O vinho obtido apresentou coloração fraca e clara, tornando a clarificação desnecessária, além de sabor doce e agradável. A predominância de espécies de Brettanomyces na polpa de cacau poderia indicar sua importância ecológica neste ambiente e sugere uma participação ativa dessas leveduras nos

  19. A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6

    Directory of Open Access Journals (Sweden)

    Kuhn David N

    2011-08-01

    Full Text Available Abstract Background The fermented dried seeds of Theobroma cacao (cacao tree are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Results Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105 span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map

  20. Desenvolvimento inicial de plântulas de Theobroma grandiflorum (Willd. ex Spreng. Schum. sob influência de sombreamento Initial development of Theobroma grandiflorum (Willd. ex Spreng. Schum. saplings under shading influence

    Directory of Open Access Journals (Sweden)

    Rubens Ribeiro da Silva

    2007-01-01

    Full Text Available O presente estudo foi conduzido com o objetivo de avaliar o comportamento inicial de plântulas de Theobroma grandiflorum (Willd. ex Spreng. Schum. (cupuaçu, em função de diferentes níveis de sombreamento. Ao final de 50 dias, após a emergência, as plântulas de cupuaçu foram submetidas a três níveis de sombreamento, sendo: 0% de sombreamento, 50% de sombreamento e Sombra Natural. O crescimento das mudas foi conduzido em delineamento de blocos casualizados, com 15 repetições, sendo cada planta considerada como uma repetição. Foram avaliados a altura, o diâmetro e o número de folhas aos 60, 82, 103, 124, 145 dias após a emergência das plântulas. A Massa Seca de Folhas (MSF, Massa Seca do Caule (MSC, Massa Seca da Raiz (MSR e Massa Seca Total (MST, Relação parte aérea/raiz (PA/R e relação Altura da planta/Diâmetro do colo (A/D, foram avaliadas no final do experimento. O crescimento inicial de Theobroma grandiflorum foi corroborado com os padrões da espécie, que ocorre no interior das matas primárias, tendo melhor desenvolvimento dos parâmetros avaliados em condições de 50% de sombreamento. A condição de 50% de sombreamento pode ser recomendada para a formação de mudas de Theobroma grandiflorum, devido o seu melhor desempenho em altura, diâmetro, número de folhas e alocação de massa nas partes da planta.The objective of this work was to evaluate the initial growth of sapling of Theobroma grandiflorum (cupuaçú, in function of different levels of solar radiation. Fifty days, after the emergency, the saplings were submitted to three levels of shade, being: 0%, 50% and natural shade. Sapling development was carried out in randomized block design with 15 repetitions (15 saplings. The sapling height, lap diameter and the numbers of leaves being evaluated on the 60st, 82nd, 103rd, 124th, 145 days after sapling emergence. The Dry Mass of the leaves (DML, Dry Mass of the stem (DMS, Dry Mass of the root (DMR and Dry

  1. Caracterización molecular de un banco de germoplasma del género Theobroma mediante la técnica RAPD* Molecular characterisation of a germplasm bank for Theobroma genus using the RAPD technique

    Directory of Open Access Journals (Sweden)

    Quintero Lorena

    2004-12-01

    Full Text Available Mediante la utilización de marcadores RAPD (Random Amplified Polymorphic DNA, se analizaron 145 materiales (128 de T. grandiflorum y 17 de T. bicolor pertenecientes al banco de germoplasma ex situ del género Theobroma del Instituto Sinchi, localizado en San José del Guaviare. A partir de un número inicial de 20, se seleccionaron los 5 cebadores capaces de generar mayor número de polimorfismos para generar 114 bandas que lograron distinguir entre más del 99% de los materiales analizados: 57 bandas para T. grandiflorum (84,2% polimórficas, 45 bandas para T. bicolor (26,7% polimórficas y 12 bandas compartidas entre las dos especies (58,3% polimórficas. A partir de la matriz de semejanza generada utilizando el índice de Dice, representada en un dendrograma UPGMA, y el análisis de componentes principales, se determinó un alto grado de semejanza intraespecífica en los materiales analizados, particularmente en T. bicolor. Luego de comparar este análisis con el morfoagronómico previamente realizado en algunos materiales de T. grandiflorum, se encontró que los grupos generados por dicha evaluación morfológica y agronómica son heterogéneos a nivel molecular. La información obtenida se utilizará como herramienta para la toma de decisiones en cuanto a las estrategias de mantenimiento, enriquecimiento y uso del banco. Palabras clave: Theobroma grandiflorum, Theobroma bicolor, RAPD, caracterización molecular.RAPD markers (Random Amplified Polymorphic DNA were used for analysing 145 individuals (128 T. grandiflorum and 17 T. bicolor from the ex situ Theobroma genus germplasm bank at Instituto Sinchi, located at San José del Guaviare. 5 primers able to generated polymorphism were selected from an initial set of 20, generating 114 bands that enable to us to distinguish between more than 99% of individuals analysed: 57 bands for T. grandiflorum (84.2% polymorphic, 45 bands for T. bicolor (26.7% polymorphic and 12 bands shared between

  2. Gene flow and genetic diversity in cultivated and wild cacao (Theobroma cacao) in Bolivia.

    Science.gov (United States)

    Chumacero de Schawe, Claudia; Durka, Walter; Tscharntke, Teja; Hensen, Isabell; Kessler, Michael

    2013-11-01

    The role of pollen flow within and between cultivated and wild tropical crop species is little known. To study the pollen flow of cacao, we estimated the degree of self-pollination and pollen dispersal distances as well as gene flow between wild and cultivated cacao (Theobroma cacao L.). We studied pollen flow and genetic diversity of cultivated and wild cacao populations by genotyping 143 wild and 86 cultivated mature plants and 374 seedlings raised from 19 wild and 25 cultivated trees at nine microsatellite loci. A principal component analysis distinguished wild and cultivated cacao trees, supporting the notion that Bolivia harbors truly wild cacao populations. Cultivated cacao had a higher level of genetic diversity than wild cacao, presumably reflecting the varied origin of cultivated plants. Both cacao types had high outcrossing rates, but the paternity analysis revealed 7-14% self-pollination in wild and cultivated cacao. Despite the tiny size of the pollinators, pollen was transported distances up to 3 km; wild cacao showed longer distances (mean = 922 m) than cultivated cacao (826 m). Our data revealed that 16-20% of pollination events occurred between cultivated and wild populations. We found evidence of self-pollination in both wild and cultivated cacao. Pollination distances are larger than those typically reported in tropical understory tree species. The relatively high pollen exchange from cultivated to wild cacao compromises genetic identity of wild populations, calling for the protection of extensive natural forest tracts to protect wild cacao in Bolivia.

  3. Modified pectin from Theobroma cacao induces potent pro-inflammatory activity in murine peritoneal macrophage.

    Science.gov (United States)

    Amorim, Juliana C; Vriesmann, Lucia Cristina; Petkowicz, Carmen L O; Martinez, Glaucia Regina; Noleto, Guilhermina R

    2016-11-01

    In vitro effects of acetylated pectin (OP) isolated from cacao pod husks (Theobroma cacao L.), its partially deacetylated and de-esterified form (MOP), and a commercial homogalacturonan (PG) were investigated on murine peritoneal macrophages. MOP stood out among the studied pectins. After 48h of incubation, compared with the control group, it was able to promote significant macrophage morphological differentiation from resident to activated stage and also stimulated nitric oxide production, which reached a level of 85% of that of LPS stimulus. In the presence of the highest tested concentration of MOP (200μg·mL -1 ), the levels of the cytokines TNF-α (6h) and IL-12 and IL-10 (48h) increased substantially in relation to untreated cells. Our results show that the partial deacetylation and de-esterification of pectin extracted from cacao pod husks (T. cacao L.) produced a polymer with greater ability than its native form to activate macrophages to a cytotoxic phenotype. Like this, they provide the possibility of a therapeutic application to MOP, which could lead to a decreased susceptibility to microbial infection besides antitumor activity. Additionally, the present results also corroborate with the proposition of that the chemical modifications of the biopolymers can result in an improved molecule with new possibilities of application. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Diversity of chloroplast genome among local clones of cocoa (Theobroma cacao, L.) from Central Sulawesi

    Science.gov (United States)

    Suwastika, I. Nengah; Pakawaru, Nurul Aisyah; Rifka, Rahmansyah, Muslimin, Ishizaki, Yoko; Cruz, André Freire; Basri, Zainuddin; Shiina, Takashi

    2017-02-01

    Chloroplast genomes typically range in size from 120 to 170 kilo base pairs (kb), which relatively conserved among plant species. Recent evaluation on several species, certain unique regions showed high variability which can be utilized in the phylogenetic analysis. Many fragments of coding regions, introns, and intergenic spacers, such as atpB-rbcL, ndhF, rbcL, rpl16, trnH-psbA, trnL-F, trnS-G, etc., have been used for phylogenetic reconstructions at various taxonomic levels. Based on that status, we would like to analysis the diversity of chloroplast genome within species of local cacao (Theobroma cacao L.) from Central Sulawesi. Our recent data showed, there were more than 20 clones from local farming in Central Sulawesi, and it can be detected based on phenotypic and nuclear-genome-based characterization (RAPD- Random Amplified Polymorphic DNA and SSR- Simple Sequences Repeat) markers. In developing DNA marker for this local cacao, here we also included analysis based on the variation of chloroplast genome. At least several regions such as rpl32-TurnL, it can be considered as chloroplast markers on our local clone of cocoa. Furthermore, we could develop phylogenetic analysis in between clones of cocoa.

  5. Mutation breeding against black pod (Phytophthora pod rot) disease of cacao (Theobroma cacao)

    International Nuclear Information System (INIS)

    Opeke, L.K.

    1977-01-01

    Black pod rot disease, caused by Phytophthora palmivora, is an important disease of cacao (Theobroma cacao L.) in Nigeria and other cacao producing countries of West Africa and Latin America. A naturally occurring source of genetic resistance to the disease has not been found. This paper completes the report, the first part of which was published in Induced Mutations in Vegetatively Propagated Plants, IAEA, Vienna (1973). The survivors of the irradiated seedlings reported on in this publication were transplanted to the field along with their controls. When the Phytophthora pod disease season began in 1973, all experimental plants along with the controls were sprayed with active and freshly prepared dense sporangial suspension of P. palmivora. Observations on Phytophthora infection were recorded at two-weekly intervals for three months. Results were pooled for each set of experimental plants, after having confirmed that no marked difference appeared among individual plants of each group. Contrary to the observations recorded at the nursery stage, all experimental plants that showed no infection indicated disease infection levels normally characteristic of the F 3 Amazon cultivar of Cacao in Nigeria. Although the nursery and the field data are difficult to reconcile and interpret, it is suggested that probably temporary disease tolerance/resistance, which some irradiated plants showed at the nursery (seedling) stage, was lost as the plants matured, thus suggesting different resistance factor systems for juvenile and mature cacao trees. (author)

  6. Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.

    Science.gov (United States)

    Livingstone, Donald; Royaert, Stefan; Stack, Conrad; Mockaitis, Keithanne; May, Greg; Farmer, Andrew; Saski, Christopher; Schnell, Ray; Kuhn, David; Motamayor, Juan Carlos

    2015-08-01

    Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ∼4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification project was undertaken using RNAseq data from 16 diverse cacao cultivars. RNA sequences were aligned to the assembled transcriptome of the cultivar Matina 1-6, and 330,000 SNPs within coding regions were identified. From these SNPs, a subset of 6,000 high-quality SNPs were selected for inclusion on an Illumina Infinium SNP array: the Cacao6kSNP array. Using Cacao6KSNP array data from over 1,000 cacao samples, we demonstrate that our custom array produces a saturated genetic map and can be used to distinguish among even closely related genotypes. Our study enhances and expands the genetic resources available to the cacao research community, and provides the genome-scale set of tools that are critical for advancing breeding with molecular markers in an agricultural species with high genetic diversity. © The Author 2015. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.

  7. Comparative evaluation of total RNA extraction methods in Theobroma cacao using shoot apical meristems.

    Science.gov (United States)

    Silva, D V; Branco, S M J; Holanda, I S A; Royaert, S; Motamayor, J C; Marelli, J P; Corrêa, R X

    2016-03-04

    Theobroma cacao is a species of great economic importance with its beans used for chocolate production. The tree has been a target of various molecular studies. It contains many polyphenols, which complicate the extraction of nucleic acids with the extraction protocols requiring a large amount of plant material. These issues, therefore, necessitate the optimization of the protocols. The aim of the present study was to evaluate different methods for extraction of total RNA from shoot apical meristems of T. cacao 'CCN 51' and to assess the influence of storage conditions for the meristems on the extraction. The study also aimed to identify the most efficient protocol for RNA extraction using a small amount of plant material. Four different protocols were evaluated for RNA extraction using one shoot apical meristem per sample. Among these protocols, one that was more efficient was then tested to extract RNA using four different numbers of shoot apical meristems, subjected to three different storage conditions. The best protocol was tested for cDNA amplification using reverse transcription-polymerase chain reaction; the cDNA quality was determined to be satisfactory for molecular analyses. The study revealed that with the best RNA extraction protocol, one shoot apical meristem was sufficient for extraction of high-quality total RNA. The results obtained might enable advances in genetic analyses and molecular studies using reduced amount of plant material.

  8. In vitro antioxidant and antiproliferative activities of methanolic plant part extracts of Theobroma cacao.

    Science.gov (United States)

    Baharum, Zainal; Akim, Abdah Md; Taufiq-Yap, Yun Hin; Hamid, Roslida Abdul; Kasran, Rosmin

    2014-11-10

    The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH), thiobarbituric acid-reactive substances (TBARS), and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT) assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50) was 358.3±7.0 µg/mL and total phenolic content was 22.0±1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4%±1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50)=41.4±3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.

  9. In Vitro Antioxidant and Antiproliferative Activities of Methanolic Plant Part Extracts of Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Zainal Baharum

    2014-11-01

    Full Text Available The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH, thiobarbituric acid-reactive substances (TBARS, and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50 was 358.3 ± 7.0 µg/mL and total phenolic content was 22.0 ± 1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4% ± 1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50 = 41.4 ± 3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.

  10. Progressive erosion of genetic and epigenetic variation in callus-derived cocoa (Theobroma cacao) plants.

    Science.gov (United States)

    Rodríguez López, Carlos M; Wetten, Andrew C; Wilkinson, Michael J

    2010-06-01

    *Relatively little is known about the timing of genetic and epigenetic forms of somaclonal variation arising from callus growth. We surveyed for both types of change in cocoa (Theobroma cacao) plants regenerated from calli of various ages, and also between tissues from the source trees. *For genetic change, we used 15 single sequence repeat (SSR) markers from four source trees and from 233 regenerated plants. For epigenetic change, we used 386 methylation-sensitive amplified polymorphism (MSAP) markers on leaf and explant (staminode) DNA from two source trees and on leaf DNA from 114 regenerants. *Genetic variation within source trees was limited to one slippage mutation in one leaf. Regenerants were far more variable, with 35% exhibiting at least one mutation. Genetic variation initially accumulated with culture age but subsequently declined. MSAP (epigenetic) profiles diverged between leaf and staminode samples from source trees. Multivariate analysis revealed that leaves from regenerants occupied intermediate eigenspace between leaves and staminodes of source plants but became progressively more similar to source tree leaves with culture age. *Statistical analysis confirmed this rather counterintuitive finding that leaves of 'late regenerants' exhibited significantly less genetic and epigenetic divergence from source leaves than those exposed to short periods of callus growth.

  11. Mating system in a natural population of Theobroma grandiflorum (Willd. ex Spreng. Schum., by microsatellite markers

    Directory of Open Access Journals (Sweden)

    Alves Rafael M.

    2003-01-01

    Full Text Available The aim of this research was to study the mating system of a natural population of Theobroma grandiflorum (cupuassu from Nova Ipixuna, Pará state, using microsatellite markers. Eight polymorphic microsatellite loci were analyzed in eight families, each represented by 10 six-month old seedlings derived from open-pollinated pods. The estimation for the multilocus outcrossing rate (m = 1.0 and individual outcrossing rate ( = 1.0 for this population suggests that T. grandiflorum may be a perfect outbreeding (allogamous species. Likewise, for the studied population the estimate for single locus outcrossing rate (S was elevated (0.946, but lower than m, confirming the likely outcrossing character of the species and suggesting the occurrence of 5.4% biparental inbreeding rate (m - S. The estimation of genetic divergence (st between allelic frequencies in ovules and pollen revealed a deviation from random mating in 75% of the evaluated loci. Likewise, the estimate of correlation of paternity (P = 0.930 and the mean coefficient of co-ancestrality within families (XY = 0.501 indicated that the outcrossings were predominantly correlated, and the offspring were full-sibs. These results suggested that for this particular population of T. grandiflorum, the sampling strategy for genetic conservation and breeding should adopt specific models for families derived from correlated outcrossing (full-sibs and not the ones usually adopted in classic outcrossing species breeding programs (half-sibs.

  12. Karyotype variation in cultivars and spontaneous cocoa mutants (Theobroma cacao L.).

    Science.gov (United States)

    Figueiredo, G S F; Melo, C A F; Souza, M M; Araújo, I S; Zaidan, H A; Pires, J L; Ahnert, D

    2013-10-18

    Four mutant cocoa accessions with morphological changes and a cultivar sample were karyomorphologically characterized. Slides were prepared by enzymatic digestion of the root meristem and squashed in 45% acetic acid, followed by 2% Giemsa staining. The chromosome number of 2n = 20 was seen in all accessions. The karyotype formula for Cacau Comum and Cacau Rui was 2n = 20m. Submetacentric chromosomes were observed in Cacau Pucala and Cacau Jaca, both with 2n = 18m + 2sm, but the karyotype formula for Cacau Sem Vidro was 2n = 16m + 4sm. Satellites were located on the long arm of the 1st and 2nd chromosome pairs of Cacau Comum, whereas Cacau Pucala had satellites on the 6th chromosome pair. Greater karyotypic variation in Cacau Sem Vidro was found, whose 1st and 2nd chromosome pairs had satellites on the long arm and 6th and 10th pairs had satellites on the short arm. Analysis revealed a lower average chromosome length in Cacau Comum (1.53 ± 0.026 µm) and a higher length in Cacau Sem Vidro (2.26 ± 0.038 µm). ANOVA revealed significant difference (P Theobroma cacao.

  13. Microencapsulation of Theobroma cacao L. waste extract: optimization using response surface methodology.

    Science.gov (United States)

    Gabbay Alves, Taís Vanessa; Silva da Costa, Russany; Aliakbarian, Bahar; Casazza, Alessandro Alberto; Perego, Patrizia; Carréra Silva Júnior, José Otávio; Ribeiro Costa, Roseane Maria; Converti, Attilio

    2017-03-01

    The cocoa extract (Theobroma cacao L.) has a significant amount of polyphenols (TP) with potent antioxidant activity (AA). This study aims to optimise microencapsulation of the extract of cocoa waste using chitosan and maltodextrin. Microencapsulation tests were performed according to a Box-Behnken factorial design, and the results were evaluated by response surface methodology with temperature, maltodextrin concentration (MD) and extract flowrate (EF) as independent variables, and the fraction of encapsulated TP, TP encapsulation yield, AA, yield of drying and solubility index as responses. The optimum conditions were: inlet temperature of 170 °C, MD of 5% and EF of 2.5 mL/min. HPLC analysis identified epicatechin as the major component of both the extract and microparticles. TP release was faster at pH 3.5 than in water. These results as a whole suggest that microencapsulation was successful and the final product can be used as a nutrient source for aquatic animal feed. Highlights Microencapsulation is optimised according to a factorial design of the Box-Behnken type. Epicatechin is the major component of both the extract and microcapsules. The release of polyphenols from microcapsules is faster at pH 3.5 than in water.

  14. Pengaruh Kadar Air dan Persamaan Model Bet untuk Prediksi Masa Simpan Kakao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Rita Hayati

    2017-04-01

    Full Text Available Effect of moisture content and BET equation to the shelf life of cocoa (Theobroma cacao L. has been conducted. Increasing the quality of cocoa beans is with proper post-harvest handling, including how the harvest, the level of ripeness, curing, fermenting, drying up storage. The purpose of this study was to determine the water content and the appropriate levels of critical in determining the shelf life of cocoa. The benefits of this research are as information for farmers in determining the shelf life of cocoa in order to design a storage area corresponding to the respiratory system owned by cocoa. The results showed that the effect of fermentation facilitator (Staphilococcus cerevisiae and drying temperature on water content showed that the fermentation facilitator (Staphilococcus cerevisiae highly significant effect on water content. The drying temperature is also highly significant effect on water content. BET equation obtained was Y = 2,912x + 1.238 (R2 = 0.965, Y = 2,897x + 1.353 (R2 = 0.968 and Y = 2,806x + 1.89 (R2 = 0.954.

  15. Confocal observations of late-acting self-incompatibility in Theobroma cacao L.

    Science.gov (United States)

    Ford, Caroline S; Wilkinson, Mike J

    2012-09-01

    Cocoa (Theobroma cacao) has an idiosyncratic form of late-acting self-incompatibility that operates through the non-fusion of incompatible gametes. Here, we used high-resolution confocal microscopy to define fine level changes to the embryo sac of the strongly self-incompatible cocoa genotype SCA 24 in the absence of pollination, and following compatible and incompatible pollination. All sperm nuclei had fused with the female nuclei by 48 h following compatible pollinations. However, following incompatible pollinations, we observed divergence in the behaviour of sperm nuclei following release into the embryo sac. Incomplete sperm nucleus migration occurred in approximately half of the embryo sacs, where the sperm nuclei had so far failed to reach the female gamete nuclei. Sperm nuclei reached but did not fuse with the female gamete nuclei in the residual cases. We argue that the cellular mechanisms governing sperm nucleus migration to the egg nucleus and those controlling subsequent nuclear fusion are likely to differ and should be considered independently. Accordingly, we recommend that future efforts to characterise the genetic basis of LSI in cocoa should take care to differentiate between these two events, both of which contribute to failed karyogamy. Implications of these results for continuing efforts to gain better understanding of the genetic control of LSI in cocoa are discussed.

  16. Presencia de metales pesados en cultivo de cacao (Theobroma cacao L. orgánico

    Directory of Open Access Journals (Sweden)

    Hugo Alfredo Huamaní-Yupanqui

    2012-12-01

    Full Text Available La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L. es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron análisis de correlación de Pearson entre los contenidos de plomo y cadmio disponibles en el suelo con variables foliares (P, Mg, Ca, Zn, Cd, Pb y del suelo (arena, arcilla y K. En los suelos, sólo en el caso de potasio se presentan deficiencias; mientras que en el tejido foliar se presentaron deficiencias de N, P, K, Mg y Zn. Los valores promedio de cadmio y plomo disponible en los suelos fueron 0.53 y 3.02 ppm y en las hojas de cacao de 0.21 y 0.58 ppm respectivamente.

  17. Management of Chinese Rose Beetle (Adoretus sinicus) Adults Feeding on Cacao (Theobroma cacao) Using Insecticides

    Science.gov (United States)

    Spafford, Helen; Ching, Alexander; Manley, Megan; Hardin, Chelsea; Bittenbender, Harry

    2016-01-01

    The Chinese rose beetle (Adoretus sinicus Burmeister (Coleoptera: Scarabaeidae)) is an introduced, widely-established pest in Hawai’i. The adult beetles feed on the leaves of cacao (Theobroma cacao L.), which can lead to defoliation and even death of young trees. We evaluated the impact of five commercially available products with different active ingredients (imidacloprid, azadirachtin, Beauveria bassiana (Bals.-Criv.) Vuill., kaolin clay, and pyrethrin) and the presence or absence of weed mat cover in reducing adult beetle feeding on sapling cacao in the field. The use of weed mat cover reduced feeding damage compared to the untreated control, as did foliar application of imidacloprid, azadirachtin, and B. bassiana. In the laboratory, field-collected adult beetles were presented cacao leaf samples dipped in one of the five products and compared to a control. Beetles exposed to pyrethrin died rapidly. Among the other treatments, only exposure to imidacloprid significantly reduced survival relative to the control. Beetles fed very little on leaf samples with azadirachtin but their longevity was not significantly reduced. Imidacloprid, azadirachtin, and weed mat application had the most promise for reducing adult Chinese rose beetle feeding damage in young cacao and deserve further investigation for successful management of this significant pest. PMID:27348004

  18. Biosynthesis, accumulation and degradation of theobromine in developing Theobroma cacao fruits.

    Science.gov (United States)

    Zheng, Xin-Qiang; Koyama, Yoko; Nagai, Chifumi; Ashihara, Hiroshi

    2004-04-01

    We have studied the purine alkaloid content and purine metabolism in Theobroma cacao fruits at differing growth stages: Stage A (young small fruit, fresh weight, ca. 2 g); stage B (medium size fruit, fresh weight, ca. 100 g) and stage C (large size, fresh weight, ca. 500 g). The major purine alkaloid in stage A fruits (mainly pericarp) was theobromine (0.7 micromol g(-1) fresh weight), followed by caffeine (0.09 micromol g(-1) fresh weight). The theobromine content of the pericarp decreased sharply with tissue age, and the caffeine content decreased gradually. A large amount of theobromine (22 micromol g(-1) fresh weight) had accumulated in seeds (mainly cotyledons) of stage C fruits. Theobromine was found also in the seed coat and placenta. Tracer experiments with [8-(14)C]adenine show that the major sites of theobromine synthesis are the young pericarp and cotyledons of T. cacao fruits. Limited amounts of purine alkaloids may be transported from the pericarp to seed tissue, but most purine alkaloids that accumulated in seeds appeared to be synthesised in cotyledons. Degradation of [8-(14)C]theobromine and [8-(14)C]caffeine to CO2 via 3-methylxanthine and ureides (allantoin and allantoic acid) was detected only in the pericarp of stage C fruits.

  19. Physiological responses of Theobroma cacao L. to water soil available in nursery stage

    Directory of Open Access Journals (Sweden)

    Jairo Garcia Lozano

    2016-01-01

    Full Text Available In the locality of El Espinal, Tolima, the effect of water stress on leaf water potential and gas exchange of plants three clones of cacao (Theobroma cacao L was evaluated. The experiment was established in a split plot design in randomized block arrangement. The main plot was four levels of available soil water, subplot grafted seedlings to three months of three clones with five repetitions. The results showed highly significant differences (P <0.01 in content of soil water, but no differences between the materials evaluated. The loss of water in the soil decreases leaf water potential (Ψf and causes stomatal closure altering gas exchange and vapor pressure deficit (DPV accentuates mainly at noon with increasing evapotranspiration. The magnitude of impact of water deficit depends on climatic variations throughout the day. The climatic variables that affect plant development, are temperature and relative humidity in the form of DPV. Net photosynthesis and growth of cocoa seedlings are physiological variables very sensitive to excess and especially to water deficit.

  20. A comparison of tissue preparation methods for protein extraction of cocoa (Theobroma cacao L. pod

    Directory of Open Access Journals (Sweden)

    Ascensión Martínez-Márquez

    2017-04-01

    Full Text Available Cocoa, Theobroma cacao L. is one of the main tropical industrial crops. Cocoa has a very high level of interfering substances, such as polysaccharides and phenolic compounds that could prevent the isolation of suitable protein. Efficient methods of protein extraction are a priority to successfully apply proteomic analyses. We compared and evaluated two methods (A and B of tissue preparation for total protein extract by phenol/SDS extraction protocol. The difference in the application of the two methods was that extensively washed dry powder of pod tissue were made in Method A, whereas that crude extract were prepared Method B. Extracted proteins were examined using one-dimensional electrophoresis (1-D. Results show that each extraction method isolated a unique subset of cocoa pod proteome. Principal component analysis showed little variation in the data obtained using Method A, while that in Methods B showed no low reproducibility, thus demonstrating that Method A is a reliable for preparing cocoa pod proteins. The protocol is expected to be applicable to other recalcitrant plant tissues and to be of interest to laboratories involved in plant proteomics analyses. A combination of extraction approaches is recommended for increasing proteome coverage when using gel-based isolation techniques.

  1. Effect of gamma radiation on the growth of botryodiplodia theobromae and on rot development in banana fruits

    International Nuclear Information System (INIS)

    Mostafa, I.Y.; El-Ashmawi, A.M.; Fahim, M.M.; Kararah, M.A.

    1984-01-01

    Radiosensitivity of Botryodiplodia theobromae Pat. increased with the increase in doses of gamma radiation. Young cultures (7 days old) were less sensitive to radiation than old ones (48 days); lethal doses being 800 and 600 Krad respectively. Rot development was greatly reduced when inoculated banana fruits were exposed to 300 Krad. Disease development was checked for 10 days in inoculated fruits exposed to 400 Krad. The combined treatment of 200 p.p.m. T B Z and 100 or 200 Krad gamma radiation was more effective in reducing disease incidence than either treatments alone. No deleterious effects occurred in banana fruits that were irradiated with the low doses of gamma radiation

  2. Trichoderma martiale sp. nov., a new endophyte from sapwood of Theobroma cacao with a potential for biological control.

    Science.gov (United States)

    Hanada, Rogério E; de Jorge Souza, T; Pomella, Alan W V; Hebbar, K Prakash; Pereira, José O; Ismaiel, Adnan; Samuels, Gary J

    2008-11-01

    The new species Trichoderma martiale was isolated as an endophyte from sapwood in trunks of Theobroma cacao (cacao, Malvaceae) in Brazil. Based on sequences of translation-elongation factor 1-alpha (tef1) and RNA polymerase II subunit (rpb2) T. martiale is a close relative of, and morphologically similar to, T. viride, but differs in the production of discrete pustules on corn meal-dextrose agar (CMD) and SNA, in having a faster rate of growth, and in being a tropical endophyte. This new species was shown, in small-scale, in situ field assays, to limit black pod rot of cacao caused by Phytophthora palmivora, the cause of black pod disease.

  3. Dynamic changes in pod and fungal physiology associated with the shift from biotrophy to necrotrophy during the infection of Theobroma cacao by Moniliophthora roreri

    Science.gov (United States)

    Where it occurs in South and Central America, M. roreri (Mr) causes a destructive pod disease (frosty pod rot) on Theobroma cacao (cacao). Hand pollinated cacao pods were inoculated with Mr spores in the field and assessed for disease symptoms over a 90 day period. On average, pods showed symptoms o...

  4. COMPARATIVE GENOME ANALYSES OF MONILIOPHTHORA PERNICIOSA AND MONILIOPHTHORA RORERI: TWO CLOSELY RELATED PHYTOPATHOGENIC BASIDIOMYCETES THAT CAUSE DISTINCTLY DIFFERENT DISEASES OF THEOBROMA CACAO

    Science.gov (United States)

    Theobroma cacao (cacao), the source of chocolate, is a tropical understory tree. Fungal diseases such as Witches’ Broom Disease (WBD) and Frosty Pod Rot Disease (FPRD) of cacao have devastated cacao production in much of the Western Hemisphere and are threats to the main cacao producing regions in A...

  5. Molecular Characterization of Resistant Accessions of Cocoa (Theobroma cocoa L.) to Phytophthora Pod Rot Selected on-Farm in Côte-d’Ivoire.

    Science.gov (United States)

    Cocoa is (Theobroma cacao L.) is a significant agricultural commodity in Côted’Ivoire which ranks 1st in the world cocoa export. Phytophthora pod rot (Ppr)also call Black pod is the most widespread disease of cocoa. Lost due to this disease depends on the species of the pathogen and vary globally fr...

  6. High incidence of preharvest colonization of huanglongbing-symptomatic Citrus sinensis fruit by Lasiodiplodia theobromae (Diplodia natalensis) and exacerbation of postharvest fruit decay by that fungus

    Science.gov (United States)

    Huanglongbing (HLB), presumably caused by bacterium Candidatus Liberibacter asiaticus (CLas), is a devastating citrus disease associated with excessive pre-harvest fruit drop. Lasiodiplodia theobromae (Diplodia) is the causal organism of citrus stem end rot (SER). The pathogen infects citrus fruit ...

  7. Genome analysis methods: Theobroma cacao [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Theobroma cacao ... 2n=20 ... 2011 Sanger (WGS), Roche/454 , Illumina 26 Gb 326 Mb 16.7x... Newbler 4,792 25,912 EUGene following specific training for T. cacao 28,798 CIRAD; http://cocoagendb.cirad.fr Dec2010 Dec2010 10.1038/ng.736 21186351 ...

  8. EFECTO DE UN GEL DE THEOBROMA CACAO EN EL CONTROL DE CARIES VESTIBULAR EN PACIENTES CON TRATAMIENTO DE ORTODONCIA. CONSULTA PRIVADA. AREQUIPA. 2014

    OpenAIRE

    SALAS LINARES, MARY JULISSA

    2015-01-01

    THEOBROMA CACAO GENERALIDADES DESCRIPCIÓN ORIGEN Y EXTENSIÓN CLASIFICACIÓN CIENTÍFICA VARIEDADES DEL CACAO DISTRIBUCIÓN USOS MEDICINALES EFECTO ANTICARIOGÉNICO GEL CARIES DENTAL FACTORES DE RIESGO MICROORGANISMOS IMPLICADOS EN LA CARIES DENTAL CARIES EN EL ESMALTE CLASIFICACIÓN DE LA CARIES MÉTODOS DE DETECCIÓN DE CARIES CRITERIOS ICDAS

  9. Biological Control of Mango Dieback Disease Caused by Lasiodiplodia theobromae Using Streptomycete and Non-streptomycete Actinobacteria in the United Arab Emirates

    Science.gov (United States)

    Kamil, Fatima H.; Saeed, Esam E.; El-Tarabily, Khaled A.; AbuQamar, Synan F.

    2018-01-01

    Dieback caused by the fungus Lasiodiplodia theobromae is an important disease on mango plantations in the United Arab Emirates (UAE). In this study, 53 actinobacterial isolates were obtained from mango rhizosphere soil in the UAE, of which 35 (66%) were classified as streptomycetes (SA) and 18 (34%) as non-streptomycetes (NSA). Among these isolates, 19 (12 SA and 7 NSA) showed antagonistic activities against L. theobromae associated with either the production of diffusible antifungal metabolites, extracellular cell-wall-degrading enzymes (CWDEs), or both. Using a “novel” mango fruit bioassay, all isolates were screened in vivo for their abilities to reduce lesion severity on fruits inoculated with L. theobromae. Three isolates, two belonging to Streptomyces and one to Micromonospora spp., showed the strongest inhibitory effect against this pathogen in vitro and were therefore selected for tests on mango seedlings. Our results revealed that the antifungal action of S. samsunensis UAE1 was related to antibiosis, and the production of CWDEs (i.e., chitinase) and siderophores; whilst S. cavourensis UAE1 and M. tulbaghiae UAE1 were considered to be associated with antibiotic- and CWDE-production, respectively. Pre-inoculation in greenhouse experiments with the most promising actinobacterial isolates resulted in very high levels of disease protection in mango seedlings subsequently inoculated with the pathogen. This was evident by the dramatic reduction in the estimated disease severity indices of the mango dieback of individual biocontrol agent (BCA) applications compared with the pathogen alone, confirming their potential in the management of mango dieback disease. L. theobromae-infected mango seedlings treated with S. samsunensis showed significantly reduced number of defoliated leaves and conidia counts of L. theobromae by 2- and 4-fold, respectively, in comparison to the other two BCA applications. This indicates that the synergistic antifungal effects of S

  10. Soil microorganisms and plant diseases associated to cocoa (Theobroma cacao L. genotypes in the Ecuadorian Amazon

    Directory of Open Access Journals (Sweden)

    Jorge Antonio Freile Almeida

    2018-01-01

    Full Text Available El objetivo de la presente investigación fue analizar la relación de los microorganismos del suelo y las principales enfermedades que afectan los clones promisorios de cacao (Theobroma cacao L. en la Amazonía Ecuatoriana. Se evaluaron los clones EET-95, EET-96, EET-103 y CCN-51, respectivamente, éste último utilizado como control, para ello, se determinó la cantidad de bacterias, hongos y actinomicetos totales, expresados en unidades formadoras de colonias (UFC por gramo de suelo, presentes en la rizósfera de los tres clones de cacao, así como la aparición de las principales enfermedades que atacan al cultivo del cacao. Los datos fueron analizados estadísticamente mediante ANOVA de un factor y prueba HSD de Tukey p≤0,05. Las bacterias fueron los microorganismos de mayor asociación a los clones en este estudio, seguido de actinomicetos y hongos. El clon CCN-51 presentó la mayor cantidad de bacterias, los clones EET-96 y EET-103, presentaron mayor incidencia de actinomicetos y el clon EET-103, la mayor presencia de hongos. La enfermedad escoba de bruja, cuyo agente causal es Cripinellis perniciosa Sthael Singer., afectó en menor medida a los clones EET-103 y CCN-51, mientras que la moniliasis causada por el hongo Moniliophthora roreri (Cif & Par Evans et al., puso en evidencia al clon EET-103 con la mayor incidencia de esta enfermedad y conversivamente al clon CCN-51 con la menor incidencia del patógeno.

  11. Morphological, biochemical, molecular and ultrastructural changes induced by Cd toxicity in seedlings of Theobroma cacao L.

    Science.gov (United States)

    Castro, Andressa V; de Almeida, Alex-Alan F; Pirovani, Carlos P; Reis, Graciele S M; Almeida, Nicolle M; Mangabeira, Pedro A O

    2015-05-01

    Seeds from Theobroma cacao progenies derived from the self-pollination of 'Catongo'×'Catongo' and the crossing between CCN-10×SCA-6 were immersed for 24h in different Cd solutions (2; 4; 8; 16 and 32 mgL(-1)) along with the control treatment (without Cd). Shortly after, the seeds were sown in plastic tubes containing organic substrate and were grown in a greenhouse for 60 days. The treatment with Cd was observed to cause morphological, biochemical, molecular and ultrastructural changes in both progenies of T. cacao. There has been deformation in chloroplasts, nuclear chromatin condensation, and reduction in thickness of the mesophyll. As for 'Catongo'×'Catongo', a decrease in thickness of the epidermis was noted on the abaxial face. There has been increased guaiacol peroxidase activity in the roots of CCN-10×SCA-6, as well as in the''Catongo'×'Catongo' leaves. In the presence of Cd, CCN-10×SCA-6 showed increased expression of the genes associated with the biosynthesis of phytochelatin (PCS-1) and class III peroxidases (PER-1) in leaves, and metallothionein (MT2b), in roots. In 'Catongo'×'Catongo', there has been an increase in the expression of genes associated with the biosynthesis of PER-1 and cytosolic superoxide dismutase dependent on copper and zinc (Cu-Zn SODCyt) in leaves and from MT2b and PCS-1 and roots. There was higher accumulation of Cd in the aerial parts of seedlings from both progenies, whereas the most pronounced accumulation was seen in''Catongo'×'Catongo'. The increase in Cd concentration has led to lower Zn and Fe levels in both progenies. Hence, one may conclude that the different survival strategies used by CCN-10×SCA-6 made such progeny more tolerant to Cd stress when compared to''Catongo'×'Catongo'. Copyright © 2015. Published by Elsevier Inc.

  12. Recombinant β-1,3-1,4-glucanase from Theobroma cacao impairs Moniliophthora perniciosa mycelial growth.

    Science.gov (United States)

    Britto, Dahyana Santos; Pirovani, Carlos Priminho; Andrade, Bruno Silva; Dos Santos, Tassiara Pereira; Pungartnik, Cristina; Cascardo, Júlio Cezar M; Micheli, Fabienne; Gesteira, Abelmon S

    2013-09-01

    In this work, we identified a gene from Theobroma cacao L. genome and cDNA libraries, named TcGlu2, that encodes a β-1,3-1,4-glucanase. The TcGlu2 ORF was 720 bp in length and encoded a polypeptide of 239 amino acids with a molecular mass of 25.58 kDa. TcGlu2 contains a conserved domain characteristic of β-1,3-1,4-glucanases and presented high protein identity with β-1,3-1,4-glucanases from other plant species. Molecular modeling of TcGlu2 showed an active site of 13 amino acids typical of glucanase with β-1,3 and 1,4 action mode. The recombinant cDNA TcGlu2 obtained by heterologous expression in Escherichia coli and whose sequence was confirmed by mass spectrometry, has a molecular mass of about 22 kDa (with His-Tag) and showed antifungal activity against the fungus Moniliophthora perniciosa, causal agent of the witches' broom disease in cacao. The integrity of the hyphae membranes of M. perniciosa, incubated with protein TcGlu2, was analyzed with propidium iodide. After 1 h of incubation, a strong fluorescence emitted by the hyphae indicating the hydrolysis of the membrane by TcGlu2, was observed. To our knowledge, this is the first study of a cacao β-1,3-1,4-glucanase expression in heterologous system and the first analysis showing the antifungal activity of a β-1,3-1,4-glucanase, in particular against M. perniciosa.

  13. TcNPR3 from Theobroma cacao functions as a repressor of the pathogen defense response.

    Science.gov (United States)

    Shi, Zi; Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J

    2013-12-06

    Arabidopsis thaliana (Arabidopsis) NON-EXPRESSOR OF PR1 (NPR1) is a transcription coactivator that plays a central role in regulating the transcriptional response to plant pathogens. Developing flowers of homozygous npr3 mutants are dramatically more resistant to infection by the pathogenic bacterium Pseudomonas syringae, suggesting a role of NPR3 as a repressor of NPR1-mediated defense response with a novel role in flower development. We report here the characterization of a putative NPR3 gene from the tropical tree species Theobroma cacao (TcNPR3). Like in Arabidopsis, TcNPR3 was constitutively expressed across a wide range of tissue types and developmental stages but with some differences in relative levels compared to Arabidopsis. To test the function of TcNPR3, we performed transgenic complementation analysis by introducing a constitutively expressing putative TcNPR3 transgene into an Arabidopsis npr3 mutant. TcNPR3 expressing Arabidopsis plants were partially restored to the WT pathogen phenotype (immature flowers susceptible to bacterial infection). To test TcNPR3 function directly in cacao tissues, a synthetic microRNA targeting TcNPR3 mRNA was transiently expressed in cacao leaves using an Agrobacterium-infiltration method. TcNPR3 knock down leaf tissues were dramatically more resistance to infection with Phytophthora capsici in a leaf bioassay, showing smaller lesion sizes and reduced pathogen replication. We conclude that TcNPR3 functions similar to the Arabidopsis NPR3 gene in the regulation of the cacao defense response. Since TcNPR3 did not show a perfect complementation of the Arabidopsis NPR3 mutation, the possibility remains that other functions of TcNPR3 remain to be found. This novel knowledge can contribute to the breeding of resistant cacao varieties against pathogens through molecular markers based approaches or biotechnological strategies.

  14. Altered physiology, cell structure, and gene expression of Theobroma cacao seedlings subjected to Cu toxicity.

    Science.gov (United States)

    Souza, Vânia L; de Almeida, Alex-Alan F; Souza, Jadiel de S; Mangabeira, Pedro A O; de Jesus, Raildo M; Pirovani, Carlos P; Ahnert, Dário; Baligar, Virupax C; Loguercio, Leandro L

    2014-01-01

    Seedlings of Theobroma cacao CCN 51 genotype were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16, and 32 mg Cu L(-1)) in nutrient solution. When doses were equal or higher than 8 mg Cu L(-1), after 24 h of treatment application, leaf gas exchange was highly affected and changes in chloroplasts thylakoids of leaf mesophyll cells and plasmolysis of cells from the root cortical region were observed. In addition, cell membranes of roots and leaves were damaged. In leaves, 96 h after treatments started, increases in the percentage of electrolyte leakage through membranes were observed with increases of Cu in the nutrient solution. Moreover, there was an increase in the concentration of thiobarbituric acid-reactive substances in roots due to lipid peroxidation of membranes. Chemical analysis showed that increases in Cu concentrations in vegetative organs of T. cacao increased with the increase of the metal in the nutrient solution, but there was a greater accumulation of Cu in roots than in shoots. The excess of Cu interfered in the levels of Mn, Zn, Fe, Mg, K, and Ca in different organs of T. cacao. Analysis of gene expression via RTq-PCR showed increased levels of MT2b, SODCyt, and PER-1 expression in roots and of MT2b, PSBA, PSBO, SODCyt, and SODChI in leaves. Hence, it was concluded that Cu in nutrient solution at doses equal or above 8 mg L(-1) significantly affected leaf gas exchange, cell ultrastructure, and transport of mineral nutrients in seedlings of this T. cacao genotype.

  15. Proanthocyanidin synthesis in Theobroma cacao: genes encoding anthocyanidin synthase, anthocyanidin reductase, and leucoanthocyanidin reductase.

    Science.gov (United States)

    Liu, Yi; Shi, Zi; Maximova, Siela; Payne, Mark J; Guiltinan, Mark J

    2013-12-05

    The proanthocyanidins (PAs), a subgroup of flavonoids, accumulate to levels of approximately 10% total dry weight of cacao seeds. PAs have been associated with human health benefits and also play important roles in pest and disease defense throughout the plant. To dissect the genetic basis of PA biosynthetic pathway in cacao (Theobroma cacao), we have isolated three genes encoding key PA synthesis enzymes, anthocyanidin synthase (ANS), anthocyanidin reductase (ANR) and leucoanthocyanidin reductase (LAR). We measured the expression levels of TcANR, TcANS and TcLAR and PA content in cacao leaves, flowers, pod exocarp and seeds. In all tissues examined, all three genes were abundantly expressed and well correlated with PA accumulation levels, suggesting their active roles in PA synthesis. Overexpression of TcANR in an Arabidopsis ban mutant complemented the PA deficient phenotype in seeds and resulted in reduced anthocyanidin levels in hypocotyls. Overexpression of TcANS in tobacco resulted in increased content of both anthocyanidins and PAs in flower petals. Overexpression of TcANS in an Arabidopsis ldox mutant complemented its PA deficient phenotype in seeds. Recombinant TcLAR protein converted leucoanthocyanidin to catechin in vitro. Transgenic tobacco overexpressing TcLAR had decreased amounts of anthocyanidins and increased PAs. Overexpressing TcLAR in Arabidopsis ldox mutant also resulted in elevated synthesis of not only catechin but also epicatechin. Our results confirm the in vivo function of cacao ANS and ANR predicted based on sequence homology to previously characterized enzymes from other species. In addition, our results provide a clear functional analysis of a LAR gene in vivo.

  16. Characterization of Pseudomonas chlororaphis from Theobroma cacao L. rhizosphere with antagonistic activity against Phytophthora palmivora (Butler).

    Science.gov (United States)

    Acebo-Guerrero, Y; Hernández-Rodríguez, A; Vandeputte, O; Miguélez-Sierra, Y; Heydrich-Pérez, M; Ye, L; Cornelis, P; Bertin, P; El Jaziri, M

    2015-10-01

    To isolate and characterize rhizobacteria from Theobroma cacao with antagonistic activity against Phytophthora palmivora, the causal agent of the black pod rot, which is one of the most important diseases of T. cacao. Among 127 rhizobacteria isolated from cacao rhizosphere, three isolates (CP07, CP24 and CP30) identified as Pseudomonas chlororaphis, showed in vitro antagonistic activity against P. palmivora. Direct antagonism tested in cacao detached leaves revealed that the isolated rhizobacteria were able to reduce symptom severity upon infection with P. palmivora Mab1, with Ps. chlororaphis CP07 standing out as a potential biocontrol agent. Besides, reduced symptom severity on leaves was also observed in planta where cacao root system was pretreated with the isolated rhizobacteria followed by leaf infection with P. palmivora Mab1. The production of lytic enzymes, siderophores, biosurfactants and HCN, as well as the detection of genes encoding antibiotics, the formation of biofilm, and bacterial motility were also assessed for all three rhizobacterial strains. By using a mutant impaired in viscosin production, derived from CP07, it was found that this particular biosurfactant turned out to be crucial for both motility and biofilm formation, but not for the in vitro antagonism against Phytophthora, although it may contribute to the bioprotection of T. cacao. In the rhizosphere of T. cacao, there are rhizobacteria, such as Ps. chlororaphis, able to protect plants against P. palmivora. This study provides a theoretical basis for the potential use of Ps. chlororaphis CP07 as a biocontrol agent for the protection of cacao plants from P. palmivora infection. © 2015 The Society for Applied Microbiology.

  17. Actividad antibacteriana de la cáscara de cacao, Theobroma cacao L

    Directory of Open Access Journals (Sweden)

    Oscar Cuéllar G.

    2012-12-01

    Full Text Available Objetivo. Evaluar la actividad antibacteriana de diferentes fracciones de la cáscara de cacao (Theobroma cacao L.. Materiales y métodos. Se evaluó la actividad antibacteriana mediante el método de difusión en agar de diferentes fracciones de la cáscara de cacao, empleando cepas autóctonas y de referencia ATCC. Posteriormente, se hizo un análisis de estas fracciones por cromatografía líquida de alta eficiencia y cromatografía de gases acoplada a espectrometría de masas. Resultados. La fracción clorofórmica presentó actividad antibacteriana frente a Bacillus cereus ATCC 11778 y Streptococcus agalactiae (autóctona, con porcentajes de inhibición de 34.90% (100 μg/μl y 52.40% (100 μg/μl respectivamente. También se evidenció una concentración mínima inhibitoria de 512 μg/ml frente a Bacillus cereus ATCC 11778 y de 128 μg/ml frente a Streptococcus agalactiae. Conclusiones. Este trabajo es el primer reporte a saber en Colombia sobre actividad antibacteriana in vitro de la cáscara de cacao, el cual resulta ser un avance importante para esta agroindustria. Esta investigación abre paso a otros estudios relacionados para establecer el espectro de inhibición frente a otros microorganismos.

  18. Ekstraksi Pektin dari Kulit Kakao (Theobroma cacao L. Menggunakan Amonium Oksalat

    Directory of Open Access Journals (Sweden)

    Cut Erika

    2013-06-01

    Full Text Available Cocoa (Theobroma cocoa L is one of the local superior commodities in Aceh Province. The production of cocoa continues to increase significantly every year. Cocoa Pod husk is a waste product of cocoa beans industry, which is containing pectin with concentration ranged between 2-10%. Pectin extraction is one of the potential researches to increase economic value of cocoa pod husks. This study aimed to determine the effect of extraction time and pH on the characteristics of cocoa pod husk pectin. Pectin was extracted from cocoa pod husks using ammonium oxalate, extraction time (60 and 120 min and pH (2.6, 3.6 and 4.6. The use of ammonium oxalate produced high yield of pectin ranged from 6.63 to 12.75%, moisture content was 7,36 to 10,77%, methoxyl content was 5.19 to 5.70%, anhydrogalacturonic acid of 59.84 to 63.14%, the esterification degree was 48.43 to 51.43 % and relative viscosity was 40 – 186,6 cP. The extraction time for 60 minutes at pH 3,6 showed a higher yield compared to 120 min at pH 4,6. Pectin on the extraction time of 60 minutes at pH 3.6 had the highest relative viscosity was 186,6 cP, and the lowest viscosity of pectin obtained at pH 2.6 and extraction time of 60 min which was 40 cP. Keywords: cocoa pod husks, ammonium oxalate, extraction time, pH

  19. Enhanced somatic embryogenesis in Theobroma cacao using the homologous BABY BOOM transcription factor.

    Science.gov (United States)

    Florez, Sergio L; Erwin, Rachel L; Maximova, Siela N; Guiltinan, Mark J; Curtis, Wayne R

    2015-05-16

    Theobroma cacao, the chocolate tree, is an important economic crop in East Africa, South East Asia, and South and Central America. Propagation of elite varieties has been achieved through somatic embryogenesis (SE) but low efficiencies and genotype dependence still presents a significant limitation for its propagation at commercial scales. Manipulation of transcription factors has been used to enhance the formation of SEs in several other plant species. This work describes the use of the transcription factor Baby Boom (BBM) to promote the transition of somatic cacao cells from the vegetative to embryonic state. An ortholog of the Arabidopsis thaliana BBM gene (AtBBM) was characterized in T. cacao (TcBBM). TcBBM expression was observed throughout embryo development and was expressed at higher levels during SE as compared to zygotic embryogenesis (ZE). TcBBM overexpression in A. thaliana and T. cacao led to phenotypes associated with SE that did not require exogenous hormones. While transient ectopic expression of TcBBM provided only moderate enhancements in embryogenic potential, constitutive overexpression dramatically increased SE proliferation but also appeared to inhibit subsequent development. Our work provides validation that TcBBM is an ortholog to AtBBM and has a specific role in both somatic and zygotic embryogenesis. Furthermore, our studies revealed that TcBBM transcript levels could serve as a biomarker for embryogenesis in cacao tissue. Results from transient expression of TcBBM provide confirmation that transcription factors can be used to enhance SE without compromising plant development and avoiding GMO plant production. This strategy could compliment a hormone-based method of reprogramming somatic cells and lead to more precise manipulation of SE at the regulatory level of transcription factors. The technology would benefit the propagation of elite varieties with low regeneration potential as well as the production of transgenic plants, which

  20. [Cocoa (Theobroma cacao L.) hulls: a posible commercial source of pectins].

    Science.gov (United States)

    Barazarte, Humberto; Sangronis, Elba; Unai, Emaldi

    2008-03-01

    Commercial exploitation of cocoa (Theobroma cacao L.) generates a volume of hulls that could be used in the production of pectins on an industrial scale. Therefore, pectins from cocoa hulls were extracted at different pH and temperature conditions, and their main chemical characteristics were evaluated. EDTA at 0.5% was used for the extraction at pHs 3, 4 and 5 and temperatures of 60, 75 and 90 degrees C, under a 3 2 factorial design. The response variables were yield, content of anhydrous galacturonic acid (AGA), content of metoxil, degree of esterification and equivalent weight of the pectins extracted. The strength of the pectic gel was determined with a TA-XT2 texturometer. Strawberry jam was made with the pectin extracted, and its acceptability was determined using a 7-point hedonic scale. The results obtained were as follows: an extraction yield from 2.64 to 4.69 g/100 g; an AGA content between 49.8 and 64.06 g/100 g; a content of metoxil between 4.72 and 7.18 g/100 g; a degree of esterification between 37.94 and 52.20%; an equivalent weight from 385.47 to 464.61 g/equivalent of H+, and a degree of gelation between 28.64 and 806.03 g force. The pectin extracted at pH 4 and 90 degrees C showed a gelation power of 422.16 g force, purity 62.26 g/100 g of AGA, and a yield of extraction of 3.89 g/100 g and allowed to prepare ajam with an average level of liking of "like moderately". Pectins from cocoa hulls show potential application in the food industry, but it is necessary to optimize the extraction parameters to increase its yield.

  1. Genetic variation in bioaccumulation and partitioning of cadmium in Theobroma cacao L.

    Science.gov (United States)

    Lewis, Caleb; Lennon, Adrian M; Eudoxie, Gaius; Umaharan, Pathmanathan

    2018-06-02

    Cadmium (Cd) is a non-essential heavy metal that is toxic to both plants and animals and chocolates have been identified as a contributor to the human dietary Cd intake. One hundred accessions representing the various genetic groups and hybrid populations in Theobroma cacao L. held at the International Cocoa Genebank, Trinidad were evaluated for leaf and bean cadmium levels with three tree replications. Representative samples of soil from the drip zone around each tree were evaluated for bioavailable cadmium. Although there were significant differences (P ≤ 0.05) among genetic groups for leaf and bean Cd much of the variation was between accessions. There was a 13-fold variation in bean Cd and a 7-fold variation in leaf Cd between accessions despite the bioavailable Cd in the soil being uniform. There were differences in the level of partitioning into beans evident by significant variation (P ≤ 0.05) in bean Cd as a percentage of the cumulative leaf and bean Cd concentration (15-52%) between accessions. Although in general there was a higher concentration of cadmium in the testa than the cotyledon of the cocoa bean there was considerable genetic variation. These results point to the potential of using a genetic strategy to mitigate cadmium within cocoa beans either through breeding or through the use of low cadmium uptake rootstocks in grafting. The results will fuel further work into the understanding of mechanisms and genetics of cadmium uptake and partitioning in cocoa. Copyright © 2018. Published by Elsevier B.V.

  2. Association mapping of seed and disease resistance traits in Theobroma cacao L.

    Science.gov (United States)

    Motilal, Lambert A; Zhang, Dapeng; Mischke, Sue; Meinhardt, Lyndel W; Boccara, Michel; Fouet, Olivier; Lanaud, Claire; Umaharan, Pathmanathan

    2016-12-01

    Microsatellite and single nucleotide polymorphism markers that could be used in marker assisted breeding of cacao were identified for number of filled seeds, black pod resistance and witches' broom disease resistance. An association mapping approach was employed to identify markers for seed number and resistance to black pod and witches' broom disease (WBD) in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms (SNPs) were assessed on 483 unique trees in the International Cocoa Genebank Trinidad (ICGT). Linkage disequilibrium (LD) and association mapping studies were conducted to identify markers to tag the phenotypic traits. Decay of LD occurred over an average 9.3 cM for chromosomes 1-9 and 2.5 cM for chromosome 10. Marker/trait associations were generally identified based on general linear models (GLMs) that incorporated principal components from molecular information on relatedness factor. Seven markers (mTcCIR 8, 66, 126, 212; TcSNP368, 697, 1370) on chromosomes 1 and 9 were identified for number of filled seeds (NSEED). A single marker was found for black pod resistance (mTcCIR280) on chromosome 3, whereas six markers on chromosomes 4, 5, 6, 8, and 10 were detected for WBD (mTcCIR91, 183; TcSNP375, 720, 1230 and 1374). It is expected that this association mapping study in cacao would contribute to the knowledge of the genetic determinism of cocoa traits and that the markers identified herein would prove useful in marker assisted breeding of cacao.

  3. Study of Seed Germination by Soaking Methode of Cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2014-12-01

    Full Text Available Study of germination methods conduct to get information about seed viability based on germination rate, percentage of germination and vigority. Germination methods was studied to get the efficiency and effectivity of germination, easy to handle, low costs with high vigority. Sand and gunny sack methods  for germination, need extensive place  and 3-4 days germination period after planting. This research will study the alternative of germination method with soaking. This method can be accelerating  germination rate and effectively place usage without decreasing the quality of cacao seedling.The research was done at Kaliwining Experimental Station, Indonesian Coffee and Cocoa Research Institue. This research consist of two experiment was arranged based on factorial completely random design. First experiment will observed to compared germination rate and the second experiment will observed seedling quality between soaking and wet gunny sack germination method.The results showed that length of radicel on soaking method longer than wet gunny sack method. Growth of radicel started from 2 hours after soaking, moreover length of radicel at 4 hours after soaking have significant different value with gunny sack method. On 24 hours after soaking have 3,69 mm and 0,681 mm on wet gunny sack treatment. Except lengt of hipocotyl, there is not different condition between seedling that out came  from soaking and wet gunny sack method. Length of hipocotyl on 36 hours after soaking have 9,15 cm and significant different between wet gunny sack germination method that have 5,40 cm. Keywords : seed germination, soaking method, Theobroma cacao L., cocoa seedlings

  4. The effect of cocoa (Theobroma cacao L on the basic color stability of thermoplastic nylon resin dentures

    Directory of Open Access Journals (Sweden)

    Amiyatun Naini

    2011-11-01

    Full Text Available Nylon thermoplastic resin is material of choice for the making of flexible. This denture do not use wire retention, but has the physical properties of water absorption. In the oral cavity, it will always be in contact with food and beverages consumed. One of the foods that are consumed by the public is chocolate. This study aimed to determine the effect of cocoa (Theobroma cacao L on color stability of the thermoplastic nylon denture base. The study sample was thermoplastic nylon (valplast with a size of 10x10x2 mm soaked in the chocolate solution for 7 and 14 days. As the control, the sample soaked with distilled water. The color testing stability used was densitometer. There were significant differences between the control group (distilled water and the chocolate solution. This was due to dissolved components/tannin having a capillary flow diffusion into thermoplastic nylons that causing discoloration. The conclusion of this study, there was the effect of cocoa (Theobroma cacao L against the color stability of the nylon thermoplastic denture base. The longer time of immersion of nylon thermoplastic the greater the change in color.

  5. Data from mass spectrometry, NMR spectra, GC–MS of fatty acid esters produced by Lasiodiplodia theobromae

    Directory of Open Access Journals (Sweden)

    Carla C. Uranga

    2016-09-01

    Full Text Available The data described herein is related to the article with the title “Fatty acid esters produced by Lasiodiplodia theobromae function as growth regulators in tobacco seedlings” C.C. Uranga, J. Beld, A. Mrse, I. Cordova-Guerrero, M.D. Burkart, R. Hernandez-Martinez (2016 [1]. Data includes nuclear magnetic resonance spectroscopy and GC–MS data used for the identification and characterization of fatty acid esters produced by L. theobromae. GC–MS traces are also shown for incubations in defined substrate, consisting in Vogel׳s salts supplemented with either 5% grapeseed oil or 5% glucose, the two combined, or 5% fructose. Traces for incubations in the combination of 5% grapeseed oil and 5% glucose for different fungal species are also included. Images of mycelium morphology when grown in 5% glucose with or without 5% grapeseed oil are shown due to the stark difference in mycelial pigmentation in the presence of triglycerides. High concentration gradient data for the plant model Nicotiana tabacum germinated in ethyl stearate (SAEE and ethyl linoleate (LAEE is included to show the transition between growth inhibition and growth induction in N. tabacum by these compounds. Keywords: NMR, GC–MS, Fatty acid esters, Ethyl stearate, Ethyl linoleate, Growth inhibition, Growth induction

  6. Pod Characteristics of cocoa (Theobroma cacao L. related to rocoa pod borer resistance.

    Directory of Open Access Journals (Sweden)

    Agung Wahyu Susilo

    2015-04-01

    Full Text Available The characteristics of cocoa (Theobroma cacao L. pod related to cocoa pod borer resistance (CPB had been identified in a series of study. The objective of this research is to evaluate the characteristics of cocoa pod using more diverse of genetic background to obtain selection criteria. Genetic materials for this studywere 25 cocoa clones planted in Central Sulawesi for resistance evaluation. Field evaluation of the resistance were assessed by using variable of the percentage of unextractable beans, number of larvae entry and exit holes by which the clones were grouped into 5 groups of resistance. A laboratory works were carried out to assess pod characteristics based on the number of trichomes, granules of tannin and thickness the lignified-tissue of sclerotic layer using micro-technique method at the different level of pod maturity (3.0; 3.5; 4.0 months. Correlation between groups of those variables was analyzed using canonical correlation. The result performed a positive association between the thickness of sclerotic layer at the secondary furrow with the number of entry holes and the number of entry holes through sclerotic layer. The thickness performed a higher value of the coefficient in association with the variables of canonical for pod characteristics 0.59; 0.55; 0.43 and the variables of canonical correlation for CPB resistance 0.54; 0.51; 0.39 that would presenting the characteristics of pod related to CPB resistance in 3.0, 3.5 and 4.0 months of pod maturity. Lignification at sclerotic layer was considered as genotypic expressions due to the thickness at the secondary furrow at 3.0, 3.5 and 4.0 months of pod maturity performed high value of broad-sense heritability i.e. 0.75, 0.89 and 0.92 respectively. A qualitative assessment of the lignification clearly differentiated the resistant clones of ARDACIAR 10 with the susceptible clones of ICCRI 04, KW 516, and KW 564.

  7. Packaging of Post Acclimatized Somatic Embryogenesis Cocoa Plantlet (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Soedarsianto Soedarsianto

    2009-05-01

    Full Text Available Clonal plants that produced by somatic embryogenesis technique is one of the best choice to produce supperior clonal cacao (Theobroma cacao L. planting materials. The somatic embryogenesis technique is a possible way for massive propagation, the outcome is true to type plants, the architecture similarity that the seedlings but there is not segregation like seedlings plants. At present mass production started of plantlets production until post-acclimatized plantlets of somatic embryogenesis cocoa was done at Indonesian Coffee and Cocoa Research Institute. Distribution system of the planting materials to whole areas in form of as up-rooted post-acclimatized plantlet. Some problems identified to reduce probability of decreasing viability of up-rooted post-acclimatized plantlets and one of them is extreme internal water deficit. This research investigate of the influece storage condition (air tight and non-air tight and box storage (mica plastic and cardboardbox. The first experiment result show, there is no significant different between mica plastic and cardboard box usage for storage of post-acclimatized cocoa pantlet. Viability of up-rooted post acclimatized cocoa plantlet influenced exactly by air tight and non-air tight storage condition. Air tight storage condition have better viability of up-rooted post acclimatised (81,58% than non-air tight storage condition (65,00%. Leaf sanasence on air tight storage condition (10,33% lower than non-air tight storage (32,58%. There is not significantly on volume storage per plantlet between 4.416 cm3 and 12.600 cm3. Relationship between fallen leaves and cocoa planlet viability follow negative linear correlation y = -1,4719x + 104,88 (R2 = 0,9772. The second experiment treatment showed that maximal storage periode of post cclimatized cocoa plantlet just until 6 days stored (97% and not significant with 3 days one. Viability of post acclimatized cocoa plantlet decreased after 6 days storage period

  8. Stability of cupuaçu (Theobroma grandiflorum nectar during storage

    Directory of Open Access Journals (Sweden)

    Margarida Cortez Vieira

    2014-10-01

    Full Text Available A shelf-life study on cupuaçu nectar (Theobroma grandiflorum was carried out in two parts. Part I studied the microbial stability of the regular nectar (batch R and the same nectar fortified with synthetic ascorbic acid (AA (batch F, pasteurized at 90 °C for 3 min and hot filled in glass bottles. Total Plate Count (TPC, yeast and molds as well as pH, total soluble solids (TTS, titratable acidity and hidroxymethylfurfural (HMF were followed along 43 storage days at 4, 25 and 35 °C. At the end of the storage period neither TPC nor molds or yeast had recovered the initial loads observed before pasteurization, for both R and F batches. Right after pasteurization, acidity increased slightly, pH decreased from 3.52 to 3.3, and TSS increased from 18.7 to 19.0 °Brix, with all stabilizing afterwards.Part II evaluated ascorbic (AA and dehydroascorbic (DHAA acids’ stabilization in the two batches, R and F, and dissolved oxygen (DO was monitored. Both batches were stored at the same temperatures as in Part I for two months. For batch R, the AA degradation results followed a reversible first order reaction (EaAA(R=-34±6 kJ/mol, kAA(R25°C=0.006±0.003 days-1, C0AA(R=0.92±0.01 and C∞AA(R= 0.43±0.19. For the (F nectar, the experimental data fitted a first order model well (EaAA(F=30±17 kJ/mol, kAA(F25°C =0.0016±0.0004 days-1. DO was modeled as a fractional conversion model (EaDO= 67±17 kJ/mol, kDO25°C= 1.94±0.94 days-1, C0DO=0.97±0.03 and C∞DO= 0.55±0.01. For both nectars, storage at environmental temperatures was preferred (AA retention above 80% to refrigeration, due to the slower rate of diffusion of DO at lower temperatures.

  9. Chemical and rheological properties of a starch-rich fraction from the pulp of the fruit cupuassu (Theobroma grandiflorum)

    International Nuclear Information System (INIS)

    Vriesmann, Lucia C.; Silveira, Joana L.M.; Petkowicz, Carmen L. de O

    2009-01-01

    The pulp obtained from the fruit of cupuassu (Theobroma grandiflorum) was extracted with hot aqueous 0.1% citric acid to give fraction 0.1CA-2 in 15% yield. This was the predominant component polysaccharide, 91% of which was composed of starch, by an iodine test and monosaccharide composition, and its 13 C NMR spectrum was consistent with that of a high amylose starch. The content of amylose found in fraction 0.1CA-2 was 71%. This value is higher than those of common starches of cereal grains, tubers, roots, and other fruits. The fraction was submitted to rheological examination, gels being prepared on heating with concentrations of 4 to 7% (w/w). A non-Newtonian behavior was observed, and gel viscosity and strength depended on the concentration. The presence of starch, as well as the presence of previously investigated pectin, conferred the high viscosity and gelling capability of the pulp

  10. Chemical and rheological properties of a starch-rich fraction from the pulp of the fruit cupuassu (Theobroma grandiflorum)

    Energy Technology Data Exchange (ETDEWEB)

    Vriesmann, Lucia C.; Silveira, Joana L.M. [Universidade Federal do Parana, Departamento de Bioquimica e Biologia Molecular, CP 19046, CEP 81531-990, Curitiba-PR (Brazil); Petkowicz, Carmen L. de O [Universidade Federal do Parana, Departamento de Bioquimica e Biologia Molecular, CP 19046, CEP 81531-990, Curitiba-PR (Brazil)], E-mail: clop@ufpr.br

    2009-03-01

    The pulp obtained from the fruit of cupuassu (Theobroma grandiflorum) was extracted with hot aqueous 0.1% citric acid to give fraction 0.1CA-2 in 15% yield. This was the predominant component polysaccharide, 91% of which was composed of starch, by an iodine test and monosaccharide composition, and its {sup 13}C NMR spectrum was consistent with that of a high amylose starch. The content of amylose found in fraction 0.1CA-2 was 71%. This value is higher than those of common starches of cereal grains, tubers, roots, and other fruits. The fraction was submitted to rheological examination, gels being prepared on heating with concentrations of 4 to 7% (w/w). A non-Newtonian behavior was observed, and gel viscosity and strength depended on the concentration. The presence of starch, as well as the presence of previously investigated pectin, conferred the high viscosity and gelling capability of the pulp.

  11. Study on the presence and influence of phenolic compounds in callogenesis and somatic embryo development of cocoa (Theobroma cacao L..

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2015-03-01

    Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although  the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.Kata kunci: Theobroma cacao L., polifenol, embrio somatik, kalus, flavonoid, katekin, in vitro recalcitance

  12. The Purification and Characterization of Lipases from Lasiodiplodia theobromae, and Their Immobilization and Use for Biodiesel Production from Coconut Oil.

    Science.gov (United States)

    Venkatesagowda, Balaji; Ponugupaty, Ebenezer; Barbosa-Dekker, Aneli M; Dekker, Robert F H

    2017-12-18

    The coconut kernel-associated fungus, Lasiodiplodia theobromae VBE1, was grown on coconut cake with added coconut oil as lipase inducer under solid-state fermentation conditions. The extracellular-produced lipases were purified and resulted in two enzymes: lipase A (68,000 Da)-purified 25.41-fold, recovery of 47.1%-and lipase B (32,000 Da)-purified 18.47-fold, recovery of 8.2%. Both lipases showed optimal activity at pH 8.0 and 35 °C, were activated by Ca 2+ , exhibited highest specificity towards coconut oil and p-nitrophenyl palmitate, and were stable in iso-octane and hexane. Ethanol supported higher lipase activity than methanol, and n-butanol inactivated both lipases. Crude lipase immobilized by entrapment within 4% (w/v) calcium alginate beads was more stable than the crude-free lipase preparation within the range pH 2.5-10.0 and 20-80 °C. The immobilized lipase preparation was used to catalyze the transesterification/methanolysis of coconut oil to biodiesel (fatty acyl methyl esters (FAMEs)) and was quantified by gas chromatography. The principal FAMEs were laurate (46.1%), myristate (22.3%), palmitate (9.9%), and oleate (7.2%), with minor amounts of caprylate, caprate, and stearate also present. The FAME profile was comparatively similar to NaOH-mediated transesterified biodiesel from coconut oil, but distinctly different to petroleum-derived diesel. This study concluded that Lasiodiplodia theobromae VBE1 lipases have potential for biodiesel production from coconut oil.

  13. Flowering levels, harvest season and yields of cupuassu (Theobroma grandiflorum Níveis de floração, período de safra e produção do cupuaçuzeiro (Theobroma grandiflorum

    Directory of Open Access Journals (Sweden)

    Giorgini Augusto Venturieri

    2011-03-01

    Full Text Available Cupuassu (Theobroma grandiflorum, a specie native to Amazonia, has been planted commercially in Brazil to satisfy the demand for the flavorful juice obtained from the pulp around its seeds. The trees are notorious for low and irregular fruit production. Data gathered over two seasons from trees in a germplasm collection in Pará, Brazil, showed that some of them fruited more regularly than others. Differences in fruit production correlated to differences in flower production. Tree-to-tree variation in flower production, fruit production, and consistency of both over time suggest considerable scope for improving yields by selection. Hand pollinations resulted in a much higher frequency of fruit set than open pollinations, indicating that lack of effective pollination is also a reason for low yield. However, attempts to increase the level of effective pollination are handicapped by low knowledge about the pollinators of cupuassu and their behavior.Cupuaçu (Theobroma grandiflorum é uma espécie nativa da Amazônia que vem sendo plantada comercialmente no Brasil para satisfazer a demanda pelo seu suco, de sabor marcante, obtido da polpa que envolve as suas sementes. As árvores não notórias pela sua baixa e irregular produtividade. Dados obtidos de dois períodos produtivos, de árvores de uma coleção de germoplasma no estado do Pará, Brasil, mostraram que algumas delas frutificam mais irregularmente que outras. Diferenças na produção de frutos foram correlacionadas à diferenças na produção de flores. Variações entre plantas nas produções de flores e de frutos, e a repetibilidade de ambos ao longo do tempo sugerem melhoria das colheitas por seleção. Polinizações manuais resultaram em aumento no pegamento dos frutos, indicando que a falta de polinizador efetivo é também um causa da produtividade baixa. Entretanto, tentativas para aumentar o nível de polinização efetiva são dificultadas pelo pouco conhecimento sobre os

  14. Transposon fingerprinting using low coverage whole genome shotgun sequencing in cacao (Theobroma cacao L.) and related species.

    Science.gov (United States)

    Sveinsson, Saemundur; Gill, Navdeep; Kane, Nolan C; Cronk, Quentin

    2013-07-24

    Transposable elements (TEs) and other repetitive elements are a large and dynamically evolving part of eukaryotic genomes, especially in plants where they can account for a significant proportion of genome size. Their dynamic nature gives them the potential for use in identifying and characterizing crop germplasm. However, their repetitive nature makes them challenging to study using conventional methods of molecular biology. Next generation sequencing and new computational tools have greatly facilitated the investigation of TE variation within species and among closely related species. (i) We generated low-coverage Illumina whole genome shotgun sequencing reads for multiple individuals of cacao (Theobroma cacao) and related species. These reads were analysed using both an alignment/mapping approach and a de novo (graph based clustering) approach. (ii) A standard set of ultra-conserved orthologous sequences (UCOS) standardized TE data between samples and provided phylogenetic information on the relatedness of samples. (iii) The mapping approach proved highly effective within the reference species but underestimated TE abundance in interspecific comparisons relative to the de novo methods. (iv) Individual T. cacao accessions have unique patterns of TE abundance indicating that the TE composition of the genome is evolving actively within this species. (v) LTR/Gypsy elements are the most abundant, comprising c.10% of the genome. (vi) Within T. cacao the retroelement families show an order of magnitude greater sequence variability than the DNA transposon families. (vii) Theobroma grandiflorum has a similar TE composition to T. cacao, but the related genus Herrania is rather different, with LTRs making up a lower proportion of the genome, perhaps because of a massive presence (c. 20%) of distinctive low complexity satellite-like repeats in this genome. (i) Short read alignment/mapping to reference TE contigs provides a simple and effective method of investigating

  15. Characterization of the fermentation process by gas chromatography Lasiodiplodia theobromae and gas chromatography coupled with mass spectrometry

    International Nuclear Information System (INIS)

    Castillo Portela, Grolamys; Eng Sanchez, Felipe; Nogueiras Lima, Clara

    2014-01-01

    Lasiodiplodia theobromae is a fungus, which has been reported by some authors as a high yield producer of the phytohormone jasmonic acid (JA). An indigenous strain of this fungus has been used for producing a fermentation broth with a high JA concentration by the Cuban Research Institute for Sugar Cane Derivatives (ICIDCA), registered as BIOJAS. The broth has been applied to some agricultural crops and demonstrated its economic feasibility as plant growth regulator and biological control of various phytopathogenic microorganisms and pests. Both fermentation broth and biomass from this fungus contain some other metabolites having bioactive properties, for instance, fatty acids. This paper shows the composition and quantification of fatty acids in the biomass using Gas Chromatography (GC) and the identification of substances profile in fermentation broth by Gas Chromatography coupled to Mass Spectrometry (GC-MS). The most fatty acids in the biomass are palmitic, stearic, oleic, linoleic and linolenic acids, being oleic acid the major component. On the other hand, 2,32 % of fatty acid esters; 2,47 % of alkenes; 14,40 % of alcohols; 30,15 % of aldehydes and 21,73 % of paraffins were detected in the composition of fermentation broth

  16. Application of glycerol as a foliar spray activates the defence response and enhances disease resistance of Theobroma cacao.

    Science.gov (United States)

    Zhang, Yufan; Smith, Philip; Maximova, Siela N; Guiltinan, Mark J

    2015-01-01

    Previous work has implicated glycerol-3-phosphate (G3P) as a mobile inducer of systemic immunity in plants. We tested the hypothesis that the exogenous application of glycerol as a foliar spray might enhance the disease resistance of Theobroma cacao through the modulation of endogenous G3P levels. We found that exogenous application of glycerol to cacao leaves over a period of 4 days increased the endogenous level of G3P and decreased the level of oleic acid (18:1). Reactive oxygen species (ROS) were produced (a marker of defence activation) and the expression of many pathogenesis-related genes was induced. Notably, the effects of glycerol application on G3P and 18:1 fatty acid content, and gene expression levels, in cacao leaves were dosage dependent. A 100 mm glycerol spray application was sufficient to stimulate the defence response without causing any observable damage, and resulted in a significantly decreased lesion formation by the cacao pathogen Phytophthora capsici; however, a 500 mm glycerol treatment led to chlorosis and cell death. The effects of glycerol treatment on the level of 18:1 and ROS were constrained to the locally treated leaves without affecting distal tissues. The mechanism of the glycerol-mediated defence response in cacao and its potential use as part of a sustainable farming system are discussed. © 2014 BSPP AND JOHN WILEY & SONS LTD.

  17. High-resolution transcript profiling of the atypical biotrophic interaction between Theobroma cacao and the fungal pathogen Moniliophthora perniciosa.

    Science.gov (United States)

    Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães

    2014-11-01

    Witches' broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen's transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. © 2014 American Society of Plant Biologists. All rights reserved.

  18. Enhanced resistance in Theobroma cacao against oomycete and fungal pathogens by secretion of phosphatidylinositol-3-phosphate-binding proteins.

    Science.gov (United States)

    Helliwell, Emily E; Vega-Arreguín, Julio; Shi, Zi; Bailey, Bryan; Xiao, Shunyuan; Maximova, Siela N; Tyler, Brett M; Guiltinan, Mark J

    2016-03-01

    The internalization of some oomycete and fungal pathogen effectors into host plant cells has been reported to be blocked by proteins that bind to the effectors' cell entry receptor, phosphatidylinositol-3-phosphate (PI3P). This finding suggested a novel strategy for disease control by engineering plants to secrete PI3P-binding proteins. In this study, we tested this strategy using the chocolate tree Theobroma cacao. Transient expression and secretion of four different PI3P-binding proteins in detached leaves of T. cacao greatly reduced infection by two oomycete pathogens, Phytophthora tropicalis and Phytophthora palmivora, which cause black pod disease. Lesion size and pathogen growth were reduced by up to 85%. Resistance was not conferred by proteins lacking a secretory leader, by proteins with mutations in their PI3P-binding site, or by a secreted PI4P-binding protein. Stably transformed, transgenic T. cacao plants expressing two different PI3P-binding proteins showed substantially enhanced resistance to both P. tropicalis and P. palmivora, as well as to the fungal pathogen Colletotrichum theobromicola. These results demonstrate that secretion of PI3P-binding proteins is an effective way to increase disease resistance in T. cacao, and potentially in other plants, against a broad spectrum of pathogens. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  19. Analysis of gene expression and proteomic profiles of clonal genotypes from Theobroma cacao subjected to soil flooding.

    Science.gov (United States)

    Bertolde, Fabiana Z; Almeida, Alex-Alan F; Pirovani, Carlos P

    2014-01-01

    Soil flooding causes changes in gene transcription, synthesis and degradation of proteins and cell metabolism. The main objective of this study was to understand the biological events of Theobroma cacao during soil flooding-induced stress, using the analyses of gene expression and activity of key enzymes involved in fermentation, as well as the identification of differentially expressed proteins by mass spectrometry in two contrasting genotypes for flooding tolerance (tolerant - TSA-792 and susceptible - TSH-774). Soil anoxia caused by flooding has led to changes in the expression pattern of genes associated with the biosynthesis of alcohol dehydrogenase (ADH), pyruvate decarboxylase (PDC) and lactate dehydrogenase (LDH) in leaves and roots of the two evaluated genotypes. Significant differences were observed between the enzyme activities of the two genotypes. Leaves and roots of the TSA-792 genotype showed higher ADH activity as compared to the TSH-774 genotype, whereas the activities of PDC and LDH have varied over the 96 h of soil flooding, being higher for TSA-792 genotype, at the initial stage, and TSH-774 genotype, at the final stage. Some of the identified proteins are those typical of the anaerobic metabolism-involved in glycolysis and alcoholic fermentation-and different proteins associated with photosynthesis, protein metabolism and oxidative stress. The ability to maintain glycolysis and induce fermentation was observed to play an important role in anoxia tolerance in cacao and may also serve to distinguish tolerant and susceptible genotypes in relation to this stressor.

  20. Fermentation of cacao (Theobroma cacao L.) seeds with a hybrid Kluyveromyces marxianus strain improved product quality attributes.

    Science.gov (United States)

    Leal, Gildemberg Amorim; Gomes, Luiz Humberto; Efraim, Priscilla; de Almeida Tavares, Flavio Cesar; Figueira, Antonio

    2008-08-01

    Fermentation of Theobroma cacao (cacao) seeds is an absolute requirement for the full development of chocolate flavor precursors. An adequate aeration of the fermenting cacao seed mass is a fundamental prerequisite for a satisfactory fermentation. Here, we evaluated whether a controlled inoculation of cacao seed fermentation using a Kluyveromyces marxianus hybrid yeast strain, with an increased pectinolytic activity, would improve an earlier liquid drainage ('sweatings') from the fermentation mass, developing a superior final product quality. Inoculation with K. marxianus increased by one third the volume of drained liquid and affected the microorganism population structure during fermentation, which was detectable up to the end of the process. Introduction of the hybrid yeast affected the profile of total seed protein degradation evaluated by polyacrylamide gel electrophoresis, with improved seed protein degradation, and reduction of titrable acidity. Sensorial evaluation of the chocolate obtained from beans fermented with the K. marxianus inoculation was more accepted by analysts in comparison with the one from cocoa obtained through natural fermentation. The increase in mass aeration during the first 24 h seemed to be fundamental for the improvement of fermentation quality, demonstrating the potential application of this improved hybrid yeast strain with superior exogenous pectinolytic activity.

  1. Possible Impact of Antioxidant Properties of Cocoa (Theobroma Cacao L.) Against Irradiation - Induced Some Biochemical Disorders in Rats

    International Nuclear Information System (INIS)

    Farag, M.F.S.; Darwish, M.M.

    2016-01-01

    Man is exposed to natural radiations either from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation of animals induce biochemical alterations which depend mostly on oxidative stress. This work aimed at evaluating the radioprotective efficiency of Cocoa (Theobroma cacao L.) against whole body γ-irradiation of rats. The virtue of cocoa aqueous extract (CAE) was given to rats at a dose of 1 g/ kg for 6 weeks to determine changes in hepatic marker enzymes, lipid profile and antioxidant status. The animals exposed to γ-rays exhibited a pronounced increment in serum aspartate transaminase (AST), alanine transaminase (ALT), alkaline phosphatase (ALP) and gamma glutamyl transpeptidase (γ GT), total cholesterol (TC), triglycerides (TG), low density lipoprotein cholesterol (LDL-C) and liver thiobarbituric acid reactive substance (TBARS). On the other hand, a significant decline was demonstrated in high density lipoprotein cholesterol (HDL-C). A decrease of hepatic reduced glutathione (GSH) content, superoxides dismutase (SOD) and catalase (CAT) activities was sustained. The CAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings revealed that cocoa would exert radio-protective properties

  2. Analysis of the cocobiota and metabolites of Moniliophthora perniciosa-resistant Theobroma cacao beans during spontaneous fermentation in southern Brazil.

    Science.gov (United States)

    Bastos, Valdeci S; Santos, Maria Fs; Gomes, Laidson P; Leite, Analy Mo; Flosi Paschoalin, Vânia M; Del Aguila, Eduardo M

    2018-03-25

    Cocoa bean fermentation is a spontaneous process involving a succession of microbial activities, yeasts, lactic acid, and acetic acid bacteria. The spontaneous fermentation of cocoa beans by Theobroma cacao TSH565 clonal variety, a highly productive hybrid resistant to Moniliophthora perniciosa and Phytophthora spp., was investigated. The natural cocobiota involved in the spontaneous fermentation of this hybrid in southern Brazil, was investigated by using both a culture-dependent microbiological analysis and a molecular analysis. The changes in the physicochemical characteristics and the kinetics of substrate utilization and metabolite production during fermentation were also evaluated. Yeasts (178) and bacteria (244) isolated during fermentation were identified by partial sequencing of the ITS and 16S rDNAs, respectively. After 144 h of fermentation, the indigenous yeast community was composed of Hanseniaspora spp., Saccharomyces spp., and Pichia spp. The bacterial population comprised Lactococcus spp., Staphylococcus spp., Acetobacter spp. and Lactobacilli strains. The kinetics of substrate transformation reflected the dynamic composition of the cocobiota. Substrates such as glucose, fructose, sucrose, and citric acid, present at the beginning of fermentation, were metabolized to produce ethanol, acetic acid, and lactic acid. The results described here provide new insights into microbial diversity in cocoa bean-pulp mass fermentation and the kinetics of metabolites synthesis, and pave the way for the selection of starter cultures to increase efficiency and consistency to obtain homogeneous and best quality cocoa products. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  3. Isolation of dimeric, trimeric, tetrameric and pentameric procyanidins from unroasted cocoa beans (Theobroma cacao L.) using countercurrent chromatography.

    Science.gov (United States)

    Esatbeyoglu, Tuba; Wray, Victor; Winterhalter, Peter

    2015-07-15

    The main procyanidins, including dimeric B2 and B5, trimeric C1, tetrameric and pentameric procyanidins, were isolated from unroasted cocoa beans (Theobroma cacao L.) using various techniques of countercurrent chromatography, such as high-speed countercurrent chromatography (HSCCC), low-speed rotary countercurrent chromatography (LSRCCC) and spiral-coil LSRCCC. Furthermore, dimeric procyanidins B1 and B7, which are not present naturally in the analysed cocoa beans, were obtained after semisynthesis of cocoa bean polymers with (+)-catechin as nucleophile and separated by countercurrent chromatography. In this way, the isolation of dimeric procyanidin B1 in considerable amounts (500mg, purity>97%) was possible in a single run. This is the first report concerning the isolation and semisynthesis of dimeric to pentameric procyanidins from T. cacao by countercurrent chromatography. Additionally, the chemical structures of tetrameric (cinnamtannin A2) and pentameric procyanidins (cinnamtannin A3) were elucidated on the basis of (1)H NMR spectroscopy. Interflavanoid linkage was determined by NOE-correlations, for the first time. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Study on the presence and influence of phenolic compounds in callogenesis and somatic embryo development of cocoa (Theobroma cacao L..

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2015-04-01

    Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.

  5. Prediction of fermentation index of cocoa beans (Theobroma cacao L.) based on color measurement and artificial neural networks.

    Science.gov (United States)

    León-Roque, Noemí; Abderrahim, Mohamed; Nuñez-Alejos, Luis; Arribas, Silvia M; Condezo-Hoyos, Luis

    2016-12-01

    Several procedures are currently used to assess fermentation index (FI) of cocoa beans (Theobroma cacao L.) for quality control. However, all of them present several drawbacks. The aim of the present work was to develop and validate a simple image based quantitative procedure, using color measurement and artificial neural network (ANNs). ANN models based on color measurements were tested to predict fermentation index (FI) of fermented cocoa beans. The RGB values were measured from surface and center region of fermented beans in images obtained by camera and desktop scanner. The FI was defined as the ratio of total free amino acids in fermented versus non-fermented samples. The ANN model that included RGB color measurement of fermented cocoa surface and R/G ratio in cocoa bean of alkaline extracts was able to predict FI with no statistical difference compared with the experimental values. Performance of the ANN model was evaluated by the coefficient of determination, Bland-Altman plot and Passing-Bablok regression analyses. Moreover, in fermented beans, total sugar content and titratable acidity showed a similar pattern to the total free amino acid predicted through the color based ANN model. The results of the present work demonstrate that the proposed ANN model can be adopted as a low-cost and in situ procedure to predict FI in fermented cocoa beans through apps developed for mobile device. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. Quantification of diazotrophs bacteria isolated from cocoa soils (Theobroma cacao L., by the technique of Most Probable Number (MPN

    Directory of Open Access Journals (Sweden)

    Adriana Zulay Argüello Navarro

    2016-07-01

    Full Text Available The objective of this research was to quantify diazotrophic bacteria and compare physicochemically rhizospheric soils of three cocoa plantations (Theobroma cacao L. in Norte de Santander Department, Colombia; for which they were characterized, differing in cultivated area, agronomic management and crop age. From serial dilutions of the samples and using the technique of Most Probable Number (MPN, In semisolid culture media (NFb, JMV, LGI, JNFb, the diazotrophs were quantified, evaluating as positive the formation of a subsurface film in the medium contained in sealed vials; equal samples were sent to the Bioambiental laboratory (UNET for physicochemical analyzes. As a result, the evaluated samples showed deficiencies in the percentage of organic matter and elements such as Potassium, Phosphorus and Magnesium. Statistically highly significant differences in MPN were reported. The highest quantification of diazotrophs was reported in the Florilandia farm, which was characterized by drip irrigation. The highest quantification of diazotrophs was recorded in the media NFb and JMV, demonstrating a greater presence of the presumed genera Azospirillum sp. and Burkholderia sp. which are easily isolated from rhizospheric soils, unlike the genera Herbaspirillum sp. and Gluconacetobacter sp. which by their endophytic character tend to be less predominant in this type of samples. It is also concluded that the physicochemical characteristics of the soil, humidity and climatic relationships at the moment of sampling, condition the amount of root exudates and therefore are factors that conditioned the presence of diazotrophs in the samples.

  7. Effect of fertigation through drip and micro sprinkler on plant biometric characters in cocoa (Theobroma cacao L.).

    Science.gov (United States)

    Krishnamoorthy, C; Rajamani, K

    2013-12-15

    A field experiment to study the influence of fertigation of N, P and K fertilizers on biometric characters of cocoa (Theobroma cacao L.) was conducted at the Department of Spices and Plantation Crops, Horticultural College and Research Institute, Tamil Nadu Agricultural University, Coimbatore during January 2010 to December 2011. The experiment was laid out with thirteen treatments replicated three times in a randomized block design. A phenomenal increase in growth parameters such as trunk girth, canopy spread and weight of the pruned branches removed, leaf fresh weight and leaf dry weight was observed with increasing levels of NPK as well as methods of fertilizer application in this study. Among the various treatments, fertigation with 125% 'Recommended Dose of Fertilizers' (125:50:175 g NPK plant year(-1)) as Water Soluble Fertilizers (WSF) through drip irrigation increased all vegetative growth parameters like trunk girth increment (1.62 cm), canopy spread increment (66.79 cm), leaf fresh weight (3.949 g), leaf dry weight (2.039 g), weight of the pruned branches removed (fresh weight 7.628 kg plant(-1)) and dry weight (4.650 kg plant(-1)).

  8. Insight into the wild origin, migration and domestication history of the fine flavour Nacional Theobroma cacao L. variety from Ecuador.

    Science.gov (United States)

    Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire

    2012-01-01

    Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR) markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.

  9. Sulawesi cacao (Theobroma cacao, l.) performances under two different agricultural system in east coast of Central Sulawesi

    Science.gov (United States)

    Muslimin; Wijayanti, W.; Anshary, A.; Basri, Z.; Cruz, A. F.; Suwastika, I. N.; Shiina, T.

    2018-04-01

    Cacao (Theobroma cacao L.) is one major agricultural commodity from central Sulawesi, which is significantly affected by a range of pest and diseases including Cacao Pod Borer (CPB), Pod Rod Diseases (PRD), and Vascular Streak Dieback (VSD). Intensive and extensive approaches, including introduction of various new superior cultivars/clones, and development of eco-friendly agricultural system were implemented in order to overtake that problem. Here, we observed the performance of three different clones (namely: Sulawesi 1, MCC01, and Tadulako-1) in two different locations (Parigi and Poso-which located along east coast of central Sulawesi province), and under two different Agricultural management system (echo-friendly-intensive and Non-Intensive). All clones tested showed their well-adapted and suitable to local conditions. The performance of each clone can be improved by intensive management system. Based on all observed parameters (number of wet bean per pot, bean count, fat and shell percentage, and percentage of infection) it convincingly showed that intensive management system was working well in improving the quality and quantity of cacao beans production, and it fit to commercial requirements. The highest rate of infection was by Phytophthora, and no significant differences on the overall performances. Clones of Sulawesi-1 and MCC01 most likely was better than Tadulako-1.

  10. Selection of Lactic Acid Bacteria with Probiotic Potential Isolated from the Fermentation Process of "Cupuaçu" (Theobroma grandiflorum).

    Science.gov (United States)

    Ornellas, Roberta Maria Santos; Santos, Tiza Teles; Arcucio, Leonardo Borges; Sandes, Sávio Henrique Cicco; Oliveira, Mayara Messias; Dias, Cristiano Villela; de Carvalho Silva, Samuel; Uetanabaro, Ana Paula Trovatti; Vinderola, Gabriel; Nicoli, Jacques Robert

    2017-01-01

    In the present study, nine lactic acid bacteria isolated from the fermentation process of "cupuaçu" (Theobroma grandiflorum) were selected for probiotic use. In vitro (resistance to gastrointestinal environment, in vitro antagonism and co-aggregation with pathogens) and in vivo (intestinal colonization and ex vivo antagonism in germ-free mice, cumulative mortality, translocation to liver and spleen, histopathological examination of liver and ileum and mRNA cytokine gene expression during an experimental infection with S. Typhimurium) assays were used. Among the nine Lactobacillus strains isolated from the "cupuaçu" fermentation, L. plantarum 81 and L. plantarum 90 were selected as potential probiotics based on better results obtained in in vitro evaluations (production of diffusible inhibitory compounds and co-aggregation) as well as in vivo experiments (resistance to gastrointestinal environment, ex vivo antagonism, higher survival after enteropathogen challenge, lower hepatic translocation of enteropathogen, lower histopathological lesions in ileum and liver and anti-inflammatory pattern of immunological response). Concluding, L. plantarum 81 and L. plantarum 90 showed in vitro and in vivo capacities for probiotic use through different mechanisms of protection and its origin would allow an easier adaptation in an alimentary matrix for its administration.

  11. Genetic diversity analyses of Lasiodiplodia theobromae on Morus alba and Agave sisalana based on RAPD and ISSR molecular markers

    Directory of Open Access Journals (Sweden)

    Hong-hui Xie

    2016-10-01

    Full Text Available Genetic diversity of 23 Lasiodiplodia theobromae isolates on Morus alba and 6 isolates on Agave sisalana in Guangxi province, China, was studied by using random amplified polymorphic DNA and inter-simple sequence repeat molecular markers. Results of two molecular markers showed that the average percentage of polymorphic loci of all isolates was more than 93%. Both dendrograms of two molecular markers showed obvious relationship between groups and the geographical locations where those strains were collected, among which, the 23 isolates on M. alba were divided into 4 populations and the 6 isolates on A. sisalana were separated as a independent population. The average genetic identity and genetic distance of 5 populations were 0.7215, 0.3284 and 0.7915, 0.2347, respectively, which indicated that the genetic identity was high and the genetic distance was short in the 5 populations. Average value of the gene diversity index (H and the Shannon’s information index (I of 29 isolates were significantly higher than 5 populations which showed that genetic diversity of those isolates was richer than the populations and the degree of genetic differentiation of the isolates was higher. The Gst and Nm of 29 isolates were 0.4411, 0.6335 and 0.4756, 0.5513, respectively, which showed that the genetic diversity was rich in those isolates.

  12. FOOD-PACKAGING INTERACTION ON THE STABILITY OF CANNED SWEETENED CUPUAÇU (Theobroma grandiflorum Schum. PUREE

    Directory of Open Access Journals (Sweden)

    MARIA TERESA DE ALVARENGA FREIRE

    2016-01-01

    Full Text Available Cupuaçu ( Theobroma grandiflorum Schum. is an exotic fruit with a promising economic potential, particularly due to its strong aroma and creamy texture. This study aimed to produce sweetened cupuaçu puree and evaluate the effects of packaging corrosion on its sensory properties and shelf - life in tinplated cans. After 240 days of storage, the commercially sterile product had average sensory analysis scores of 5.89 ± 0.21, 5.39 ± 0.30, 5.45 ± 0.21 and 5.49 ± 0.25, for appearance, aroma, flavor and overall appreciation, respectively. Sensory acceptance scores did not change during storage (p>0.05. Corrosion potential and low tin and iron levels in the product, which are parameters used to evaluate food - packaging interaction, demonstrated the product remained food - safe throughout its shelf - life. Tinplate is a promising packaging material for sweetened cupuaçu puree due to its mechanical and protective properties. Furthermore, tin plating is an economically viable food technology to extend the shelf - life of cupuaçu products and expand its domestic and international markets.

  13. Insight into the wild origin, migration and domestication history of the fine flavour Nacional Theobroma cacao L. variety from Ecuador.

    Directory of Open Access Journals (Sweden)

    Rey Gaston Loor Solorzano

    Full Text Available Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.

  14. Creation of BAC genomic resources for cocoa ( Theobroma cacao L.) for physical mapping of RGA containing BAC clones.

    Science.gov (United States)

    Clément, D; Lanaud, C; Sabau, X; Fouet, O; Le Cunff, L; Ruiz, E; Risterucci, A M; Glaszmann, J C; Piffanelli, P

    2004-05-01

    We have constructed and validated the first cocoa ( Theobroma cacao L.) BAC library, with the aim of developing molecular resources to study the structure and evolution of the genome of this perennial crop. This library contains 36,864 clones with an average insert size of 120 kb, representing approximately ten haploid genome equivalents. It was constructed from the genotype Scavina-6 (Sca-6), a Forastero clone highly resistant to cocoa pathogens and a parent of existing mapping populations. Validation of the BAC library was carried out with a set of 13 genetically-anchored single copy and one duplicated markers. An average of nine BAC clones per probe was identified, giving an initial experimental estimation of the genome coverage represented in the library. Screening of the library with a set of resistance gene analogues (RGAs), previously mapped in cocoa and co-localizing with QTL for resistance to Phytophthora traits, confirmed at the physical level the tight clustering of RGAs in the cocoa genome and provided the first insights into the relationships between genetic and physical distances in the cocoa genome. This library represents an available BAC resource for structural genomic studies or map-based cloning of genes corresponding to important QTLs for agronomic traits such as resistance genes to major cocoa pathogens like Phytophthora spp ( palmivora and megakarya), Crinipellis perniciosa and Moniliophthora roreri.

  15. Somatic embryogenesis and plant regeneration in elite clones of Theobroma cacao Embriogênese somática e regeneração in vitro de clones elite de Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Thiago Édson Ribeiro da Silva

    2008-10-01

    Full Text Available The objective of this work was to evaluated a procedure for somatic embryogenesis and regeneration of cacao (Theobroma cacao L. elite clones. Petal explants from cacao clones TSH 565 and TSH 1188 were cultured on PCG and SCG-2 media, for calli growth. Somatic embryos were formed on the surface of embryogenic calli after transfer to embryo development (ED medium. Clone TSH 565 showed a higher embryogenic potential than TSH 1188. The best combination of carbon source for embryo induction in ED medium was genotype-specific. Embryogenic callus formations increased in micropore tape-sealed Petri dishes, irrespective of cacao genotype. Mature somatic embryos were successfully converted into plantlets.O objetivo deste trabalho foi avaliar um procedimento para embriogênese somática e regeneração de clones elite de cacau. Pétalas dos clones de cacau TSH 565 e TSH 1188 foram cultivadas em meios PCG e SCG-2 para o crescimento de calos. Embriões somáticos desenvolveram-se na superfície dos calos embriogênicos, após a transferência para o meio ED. O clone TSH 565 apresentou maior potencial embriogênico do que o TSH 1188. A melhor combinação de fonte de carbono quanto à indução de embriões em meio ED foi específica do genótipo. A formação de calos embriogênicos foi superior em placas de Petri seladas com fita hipoalergênica, independentemente do genótipo. Embriões maduros de ambos os genótipos foram convertidos em plântulas.

  16. Identification and mapping of conserved ortholog set(COS) II sequences of cacao and their conversion to SNP markers for marker-assisted selection in Theobroma cocoa and comparative genomics studies

    Science.gov (United States)

    Theobroma cacao is a tree cultivated in the tropics around the world for its seeds that are the source of both chocolate and cocoa butter. The cacao genome sequencing project initiated as a collaboration between USDA, Mars, Inc. and IBM has generated a great deal of transcriptome and genome sequenc...

  17. Polyclonal Antibody-based ELISA in combination with specific PCR amplification of ITS 1 regions for the detection and quantitation of Lasiodiplodia theobromae, causal agent of 2 gummosis in cashew nut plants

    NARCIS (Netherlands)

    Muniz, C.R.; Freire, F.C.O.; Viana, F.M.P.; Cardoso, J.E.; Correia, D.; Jalink, H.; Kema, G.H.J.; Silva, G.F.; Guedes, M.I.F.

    2012-01-01

    Members of Botryosphaeriaceae family are associated with serious diseases in different plants 18 across the world. In cashew nut plants (Anacardium occidentale L.), the fungus Lasiodiplodia 19 theobromae causes a severe group of symptoms related to gummosis that results in decreased nut 20

  18. Theobroma cacao L. pathogenesis-related gene tandem array members show diverse expression dynamics in response to pathogen colonization.

    Science.gov (United States)

    Fister, Andrew S; Mejia, Luis C; Zhang, Yufan; Herre, Edward Allen; Maximova, Siela N; Guiltinan, Mark J

    2016-05-17

    The pathogenesis-related (PR) group of proteins are operationally defined as polypeptides that increase in concentration in plant tissues upon contact with a pathogen. To date, 17 classes of highly divergent proteins have been described that act through multiple mechanisms of pathogen resistance. Characterizing these families in cacao, an economically important tree crop, and comparing the families to those in other species, is an important step in understanding cacao's immune response. Using publically available resources, all members of the 17 recognized pathogenesis-related gene families in the genome of Theobroma cacao were identified and annotated resulting in a set of ~350 members in both published cacao genomes. Approximately 50 % of these genes are organized in tandem arrays scattered throughout the genome. This feature was observed in five additional plant taxa (three dicots and two monocots), suggesting that tandem duplication has played an important role in the evolution of the PR genes in higher plants. Expression profiling captured the dynamics and complexity of PR genes expression at basal levels and after induction by two cacao pathogens (the oomycete, Phytophthora palmivora, and the fungus, Colletotrichum theobromicola), identifying specific genes within families that are more responsive to pathogen challenge. Subsequent qRT-PCR validated the induction of several PR-1, PR-3, PR-4, and PR-10 family members, with greater than 1000 fold induction detected for specific genes. We describe candidate genes that are likely to be involved in cacao's defense against Phytophthora and Colletotrichum infection and could be potentially useful for marker-assisted selection for breeding of disease resistant cacao varieties. The data presented here, along with existing cacao-omics resources, will enable targeted functional genetic screening of defense genes likely to play critical functions in cacao's defense against its pathogens.

  19. Sodium-potassium synergism in Theobroma cacao: stimulation of photosynthesis, water-use efficiency and mineral nutrition.

    Science.gov (United States)

    Gattward, James N; Almeida, Alex-Alan F; Souza, José O; Gomes, Fábio P; Kronzucker, Herbert J

    2012-11-01

    In ecological setting, sodium (Na(+)) can be beneficial or toxic, depending on plant species and the Na(+) level in the soil. While its effects are more frequently studied at high saline levels, Na(+) has also been shown to be of potential benefit to some species at lower levels of supply, especially in C4 species. Here, clonal plants of the major tropical C3 crop Theobroma cacao (cacao) were grown in soil where potassium (K(+)) was partially replaced (at six levels, up to 50% replacement) by Na(+), at two concentrations (2.5 and 4.0 mmol(c) dm(-3)). At both concentrations, net photosynthesis per unit leaf area (A) increased more than twofold with increasing substitution of K(+) by Na(+). Concomitantly, instantaneous (A/E) and intrinsic (A/g(s)) water-use efficiency (WUE) more than doubled. Stomatal conductance (g(s)) and transpiration rate (E) exhibited a decline at 2.5 mmol dm(-3), but remained unchanged at 4 mmol dm(-3). Leaf nitrogen content was not impacted by Na(+) supplementation, whereas sulfur (S), calcium (Ca(2+)), magnesium (Mg(2+)) and zinc (Zn(2+)) contents were maximized at 2.5 mmol dm(-3) and intermediate (30-40%) replacement levels. Leaf K(+) did not decline significantly. In contrast, leaf Na(+) content increased steadily. The resultant elevated Na(+)/K(+) ratios in tissue correlated with increased, not decreased, plant performance. The results show that Na(+) can partially replace K(+) in the nutrition of clonal cacao, with significant beneficial effects on photosynthesis, WUE and mineral nutrition in this major perennial C3 crop. Copyright © Physiologia Plantarum 2012.

  20. Efficient method of protein extraction from Theobroma cacao L. roots for two-dimensional gel electrophoresis and mass spectrometry analyses.

    Science.gov (United States)

    Bertolde, F Z; Almeida, A-A F; Silva, F A C; Oliveira, T M; Pirovani, C P

    2014-07-04

    Theobroma cacao is a woody and recalcitrant plant with a very high level of interfering compounds. Standard protocols for protein extraction were proposed for various types of samples, but the presence of interfering compounds in many samples prevented the isolation of proteins suitable for two-dimensional gel electrophoresis (2-DE). An efficient method to extract root proteins for 2-DE was established to overcome these problems. The main features of this protocol are: i) precipitation with trichloroacetic acid/acetone overnight to prepare the acetone dry powder (ADP), ii) several additional steps of sonication in the ADP preparation and extractions with dense sodium dodecyl sulfate and phenol, and iii) adding two stages of phenol extractions. Proteins were extracted from roots using this new protocol (Method B) and a protocol described in the literature for T. cacao leaves and meristems (Method A). Using these methods, we obtained a protein yield of about 0.7 and 2.5 mg per 1.0 g lyophilized root, and a total of 60 and 400 spots could be separated, respectively. Through Method B, it was possible to isolate high-quality protein and a high yield of roots from T. cacao for high-quality 2-DE gels. To demonstrate the quality of the extracted proteins from roots of T. cacao using Method B, several protein spots were cut from the 2-DE gels, analyzed by tandem mass spectrometry, and identified. Method B was further tested on Citrus roots, with a protein yield of about 2.7 mg per 1.0 g lyophilized root and 800 detected spots.

  1. Application of IBA in environmental remediation using skins of cocoa (Theobroma cacao) and sweet potatoes (Ipomoea batatas)

    Energy Technology Data Exchange (ETDEWEB)

    Sumbu, K. [Department of Chemistry, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa); Mars, J.A.; Gihwala, D. [Department of Biomedical Sciences, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa)

    2013-07-01

    Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)

  2. Prediction of Cacao (Theobroma cacao) Resistance to Moniliophthora spp. Diseases via Genome-Wide Association Analysis and Genomic Selection.

    Science.gov (United States)

    McElroy, Michel S; Navarro, Alberto J R; Mustiga, Guiliana; Stack, Conrad; Gezan, Salvador; Peña, Geover; Sarabia, Widem; Saquicela, Diego; Sotomayor, Ignacio; Douglas, Gavin M; Migicovsky, Zoë; Amores, Freddy; Tarqui, Omar; Myles, Sean; Motamayor, Juan C

    2018-01-01

    Cacao ( Theobroma cacao ) is a globally important crop, and its yield is severely restricted by disease. Two of the most damaging diseases, witches' broom disease (WBD) and frosty pod rot disease (FPRD), are caused by a pair of related fungi: Moniliophthora perniciosa and Moniliophthora roreri , respectively. Resistant cultivars are the most effective long-term strategy to address Moniliophthora diseases, but efficiently generating resistant and productive new cultivars will require robust methods for screening germplasm before field testing. Marker-assisted selection (MAS) and genomic selection (GS) provide two potential avenues for predicting the performance of new genotypes, potentially increasing the selection gain per unit time. To test the effectiveness of these two approaches, we performed a genome-wide association study (GWAS) and GS on three related populations of cacao in Ecuador genotyped with a 15K single nucleotide polymorphism (SNP) microarray for three measures of WBD infection (vegetative broom, cushion broom, and chirimoya pod), one of FPRD (monilia pod) and two productivity traits (total fresh weight of pods and % healthy pods produced). GWAS yielded several SNPs associated with disease resistance in each population, but none were significantly correlated with the same trait in other populations. Genomic selection, using one population as a training set to estimate the phenotypes of the remaining two (composed of different families), varied among traits, from a mean prediction accuracy of 0.46 (vegetative broom) to 0.15 (monilia pod), and varied between training populations. Simulations demonstrated that selecting seedlings using GWAS markers alone generates no improvement over selecting at random, but that GS improves the selection process significantly. Our results suggest that the GWAS markers discovered here are not sufficiently predictive across diverse germplasm to be useful for MAS, but that using all markers in a GS framework holds

  3. Application of IBA in environmental remediation using skins of cocoa (Theobroma cacao) and sweet potatoes (Ipomoea batatas)

    International Nuclear Information System (INIS)

    Sumbu, K.; Mars, J.A.; Gihwala, D.

    2013-01-01

    Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)

  4. The effect of 2,4 dichlorophenoxyacetic acid on in vitro callogenesis of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Sulistyani Pancaningtyas

    2015-08-01

    Full Text Available Cocoa (Theobroma cacao L. development using modern breeding techniques can be facilitated by propagation of planting material through somatic embryogenesis. Various factors that may affect embryogenesis are the composition of culture medium and culture condition. Hormone commonly used to initiate the formation of callus is auxin with type 2.4-D (2.4 Dichlorophenoxy acetic acid. The aim of this study was to determine the effect of the addition of 2.4 -D hormoneson the process of cocoa embryogenesis. The treatments were arragged in factorial combination in completely randomized design, which consisted of two factors. Thefirst factor was the concentration of auxin 2,4-D 25 %, 50 %, 75 %, and 100 %; and the second factor was cocoa clones; Sulawesi 01 and Sulawesi 02. The resultshowed that the addition of 2.4-D hormone up to 100% on somatic embryogenesis of cocoa for Sulawesi 01 clone was not significantly different from Sulawesi 02 clone for all parameters. While on the addition of 2.4-D, there was significant difference between Sulawesi 01 and 02. Cocoa embryogenic callus using the addition of 2.4-D (25%-100% was significantly different from control. Increased concentrations of 2,4-D hormone which is applied onto media would inhibit the formation of the somatic embryo. Addition of 2.4 D 25%, encouraged towards non-embryogenic callus. Keywords: 2.4 Dichlorophenoxy acetic acid, embryogenic callus, somatic embryos, cocoa, medium culture, hormone

  5. Transient Expression of CRISPR/Cas9 Machinery Targeting TcNPR3 Enhances Defense Response in Theobroma cacao.

    Science.gov (United States)

    Fister, Andrew S; Landherr, Lena; Maximova, Siela N; Guiltinan, Mark J

    2018-01-01

    Theobroma cacao , the source of cocoa, suffers significant losses to a variety of pathogens resulting in reduced incomes for millions of farmers in developing countries. Development of disease resistant cacao varieties is an essential strategy to combat this threat, but is limited by sources of genetic resistance and the slow generation time of this tropical tree crop. In this study, we present the first application of genome editing technology in cacao, using Agrobacterium-mediated transient transformation to introduce CRISPR/Cas9 components into cacao leaves and cotyledon cells. As a first proof of concept, we targeted the cacao Non-Expressor of Pathogenesis-Related 3 (TcNPR3) gene, a suppressor of the defense response. After demonstrating activity of designed single-guide RNAs (sgRNA) in vitro , we used Agrobacterium to introduce a CRISPR/Cas9 system into leaf tissue, and identified the presence of deletions in 27% of TcNPR3 copies in the treated tissues. The edited tissue exhibited an increased resistance to infection with the cacao pathogen Phytophthora tropicalis and elevated expression of downstream defense genes. Analysis of off-target mutagenesis in sequences similar to sgRNA target sites using high-throughput sequencing did not reveal mutations above background sequencing error rates. These results confirm the function of NPR3 as a repressor of the cacao immune system and demonstrate the application of CRISPR/Cas9 as a powerful functional genomics tool for cacao. Several stably transformed and genome edited somatic embryos were obtained via Agrobacterium -mediated transformation, and ongoing work will test the effectiveness of this approach at a whole plant level.

  6. Genetic Parameters and the Impact of Off-Types for Theobroma cacao L. in a Breeding Program in Brazil

    Science.gov (United States)

    DuVal, Ashley; Gezan, Salvador A.; Mustiga, Guiliana; Stack, Conrad; Marelli, Jean-Philippe; Chaparro, José; Livingstone, Donald; Royaert, Stefan; Motamayor, Juan C.

    2017-01-01

    Breeding programs of cacao (Theobroma cacao L.) trees share the many challenges of breeding long-living perennial crops, and genetic progress is further constrained by both the limited understanding of the inheritance of complex traits and the prevalence of technical issues, such as mislabeled individuals (off-types). To better understand the genetic architecture of cacao, in this study, 13 years of phenotypic data collected from four progeny trials in Bahia, Brazil were analyzed jointly in a multisite analysis. Three separate analyses (multisite, single site with and without off-types) were performed to estimate genetic parameters from statistical models fitted on nine important agronomic traits (yield, seed index, pod index, % healthy pods, % pods infected with witches broom, % of pods other loss, vegetative brooms, diameter, and tree height). Genetic parameters were estimated along with variance components and heritabilities from the multisite analysis, and a trial was fingerprinted with low-density SNP markers to determine the impact of off-types on estimations. Heritabilities ranged from 0.37 to 0.64 for yield and its components and from 0.03 to 0.16 for disease resistance traits. A weighted index was used to make selections for clonal evaluation, and breeding values estimated for the parental selection and estimation of genetic gain. The impact of off-types to breeding progress in cacao was assessed for the first time. Even when present at <5% of the total population, off-types altered selections by 48%, and impacted heritability estimations for all nine of the traits analyzed, including a 41% difference in estimated heritability for yield. These results show that in a mixed model analysis, even a low level of pedigree error can significantly alter estimations of genetic parameters and selections in a breeding program. PMID:29250097

  7. Absorption of N-phenylpropenoyl-L-amino acids in healthy humans by oral administration of cocoa (Theobroma cacao).

    Science.gov (United States)

    Stark, Timo; Lang, Roman; Keller, Daniela; Hensel, Andreas; Hofmann, Thomas

    2008-10-01

    Besides flavan-3-ols, a family of N-phenylpropenoyl-L-amino acids (NPAs) has been recently identified as polyphenol/amino acid conjugates in the seeds of Theobroma cacao as well as in a variety of herbal drugs. Stimulated by reports on their biological activity, the purpose of this study was to investigate if these amides are absorbed by healthy volunteers after administration of a cocoa drink. For the first time, 12 NPAs were quantified in human urine by means of a stable isotope dilution analysis with LC-MS/MS (MRM) detection. A maximum amount was found in the urine taken 2 h after the cocoa consumption. The highest absolute amount of NPAs excreted with the urine was found for N-[4'-hydroxy-(E)-cinnamoyl]-L-aspartic acid (5), but the highest recovery rate (57.3 and 22.8%), that means the percentage amount of ingested amides excreted with the urine, were determined for N-[4'-hydroxy-(E)-cinnamoyl]-L-glutamic acid (6) and N-[4'-hydroxy-3'-methoxy-(E)-cinnamoyl]-L-tyrosine (13). In order to gain first insights into the NPA metabolism in vivo, urine samples were analyzed by LC-MS/MS before and after beta-glucuronidase/sulfatase treatment. As independent of the enzyme treatment the same NPA amounts were found in urine, there is strong evidence that these amides are metabolized neither via their O-glucuronides nor their O-sulfates. In order to screen for caffeic acid O-glucuronides as potential NPA metabolites, urine samples were screened by means of LC-MS/MS for caffeic acid 3-O-beta-D-glucuronide and 4-O-beta-D-glucuronide. But not even trace amounts of one of these glucuronides were detectable, thus excluding them as major NPA metabolites and underlining the importance of future investigations on a potential O-methylation or reduction of the N-phenylpropenoyl moiety in NPAs.

  8. Application of neem (Azadirachta indica) as biological pesticides in cocoa seed (Theobroma cacao) storage using various local adsorbent media

    Science.gov (United States)

    Mardiyani, S. A.; Sunawan; Pawestri, A. E.

    2018-03-01

    Cocoa seeds are recalcitrant (the water content is more than 40%) that require special handling. The use of adsorbent media to reduce the decrease in the quality of cocoa seeds and extend their shelf life in this storage has not been widely done. Local adsorbent media such as sawdust, sand and ash have the potential to maintain the viability of cocoa seeds. The objective of this research was to determine the interaction of the application of neem (Azadirachta indica) as biological pesticides and the use of various natural adsorbent media in the storage of cocoa seeds (Theobroma cacao). It was an experimental study with a factorial design composed of three factors. The first factor was the medium adsorbent type for the storage of cocoa seed, which consists of three levels (river sand, ash, and sawdust). The second factor was the concentration of neem leaves for pre-storage treatment with three levels (10, 20, and 30%). The third factor was the storage time (10 and 20 days). The results of the study indicated that the combination of the three factors showed a significant interaction in the height of the plant and the diameter of the stem of the seedling at 28 days after sowing. The fresh weight of the seedlings of the seeds that were stored in ash media gave a better result than the seedlings of seeds that had been stored in the river sand and the sawdust as adsorbent media. The application of 20% extract of neem leaves gave the best influence for the seeds that were stored for 20 days.

  9. Identificación de un gen codificante de polifenol oxidasa (PPO en Theobroma cacao L. (cacao de Ecuador

    Directory of Open Access Journals (Sweden)

    Jaime Morante-Carriel

    2017-12-01

    Full Text Available En Ecuador, las plantaciones de cacao presentan bajos promedios de producción debido a la diversidad de patógenos, especialmente a la infección por Moniliophthora roreri (monilia. Se cree que existe una relación entre el ataque del hongo y el aumento de los niveles de expresión de genes codificantes de polifenol oxidasas (PPOs como mecanismo de defensa ante patógenos y herbívoros en diferentes plantas. Para la identificación de genes que codifican para PPOs, se seleccionaron hojas de cacao Nacional, provenientes de plantas resistentes y susceptibles a monilia, ubicadas en la Finca Experimental La Represa, propiedad de la Universidad Técnica Estatal de Quevedo. Se afinó un protocolo de extracción de ARN total de alta calidad para hojas de cacao recalcitrantes. Después de su retrotranscripción a ADNc, se realizaron ensayos de amplificación por PCR con diferentes primers, diseñados a partir de secuencias conservadas de PPOs. Los productos de amplificación permitieron la identificación de un gen de 961 pb, similar a un gen que codifica para la PPO predictiva de Theobroma cacao depositada en NCBI (XP_017978715.1 La identificación de este gen, es fundamental para evaluar a futuro los niveles de expresión y cuantificación en diferentes estados de desarrollo del fruto. Dicha cuantificación permitirá proponer herramientas de control para monilia y construir las bases para el mejoramiento genético del cacao Nacional.

  10. Photosynthetic pigments and stomatal conductance in ecotypes of copoazu (Theobroma grandi orum Willd. Ex. Spreng K. Schum..

    Directory of Open Access Journals (Sweden)

    Juan Carlos Suárez-Salazar

    2016-12-01

    Full Text Available The objective of this work was to evaluate the variability of photosynthetic pigment content and daily stomatal conductance was evaluated in relation to environmental variables in Copoazú (Theobroma grandi orum ecotypes. The ecotypes used were part of the germoplasm bank of the University of the Amazon (Colombia. The study was carried out during the year 2015. Four leaves of the average stratum of four plants were collected for each ecotype, to extract and read at different levels of absorbance and determine the content of photosynthetic pigments. During the hours of 04:00 a.m. to 6:00 p.m., the stomatal conductance (gs was monitored for environmental variables (relative humidity, air temperature, radiation and vapor pressure de cit (VPD. An analysis of variance was made using the Tukey test, correlations and regressions were made between gs and environmental variables. The contents of chlorophyll a, b, total and carotenoids among ecotypes were different (P<0.0001, the ecotype UA-31 presented the highest values, contrasting with the ecotype UA-37. Concerning gs, the interaction ecotype*hour showed signi cant differences (P<0.0001 .The ecotypes that presented the highest values of gs were UA-67 and UA-039, (P<0.0001, radiation (-0.91, P<0.0001 and DPV (-0.94; P<0.0001 0.0001.The results suggest that ecotypes UA-039 and UA-31 were the most suitable in terms of gaseous exchange and content of photosynthetic pigments.

  11. Successful pod infections by Moniliophthora roreri result in differential Theobroma cacao gene expression depending on the clone's level of tolerance.

    Science.gov (United States)

    Ali, Shahin S; Melnick, Rachel L; Crozier, Jayne; Phillips-Mora, Wilberth; Strem, Mary D; Shao, Jonathan; Zhang, Dapeng; Sicher, Richard; Meinhardt, Lyndel; Bailey, Bryan A

    2014-09-01

    An understanding of the tolerance mechanisms of Theobroma cacao used against Moniliophthora roreri, the causal agent of frosty pod rot, is important for the generation of stable disease-tolerant clones. A comparative view was obtained of transcript populations of infected pods from two susceptible and two tolerant clones using RNA sequence (RNA-Seq) analysis. A total of 3009 transcripts showed differential expression among clones. KEGG (Kyoto Encyclopedia of Genes and Genomes) pathway analysis of differentially expressed genes indicated shifts in 152 different metabolic pathways between the tolerant and susceptible clones. Real-time quantitative reverse transcription polymerase chain reaction (real-time qRT-PCR) analyses of 36 genes verified the differential expression. Regression analysis validated a uniform progression in gene expression in association with infection levels and fungal loads in the susceptible clones. Expression patterns observed in the susceptible clones diverged in tolerant clones, with many genes showing higher expression at a low level of infection and fungal load. Principal coordinate analyses of real-time qRT-PCR data separated the gene expression patterns between susceptible and tolerant clones for pods showing malformation. Although some genes were constitutively differentially expressed between clones, most results suggested that defence responses were induced at low fungal load in the tolerant clones. Several elicitor-responsive genes were highly expressed in tolerant clones, suggesting rapid recognition of the pathogen and induction of defence genes. Expression patterns suggested that the jasmonic acid-ethylene- and/or salicylic acid-mediated defence pathways were activated in the tolerant clones, being enhanced by reduced brassinosteroid (BR) biosynthesis and catabolic inactivation of both BR and abscisic acids. Finally, several genes associated with hypersensitive response-like cell death were also induced in tolerant clones. © 2014

  12. Prediction of Cacao (Theobroma cacao Resistance to Moniliophthora spp. Diseases via Genome-Wide Association Analysis and Genomic Selection

    Directory of Open Access Journals (Sweden)

    Michel S. McElroy

    2018-03-01

    Full Text Available Cacao (Theobroma cacao is a globally important crop, and its yield is severely restricted by disease. Two of the most damaging diseases, witches’ broom disease (WBD and frosty pod rot disease (FPRD, are caused by a pair of related fungi: Moniliophthora perniciosa and Moniliophthora roreri, respectively. Resistant cultivars are the most effective long-term strategy to address Moniliophthora diseases, but efficiently generating resistant and productive new cultivars will require robust methods for screening germplasm before field testing. Marker-assisted selection (MAS and genomic selection (GS provide two potential avenues for predicting the performance of new genotypes, potentially increasing the selection gain per unit time. To test the effectiveness of these two approaches, we performed a genome-wide association study (GWAS and GS on three related populations of cacao in Ecuador genotyped with a 15K single nucleotide polymorphism (SNP microarray for three measures of WBD infection (vegetative broom, cushion broom, and chirimoya pod, one of FPRD (monilia pod and two productivity traits (total fresh weight of pods and % healthy pods produced. GWAS yielded several SNPs associated with disease resistance in each population, but none were significantly correlated with the same trait in other populations. Genomic selection, using one population as a training set to estimate the phenotypes of the remaining two (composed of different families, varied among traits, from a mean prediction accuracy of 0.46 (vegetative broom to 0.15 (monilia pod, and varied between training populations. Simulations demonstrated that selecting seedlings using GWAS markers alone generates no improvement over selecting at random, but that GS improves the selection process significantly. Our results suggest that the GWAS markers discovered here are not sufficiently predictive across diverse germplasm to be useful for MAS, but that using all markers in a GS framework holds

  13. Selection of Reference Genes for Expression Study in Pulp and Seeds of Theobroma grandiflorum (Willd. ex Spreng. Schum.

    Directory of Open Access Journals (Sweden)

    Lucas Ferraz Dos Santos

    Full Text Available Cupuassu (Theobroma grandiflorum [Willd. ex Spreng.] Schum is a species of high economic importance in Brazil with great potential at international level due to the multiple uses of both its seeds and pulp in the industry of sweets and cosmetics. For this reason, the cupuassu breeding program focused on the selection of genotypes with high pulp and seed quality-selection associated with the understanding of the mechanisms involved in fruit formation. Gene expression is one of the most used approaches related to such understanding. In this sense, quantitative real-time PCR (qPCR is a powerful tool, since it rapidly and reliably quantifies gene expression levels across different experimental conditions. The analysis by qPCR and the correct interpretation of data depend on signal normalization using reference genes, i.e. genes presenting a uniform pattern of expression in the analyzed samples. Here, we selected and analyzed the expression of five genes from cupuassu (ACP, ACT, GAPDH, MDH, TUB to be used as candidates for reference genes on pulp and seed of young, maturing and mature cupuassu fruits. The evaluation of the gene expression stability was obtained using the NormFinder, geNorm and BestKeeper programs. In general, our results indicated that the GAPDH and MDH genes constituted the best combination as reference genes to analyze the expression of cupuassu samples. To our knowledge, this is the first report of reference gene definition in cupuassu, and these results will support subsequent analysis related to gene expression studies in cupuassu plants subjected to different biotic or abiotic conditions as well as serve as a tool for diversity analysis based on pulp and seed quality.

  14. Effects of enriched compost with efficient microorganisms on the germination of recalcitrant seeds of breadfruit (Parkinson Fosberg and Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Yánez Yánez Wilfrido

    2016-11-01

    Full Text Available The research was conducted at the Center for Research, Graduate Studies and Amazon Conservation (CIPA of the Amazon State University, Ecuador. The purpose was to assess the effect of enriched compost Germination, day and day’s emergency transplantation two species of tropical origin and breadfruit Theobroma cacao. The experimental field is located in the province of Napo, 16'-1 and S and 77º 36'' 58'y 76'' W, at an altitude of 556 meters, with temperature between 18 and 32oC, average annual precipitation above 3000mm and relative humidity between 87 and 89%. An experimental design with five treatments in a randomized complete block design with three replications was applied. Treatments consisted of compost (1 MS, (2 lactic acid bacteria, (3 commercial yeast, (4 a combination thereof and (5 only compost, witness. It was determined that the compost mixture (T4 as a whole, has the greatest effect on the parameters of the seeds. Germination was found that in two of the T3 and T4 treatments significantly decreased the number of days to germination, in relation to the witness, 33 days and 13 days Artocarpus altilis, Theobroma cacao. The number of emerged plants, increase in both species with the addition of EM, lactic acid bacteria and commercial yeast (T4. a reduction is also reported in the days to transplant species studied to be significant particularly in cocoa. It was also determined that most bioburden corresponded to bacteria.

  15. Influência do substrato no crescimento de mudas de cupuaçu (Theobroma grandiflorum Schum. = Influence of the substrate on the growth of cupuassu (Theobroma grandiflorum Schum. seedlings

    Directory of Open Access Journals (Sweden)

    Maria das Graças Rodrigues Ferreira

    2009-10-01

    Full Text Available Entre as fruteiras amazônicas, destaca-se o cupuaçuzeiro, espécie de recente domesticação que vêm sendo valorizada por suas características de sabor e aroma. Um dos fatores determinantes para produção de mudas é a recomendação do substrato mais apropriado e, para espécies nativas, esta informação ainda é escassa. O objetivo deste trabalho foi avaliar o efeito de diferentes substratos na velocidade de germinação das sementes e no crescimento das mudas decupuaçu. O trabalho foi realizado em casa-de-vegetação, sendo testados sete substratos: terra vegetal + areia (1:1, terra vegetal, bioplant®, bioclone®, plugmix®, areia e vermiculita. Foram avaliadas as características: índice de velocidade de emergência (IVE, comprimento da raiz (CR, comprimento da parte aérea (CPA, biomassa seca da raiz (BSR e biomassa seca da parte aérea (BSPA, em delineamento experimental inteiramente casualizado com sete tratamentos, com quatro repetições de 15 sementes. As médias dos efeitos de substrato foram agrupadas pelo teste de Scott-Knott e a recomendação dos substratos foi realizada com o auxílio da técnicamultivariada de variáveis canônicas. O substrato bioclone® se destacou na maioria das características de germinação e qualidade das mudas avaliadas.The cupuassu (Theobroma grandiflorum stands out as an important recently domesticated Amazon fruit. Although the substrate is a prime factor for plantlet development, there are few recommendations for cupuassu plantlet production. The objective of this work was to evaluate the influence of different substrates on cupuassu germination and seedling growth. Seven substrates were tested in greenhouse conditions: vegetable soil + sand (1:1, vegetable soil, bioplant®, bioclone®, plugmix®, sand and vermiculite. The following germination and seedling traits were evaluated: germination speedindex, length and dry mass of roots and aerial parts; using a completely randomized design

  16. Use of Trichoderma fungi in spray solutions to reduce Moniliophthora roreri infection of Theobroma cacao fruits in Northeastern Costa Rica.

    Science.gov (United States)

    Seng, John; Herrera, Geovanny; Vaughan, Christopher S; McCoy, Michael B

    2014-09-01

    Cacao (Theobroma cacao) is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthllora roreri, known commonly as "monilia", has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Thichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia) at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma). Each treatment was applied to four trees of each clone. We monitored the incidence of monilia infection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p ≤ 0.05) in only 35d, as compared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1,500 kg dried beans/ha by 198 kg/ha up to 1,698 kg/ha or by a total increase over the whole 110 ha plantation by 21,780 kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days) would decrease infection incidence even more. Application of this fungal control

  17. Doxorubicin induced neuro- and cardiotoxicities in experimental rats: Protection against oxidative damage by Theobroma cacao Stem bark

    Directory of Open Access Journals (Sweden)

    A.M. Kosoko

    2017-07-01

    Full Text Available 80 rats, randomly selected, were divided into 3 treatment groups: pre-, co- and post-treatment; consisting of 6 sub-groups each (5 rats per sub-group: baseline, normal saline (2 mL, α-lipoic acid (20 mg/kg body weight, 200 mg/kg, 400 mg/kg or 800 mg/kg body weight Theobroma cacao stem bark aqueous extract (TCAE. All rats except for baseline group were intoxicated with 20 mg/kg body weight doxorubicin (DOX intraperitoneally. The animals in pre- or post-treatment group received a single dose of DOX (20 mg/kg body weight intraperitoneally 24 h before or after 7 days’ oral administration with TCAE respectively while those in co-treatment group were co-administered 2.86 mg/kg body weight of DOX with either normal saline, α- lipoic acid or TCAE orally for 7 days. Animals were sacrificed (pre- and post- treatment groups were sacrificed on the ninth day while the co-treatment group sacrificed on the 8th day. Brain and heart tissue samples were harvested for enzyme markers of toxicity, oxidative stress and histopathological examinations. DOX intoxication caused significant decrease in activities of LDH and ACP, and increase in γGT and ALP activities in brain tissues while causing a significant increase in LDH, ACP, γGT activities and decrease in ALP activity in the cardiac tissues. DOX intoxication caused a significant increase in concentrations of H2O2 generated, MDA and PC, XO, MPx and NOX activities with concomitant decrease in CAT, SOD, GPx and GST activities, and in concentrations of GSH, AsA and α-Toc in brain and cardiac tissues. Pre-, co- and post-treatment with TCAE at either 200 mg/kg, 400 mg/kg or 800 mg/kg body weight significantly reversed the oxidative damage to the organs induced by DOX-intoxication. The result affirmed that T. cacao stem bark aqueous extract protected against DOX induced oxidative damage in brain and cardiac tissues of experimental rats.

  18. Use of Trichoderma fungi in spray solutions to reduce Moniliophthora roreri infection of Theobroma cacao fruits in Northeastern Costa Rica

    Directory of Open Access Journals (Sweden)

    John Seng

    2014-09-01

    Full Text Available Cacao (Theobroma cacao is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthora roreri, known commonly as “monilia”, has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. Fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Trichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma. Each treatment was applied to four trees of each clone. We monitored the incidence of moniliainfection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p<0.05 in only 35d, ascompared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1 500kg dried beans/ha by 198kg/ha up to 1 698kg/ha or by a total increase over the whole 110ha plantation by 21 780kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days would decrease infection incidence even more. Application of this fungal

  19. Analisis Pindah Panas pada Ruang Fermentasi Biji Kakao (Theobroma cacao L dengan Menggunakan Kotak Kayu dan Styrofoam

    Directory of Open Access Journals (Sweden)

    Fazzatul Rahmi

    2017-04-01

    Full Text Available Abstrak. Fermentasi merupakan kegiatan untuk melepaskan zat lendir dari permukaan kulit biji dan menghasilkan biji mutu dan aroma yang baik. Selain itu fermentasi juga dilakukan untuk menghindari tumbuhnya jamur selama masa penyimpanan. Selama fermentasi berlangsung akan terjadinya perpindahan panas/ suhu di dalam kotak fermentasi. Tujuan yang ingin dicapai dalam penelitian yaitu untuk melihat perubahan suhu selama proses fermentasi, mengetahui pengaruh bahan kotak (kayu dan styrofoam terhadap perpindahan panas di dalam kotak fermentasi dan perpindahan panas dari dalam kotak fermentasi terhadap lingkungan luar. Hasil penelitian yang diperoleh bahwa suhu ideal fermentasi pada kotak kayu dihasilkan pada hari ke-5, sedangkan kotak styrofoam suhu ideal dihasilkan pada hari ke-3. Perpindahan panas pada bahan kayu suhunya lebih tinggi dibandingkan dengan bahan styrofoam. Hal ini disebabkan karena panas pada kotak kayu keluar lebih cepat, sehingga suhu pada proses fermentasi bisa lebih rendah dibandingkan menggunakan kotak styrofoam. Hasil fermentasi biji kakao dengan menggunakan kotak kayu didapatkan biji kakao yang bagus yaitu pada hari ke-5 fermentasi dan kotak styrofoam pada hari ke-5 fermentasi didapatkan biji kakao yang berjamur.   Analysis Of Transfer Heat Room Of Cocoa Seed Fermentation (Theobroma cacao L. Using Wood Box and Styrofoam Abstract. Fermentation is an activity to remove mucous substances from the skin surface to produce quality of seed and good aroma. In addition, fermentation also done to avoid the growth of mold during storage period. During fermentation, the heat transfer / temperature will be happen inside the fermentation box. The aim of this study is to observe the changes of temperature during the fermentation process, knowing the effect of packaging materials (wood and styrofoam to heat transfer in the fermentation box and heat transfer from inside of fermentation box to the environment in the outside. The results showed

  20. Endophytic Association of Trichoderma asperellum within Theobroma cacao Suppresses Vascular Streak Dieback Incidence and Promotes Side Graft Growth.

    Science.gov (United States)

    Rosmana, Ade; Nasaruddin, Nasaruddin; Hendarto, Hendarto; Hakkar, Andi Akbar; Agriansyah, Nursalim

    2016-09-01

    Trichoderma species are able to persist on living sapwood and leaves of cacao ( Theobroma cacao ) in an endophytic relationship. In this research, we evaluated the ability of Trichodema asperellum introduced at the incision site in the bark for side grafting with the concentration of 4 g/10 mL, 4 g/100 mL, and 4 g/1,000 mL (suspended in water) in suppressing vascular streak dieback (VSD) incidence and promoting growth of side grafts in the field. The incidence of VSD in two local clones of cacao, MCC1 and M04, without application of T. asperellum was 71.2% and 70.1% at 21 wk after grafting, respectively. However, when the two clones were treated with a concentration of 4 g/10 mL T. asperellum , the incidence was 20.6% and 21.7%, respectively, compared to 29.1% and 20.9% at 4 g/100 mL and 18.2% and 15.6% at 4 g/1,000 mL. By comparing to the control, the treatment with the same concentrations of T. asperellum listed above, the total number of stomata in MCC1 decreased by 41.9%, 30.2%, and 14.0% and in M04 by 30.5%, 21.9%, and -2.5% (exception), respectively. Otherwise, the total area of stomata opening increased by 91.4%, 99.7%, and 28.6% in MCC1 and by 203.8%, 253.5%, and 35.9% in M04, respectively. Furthermore, the number of buds and branches treated with a mixture concentration on the the two clones increased by 90.7% and 21.7%, respectively. These data showed that the application of T. asperellum to cacao scions while grafting can decrease VSD incidence in side grafts and increase growth of grafts in addition to decreasing total number of stomata, increasing total area of opened stomata, and increasing number of buds and branches.

  1. A Larger Chocolate Chip—Development of a 15K Theobroma cacao L. SNP Array to Create High-Density Linkage Maps

    Directory of Open Access Journals (Sweden)

    Donald Livingstone

    2017-12-01

    Full Text Available Cacao (Theobroma cacao L. is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.

  2. Effect of culture media and environmental factors on mycelial growth and pycnidial production of Lasiodiplodia theobromae in physic nut (Jatropha curcas).

    Science.gov (United States)

    Latha, P; Prakasam, V; Jonathan, E I; Samiyappan, R; Natarajan, C

    2013-07-01

    Physic nut (Jatropha curcas) is an important commercial bio-diesel plant species and is being advocated for development of waste and dry land. The collar and root rot caused by Lasiodiplodia theobromae is an important soil borne disease which causes considerable yield loss in this crop. In this study, the effects of culture media, temperature, photoperiod, carbon and nitrogen sources and pH on mycelial growth and pycnidial production were evaluated. Among the growth media tested, potato dextrose agar supported the highest growth followed by potato sucrose agar and corn meal agar. Among several carbon sources tested, carboxy methyl cellulose and sucrose were found superior for growth and pycnidial production. The nitrogen sources viz., ammonium oxalate and ammonium dihydrogen phosphate were recorded maximum mycelial growth and pycnidial production. The fungus grows at pH 5.0-9.0 and optimum growth was observed at pH 7.0.

  3. A Larger Chocolate Chip-Development of a 15K Theobroma cacao L. SNP Array to Create High-Density Linkage Maps.

    Science.gov (United States)

    Livingstone, Donald; Stack, Conrad; Mustiga, Guiliana M; Rodezno, Dayana C; Suarez, Carmen; Amores, Freddy; Feltus, Frank A; Mockaitis, Keithanne; Cornejo, Omar E; Motamayor, Juan C

    2017-01-01

    Cacao ( Theobroma cacao L.) is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.

  4. Avaliação e seleção de progênies de cupuaçuzeiro (Theobroma grandiflorum, em Belém, Pará Evaluation and selection of Theobroma grandiflorum parents, in Belem, Para

    Directory of Open Access Journals (Sweden)

    Rafael Moysés Alves

    2010-03-01

    Full Text Available Este trabalho teve por objetivo a seleção entre e dentro de progênies de irmãos completos de cupuaçuzeiro. Foram avaliadas 21 progênies de irmãos completos, em dois experimentos, com cinco plantas por parcela. Os experimentos foram avaliados ao nível de indivíduos, em cada safra, para os caracteres: produção de frutos, polpa e semente, bem como resistência à vassoura-de-bruxa. Para efeito de seleção, também foi considerado o grau de parentesco das matrizes. As análises foram conduzidas via metodologia de modelos lineares mistos, como delineamento em blocos incompletos, desbalanceados com tratamentos comuns. Foram estimados os parâmetros genéticos e os valores genotípicos ajustados de progênies, bem como os valores genéticos aditivos e genotípicos individuais. Os resultados demonstraram que as progênies 12; 13; 18; 20; 21 e 24 tiveram os melhores desempenhos para as variáveis de produção. Entre elas, as progênies 12; 13 e 18 foram as que mais se destacaram. Foram selecionadas três matrizes da progênie 18, duas matrizes da progênie 12 e uma matriz de cada uma das progênies 13; 20 e 21. É possível concluir que essas matrizes, juntamente com materiais selecionados em outras áreas experimentais, apresentam potencial para compor um pomar de sementes clonais, estabelecido em lote isolado de outros plantios, onde será produzida uma população melhorada de primeiro ciclo que se constituirá na nova cultivar de cupuaçuzeiro.This paper had as objective the selection among and within full sib families of Theobroma grandiflorum. A total of 21 full sibs progenies were appraised, in two experiments, with five plants for plot. The experiments were appraised at the individuals' level, in each crop, for the traits: production of fruits, pulp and seed and resistance to witch's broom disease. The degree of genetic relationship of the candidates was also considered. The analyses were performed through the methodology of mixed

  5. Srovnání pěstování kakaovníku pravého (Theobroma cacao L.) v agrolesnických a monokulturních systémech

    OpenAIRE

    Andrušíková, Petra

    2016-01-01

    Bachelor thesis contains characteristic of species Theobroma cacao. In this work is described origin and history, processing and world market with cocoa beans. In work is compared cultivation at plantation in agroforestry and monoculture systems. There is compared the benefits and disadvantages of usage of this systems. In the work is mentioned some informations about world organization, which are interested in agroforestry and also agroforestry certification.

  6. Comparación de métodos preparativos de tejidos para la extracción de proteínas de la mazorca de cacao ( Theobroma cacao L.)

    OpenAIRE

    Martínez-Márquez, Ascensión; Morante-Carriel, Jaime Alfredo; Bru-Martínez, Roque

    2017-01-01

    Cocoa, Theobroma cacao L. is one of the main tropical industrial crops. Cocoa has a very high level of interfering substances, such as polysaccharides and phenolic compounds that could prevent the isolation of suitable protein. Efficient methods of protein extraction are a priority to successfully apply proteomic analyses. We compared and evaluated two methods (A and B) of tissue preparation for total protein extract by phenol/SDS extraction protocol. The difference in the application of the ...

  7. EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA); Scientific Opinion on the substantiation of health claims related to caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood (ID 4276) pursuant to Article 13(1) of Regulation (EC) No 1924/2006

    DEFF Research Database (Denmark)

    Tetens, Inge

    Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies was asked to provide a scientific opinion on a list of health claims pursuant to Article 13 of Regulation (EC) No 1924/2006. This opinion addresses the scientific substantiation of health...... claims in relation to caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood. The scientific substantiation is based on the information provided by the Member States in the consolidated list of Article 13 health claims and references that EFSA has received from Member States...... or directly from stakeholders. The food that is the subject of the health claim is cocoa (Theobroma cacao L.). The Panel considers that whereas the food, cocoa (Theobroma cacao L.), is not sufficiently characterised in relation to the claimed effect evaluated in this opinion, the food constituents, caffeine...

  8. Produção e caracterização de biomassa extracelular obtida por fermentação submersa usando Lasidioplodia theobromae isolado do cacau

    Directory of Open Access Journals (Sweden)

    Josileide Gonçalves Borges

    2014-01-01

    Full Text Available Gomas produzidas por microrganismos são usadas como modificadores de alimentos e a biomassa residual para isolamento de seus constituintes. O objetivo deste trabalho foi produzir e caracterizar biomassa extracelular por fermentação submersa com Lasidioplodia theobromae isolado de cacau da Bahia com morte descendente. Foram testadas quatro fontes de carbono fermentadas a 28 ºC, 180 rpm por 72 horas. A que resultou em maior produção de biomassa foi avaliada quanto à variação da concentração e pH. As frações obtidas foram caracterizadas por infravermelho (FTIR e análise por termogravimetria (TG, composição centesimal e monossacarídica. A fermentação submersa da sacarose comercial a 40 g.L-1 em pH 4,0 por L. theobromae resultou em máxima produção da fração I (8,64g.L-1, e a 50g.L-1, pH 5,0, da fração II (23,69 g.L-1. Os espectros de FTIR mostraram presença de grupos amino, poliois e ésteres, e nas análises termogravimétricas observaram-se três eventos de perda de massa em diferentes intensidades. As frações contêm mesma composição em proporções diferenciadas, sendo fontes de proteínas (19,88-29,45%, lipídios (11,07-28,79%, cinzas (3,55-3,88%, e carboidratos (30,16-37,96% compostos unicamente de glicose e manose em diferentes proporções, portanto ambas glucomananas. As frações apresentam propriedades e potencial desejáveis para ampla utilização em processos biotecnológicos de alta relevância científica.

  9. EFEITO DO EXTRATO FOLIAR DE Gossypium arboreum L. (ALGODÃO SOB O CRESCIMENTO MICELIAL DE Lasiodiplodia theobromae (PAT. GRIFFON & MAUBL

    Directory of Open Access Journals (Sweden)

    Caroline da Cruz Vasconcelos

    2017-03-01

    Full Text Available O uso de extratos vegetais tem sido amplamente estudado como controle biológico alternativo de doenças de plantas, especialmente aquelas causadas por fungos patogênicos. Nesse sentido, o objetivo do presente estudo foi avaliar a atividade antifúngica in vitro do extrato bruto etanólico obtido de folhas de algodão (Gossypium arboreum L., Malvaceae em diferentes concentrações sob o desenvolvimento micelial do fungo fitopatogênico Lasiodiplodia theobromae. O ensaio foi conduzido nos Laboratórios de Microbiologia/Fitopatologia/Genética e de Cultivo/Isolamento da Universidade do Estado do Amapá/UEAP, em Macapá, Amapá. Em um Delineamento Inteiramente Casualizado (DIC, seis tratamentos e seis repetições foram organizados: T1 (controle negativo – BDA (Batata-Dextrose-Ágar + 0 mg.mL-1 (extrato foliar; T2 - BDA + 5 mg.mL-1 (extrato foliar; T3 - BDA + 10 mg.mL-1 (extrato foliar; T4 - BDA + 20 mg.mL-1 (extrato foliar; T5 - BDA + 2,5 mL de etanol e T6 (controle positivo - BDA + 2,5 mL de fungicida comercial (Derosal®. As variáveis inibição do crescimento micelial (ICM, índice de velocidade de crescimento micelial (IVCM e área abaixo da curva de cobertura de crescimento micelial (AACCM foram calculadas ao final do experimento. Os resultados mostraram que o extrato bruto etanólico das folhas de G. arboreum não apresentou atividade antifúngica in vitro frente ao fungo L. theobromae nas concentrações testadas. O extrato induziu o crescimento micelial do fungo, especialmente na concentração 10 mg.mL-1, a qual apresentou condição ideal para o desenvolvimento das estruturas do fungo. Palavras-chave: Malvaceae, extrato vegetal, controle biológico, fitopatógeno.

  10. High-Resolution Transcript Profiling of the Atypical Biotrophic Interaction between Theobroma cacao and the Fungal Pathogen Moniliophthora perniciosa[C][W][OPEN

    Science.gov (United States)

    Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães

    2014-01-01

    Witches’ broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen’s transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. PMID:25371547

  11. Theobroma cacao extract attenuates the development of Dermatophagoides farinae-induced atopic dermatitis-like symptoms in NC/Nga mice.

    Science.gov (United States)

    Kang, Heerim; Lee, Chang Hyung; Kim, Jong Rhan; Kwon, Jung Yeon; Son, Myoung-Jin; Kim, Jong-Eun; Lee, Ki Won

    2017-02-01

    Cacao beans from Theobroma cacao are an abundant source of polyphenols, particularly flavonoids. Previous studies demonstrated that cacao flavanols decrease pro-inflammatory cytokines resulting in the alleviation of allergic symptoms. We sought to investigate the effects of cacao extract (CE) on Dermatophagoides farinae extract (DFE)-induced atopic dermatitis (AD)-like symptoms. CE attenuated DFE-induced AD-like symptoms as assessed by skin lesion analyses, dermatitis score, and skin thickness. Histopathological analysis revealed that CE suppressed DFE-induced immune cell infiltration into the skin. These observations occurred concomitantly with the downregulation of inflammatory markers including serum immunoglobulin (Ig) E, chemokine; thymus and activation-regulated chemokine and macrophage-derived chemokine as well as the skin-derived cytokines interleukin (IL)-4, IL-5, and interferon-γ. CE also significantly alleviated transepidermal water loss and increased skin hydration. These results suggest that CE, a natural phytochemical-rich food, has potential therapeutic efficacy for the treatment of AD. Copyright © 2016. Published by Elsevier Ltd.

  12. CARACTERIZAÇÃO FÍSICO-QUÍMICA E REOLÓGICAS DA POLPA DE CUPUAÇU CONGELADA (Theobroma grandiflorum Schum

    Directory of Open Access Journals (Sweden)

    Marcela Vicente Vieira Andrade Gonçalves

    2013-12-01

    Full Text Available Cupuaçu, uma das principais e mais consumidas frutas da região amazônica brasileira, pertence à família Sterculiacea, cuja denominação binomial é Theobroma grandiflorum schum. É uma fruta típica da Amazônia, sendo cultivada nos estados do Pará, Maranhão e Tocantins. Esta fruta apresenta crescente utilização no Brasil para o mercado interno e externo, sendo comumente comercializada como polpa congelada. Apesar de sua importância, há poucos dados de caracterização e contaminação da polpa de cupuaçu. Amostras de polpa de cupuaçu foram avaliadas quanto à viscosidade aparente, tensão de cisalhamento, umidade, cinzas, nitrogênio total, extrato etéreo, acidez, sólidos solúveis e pH. Os resultados demonstram a necessidade de aprimorar as boas práticas agrícolas e de fabricação e implantação de sistemas de controle de qualidade para minimização dos riscos associados à contaminação por micro-organismos.

  13. Properties of An Oral Nanoformulation of A Molecularly Dispersed Amphotericin B Comprising A Composite Matrix of Theobroma Oil and Bee’S Wax

    Directory of Open Access Journals (Sweden)

    Chloe See Wei Tan

    2014-12-01

    Full Text Available An amphotericin B-containing (AmB solid lipid nanoparticulate drug delivery system intended for oral administration, comprised of bee’s wax and theobroma oil as lipid components was formulated with the aim to ascertain the location of AmB within the lipid matrix: (a a homogenous matrix; (b a drug-enriched shell; or (c a drug enriched core. Both the drug-loaded and drug-free nanoparticles were spherical with AmB contributing to an increase in both the z-average diameter (169 ± 1 to 222 ± 2 nm and zeta potential (40.8 ± 0.9 to 50.3 ± 1.0 mV of the nanoparticles. A maximum encapsulation efficiency of 21.4% ± 3.0%, corresponding to 10.7 ± 0.4 mg encapsulated AmB within the lipid matrix was observed. Surface analysis and electron microscopic imaging indicated that AmB was dispersed uniformly within the lipid matrix (option (a above and, therefore, this is the most suitable of the three models with regard to modeling the propensity for uptake by epithelia and release of AmB in lymph.

  14. The causal agents of witches' broom and frosty pod rot of cacao (chocolate, Theobroma cacao) form a new lineage of Marasmiaceae.

    Science.gov (United States)

    Aime, M C; Phillips-Mora, W

    2005-01-01

    The two most devastating diseases of cacao (Theobroma cacao)--the source of chocolate--in tropical America are caused by the fungi Crinipellis perniciosa (witches' broom disease) and Moniliophthora roreri (frosty pod rot or moniliasis disease). Despite the agricultural, socio-economic and environmental impact of these fungi, most aspects of their life cycles are unknown, and the phylogenetic relationships of M. roreri have yet to be conclusively established. In this paper, extensive phylogenetic analyses of five nuclear gene regions (28S rDNA, 18S rDNA, ITS, RPB1, and EF1-alpha) confirm that C. perniciosa and M. roreri are sister taxa that belong in the Marasmiaceae (euagarics). Furthermore, these taxa form part of a separate and distinct lineage within the family. This lineage includes the biotrophic fungi Moniliophthora perniciosa comb. nov. and M. roreri, as well as one undescribed endophytic species. The sister genera to Moniliophthora are Marasmius, Crinipellis and Chaetocalathus, which consist mainly of saprotrophic litter fungi.

  15. [Effect of mixed edaphic bacterial inoculants in the early development of improved cocoa cultivars (Theobroma cacao L.) in a traditional agroforestry system of Oaxaca, Mexico].

    Science.gov (United States)

    Hipólito-Romero, E; Carcaño-Montiel, M G; Ramos-Prado, J M; Vázquez-Cabañas, E A; López-Reyes, L; Ricaño-Rodríguez, J

    Cocoa plant (Theobroma cacao L.) is native from South America and it represents one of the most significant "bio-cultural" resources of Mesoamerica, since it is a region where it was domesticated and had a relevance as ritual drink and as currency in many pre-hispanic cultures until the arrival of the Spaniards who spread its use worldwide, and became it one of the most consumed commodity goods. Through this research, an alternative is proposed to address the problem of cultivars through the introduction of a wide variety of cocoa plants in traditional agroforestry systems, in synergy with the inoculation of nitrogen-fixing and insoluble phosphor solubilizing edaphic bacterial consortia. Four cultivars of improved grafted cocoa plants were introduced in a traditional agroforestry plot and three fertilization treatments were applied: application of biofertilizer, application of chemical fertilizer and control. Measurements of height, stem diameter, number of leaves and branches were recorded at 2 and 12 months after planting and rhizosphere microbial populations were characterized. Growth results showed good potential for all studied cultivars and it was observed that biofertilization foresees significant effects in some of the growth indicators of cocoa plant. Thereby, plant associations in an agroforestry system could be favorable to promote fruit development and resistance to pests and diseases. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  16. Effect of Organic and Conventional Fertilization on the Growth and Production of Theobroma Cacao L. Under an Agroforestry System in Rivera (Huila, Colombia

    Directory of Open Access Journals (Sweden)

    Faver Álvarez Carrillo

    2015-07-01

    Full Text Available The impact of organic fertilizing schemes on the cocoa (Theobroma cacao L. growth and production under agroforestry systems (AFS has been scarcely studied. In this sense, in Rivera (Huila-Colombia, the effect of different management strategies for amendment application in cocoa under agroforestry systems was evaluated. Four treatments were considered: i conventional fertilizing or farmer fertilizing (chemical, T1; ii Potassium sulfate (chemical, T2; iii eco-cocoa + Super 4 (ECO-S4 (organical, T3; and iv the mixture of among the treatments with potassium sulfate + eco-cocoa (SP-ECO (chemical + organical, T4. Variance analysis, Fisher test (p<0.05 and principal components analysis (PCA were used for data comparisons. For the height of cocoa plants, there was an average increase of 22.5 cm, while for stem diameter was 4.71 cm, with significant differences between the treatments. In general, an effect of the fertilizing scheme on the agronomic parameters of cocoa evaluated was found —especially for some important variables such as number of grains per pod and average weight of the grain—. There were similar parameters between the chemical and the organic treatments. This demonstrates that organic schemes of fertilizing could be an important alternative for improving cocoa production.

  17. Anti-inflammatory properties of clovamide and Theobroma cacao phenolic extracts in human monocytes: evaluation of respiratory burst, cytokine release, NF-κB activation, and PPARγ modulation.

    Science.gov (United States)

    Zeng, Huawu; Locatelli, Monica; Bardelli, Claudio; Amoruso, Angela; Coisson, Jean Daniel; Travaglia, Fabiano; Arlorio, Marco; Brunelleschi, Sandra

    2011-05-25

    There is a great interest in the potential health benefits of biologically active phenolic compounds in cocoa (Theobroma cacao) and dark chocolate. We investigated the anti-inflammatory potential of clovamide (a N-phenylpropenoyl-L-amino acid amide present in cocoa beans) and two phenolic extracts from unroasted and roasted cocoa beans, by evaluating superoxide anion (O(2)(-)) production, cytokine release, and NF-κB activation in human monocytes stimulated by phorbol 12-myristate 13-acetate (PMA). The effects of rosmarinic acid are shown for comparison. Clovamide and rosmarinic acid inhibited PMA-induced O(2)(-) production and cytokine release (with a bell-shaped curve and maximal inhibition at 10-100 nM), as well as PMA-induced NF-κB activation; the two cocoa extracts were less effective. In all tests, clovamide was the most potent compound and also enhanced peroxisome proliferator-activated receptor-γ (PPARγ) activity, which may exert anti-inflammatory effects. These findings indicate clovamide as a possible bioactive compound with anti-inflammatory activity in human cells.

  18. Evaluación del potencial biofertilizante de bacterias diazótrofas aisladas de suelos con cultivo de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Adriana Zulay Argüello-Navarro

    2014-09-01

    Full Text Available La adaptabilidad del cacao (Theobroma cacao L. en condiciones adversas permite sugerir que la microbiota asociada con la rizosfera desempeña una función importante para la nutrición y el desarrollo de la planta. En el trabajo se evaluó el potencial biofertilizante de bacterias fijadoras de nitrógeno (diazótrofas aisladas de suelos cacaoteros por la técnica de diluciones seriadas. Las bacterias se aislaron en medios semiselectivos (NFb, JMV, LGI, JNFb. Los aislados puros se caracterizaron morfológica y bioquímicamente y complementariamente se evaluó la capacidad de fijación biológica de nitrógeno (FBN por el método de Micro-Kjeldahl. Los aislados con mejor capacidad de fijación de nitrógeno fueron seleccionados para evaluar su potencial promotor de crecimiento durante 120 días en plantas de cacao clon CCN 51 establecidas a partir de semillas. El análisis de datos mostró que las plantas de cacao respondieron efectivamente a los tratamientos con bacterias donde las variables de crecimiento y N (% foliar incrementaron significativamente, en comparación con el testigo. Se destacó el aporte de los aislados DKA2J24, DKB3J73 presuntamente del género Burkholderia sp. y DKA1L3 semejante al género Gluconacetobacter sp., todos con un gran potencial como biofertilizantes en la prueba de bioensayo.

  19. Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao.

    Science.gov (United States)

    Liu, Yi; Shi, Zi; Maximova, Siela N; Payne, Mark J; Guiltinan, Mark J

    2015-06-25

    The flavan-3-ols catechin and epicatechin, and their polymerized oligomers, the proanthocyanidins (PAs, also called condensed tannins), accumulate to levels of up to 15 % of the total weight of dry seeds of Theobroma cacao L. These compounds have been associated with several health benefits in humans. They also play important roles in pest and disease defense throughout the plant. In Arabidopsis, the R2R3 type MYB transcription factor TT2 regulates the major genes leading to the synthesis of PA. To explore the transcriptional regulation of the PA synthesis pathway in cacao, we isolated and characterized an R2R3 type MYB transcription factor MYBPA from cacao. We examined the spatial and temporal gene expression patterns of the Tc-MYBPA gene and found it to be developmentally expressed in a manner consistent with its involvement in PAs and anthocyanin synthesis. Functional complementation of an Arabidopsis tt2 mutant with Tc-MYBPA suggested that it can functionally substitute the Arabidopsis TT2 gene. Interestingly, in addition to PA accumulation in seeds of the Tc-MYBPA expressing plants, we also observed an obvious increase of anthocyanidin accumulation in hypocotyls. We observed that overexpression of the Tc-MYBPA gene resulted in increased expression of several key genes encoding the major structural enzymes of the PA and anthocyanidin pathway, including DFR (dihydroflavanol reductase), LDOX (leucoanthocyanidin dioxygenase) and BAN (ANR, anthocyanidin reductase). We conclude that the Tc-MYBPA gene that encodes an R2R3 type MYB transcription factor is an Arabidopsis TT2 like transcription factor, and may be involved in the regulation of both anthocyanin and PA synthesis in cacao. This research may provide molecular tools for breeding of cacao varieties with improved disease resistance and enhanced flavonoid profiles for nutritional and pharmaceutical applications.

  20. Theobroma cacao increases cells viability and reduces IL-6 and sVCAM-1 level in endothelial cells induced by plasma from preeclamptic patients.

    Science.gov (United States)

    Rahayu, Budi; Baktiyani, Siti Candra Windu; Nurdiana, Nurdiana

    2016-01-01

    This study aims to investigate whether an ethanolic extract of Theobroma cacao bean is able to increase cell viability and decrease IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Endothelial cells were obtained from human umbilical vascular endothelial cells. At confluency, endothelial cells were divided into six groups, which included control (untreated), endothelial cells exposed to plasma from normal pregnancy, endothelial cells exposed to 2% plasma from preeclamptic patients (PP), endothelial cells exposed to PP in the presence of ethanolic extract of T. cacao (PP+TC) at the following three doses: 25, 50, and 100 ppm. The analysis was performed in silico using the Hex 8.0, LigPlus and LigandScout 3.1 software. Analysis on IL-6 and sVCAM-1 levels were done by enzyme linked immunosorbent assay (ELISA). We found that seven of them could bind to the protein NFκB (catechin, leucoanthocyanidin, niacin, phenylethylamine, theobromine, theophylline, and thiamin). This increase in IL-6 was significantly (Pcacao extract. Plasma from PP significantly increased sVCAM-1 levels compared to untreated cells. This increase in sVCAM-1 was significantly attenuated by all doses of the extract. In conclusion, T. cacao extract prohibits the increase in IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Therefore this may provide a herbal therapy for attenuating the endothelial dysfunction found in preeclampsia. Copyright © 2016 International Society for the Study of Hypertension in Pregnancy. Published by Elsevier B.V. All rights reserved.

  1. Present spatial diversity patterns of Theobroma cacao L. in the neotropics reflect genetic differentiation in pleistocene refugia followed by human-influenced dispersal.

    Science.gov (United States)

    Thomas, Evert; van Zonneveld, Maarten; Loo, Judy; Hodgkin, Toby; Galluzzi, Gea; van Etten, Jacob

    2012-01-01

    Cacao (Theobroma cacao L.) is indigenous to the Amazon basin, but is generally believed to have been domesticated in Mesoamerica for the production of chocolate beverage. However, cacao's distribution of genetic diversity in South America is also likely to reflect pre-Columbian human influences that were superimposed on natural processes of genetic differentiation. Here we present the results of a spatial analysis of the intra-specific diversity of cacao in Latin America, drawing on a dataset of 939 cacao trees genotypically characterized by means of 96 SSR markers. To assess continental diversity patterns we performed grid-based calculations of allelic richness, Shannon diversity and Nei gene diversity, and distinguished different spatially coherent genetic groups by means of cluster analysis. The highest levels of genetic diversity were observed in the Upper Amazon areas from southern Peru to the Ecuadorian Amazon and the border areas between Colombia, Peru and Brazil. On the assumption that the last glaciation (22,000-13,000 BP) had the greatest pre-human impact on the current distribution and diversity of cacao, we modeled the species' Pleistocene niche suitability and overlaid this with present-day diversity maps. The results suggest that cacao was already widely distributed in the Western Amazon before the onset of glaciation. During glaciations, cacao populations were likely to have been restricted to several refugia where they probably underwent genetic differentiation, resulting in a number of genetic clusters which are representative for, or closest related to, the original wild cacao populations. The analyses also suggested that genetic differentiation and geographical distribution of a number of other clusters seem to have been significantly affected by processes of human management and accompanying genetic bottlenecks. We discuss the implications of these results for future germplasm collection and in situ, on farm and ex situ conservation of cacao.

  2. The Theobroma cacao B3 domain transcription factor TcLEC2 plays a duel role in control of embryo development and maturation.

    Science.gov (United States)

    Zhang, Yufan; Clemens, Adam; Maximova, Siela N; Guiltinan, Mark J

    2014-04-24

    The Arabidopsis thaliana LEC2 gene encodes a B3 domain transcription factor, which plays critical roles during both zygotic and somatic embryogenesis. LEC2 exerts significant impacts on determining embryogenic potential and various metabolic processes through a complicated genetic regulatory network. An ortholog of the Arabidopsis Leafy Cotyledon 2 gene (AtLEC2) was characterized in Theobroma cacao (TcLEC2). TcLEC2 encodes a B3 domain transcription factor preferentially expressed during early and late zygotic embryo development. The expression of TcLEC2 was higher in dedifferentiated cells competent for somatic embryogenesis (embryogenic calli), compared to non-embryogenic calli. Transient overexpression of TcLEC2 in immature zygotic embryos resulted in changes in gene expression profiles and fatty acid composition. Ectopic expression of TcLEC2 in cacao leaves changed the expression levels of several seed related genes. The overexpression of TcLEC2 in cacao explants greatly increased the frequency of regeneration of stably transformed somatic embryos. TcLEC2 overexpressing cotyledon explants exhibited a very high level of embryogenic competency and when cultured on hormone free medium, exhibited an iterative embryogenic chain-reaction. Our study revealed essential roles of TcLEC2 during both zygotic and somatic embryo development. Collectively, our evidence supports the conclusion that TcLEC2 is a functional ortholog of AtLEC2 and that it is involved in similar genetic regulatory networks during cacao somatic embryogenesis. To our knowledge, this is the first detailed report of the functional analysis of a LEC2 ortholog in a species other then Arabidopsis. TcLEC2 could potentially be used as a biomarker for the improvement of the SE process and screen for elite varieties in cacao germplasm.

  3. Efecto de las cepas nativas Paecilomyces sp. (Bainier y Lecanicillium sp. (Zimm en el control de Carmenta foraseminis Eichlin (Lepidoptera: Sesiidae en cultivos de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Wilmer Figueroa Medina

    2013-07-01

    Full Text Available El pasador del fruto, Carmenta foraseminis Eichlin, es un insecto que ha acentuado su ataque en cultivos de cacao (Theobroma cacao L. en los últimos años en Norte de Santander (Colombia. El objetivo de este estudio fue evaluar la patogenicidad de las cepas nativas Giav-3 Paecilomyces sp. y Giav-4 Lecanicillium sp. sobre larvas de C. foraseminis. Para el efecto, se realizaron aislamientos a partir de muestras de suelo recolectadas en el municipio de Tibú, Norte de Santander. Después de obtenidos los cultivos puros se procedió a la caracterización macroscópica y microscópica para la identificación del género de los aislados mediante claves taxonómicas. La infección fue realizada mediante inmersión de larvas en las suspensiones de los aislados en concentraciones de 0, 10(6, 10(7 y 10(8 conidios/ml. En ambos aislados se observó una tendencia lineal respecto a la mortalidad, la cual fue directamente proporcional a las concentraciones del inóculo. La CL50 y CL90 para Giav-3 fue de 10(6.95 y 10(8.70 conidios/ml y para Giav-4 de 10(6.6 y 10(8.04 conidios/ml, respectivamente. Lo cual indica que esta última requirió la menor concentración de inóculo para eliminar el 50% y 90% de la población tratada, lo que supone una mayor efectividad contra las larvas.

  4. Improving Nutritional Quality of Cocoa Pod (Theobroma cacao) through Chemical and Biological Treatments for Ruminant Feeding: In vitro and In vivo Evaluation.

    Science.gov (United States)

    Laconi, Erika B; Jayanegara, Anuraga

    2015-03-01

    Cocoa pod is among the by-products of cocoa (Theobroma cacao) plantations. The aim of this study was to apply a number of treatments in order to improve nutritional quality of cocoa pod for feeding of ruminants. Cocoa pod was subjected to different treatments, i.e. C (cocoa pod without any treatment or control), CAm (cocoa pod+1.5% urea), CMo (cocoa pod+3% molasses), CRu (cocoa pod+3% rumen content) and CPh (cocoa pod+3% molasses+Phanerochaete chrysosporium inoculum). Analysis of proximate and Van Soest's fiber fraction were performed on the respective treatments. The pods were then subjected to an in vitro digestibility evaluation by incubation in rumen fluid-buffer medium, employing a randomized complete block design (n = 3 replicates). Further, an in vivo evaluation of the pods (35% inclusion level in total mixed ration) was conducted by feeding to young Holstein steers (average body weight of 145±3.6 kg) with a 5×5 latin square design arrangement (n = 5 replicates). Each experimental period lasted for 30 d; the first 20 d was for feed adaptation, the next 3 d was for sampling of rumen liquid, and the last 7 d was for measurements of digestibility and N balance. Results revealed that lignin content was reduced significantly when cocoa pod was treated with urea, molasses, rumen content or P. chrysosporium (pCAm>CRu>CMo. Among all treatments, CAm and CPh treatments significantly improved the in vitro dry matter and organic matter digestibility (pcocoa pod. Average daily gain of steers receiving CAm or CPh treatment was significantly higher than that of control (pcocoa pod.

  5. Chemical, physico-chemical and sensory characterization of mixed açai (Euterpe oleracea and cocoa´s honey (Theobroma cacao jellies

    Directory of Open Access Journals (Sweden)

    Biano Alves de Melo Neto

    2013-06-01

    Full Text Available Four formulations of mixed açaí (Euterpe oleracea (A and cocoa´s honey (Theobroma cacao (CH jellies were prepared according to the following proportions: T1 (40% A:60% CH, T2 (50% A:50% CH, T3 (60% A: 40% CH and T4 (100% A - control. All formulations were prepared using a rate 60:40 (w/w of sucrose and pulp, plus 0.5% pectin and the products reached to average of 65% soluble solids content. The jellies were analyzed by chemical and physicochemical (titratable acidity, pH, soluble solid content, dry matter, total protein, lipids, vitamin C and calories and sensory characteristics; also were evaluated levels of P, K, Ca, Mg, Fe, Zn, Cu and Mn. It was used a hedonic scale of 7 points to evaluate the attributes: overall impression, spreadability, brightness, flavor, texture and color, and also was verified the purchase intention score. The titratable acidity and pH ranged from 0.46 to 0.64% and 3.35 to 3.64, respectively, that are within the range found at most fruit jellies. The soluble solids content ranged between 65.2 and 65.5 ºBrix. The sensory acceptance results showed that all treatments (T1, T2, T3 and T4 presented means of sensory attributes above 4, demonstrating good acceptance of the product, but the treatment T1 presented the higher scores for the evaluated attributes. Cocoa´s honey added a positive influence on the attributes of color, texture and spreadability.

  6. Selección de genotipos de cacao (Theobroma cacao L. con resistencia a escoba de bruja (Moniliophthora perniciosa en Los Ríos, Ecuador

    Directory of Open Access Journals (Sweden)

    Omar Miguel Tarqui Freire

    2017-07-01

    Full Text Available El Programa de Mejoramiento del Cacao y el Café en el INIAP EET-Pichilingue ha estado estudiando, durante varios años, los genotipos de cacao más altos (Theobroma cacao L. caracterizados por la resistencia genética a las principales enfermedades, especialmente la escoba de brujas (Moniliophthora perniciosa Factor limitante para su cultivo en varios países de América Central y del Sur. El objetivo de la investigación fue identificar y seleccionar los clones de cacao con una baja incidencia de la enfermedad de la escoba de brujas. Se probaron 21 genotipos (14 resultantes de Amazonas x Amazonas y (4 de Amazonas x Cruces Nacionales. Entre la población derivada de cruces nacionales vs. nacionales, no se encontraron genotipos mostrando resistencia a la enfermedad. Además, se seleccionó INIAPT 074 del cruce entre CCN 51 x B 60 y TIP 1 y TAP 6 como clones de control. Se evaluaron las siguientes características: Número de mazorcas sanas (MS, Peso fresco (PF, Número de mazorcas enfermas (ME, Número de escobas vegetativas (EBveg, Número de escobas portadoras (EBcojin y Número de chirimoyas. Un análisis de componentes principales y un análisis de conglomerados se realizaron utilizando el método de Ward y se construyó un dendrograma para determinar la similitud entre las características productivas y sanitarias. Se determinó que los genotipos resultantes del cruce amazónico x amazónico: INIAPT 527, INIAPT 560 e INIAPT 526 presentaron menor incidencia de escobas y se identificaron como fuentes de resistencia genética a Moniliophthora perniciosa.

  7. Sequencing of a QTL-rich region of the Theobroma cacao genome using pooled BACs and the identification of trait specific candidate genes

    Directory of Open Access Journals (Sweden)

    Blackmon Barbara P

    2011-07-01

    Full Text Available Abstract Background BAC-based physical maps provide for sequencing across an entire genome or a selected sub-genomic region of biological interest. Such a region can be approached with next-generation whole-genome sequencing and assembly as if it were an independent small genome. Using the minimum tiling path as a guide, specific BAC clones representing the prioritized genomic interval are selected, pooled, and used to prepare a sequencing library. Results This pooled BAC approach was taken to sequence and assemble a QTL-rich region, of ~3 Mbp and represented by twenty-seven BACs, on linkage group 5 of the Theobroma cacao cv. Matina 1-6 genome. Using various mixtures of read coverages from paired-end and linear 454 libraries, multiple assemblies of varied quality were generated. Quality was assessed by comparing the assembly of 454 reads with a subset of ten BACs individually sequenced and assembled using Sanger reads. A mixture of reads optimal for assembly was identified. We found, furthermore, that a quality assembly suitable for serving as a reference genome template could be obtained even with a reduced depth of sequencing coverage. Annotation of the resulting assembly revealed several genes potentially responsible for three T. cacao traits: black pod disease resistance, bean shape index, and pod weight. Conclusions Our results, as with other pooled BAC sequencing reports, suggest that pooling portions of a minimum tiling path derived from a BAC-based physical map is an effective method to target sub-genomic regions for sequencing. While we focused on a single QTL region, other QTL regions of importance could be similarly sequenced allowing for biological discovery to take place before a high quality whole-genome assembly is completed.

  8. Préférences alimentaires de Sahlbergella singularis Hagl. (Hemiptera: Miridae vis-à-vis de quelques clones de cacaoyers (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Amang, J.

    2005-01-01

    Full Text Available Feeding Preferences of Sahlbergella singularis Hagl. (Hemiptera: Miridae to some Cocoa (Theobroma cacao L. Clones. The selection of cocoa clones, resistant to Sahlbergella singularis Hagl. was done in the laboratory according to the standardized method of indoor microtests based on the study of mirid feeding preferences. Fourteen cocoa clones were involved. The Sca6 clone was the control. An index (i which expresses the ratio of the number of stings on the clone to that obtained on the control was calculated for each cultivar. Which has enabled to quantify the levels of attractiveness of cocoa clones to S. singularis and to classify these clones in three groups: less attractive clones (i< 1, non different (i= 1 and more attractive (i> 1. The results obtained showed that the mean numbers of feeding stings on the control (tr ranged from 5.49 to 5.62 (5.49≤ tr≤ 5.62 and that obtained on the other clones (tc from 5.29 to 6.18 (5.29≤ tc ≤ 6.18. The Na33 clone had the highest stings mean number (6.18 and IFC 100 the lowest one (5.29. The High Amazonian clone Na33 was the most attractive and the clones ICS100, IFC100, (exotic trinitario, Sca12 (catongo and Na32 (High Amazonian were less attractive. On the other hand the clones IFC1363, IFC1362, IFC1374 (catongo, UPA337, T60/887, ICS1 and IMC60 (High Amazonians and ICS95 (exotic trinitario were non different. The reactivity seemed not depending on the origin of the clone. Save the High Amazonian clone Na33 which was the most attractive there were among non different and less attractive clones as well exotic trinitario, catongo as High Amazonians.

  9. DAMPAK APLIKASI INSEKTISIDA PERMETRIN TERHADAP HAMA PENGISAP BIJAIJ HELOPELTIS SPP. (HEMIPTERA: MIRIDAE DAN ARTROPODA NON-TARGET PADA PERTANAMAN KAKAO (THEOBROMA CACAO L.

    Directory of Open Access Journals (Sweden)

    Rosma Hasibuan

    2014-08-01

    Full Text Available Impact of Permethrin-Insecticide Application on Mirid Pest of Cocoa Helopeltis spp. (Hemiptera: Miridae and on Non-target  Arthropods in Cocoa Plantations (Theobroma cacao L.. Cocoa mirid bugs, Helopeltis spp., (Hemiptera: Miridae are the most important pest of cocoa in Indonesia. A field study was conducted to investigate the effect of permethrin on cocoa mirids and non-target arthropods at a cocoa plantation in specific place. A randomized complete block design was used in which each of four blocks consisted of 5 treatments (4 concentrations of permethrin; 50; 100; 200; and 250 ppm and control. The results indicated that the application of permethrin significantly increased the cocoa mirids mortaliiy throughout all sprayed cocoa trees (up to 100% 72 h after application. Even at 1 h after application, the percentage of Cocoa mirids mortality 29.2% - 53.9% on cocoa trees sprayed with permethrin at concentrations of 50 - 250 ppm was significantly higher than that on control plant (3.6%. At 72 h after treatments, application of permethrin at concentrations of 200 and 250 ppm caused a complete kill (mortalty of 100% in the test mirids. Meanwhile, ground cloths caught at least 22 fanilies of abore-ground arthropods that were found killed by permethrin applications. Moreover, the number of non-target arthropods killed by permethrin at concentrations of 100 - 250 ppm (27.3 - 85.3 individuals/ground cloth were signifcantly higher than that on control trees. These results demonstrated that despite high efficacy of permethrin in controlling of cocoa mirids (Hetopeltis spp., its application also had adverse effects on non-target arthropods incocoa plantations.

  10. Genetic diversity and structure of managed and semi-natural populations of cocoa (Theobroma cacao) in the Huallaga and Ucayali Valleys of Peru.

    Science.gov (United States)

    Zhang, Dapeng; Arevalo-Gardini, Enrique; Mischke, Sue; Zúñiga-Cernades, Luis; Barreto-Chavez, Alejandro; Del Aguila, Jorge Adriazola

    2006-09-01

    Cocoa (Theobroma cacao) is indigenous to the Amazon region of South America, and it is well known that the Peruvian Amazon harbours a large number of diverse cocoa populations. A small fraction of the diversity has been collected and maintained as an ex-situ germplasm repository in Peru. However, incorrect labelling of accessions and lack of information on genetic diversity have hindered efficient conservation and use of this germplasm. This study targeted assessment of genetic diversity and population structure in a managed and a semi-natural population. Using a capillary electrophoresis genotyping system, 105 cocoa accessions collected from the Huallaga and Ucayali valleys of Peru were fingerprinted. Based on 15 loci SSR profiles, genetic identity was examined for each accession and duplicates identified, population structure assessed and genetic diversity analysed in these two populations. Ten synonymous mislabelled groups were identified among the 105 accessions. The germplasm group in the Huallaga valley was clearly separated from the group in Ucayali valley by the Bayesian assignment test. The Huallaga group has lower genetic diversity, both in terms of allelic richness and of gene diversity, than the Ucayali group. Analysis of molecular variance suggested genetic substructure in the Ucayali group. Significant spatial correlation between genetic distance and geographical distances was detected in the Ucayali group by Mantel tests. These results substantiate the hypothesis that the Peruvian Amazon hosts a high level of cocoa genetic diversity, and the diversity has a spatial structure. The introduction of exotic seed populations into the Peruvian Amazon is changing the cocoa germplasm spectrum in this region. The spatial structure of cocoa diversity recorded here highlights the need for additional collecting and conservation measures for natural and semi-natural cocoa populations.

  11. Evaluación sensorial de cacao (Theobroma cacao L. cultivado en la región del sur del departamento de Bolívar (Colombia

    Directory of Open Access Journals (Sweden)

    Johana Andrea Guzmán Duque

    2014-12-01

    Full Text Available El departamento de Bolívar (Colombia presenta condiciones aptas tanto agrícolas como culturales para el desarrollo productivo de cacao de fino aroma. Esta actividad ofrece una oportunidad conveniente para su desarrollo sostenible, económico y de proyección social. La presente investigación evaluó las características sensoriales del cacao Theobroma cacao L. en seis municipios del sur de Bolívar para determinar atributos propios y diferencias significativas entre estas regiones; para esto se realizó un muestreo de granos secos y mazorcas de cacao, de los clones más representativos de cada municipio. El proceso se llevó a cabo con 18 jueces capacitados para detectar, describir y discriminar propiedades  sensoriales en el cacao, quienes evaluaron las muestras a través de cuatro pruebas sensoriales específicas diseñadas para realizar la caracterización organoléptica del cacao de Bolívar, seleccionando para este fin las pruebas descriptivas de perfil de sabor y análisis cuantitativo y las pruebas discriminativas de ordenamiento y escalar de control. El análisis físico y sensorial del grano reveló la correlación entre las condiciones agroecológicas y tecnológicas (especialmente aquellos que tienen que ver con las operaciones de fermentación y/o beneficio con las cualidades sensoriales que éste posee en sus atributos de sabor y aroma.

  12. Genome-wide analysis reveals divergent patterns of gene expression during zygotic and somatic embryo maturation of Theobroma cacao L., the chocolate tree.

    Science.gov (United States)

    Maximova, Siela N; Florez, Sergio; Shen, Xiangling; Niemenak, Nicolas; Zhang, Yufan; Curtis, Wayne; Guiltinan, Mark J

    2014-07-16

    Theobroma cacao L. is a tropical fruit tree, the seeds of which are used to create chocolate. In vitro somatic embryogenesis (SE) of cacao is a propagation system useful for rapid mass-multiplication to accelerate breeding programs and to provide plants directly to farmers. Two major limitations of cacao SE remain: the efficiency of embryo production is highly genotype dependent and the lack of full cotyledon development results in low embryo to plant conversion rates. With the goal to better understand SE development and to improve the efficiency of SE conversion we examined gene expression differences between zygotic and somatic embryos using a whole genome microarray. The expression of 28,752 genes was determined at 4 developmental time points during zygotic embryogenesis (ZE) and 2 time points during cacao somatic embryogenesis (SE). Within the ZE time course, 10,288 differentially expressed genes were enriched for functions related to responses to abiotic and biotic stimulus, metabolic and cellular processes. A comparison ZE and SE expression profiles identified 10,175 differentially expressed genes. Many TF genes, putatively involved in ethylene metabolism and response, were more strongly expressed in SEs as compared to ZEs. Expression levels of genes involved in fatty acid metabolism, flavonoid biosynthesis and seed storage protein genes were also differentially expressed in the two types of embryos. Large numbers of genes were differentially regulated during various stages of both ZE and SE development in cacao. The relatively higher expression of ethylene and flavonoid related genes during SE suggests that the developing tissues may be experiencing high levels of stress during SE maturation caused by the in vitro environment. The expression of genes involved in the synthesis of auxin, polyunsaturated fatty acids and secondary metabolites was higher in SEs relative to ZEs despite lack of lipid and metabolite accumulation. These differences in gene

  13. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions

    Science.gov (United States)

    Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire

    2008-01-01

    Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high

  14. Utilization of Cacao Pod Husk (Theobroma cacao l.) as Activated Carbon and Catalyst in Biodiesel Production Process from Waste Cooking Oil

    Science.gov (United States)

    Rachmat, Devita; Johar Mawarani, Lizda; Dewi Risanti, Doty

    2018-01-01

    Cocoa pod husk (Theobroma cacao l.) is a waste from cocoa beans processing. In this research we employ cocoa pod husk as activated carbon to decrease the value of FFA (Free Fatty Acid) in waste cooking oil and as K2CO3 catalyst in biodiesel production process from waste cooking oil. Cocoa pod husk was crusched and grounded into powder that passed thorugh 60 mesh-screen. As activated carbon, cocoa pod husk was firstly carbonized at three variant temperatures i.e 250°C, 300°C and 350°C. The activation process was done using HCl 2M as activator. Based on the results of XRD and FTIR, the carbonization at all variant temperatures does not cause a significant changes in terms of crystallite structure and water content. The pore of activated carbon started to form in sample that was carbonized at 350°C resulting in pore diameter of 5.14644 nm. This result was supported by the fact that the ability of this activated carbon in reducing the FFA of waste cooking oil was the most pronounced one, i.e. up to 86.7% of FFA. It was found that the performance of cocoa pod husk’s activated carbon in reducing FFA is more effective than esterification using H2SO4 which can only decrease 80.8%. On the other hand, the utilization as K2CO3 catalyst was carried out by carbonization at temperature 650°C and extraction using aquadest solvent. The extraction of cocoa pod husk produced 7.067% K2CO3 catalyst. According to RD results the fraction of K2CO3 compound from the green catalysts is the same as the commercial (SAP, 99%) that is ≥ 60%. From the obtained results, the best yield percentage was obtained using K2CO3 catalyst from cacao pod husk extract, i.e. 73-85%. To cope with biodiesel conversion efficiency, a two-step process consisting pretreatment with activated carbon carbonized at 350°C and esterification with K2CO3 from cocoa pod husk catalyst was developed. This two-step process could reach a high conversion of 85%. From the results it was clear that the produced

  15. Population dynamics of epiphytic mycoparasites of the genera Clonostachys and Fusarium for the biocontrol of black pod (Phytophthora palmivora) and moniliasis (Moniliophthora roreri) on cocoa (Theobroma cacao).

    Science.gov (United States)

    Hoopen, G Martijn ten; Rees, Robert; Aisa, Philo; Stirrup, Tim; Krauss, Ulrike

    2003-05-01

    Mycoparasites collected from aerial parts of the cocoa plant (Theobroma cacao) have shown great promise in the control of black pod, caused by Phytophthora palmivora, and moniliasis, caused by Moniliophthora roreri. However, the ecology of epiphytic mycoparasites is still poorly understood although it has a direct bearing on applied biocontrol practices, ranging from the identification and isolation of promising biocontrol candidates to formulation needs and required application frequency. One objective of this study was to determine the natural abundance of mycoparasites on cocoa flowers and pods in relation to crop development stage and cultivar. For this purpose, native mycoparasites were detected on cocoa flowers and pods using the precolonised plate baiting technique. Furthermore, the survival of an applied Clonostachys rosea isolate on cocoa pods on shaded and non-shaded trees was compared as well as the recolonisation patterns of surface-sterilised pods by native mycoparasites under these conditions. Clonostachys spp. were the most commonly isolated native mycoparasites, followed by Fusarium spp. No differences in the occurrence of native, epiphytic mycoparasites were observed between the three main cocoa cultivars, 'Criollo', 'Forastero' and 'Trinitario', nor between clones within these groups. Thus, a single biocontrol inoculum can be suitable for application to cultivar mixtures of cocoa commonly grown together in a field. Different susceptibility classes of segregating F1 populations of hybrids with resistance against M. roreri and P. palmivora supported similar population levels and taxonomic assemblages of mycoparasites. Therefore, we reject the hypothesis that these antagonists mediate resistance. Mycoparasite abundance and genetic disease resistance to black pod and moniliasis are independent phenomena and should lead to additive effects if employed simultaneously in an integrated disease management programme. The survival of applied C. rosea was not

  16. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions.

    Science.gov (United States)

    Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire

    2008-10-30

    Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species.Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories.A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database.To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection.A large collection of new genetic markers was provided by this ESTs collection. This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high density gene map of T. cacao

  17. Towards the understanding of the cocoa transcriptome: Production and analysis of an exhaustive dataset of ESTs of Theobroma cacao L. generated from various tissues and under various conditions

    Directory of Open Access Journals (Sweden)

    Ruiz Manuel

    2008-10-01

    Full Text Available Abstract Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow

  18. Colombia a Source of Cacao Genetic Diversity As Revealed by the Population Structure Analysis of Germplasm Bank of Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Jaime A. Osorio-Guarín

    2017-11-01

    Full Text Available Beans of the species Theobroma cacao L., also known as cacao, are the raw material to produce chocolate. Colombian cacao has been classified as a fine flavor cacao that represents the 5% of cacao world’s production. Colombian genetic resources from this species are conserved in ex situ and in-field germplasm banks, since T. cacao has recalcitrant seeds to desication and long-term storage. Currently, the collection of T. cacao of the Colombian Corporation of Agricultural Research (CORPOICA has approximately 700 germplasm accessions. We conducted a molecular analysis of Corpoica’s cacao collection and a morphological characterization of some accessions with the goal to study its genetic diversity and population structure and, to select interesting accessions for the cacao’s breeding program. Phenotypic evaluation was performed based on 18 morphological traits and 4 biochemical traits. PCA analysis of morphological traits explained 60.6% of the total variation in seven components and 100% of the total variation of biochemical traits in four components, grouping the collection in 4 clusters for both variables. We explored 565 accessions from Corpoica’s germplasm and 252 accessions from reference populations using 96 single nucleotide polymorphism (SNP molecular markers. Molecular patterns of cacao Corpoica’s collection were obtained amplifying specific alleles in a Fluidigm platform that used integrated circuits of fluids. Corpoica’s collection showed highest genetic diversity [Expected Heterozygosity (HE = 0.314, Observed Heterozygosity (HO = 0.353] that is reduced when reference populations were included in the dataset (HE = 0.294, HO = 0.261. The collection was divided into four clusters based on population structure analysis. Cacao accessions from distinct groups showed some taxonomic concordance and reflected their geographic origins. For instance, accessions classified as Criollo were clearly differentiated in one group and we

  19. Variabilidad genética de Moniliophthora perniciosa (Stahel Aime y Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae en variedades de cacao (Theobroma cacao L. Genetic variability of Moniliophthora perniciosa (Stahel Aime & Phillips-Mora, comb. nov. (Agaricales - Marasmiaceae in varieties of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Carolina Osorio-Solano

    2012-04-01

    Full Text Available Moniliophthora perniciosa, agente causante de la ‘escoba de bruja’ en cacao (Theobroma cacao, presenta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cercanas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos encaminados al manejo de este patógeno y el desarrollo de materiales resistentes de cacao. En este estudio se analizaron 12 aislamientos del hongo obtenidos de diferentes materiales de cacao. Cada una de las muestras se evaluó con marcadores moleculares que tienen como blanco una región del ADN ribosomal (ADNr nuclear conocida como ITS (Internal Transcribed Spacer, una región intergénica (IGS-1 y cinco secuencias simples repetidas (SSR. El marcador IGS-1 permitió la determinación del biotipo C, no obstante se encontró una variabilidad genética evidente dentro de este biotipo, aún no registrada. El análisis de la diversidad genética de M. perniciosa por medio de marcadores microsatélite arrojó un valor total de 0.4260, una heterocigosidad total de 0.6143 y un índice de información polimórfica (PIC de 0.3407, valores considerados de rango medio a alto para los aislamientos estudiados y que estiman la variabilidad genética presente en M. perniciosa.Moniliophthora perniciosa, the founder agent of the ‘witch’s broom’ on cocoa (Theobroma cacao L. is one of the most important diseases in cocoa plantations, causing economic losses close to 70% worldwide and 40% nationwide. It shows a high genetic variability and discrepancies in its taxonomy. Characterization of the genetic diversity of biotypes is important for projects aimed towards the handling of this pathogen and the development of resistant cocoa materials. Twelve isolations of the fungus were analyzed in this study from different

  20. Verificación del método analítico de espectroscopia de absorción atómica con horno de grafito para la cuantificación de cadmio en almendra de cacao (Theobroma cacao).

    OpenAIRE

    Araujo Abad, Lourdes Salomé

    2016-01-01

    The objective of this work was to verify the performance parameters of the analytical method of atomic absorption spectroscopy with graphite furnace for quantification of cadmium in cocoa (Theobroma cacao) almond, for which a protocol was prepared, analyzes were performed on the certified reference material (MRC), the concentration of cadmium in dry cocoa beans four farms (Farm A, B, C and D) located in the cocoa zone of the country, Flavio Alfaro Manabí, was determined an...

  1. Datos experimentales de la cinética del secado y del modelo matemático para pulpa de cupuaçu (Theobroma grandiflorum en rodajas Kinetic drying experimental data and mathematical model for cupuaçu pulp (Theobroma grandiflora slices

    Directory of Open Access Journals (Sweden)

    Abraham Damian Giraldo-Zuniga

    2010-03-01

    Full Text Available En este trabajo fueron obtenidos experimentalmente la cinética del secado de la pulpa de cupuaçu en forma de rodajas con espesor de 0,5 cm. El secado fue realizado utilizándose un secador laboratorial de bandejas, a las temperaturas de 50, 60 y 70 ºC y a la velocidad del aire de secado de 1,5 m/s. De acuerdo con los datos de la cinética del secado se puede observar que cuanto mayor es la temperatura del secado mayor es la velocidad del secado. El tiempo requerido para secar el producto hasta una humedad del 20%, fueron 9,2, 8,1 y 7,3 horas para las temperaturas de secado de 50, 60 y 70 ºC respectivamente. Las curvas experimentales del secado fueron ajustados al modelo difusional de Fick considerándose la muestra como una lámina infinita y al modelo de Page. Los dos modelos se ajustaron bien a los datos experimentales. Los coeficientes de difusión del modelo de Fick variaron de 1.171 a 1.561 m/s².This work examined experimentally the kinetics of drying cupuaçu pulp (Theobroma grandiflorum slices. The experimental runs were driven in a laboratory dryer, at temperatures of 50, 60 and 70 ºC and an air drying velocity of 1.5 m/s. According to the kinetics study, increasing the temperature led to a decrease in drying time. The required drying times were 9.2, 8.1 and 7.3 hours for drying temperatures of 50, 60 and 70 ºC respectively. The experimental drying curves were adjusted to Fick's diffusional model for an infinite lamina with shrinkage and Page model. The diffusion coefficients of the Fick model varied between 1.171 and 1.561 m/s².

  2. Seasonal dynamics of arbuscular mycorrhizal fungi in plants of Theobroma grandiflorum Schum and Paullinia cupana Mart. of aN agroforestry system in Central Amazonia, Amazonas State, Brazil Dinâmica sazonal de fungos micorrízicos arbusculares em plantas de Theobroma grandiflorum Schum e Paullinia cupana Mart. de um sistema agroflorestal na Amazônia Central, Amazonas, Brasil

    Directory of Open Access Journals (Sweden)

    Arlem Nascimento de Oliveira

    2005-09-01

    Full Text Available The seasonal dynamics of Arbuscular Mycorrhizal Fungi (AMF was investigated in the rhizosphere of two fruit species in a terra firme (upland ecosystem in Central Amazonia. Two host species (Theobroma grandiflorum and Paullinia cupana and nine sampling months (August, September and December/1998, February, April, May and December/1999, February and May/2000 were studied in a completely randomized design, with five replications, set in a 2 x 9 factorial experiment. Soil (0-20 cm depth and root samples were collected between August 1998 and May 2000. The mean percent colonization of AMF for both species reached maximal values in February and May 2000 (rainy season. In April and May 1999, February and May 2000 (rainy season the highest AMF spore numbers were registered. The pluvial precipitation was significantly positively correlated with AMF number spores for both fruit species, and significant positive correlation only with AMF colonization of P. cupana. Soil moisture content was positively correlated with colonization and spore numbers of AMF for both species evaluated. AMF colonization and AMF spore numbers of T. grandiflorum were positively correlated with soil Mg and K concentrations. AMF spore numbers of T. grandiflorum were also negatively correlated with effective cation exchange capacity (ECEC. AMF colonization and AMF spore numbers in the rhizosphere of P. cupana were positively correlated with pH and Mn concentrations. AMF colonization was also positively correlated with AMF spore numbers for both species evaluated. In conclusion, this study showed that AMF colonization and sporulation are seasonal and dependent on host plant species, pluvial precipitation, soil moisture content and soil chemistry in Central Amazonia conditions.A dinâmica sazonal de fungos micorrízicos arbusculares (FMA foi investigada na rizosfera de duas espécies frutíferas em um ecossistema de terra firme na Amazônia Central. Adotou-se o delineamento

  3. Characterization of Cocoa (Theobroma cacao L. Farming Systems in the Norte de Santander Department and Assessment Their Sustainability / Caracterización de los Sistemas de Producción de Cacao (Theobroma cacao L. en el Departamento de Norte de Santander

    Directory of Open Access Journals (Sweden)

    Jesús Arturo Ramírez Sulvarán

    2014-03-01

    Full Text Available The cocoa (Theobroma cacao L. based economyhas been considered a valid alternative to support sustainable development in northeastern Colombia. However, there is a lack of information about the cocoa production systems in the region which is needed for the implementation of effective plans to improve their performance and sustainability. Four of the main cocoa producing municipalities in the Norte de Santanderdepartment were considered for this study: Teorama, Bucarasica, Cúcuta and San Calixto. These entities were selected due to their adequate security conditions, availability of field assistants and departmental representativeness in cocoa production. The objective was to obtain basic information for local, specific and participatory actions for the sustainability of the cocoa production systems and to improve the living conditions of farmers. The methodology used was based on the farming system approach, considering the socioeconomic, technological and agro-ecologicalcomponents, and their relationships, and evaluating themaccording to the principles of sustainable agriculture. The phases covered were: (1 analysis of secondary data, (2 formulation and evaluation of sustainability indicators, (3 design, implementation and analysis of survey data and (4 validation by the farmers of the obtained information and the prioritization of problems. The results indicate that there is only one cocoa production system of a family-mercantile type, with low technology. Most farmers havelow incomes and basic needs such as health, education and public services are not met. They do not employ the agronomic and postharvest practices recommended by specialists. The water and soil resources are being degraded. In general, the farming system leans towards unsustainability and it is vital that integrative actions be taken to change this situation. / Se considera que el desarrollo de una economía basada en el cacao (Theobroma cacao L

  4. Discovery and mapping of a new expressed sequence tag-single nucleotide polymorphism and simple sequence repeat panel for large-scale genetic studies and breeding of Theobroma cacao L.

    Science.gov (United States)

    Allegre, Mathilde; Argout, Xavier; Boccara, Michel; Fouet, Olivier; Roguet, Yolande; Bérard, Aurélie; Thévenin, Jean Marc; Chauveau, Aurélie; Rivallan, Ronan; Clement, Didier; Courtois, Brigitte; Gramacho, Karina; Boland-Augé, Anne; Tahi, Mathias; Umaharan, Pathmanathan; Brunel, Dominique; Lanaud, Claire

    2012-01-01

    Theobroma cacao is an economically important tree of several tropical countries. Its genetic improvement is essential to provide protection against major diseases and improve chocolate quality. We discovered and mapped new expressed sequence tag-single nucleotide polymorphism (EST-SNP) and simple sequence repeat (SSR) markers and constructed a high-density genetic map. By screening 149 650 ESTs, 5246 SNPs were detected in silico, of which 1536 corresponded to genes with a putative function, while 851 had a clear polymorphic pattern across a collection of genetic resources. In addition, 409 new SSR markers were detected on the Criollo genome. Lastly, 681 new EST-SNPs and 163 new SSRs were added to the pre-existing 418 co-dominant markers to construct a large consensus genetic map. This high-density map and the set of new genetic markers identified in this study are a milestone in cocoa genomics and for marker-assisted breeding. The data are available at http://tropgenedb.cirad.fr. PMID:22210604

  5. Theobromine, the primary methylxanthine found in Theobroma cacao, prevents malignant glioblastoma proliferation by negatively regulating phosphodiesterase-4, extracellular signal-regulated kinase, Akt/mammalian target of rapamycin kinase, and nuclear factor-kappa B.

    Science.gov (United States)

    Sugimoto, Naotoshi; Miwa, Shinji; Hitomi, Yoshiaki; Nakamura, Hiroyuki; Tsuchiya, Hiroyuki; Yachie, Akihiro

    2014-01-01

    Theobromine, a caffeine derivative, is the primary methylxanthine produced by Theobroma cacao. We previously showed that methylxanthines, including caffeine and theophylline, have antitumor and antiinflammatory effects, which are in part mediated by their inhibition of phosphodiesterase (PDE). A member of the PDE family, PDE4, is widely expressed in and promotes the growth of glioblastoma, the most common type of brain tumor. The purpose of this study was to determine whether theobromine could exert growth inhibitory effects on U87-MG, a cell line derived from human malignant glioma. We show that theobromine treatment elevates intracellular cAMP levels and increases the activity of p38 mitogen-activated protein kinase and c-Jun N-terminal kinase, whereas it attenuates p44/42 extracellular signal-regulated kinase activity and the Akt/mammalian target of rapamycin kinase and nuclear factor-kappa B signal pathways. It also inhibits cell proliferation. These results suggest that foods and beverages containing cocoa bean extracts, including theobromine, might be extremely effective in preventing human glioblastoma.

  6. Efecto de la temperatura y tiempo de tostado en los caracteres sensoriales y en las propiedades químicas de granos de cacao (Theobroma cacao L.) procedente de Uchiza, San Martín – Perú para la obtención de NIBS

    OpenAIRE

    Aldave Palacios, Gladis Josefina

    2016-01-01

    Estudia las variedades de cacao (Theobroma cacao L.) CCN-51 e ICS-6, procedentes del distrito de Uchiza, provincia de Tocache, departamento de San Martín, en Perú. Efectúa el tratamiento térmico de tostado a las temperaturas de 120 y 130 °C por 40 y 50 minutos, los nibs de cacao (granos de cacao tostados y pelados) son evaluados sensorialmente por seis jueces entrenados. La evaluación estadística mediante la prueba no paramétrica de Wilcoxon no halla diferencia significativa entre los tratami...

  7. Genetic analysis of half-sib progenies of Theobroma grandiflorum Análise genética de famílias de meios-irmãos de cupuaçuzeiro

    Directory of Open Access Journals (Sweden)

    Maria Clideana Cabral Maia

    2011-06-01

    Full Text Available

    The cupuaçuzeiro (Theobroma grandiflorum, species native from the Amazon region, has been domesticated presenting a broad genetic variability, and thus favorable conditions for establishing of strategies to breeding and genetic conservation. The aim of this work was to evaluate 36 half-sib progenies of Theobroma grandiflorum obtained from a stratified mass selection in farmers areas based on primary components of yield. The experiment for selection of elite progenies was set up in a randomized complete block design with three replications and four plants per plot. The fruit traits (length and width, in cm and components of production (average weight of fruit/plant; average weight of pulp with seeds/plant and average weight of pulp/plant, in g were evaluated. The data were analyzed through the methodology of REML/BLUP using the Selegen software. Analysis of grouping was performed using the matrix of genetic euclidean distances and Mahalanobis. The experimental population allowed the selection of superior parents for formation of base population to be used in the genetic improvement of cupuaçu. Among the 36 analyzed lineages only the genotypes 9, 10 and 18 showed genetic divergence and they can be recommended with some lineage of group 1 that demonstrates agronomic superiority to form base population of experimental clones with high genetic dissimilarity.

    doi: 10.4336/2011.pfb.31.66.123

    O cupuaçuzeiro, espécie nativa da região Amazônica, encontra-se em processo de domesticação, apresentando ampla variabilidade genética e condições favoráveis para o estabelecimento de estratégias de melhoramento e conservação. O objetivo foi avaliar geneticamente 36 progênies de meios-irmãos de cupuaçu oriundos de seleção massal estratificada em

  8. In Vitro Studies on the Antioxidant Property and Inhibition of α-Amylase, α-Glucosidase, and Angiotensin I-Converting Enzyme by Polyphenol-Rich Extracts from Cocoa (Theobroma cacao) Bean.

    Science.gov (United States)

    Oboh, Ganiyu; Ademosun, Ayokunle O; Ademiluyi, Adedayo O; Omojokun, Olasunkanmi S; Nwanna, Esther E; Longe, Kuburat O

    2014-01-01

    Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao) bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH), 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), hydroxyl (OH), and nitric oxide (NO)] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL), α-glucosidase (1.84 ± 0.17 mg/mL), and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart]) activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL), NO (6.98 ± 0.886 mg/mL), OH (3.72 ± 0.26 mg/mL), and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension.

  9. In Vitro Studies on the Antioxidant Property and Inhibition of α-Amylase, α-Glucosidase, and Angiotensin I-Converting Enzyme by Polyphenol-Rich Extracts from Cocoa (Theobroma cacao Bean

    Directory of Open Access Journals (Sweden)

    Ganiyu Oboh

    2014-01-01

    Full Text Available Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH, 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid (ABTS, hydroxyl (OH, and nitric oxide (NO] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL, α-glucosidase (1.84 ± 0.17 mg/mL, and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart] activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL, NO (6.98 ± 0.886 mg/mL, OH (3.72 ± 0.26 mg/mL, and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension.

  10. Tc-cAPX, a cytosolic ascorbate peroxidase of Theobroma cacao L. engaged in the interaction with Moniliophthora perniciosa, the causing agent of witches' broom disease.

    Science.gov (United States)

    Camillo, Luciana Rodrigues; Filadelfo, Ciro Ribeiro; Monzani, Paulo Sérgio; Corrêa, Ronan Xavier; Gramacho, Karina Peres; Micheli, Fabienne; Pirovani, Carlos Priminho

    2013-12-01

    The level of hydrogen peroxide (H2O2) in plants signalizes the induction of several genes, including that of ascorbate peroxidase (APX-EC 1.11.1.11). APX isoenzymes play a central role in the elimination of intracellular H2O2 and contribute to plant responses to diverse stresses. During the infection process in Theobroma cacao by Moniliophthora perniciosa oxidative stress is generated and the APX action recruited from the plant. The present work aimed to characterize the T. cacao APX involved in the molecular interaction of T. cacao-M. perniciosa. The peroxidase activity was analyzed in protein extracts from cocoa plants infected by M. perniciosa and showed the induction of peroxidases like APX in resistant cocoa plants. The cytosolic protein of T. cacao (GenBank: ABR68691.2) was phylogenetically analyzed in relation to other peroxidases from the cocoa genome and eight genes encoding APX proteins with conserved domains were also analyzed. The cDNA from cytosolic APX was cloned in pET28a and the recombinant protein expressed and purified (rTc-cAPX). The secondary structure of the protein was analyzed by Circular Dichroism (CD) displaying high proportion of α-helices when folded. The enzymatic assay shows stable activity using ascorbate and guaiacol as an electron donor for H2O2 reduction. The pH 7.5 is the optimum for enzyme activity. Chromatographic analysis suggests that rTc-cAPX is a homodimer in solution. Results indicate that the rTc-cAPX is correctly folded, stable and biochemically active. The purified rTc-cAPX presented biotechnological potential and is adequate for future structural and functional studies. Copyright © 2013 The Authors. Published by Elsevier Masson SAS.. All rights reserved.

  11. In Vitro Studies on the Antioxidant Property and Inhibition of α-Amylase, α-Glucosidase, and Angiotensin I-Converting Enzyme by Polyphenol-Rich Extracts from Cocoa (Theobroma cacao) Bean

    Science.gov (United States)

    Ademosun, Ayokunle O.; Ademiluyi, Adedayo O.; Omojokun, Olasunkanmi S.; Nwanna, Esther E.; Longe, Kuburat O.

    2014-01-01

    Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao) bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH), 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), hydroxyl (OH), and nitric oxide (NO)] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL), α-glucosidase (1.84 ± 0.17 mg/mL), and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart]) activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL), NO (6.98 ± 0.886 mg/mL), OH (3.72 ± 0.26 mg/mL), and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension. PMID:25295218

  12. Inhibitory Effect of Phragmanthera Incana (Schum.) Harvested from Cocoa (Theobroma Cacao) and Kolanut (Cola Nitida) Trees on Fe2+ induced Lipid Oxidative Stress in Some Rat Tissues - In Vitro

    Science.gov (United States)

    Ogunmefun, O. T.; Fasola, T. R.; Saba, A. B.; Akinyemi, A. J.

    2015-01-01

    Evidence in both experimental and clinical studies has shown the participation of oxidative stress in the development and progression of diabetes mellitus. This study therefore, sought to investigate the inhibitory effect of methanolic extract of Phragmanthera incana leaves, a mistletoe species harvested from Cocoa (Theobroma cacao) and Kolanut (Cola nitida) on FeSO4 induced lipid peroxidation in rat pancreas, liver, kidney, heart and brain in vitro. The methanolic extract was prepared with 90% methanol (v/v); subsequently, the antioxidant properties and inhibitory effect of the extract on Fe2+ induced lipid peroxidation in some rat tissues were determined in vitro. Incubation of the different rat tissues homogenate in the presence of Fe caused a significant increase in the malondialdehyde (MDA) contents of the tissues. However, the methanolic extracts of Phragmanthera incana leaves harvested from both Cocoa and Kolanut trees caused a significant decrease in the MDA contents of all the tissues tested in a dose-dependent manner. However, the extract of Phragmanthera incana leaves harvested from kolanut trees had a better inhibitory effect on Fe2+- induced lipid peroxidation in the rat tissues homogenates than that of Phragmanthera incana leaves harvested from cocoa trees. This higher inhibitory effect could be attributed to its significantly higher antioxidant properties as typified by their phenolic content, DPPH radical scavenging ability and reducing power. Therefore, oxidative stress associated with diabetes and its other complications could be potentially managed/prevented by harnessing Phragmanthera incana leaves as cheap nutraceuticals. However, Phragmanthera incana leaves harvested from kolanut trees exhibited better antioxidant properties.

  13. ESTUDIO DE LA DIVERSIDAD GENÉTICA DE 20 ACCESIONES DE CACAO (Theobroma cacao L. MEDIANTE AP-PCR DE LA COLECCIÓN DEL CENTRO DEL CACAO DE AROMA TENGUEL EN LA FINCA EXPERIMENTAL LA BUSETA

    Directory of Open Access Journals (Sweden)

    Mercedes Susana Carranza Patiño

    2008-06-01

    Full Text Available El presente estudio consistió en determinar la diversidad genética basada en los marcadores RAPD´s (Random Amplification of Polymorphic DNA de 20 accesiones de cacao (Theobroma cacao L.de la variedad Nacional, con características de productividad, y niveles de resistencia, susceptibilidad y tolerancia a las rincipales enfermedades causadas por hongos como Ceratocistys fimbriata, Moniliophtora roreri y Crinipelis perniciosa. Este germoplasma de cacao se encuentra localizado en el Centro de Cacao de Aroma Tenguel, en la Finca Experimental “La Buseta” propiedad de la Universidad Técnica Estatal de Quevedo. La extracción de ADN se la realizó utilizando el protocolo de Doyle & Doyle (1990 con algunas modificaciones. 14 oligonucleótidos fueron utilizados para la obtención de marcadores RAPD´s, de los cuales 9 amplificaron productos reproducibles OPA-15, OPC-07, OPC-9, OPC-4, OPC-3, OPC-1, OPA-12 OPC-13 y OPA-7. Los productos de amplificación fueron migrados en geles de agarosa al 1.2% a 90 voltios por una hora. Los marcadores moleculares fueron analizados por medio de una matriz de datos binarios para calcular las distancias genéticas. Los nueve cebadores utilizados generaron 67 bandas de las cuales 59 (88% fueron polimórficas. El dendrograma mostró dos grupos A y B, en el grupo A se incluyo dos accesiones, y en el grupo B se encuentran los 18 restantes el cual incluye 2 subgrupos B1 y B2 en el subgrupo B1 se incluye la accesión (L-22-H-40, y en el subgrupo B2 están incluidas las accesiones que poseen características de productividad. El nivel de diversidad más alto se obtuvo con los oligonucleótidos OPC 04 (0.80, OPC 07 (0.82. El cebador OPC 01 (0.37 reportó el nivel más bajo. Las accesiones (L-22-H-40 (O.75, (L-34-H-07 (0.86 y el (L-42-H-60 (0.72 presentaron los niveles de variabilidad más altos, siendo los valores más bajos los mostrados por las accesiones (L-26-H-64 (O.48 y (L-23-H63 (O.47. El valor de la diversidad

  14. Análisis y estimación de parámetros e índices de crecimiento del árbol de Maraco (Theobroma bicolorH.B.K. a primera floración

    Directory of Open Access Journals (Sweden)

    Hernández G. María Soledad

    1995-12-01

    Full Text Available El maraco (Theobroma bicolor H.B.K. es un frutal amazónico con alto potencial agroindustrial. Para su inclusión dentro de la economía de mercado regional es indispensable conocer su comportamiento fisiológico durante ta'tase vegetativa con el fin de establecer la eficiencia de acumulación de materia
    seca. Entonces, se hace necesario desarrollar estudios que conduzcan a un mayor conocimiento de la especie, permitiendo con ello, generar alternativas para su producción comercial dentro del entorno amazónico. El presente estudio tuvo como objetivo caracterizar el crecimiento vegetativo de la especie a partir del cálculo de las medidas derivadas de crecimiento: Tasa de asimilación neta (TAN, Tasa de crecimiento relativo (TCR, Tasa de crecimiento del cultivo (TCC, Relación del área foliar (RAF, Duración del área foliar (DAF e índice de área foliar (IAF en el árbol de maraco, desde su siembra definitiva en el campo hasta la primera
    floración. Se encontró que el área fotosintética del árbol y su materia seca aumentaron a lo largo de toda la fase vegetativa, con un patrón de crecimiento sigmoidal. Los índices TAN, TCR y TCC se hicieron máximos en el período previo al iniciar de la fase reproductiva, con lo cual se logró, en la planta, el balance carbono/nitrógeno requerido para
    la transición entre una fase y otra. Igualmente, la RAF se hizo máxima para la misma etapa. El análisis de crecimiento permitió cuantificar el crecimiento de la planta, su producción de materia seca y la expansión del área foliar, con lo cual se podrá en adelante, generar prácticas adecuadas de fertilización que promuevan la producción de tejidos fotosintéticos y pigmentos clorofílicos. De igual manera, se podrá establecer la arquitectura de planta ideal que permita la mayor eficiencia en el cultivo para la conversión de la energía radiante en energía química.
    The Maraco is an amazonic fruit with a high potential for

  15. Sulphur depletion altered somatic embryogenesis in Theobroma ...

    African Journals Online (AJOL)

    USER

    2010-08-30

    Aug 30, 2010 ... embryo) occur in response to alteration of genes expression patterns ... the proteins synthesis and the rate with which all amino ... thiamine-HCl, 1 mgml-1 nicotinic acid and 2 mgml-1 glycine), 20 gL-1 ... Amino acids and soluble sugar extraction .... 0.1% (v/v) Triton X-100, 0.1 % (w/v) dithiothreitol, and 0.2%.

  16. Avaliação genética de indivíduos e progênies de cupuaçuzeiro no estado do Pará e estimativas de parâmetros genéticos Genetic evaluation of individuals and progenies of Theobroma grandiflorum in the state of Pará and estimates of genetic parameters

    Directory of Open Access Journals (Sweden)

    Rafael Moysés Alves

    2008-09-01

    seleção recorrente para melhorar, gradativamente, o nível de resistência. Parece suficiente considerar na seleção apenas o número de vassouras, não sendo necessário considerar o peso. A correlação entre resistência no fruto e na inflorescência foi alta (0.84, indicando algum controle genético comum aos dois caracteres. Foram identificadas progênies superiores, simultaneamente, para produção de frutos e resistência à vassoura.This paper deals with the genotypic evaluation of Theobroma grandiflorum progenies in the Pará State for the characters number of fruits (NF in four harvests, intensity of occurrence of witch's broom disease in the inflorescences (WBI and in the fruits (WBF and weight of branches with witch's broom (WWB. Also, it presents estimates of genetic parameters that allow to infer on the genetic control and level of genetic variability in the appraised germplasm. All the characters presented considerable genetic variability, with coefficients of genetic variation varying from 27% to 88% at progenies level and from 38% to 123% at individual level. This reveals excellent possibilities for the selection in that hybrid experimental population. The estimates of individual narrow sense heritabilities, in a harvest, varied from 25% to 54% and the individual repeatabilities for NF was equal at 35%. With the four accomplished harvests the individual heritability increased to 48%, providing selective accuracy of 70%, for the individuals' selection. The gain in efficiency, when using more than five crops is practically worthless. For NF, genetic gains above 60% can be obtained with the selection of the best five individuals. Individuals with annual production of 17 fruits can be selected, value which is much more superior to the general average of 10 fruits, found in the commercial plantations. Superior genetic gains can be obtained with clone propagation of the best individuals in relation to the sexual propagation and for the best individual the

  17. Review of vegetative propagation of cacao ( Theobroma cacao L ...

    African Journals Online (AJOL)

    Parmi les facteurs physiologiques influençant la propagation de cacao par les boutures de cacao, les différences du clonage, la surface foliaire, l'âge physiologique, les traits anatomiques, les facteurs nutritionnels et biochimiques exercent la plus forte influence. Les clones d'Upper Amazon et de Trinitario prennent les ...

  18. Heavy metals in soils of cocoa plantation (Theobroma cacao L.)

    Science.gov (United States)

    Cocoa has experienced significant growth in recent years in Peru and the presence of heavy metals in the soils of these plantations is a potential problem for the export of this product. Contents of heavy metals (Cd, Ni, Pb, Fe, Cu, Zn, Mn) in soils from 19 plantations that have been in production f...

  19. Hypoglycemic effects of cocoa (Theobroma cacao L.) autolysates.

    Science.gov (United States)

    Sarmadi, Bahareh; Aminuddin, Farhana; Hamid, Muhajir; Saari, Nazamid; Abdul-Hamid, Azizah; Ismail, Amin

    2012-09-15

    Fat, alkaloid and polyphenol contents of two clones of cocoa (UIT1 and PBC 140) were removed and the remaining powder was autolyzed at pH 3.5 and 5.2. Based on the results, autolysates of UIT produced at pH 3.5 exhibited the highest ability to inhibit α-amylase activity. However, no α-glucosidase inhibition activity was observed under the conditions specified. Autolysates produced under pH 3.5 caused the highest amount of insulin secretion. In streptozotocin-diabetic rats, all cocoa autolysates significantly decreased blood glucose at 4h. To assure that the results from the assays were not due to the polyphenols of cocoa autolysates qualitative and quantitative tests were applied. According to their results cocoa autolysates were found to be free from polyphenols. Analysis of amino acid composition revealed that cocoa autolysates were abundant in hydrophobic amino acids. It can be suggested that besides other compounds of cocoa, its peptides and amino acids could contribute to its health benefits. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Antifungal effects of sisal leaf juice on Lasiodiplodia theobromae ...

    African Journals Online (AJOL)

    Among the nine varieties, the inhibition effects of hybrid 76416 and Agave americana were the best with absolute inhibition of all the leaf juice treatments against the mycelial growth, followed by Agave Amaniensis, Agave virdis, Agave angustifolia and Hybrid 11648. The inhibitory effect of some fresh juices would be cut ...

  1. Review of vegetative propagation of cacao ( Theobroma cacao L ...

    African Journals Online (AJOL)

    Cet article fait une révision de facteurs environnementaux favorables et les diffecultés techniques qui ont limité l'utilisation extensive de propagation végétative pour la multiplication de cacao. Inclus dans les facteurs extérieurs importante influençcant l'enracinement de boutures de cacao saont: la lumière, la température, ...

  2. Flavonoids from Theobroma cacao down-regulate inflammatory mediators.

    Science.gov (United States)

    Ramiro, Emma; Franch, Angels; Castellote, Cristina; Pérez-Cano, Francisco; Permanyer, Joan; Izquierdo-Pulido, Maria; Castell, Margarida

    2005-11-02

    In the present study, we report the effects of a cocoa extract on the secretion and RNA expression of various proinflammatory mediators by macrophages. Monocyte chemoattractant protein 1 and tumor necrosis factor alpha (TNFalpha) were significantly and dose-dependently diminished by cocoa extract, and this effect was higher than that produced by equivalent concentrations of epicatechin but was lower than that produced by isoquercitrin. Interestingly, cocoa extract added prior to cell activation resulted in a significantly greater inhibition of TNFalpha secretion. Both cocoa extract and epicatechin decreased TNFalpha, interleukin (IL) 1alpha, and IL-6 mRNA expression, suggesting that their inhibitory effect on cytokine secretion is produced, in part, at the transcriptional level. Cocoa extract also significantly decreased NO secretion in a dose-dependent manner and with a greater effect than that produced by epicatechin. In conclusion, our study shows that cocoa flavonoids not only inhibit NO release from macrophages but also down-regulate inflammatory cytokines and chemokines.

  3. First report of Lasiodiplodia theobromae (Pat.) Griffon & Maubl ...

    African Journals Online (AJOL)

    SARAH

    2014-07-31

    Jul 31, 2014 ... *1School of Crop and Seed Production and Management (EGPVS), ... 2International Institute of Tropical Agriculture, 08 BP 0932, Cotonou, Rep. ... Objective: Jatropha curcas L. is an important biofuel crop grown worldwide.

  4. KARAKTERISASI ENZIM POLIFENOL OKSIDASE BIJI KAKAO (Theobroma cacao Linn. Characterization of Polyphenol Oxidase Enzyme of Cocoa Beans (Theobroma cacao Linn.

    Directory of Open Access Journals (Sweden)

    G.P. Ganda Putra

    2012-05-01

    max equals to 595,24 U/gram (db of cocoa beans and K equals to 0,20 M; result of SDS- PAGE of enzyme shows protein bands at M� of 11,75; 17,80; 27,80; 36,03 and 131,52 kDa; and finally, optimumcondition of enzyme activity is at the temperature of 53,43oC; pH 5,42 and incubation time of 80,91 minutes. ABSTRAK Telah dilakukan penelitian dengan tujuan untuk: (1 mengetahui karakteristik enzim polifenol oksidase dan (2 menen- tukan kondisi (suhu, pH dan waktu inkubasi optimum aktivitas enzim polifenol oksidase, yang diisolasi dari biji kakao kering. Hasil penelitian berupa kondisi (suhu, pH dan waktu inkubasi optimum aktivitas enzim polifenol oksidase akan diaplikasikan untuk perbaikan mutu biji kakao kering melalui teknik rehidrasi. Penelitian ini dilakukan melalui tahapan: (1 isolasi enzim polifenol oksidase dari 10 sampel biji kakao kering di Provinsi Bali, (2 karakterisasi enzim polifenol oksidase (aktivitas, kinetika enzim, BM dan (3 penentuan kondisi suhu, pH dan waktu inkubasi optimum. Hasil yang diperoleh menunjukkan bahwa: (1 aktivitas enzim polifenol oksidase rata-rata 157,49 ± 58,03 U/gram (bk biji kakao dengan aktivitas maksimum 258,22 U/gram (bk biji kakao dan minimum 59,01 U/gram (bk biji kakao; maks sebesar 595,24 U/gram (bk biji kakao dan K sebesar 0,20 M; hasil SDS-PAGE enzim menunjukkan pita-pita protein yang terbentuk pada BM 11,75; 17,80; 27,80; 36,03 dan 131,52 kDa; dan (2 kondisi optimum aktivitas enzimadalah suhu 53,43oC; pH 5,42 dan waktu inkubasi 80,91 menit.

  5. Perfil sensorial de pó de cacau (Theobroma cacao L.) alcalinizado Sensory profile and acceptance of alkalinized cocoa (Theobroma cacao L.) powder

    OpenAIRE

    Eliete da Silva Bispo; Vera Lúcia Pupo Ferreira; Ligia Regina Radomille de Santana; Katumi Yotsuyanagi

    2005-01-01

    A Análise Descritiva Quantitativa(ADQ) foi empregada para caracterização das amostras de pós de cacau que representaram a amplitude do delineamento composto rotacional central 2 do processo de alcalinização dos "nibs" de cacau. As variáveis independentes foram faixas de temperatura de 60 a 120 ºC, de tempo de 30 a 150min e de concentração de K2CO3 de 1,22 a 4,78%. Foram avaliadas oito amostras de pó de cacau representativas das variações de cor e aceitabilidade do total das amostras obtidas e...

  6. Perfil sensorial de pó de cacau (Theobroma cacao L. alcalinizado Sensory profile and acceptance of alkalinized cocoa (Theobroma cacao L. powder

    Directory of Open Access Journals (Sweden)

    Eliete da Silva Bispo

    2005-06-01

    Full Text Available A Análise Descritiva Quantitativa(ADQ foi empregada para caracterização das amostras de pós de cacau que representaram a amplitude do delineamento composto rotacional central 2 do processo de alcalinização dos "nibs" de cacau. As variáveis independentes foram faixas de temperatura de 60 a 120 ºC, de tempo de 30 a 150min e de concentração de K2CO3 de 1,22 a 4,78%. Foram avaliadas oito amostras de pó de cacau representativas das variações de cor e aceitabilidade do total das amostras obtidas experimentalmente e duas amostras de marcas comerciais. A análise do aroma foi feita diretamente nos pós de cacau alcalinizados e a dos demais atributos na forma de bebida achocolatada (2% do pó de cacau e 7% de açúcar em leite desnatado esterilizado. Doze provadores selecionados com base no seu poder de discriminação, reprodutibilidade e concordância com a equipe geraram em consenso, pelo método de rede (Kelly's Repertory Grid Method, três termos descritos para o aroma (alcalino, chocolate e queimado e doze para os achocolatados (solubilidade, marrom, marrom avermelhado, chocolate, queimado, caramelo, doce, adstringente, alcalino, amargo, salgado e corpo. As avaliações das amostras foram feitas monadicamente com três repetições e em cabines individuais. Os dados obtidos foram submetidos a ANOVA, teste de Tukey e Análise de Componentes Principais. As avaliações dos aromas dos pós de cacau mostraram relação direta entre o aroma alcalino e os teores de álcali, temperatura e tempo do processo. De modo geral, os produtos com menores concentrações de K2CO3 (1,22 - 3,00% apresentaram aroma e sabor de chocolate mais fortes. Encontrou-se uma relação direta entre os teores de álcali no produto e o sabor alcalino, queimado e adstringente e uma relação inversa com a luminosidade da cor. Assim, as amostras com maior concentração de K2CO3 (4,78%, foram consideradas pela equipe sensorial, as de mais forte sabor e aroma alcalino, queimado e adstringente, assim como de cor marrom e marrom avermelhado mais escura. Todos os processos levaram à obtenção de amostras com alta solubilidade e fraco sabor amargo.The Quantitative Descriptive Analysis (ADQ was used aiming to show the sensory characterization of cocoa powder samples representing the range of a central composite design, 2³ of the process of alkalization of the cocoa "nibs" using variables independent such as temperature (60, 72, 90 and 108 ºC, time (30, 54, 90, 126 and 150min and concentration of K2CO3(0.0, 1.22, 3.0 and 4.78%. Two commercial samples of alkalinized cocoa powder were appraised. The analysis of the flavour was accomplished in the alkalinized cocoa powders and the other atributes in the chocolate beverage form (2% of the alkalinized cocoa powders and 7% of sugar in skimmed sterilized milk. Twelve panelists were selectedbased in their to detect setterness, reliability and agreement with the panel. The data were evaluated by means of variance analysis ANOVA for the factors sample and panelist, as well as of the interaction sample x panelist. The Tukey test was applied for comparison of the averages of samples at the level of 5%. The principal components technique was applied to the data, obtaining the configuration of the samples considering all attributes. Roughly samples with K2CO3 between 1.22 to 3.0% and one of the commercial samples were considered with stronger chocolate flavour, as well as, weaker alkaline flavour and taste. Samples with K2CO3 with 4,78% were considered the darkest color and strongest alkaline flavour and astringency. For the chocolate beverage there was no significant difference at 5% level in relation to solubility and bitter flavor.

  7. OPTIMASI ISOLASI LIPASE INDIGENOUS BIJI KAKAO (Theobroma cacao L. The Optimizing of Isolation of Cocoa Bean Indogenous Lipase (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    I D. G. Mayun Permana

    2012-05-01

    Full Text Available The aim of the research is to optimize the isolation method of cocoa bean lipase. The research is held by determining the position of lipase on cocoa bean, varying extraction medium and isolation process. The result shows that the lipase of cocoa bean is   cytosolic enzyme. The defatting process do not increase the lipase activity. Polyphenols inhibit the lipase activity, so that removal of the polyphenol will increase the activity. Blocking the polyphenol with polyvinilpolypirrolidone (PVPP will also increase the activity.The optimum consentration of PVPP is 8 %. The lipase activity will reach the highest when homogenized for 10 menit at 10,000 rpm. The best medium extraction for lipase isolation is 0.15 M phosphate buffer pH 7.5 containing sucrose 0.6 M and CaCl  1.0 mM.   ABSTRAK Penelitian ini bertujuan untuk mengoptimasi isolasi lipase indigenous biji kakao. Optimasi diawali dengan menentukan keberadaan lipase kemudian optimasi medium ekstraksi dan proses ekstraksi. Hasil penelitian menunjukkan bahwa lipase berada dalam sitosol. Penghilangan lemak tidak meningkatkan aktivitas lipase. Senyawa polifenol menghambat aktivitas lipase dan penghilangan polifenol dapat meningkatkan aktivitas lipase. Polyvinilpolypirrolidone (PVPP dapat menghambat polifenol sehingga dapat meningkatkan aktivitas lipase. Konsentrasi PVPP optimum adalah 8 % dari berat biji kakao. Proses homogenisasi optimum diperoleh dalam waktu 10 menit pada kecepatan 10.000 rpm. Medium ekstraksi untuk isolasi lipase biji kakao terbaik adalah bufer fosfat 0,15 M  dan pH 7,5 yang mengandung sukrosa 0,6 M dan 1,0 mM CaCl .

  8. STUDI PEMBUATAN TEH DAUN TANAMAN KAKAO (Theobroma cacao L SEBAGAI MINUMAN PENYEGAR (Production of Tea from Cocoa Leaves (Theobroma cacao L as Refreshment Beverage

    Directory of Open Access Journals (Sweden)

    Supriyanto Supriyanto

    2015-02-01

    kakao kering berkadar air 3-5%. Dilakukan pengamatan dan analisis meliputi kadar air, warna, kadar total polifenol, aktivitas antioksidan dan uji sensoris pada air rebusan teh daun kakao sebagai minuman penyegar. Hasil penelitian menunjukkan bahwa minuman penyegar hasil rebusan teh daun kakao dapat diterima oleh panelis, dan  yang paling disukai adalah air rebusan teh yang dibuat dari daun kakao muda dilayukan 10 menit. Air rebusan tersebut  warnanya sangat coklat, sedikit berbau daun, agak pahit dan sedikit sepat. Bubuk teh daun kakao mengandung total polifenol antara 0,42-0,74 mg/100 g, mempunyai aktivitas antioksidan antara 20,31 – 36,86%. Kata kunci: Daun kakao, pelayuan, umur daun, teh daun kakao, polifenol

  9. Impact of fermentation on nitrogenous compounds of cocoa beans (Theobroma cacao L.) from various origins.

    Science.gov (United States)

    Hue, C; Gunata, Z; Breysse, A; Davrieux, F; Boulanger, R; Sauvage, F X

    2016-02-01

    Tangential filtration technique was used to separate and quantify three different fractions of nitrogenous compounds depending on their molecular size, during cocoa fermentation. On every phenotype and origin analyzed, protein profile of non-fermented samples was similar. During fermentation course, proteins get degraded with a concomitant increase in amino acids content. Peptides between 3 and 10 kDa were observed at low levels. A strong correlation between amino acids and ammonia nitrogen, a fermentation marker was found. Attention was drawn on each fraction, and enabled to point out other phenomenon occurring during fermentation. The migration of some nitrogenous compounds towards the bean shell during fermentation was demonstrated. Acetone treatment of cocoa powder prior to SDS-PAGE led to losses of nitrogenous compounds. This result gives clues on the tanning phenomenon carried out by polyphenols on nitrogenous compounds, phenomenon which increases during fermentation. Copyright © 2015. Published by Elsevier Ltd.

  10. Molecular, physiological and biochemical responses of Theobroma cacao L. genotypes to soil water deficit.

    Science.gov (United States)

    Santos, Ivanildes C Dos; Almeida, Alex-Alan Furtado de; Anhert, Dário; Conceição, Alessandro S da; Pirovani, Carlos P; Pires, José L; Valle, Raúl René; Baligar, Virupax C

    2014-01-01

    Six months-old seminal plants of 36 cacao genotypes grown under greenhouse conditions were subjected to two soil water regimes (control and drought) to assess, the effects of water deficit on growth, chemical composition and oxidative stress. In the control, soil moisture was maintained near field capacity with leaf water potentials (ΨWL) ranging from -0.1 to -0.5 MPa. In the drought treatment, the soil moisture was reduced gradually by withholding additional water until ΨWL reached values of between -2.0 to -2.5 MPa. The tolerant genotypes PS-1319, MO-20 and MA-15 recorded significant increases in guaiacol peroxidase activity reflecting a more efficient antioxidant metabolism. In relation to drought tolerance, the most important variables in the distinguishing contrasting groups were: total leaf area per plant; leaf, stem and total dry biomass; relative growth rate; plant shoot biomass and leaf content of N, Ca, and Mg. From the results of these analyses, six genotypes were selected with contrasting characteristics for tolerance to soil water deficit [CC-40, C. SUL-4 and SIC-2 (non-tolerant) and MA-15, MO-20, and PA-13 (tolerant)] for further assessment of the expression of genes NCED5, PP2C, psbA and psbO to water deficit. Increased expression of NCED5, PP2C, psbA and psbO genes were found for non-tolerant genotypes, while in the majority of tolerant genotypes there was repression of these genes, with the exception of PA-13 that showed an increased expression of psbA. Mutivariate analysis showed that growth variables, leaf and total dry biomass, relative growth rate as well as Mg content of the leaves were the most important factor in the classification of the genotypes as tolerant, moderately tolerant and sensitive to water deficit. Therefore these variables are reliable plant traits in the selection of plants tolerant to drought.

  11. Respon Pertumbuhan Bibit Kakao (Theobroma Cacao L.) TerhadapPemberian Pupuk Guano Dan KCl

    OpenAIRE

    Rajagukguk, Pispa; Siagian, Balonggu; Rosanty Lahay, Ratna

    2015-01-01

    Addition of guano in cultivation of cacao seedling is the one step to use organic fertilizer thatcomes from animal feces and it is used to add soil nutrient for the growth of cocoa seedlings, aswell addition of KCl is used to add soil nutrient too. For that purpose addition guano and KCl aimsto increase growth of cacao in cultivation of seedling. This research had been conducted atexperimental field of agriculture fakulty University of North Sumatera in October 2013 - January2014 using factor...

  12. Molecular, Biochemical and Ultrastructural Changes Induced by Pb Toxicity in Seedlings of Theobroma cacao L.

    Science.gov (United States)

    Reis, Graciele Santos Monteiro; de Almeida, Alex-Alan Furtado; de Almeida, Nicolle Moreira; de Castro, Andressa Vieira; Mangabeira, Pedro Antonio Oliveira; Pirovani, Carlos Priminho

    2015-01-01

    Pb is a metal which is highly toxic to plants and animals, including humans. High concentrations of Pb have been observed in beans of T. cacao, as well as in its products. In this work, we evaluated the molecular, biochemical, and ultrastructural alterations in mature leaves and primary roots of seedlings of two progenies of T. cacao, obtained from seed germination in different concentrations of Pb (0, 0.05, 0.1, 0.2, 0.4, 0.8 g L(-1)), in the form of Pb(NO3)2. The progenies resulted from self-fertilization of Catongo and a cross of CCN-10 x SCA-6. The Pb, supplied via seminal, caused alterations in the ultrastructures of the mesophyll cells and in the amount of starch grains in the chloroplasts. The dosage of substances reactive to thiobarbituric acid showed that Pb induced lipid peroxidation. The activity of guaiacol peroxidases and the expression of genes associated to synthetase of phytochelatin, SODcyt and PER increased in response to Pb. In addition, there was alteration in the expression of stress-related proteins. The progeny of CCN-10 x SCA-6 was more tolerant to Pb stress when compared to Catongo, since: (i) it accumulated more Pb in the roots, preventing its translocation to the shoot; (ii) it presented higher activity of peroxidases in the roots, which are enzymes involved in the elimination of excess of reactive oxygen species; and (iii) increased expression of the gene in the phytochelatin biosynthesis route. The results of the proteomic analysis were of paramount importance to differentiate the defense mechanisms used by both progenies of T. cacao.

  13. Antimicrobial properties of two novel peptides derived from Theobroma cacao osmotin.

    Science.gov (United States)

    Falcao, Loeni L; Silva-Werneck, Joseilde O; Ramos, Alessandra de R; Martins, Natalia F; Bresso, Emmanuel; Rodrigues, Magali A; Bemquerer, Marcelo P; Marcellino, Lucilia H

    2016-05-01

    The osmotin proteins of several plants display antifungal activity, which can play an important role in plant defense against diseases. Thus, this protein can be useful as a source for biotechnological strategies aiming to combat fungal diseases. In this work, we analyzed the antifungal activity of a cacao osmotin-like protein (TcOsm1) and of two osmotin-derived synthetic peptides with antimicrobial features, differing by five amino acids residues at the N-terminus. Antimicrobial tests showed that TcOsm1 expressed in Escherichia coli inhibits the growth of Moniliophthora perniciosa mycelium and Pichia pastoris X-33 in vitro. The TcOsm1-derived peptides, named Osm-pepA (H-RRLDRGGVWNLNVNPGTTGARVWARTK-NH2), located at R23-K49, and Osm-pepB (H-GGVWNLNVNPGTTGARVWARTK-NH2), located at G28-K49, inhibited growth of yeasts (Saccharomyces cerevisiae S288C and Pichia pastoris X-33) and spore germination of the phytopathogenic fungi Fusarium f. sp. glycines and Colletotrichum gossypi. Osm-pepA was more efficient than Osm-pepB for S. cerevisiae (MIC=40μM and MIC=127μM, respectively), as well as for P. pastoris (MIC=20μM and MIC=127μM, respectively). Furthermore, the peptides presented a biphasic performance, promoting S. cerevisiae growth in doses around 5μM and inhibiting it at higher doses. The structural model for these peptides showed that the five amino acids residues, RRLDR at Osm-pepA N-terminus, significantly affect the tertiary structure, indicating that this structure is important for the peptide antimicrobial potency. This is the first report of development of antimicrobial peptides from T. cacao. Taken together, the results indicate that the cacao osmotin and its derived peptides, herein studied, are good candidates for developing biotechnological tools aiming to control phytopathogenic fungi. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Genetic diversity of naturalized cacao (Theobroma cacao L.) in Puerto Rico

    Science.gov (United States)

    Identification of genetically diverse cacao with disease resistance, high productivity and desirable organoleptic traits is vitally important to the agricultural crop’s long-term sustainability. Environmental changes, pests and diseases as well as nation’s sovereign property rights have led to a de...

  15. In vitro seed germination and rootstock establishing for micrografting of Theobroma cacao L

    Science.gov (United States)

    Micrografting has been successfully implemented in several plant species of Acacia, Citrus, Eucalyptus, Havea, Malus, Olea, Opuntia, Prunus and other genera. This technique is employed for plant rejuvenation, true-to-type propagation, genetic improvement, recovery of virus-free plants, testing of po...

  16. Respon pertumbuhan bibit kakao (Theobroma cacao L.) terhadap pemberian pupuk guano dan KCl

    OpenAIRE

    Rajagukguk, Pispa

    2015-01-01

    Addition of Guano in Cultivation of Cacao Seedling is the one of step to use organic fertilizer that comes from animal feces in the world. For that purpose addition guano aims to increase growth of Cacao in Cultivation of Seedling. This research had been conducted at experimental field of Fakultas Pertanian USU in October 2013 - January 2014 using factorial randomized block design with two factor, i.e. addition dose of Guano (0, 75 , 150 , 225 g/polibag) and dose of KCl (0 , ...

  17. Proteome analysis during pod, zygotic and somatic embryo maturation of Theobroma cacao.

    Science.gov (United States)

    Niemenak, Nicolas; Kaiser, Edward; Maximova, Siela N; Laremore, Tatiana; Guiltinan, Mark J

    2015-05-15

    Two dimensional electrophoresis and nano-LC-MS were performed in order to identify alterations in protein abundance that correlate with maturation of cacao zygotic and somatic embryos. The cacao pod proteome was also characterized during development. The recently published cacao genome sequence was used to create a predicted proteolytic fragment database. Several hundred protein spots were resolved on each tissue analysis, of which 72 variable spots were subjected to MS analysis, resulting in 49 identifications. The identified proteins represent an array of functional categories, including seed storage, stress response, photosynthesis and translation factors. The seed storage protein was strongly accumulated in cacao zygotic embryos compared to their somatic counterpart. However, sucrose treatment (60 g L(-1)) allows up-regulation of storage protein in SE. A high similarity in the profiles of acidic proteins was observed in mature zygotic and somatic embryos. Differential expression in both tissues was observed in proteins having high pI. Several proteins were detected exclusively in fruit tissues, including a chitinase and a 14-3-3 protein. We also identified a novel cacao protein related to known mabinlin type sweet storage proteins. Moreover, the specific presence of thaumatin-like protein, another sweet protein, was also detected in fruit tissue. We discuss our observed correlations between protein expression profiles, developmental stage and stress responses. Copyright © 2015 Elsevier GmbH. All rights reserved.

  18. Molecular cloning and expression analysis of the sucrose transporter gene family from Theobroma cacao L.

    Science.gov (United States)

    Li, Fupeng; Wu, Baoduo; Qin, Xiaowei; Yan, Lin; Hao, Chaoyun; Tan, Lehe; Lai, Jianxiong

    2014-08-10

    In this study, we performed cloning and expression analysis of six putative sucrose transporter genes, designated TcSUT1, TcSUT2, TcSUT3, TcSUT4, TcSUT5 and TcSUT6, from the cacao genotype 'TAS-R8'. The combination of cDNA and genomic DNA sequences revealed that the cacao SUT genes contained exon numbers ranging from 1 to 14. The average molecular mass of all six deduced proteins was approximately 56 kDa (range 52 to 66 kDa). All six proteins were predicted to exhibit typical features of sucrose transporters with 12 trans-membrane spanning domains. Phylogenetic analysis revealed that TcSUT2 and TcSUT4 belonged to Group 2 SUT and Group 4 SUT, respectively, and the other TcSUT proteins were belonging to Group 1 SUT. Real-time PCR was conducted to investigate the expression pattern of each member of the SUT family in cacao. Our experiment showed that TcSUT1 was expressed dominantly in pods and that, TcSUT3 and TcSUT4 were highly expressed in both pods and in bark with phloem. Within pods, TcSUT1 and TcSUT4 were expressed more in the seed coat and seed from the pod enlargement stage to the ripening stage. TcSUT5 expression sharply increased to its highest expression level in the seed coat during the ripening stage. Expression pattern analysis indicated that TcSUT genes may be associated with photoassimilate transport into developing seeds and may, therefore, have an impact on seed production. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. Diallel Analysis and Growth Parameters as Selection Tools for Drought Tolerance in Young Theobroma cacao Plants.

    Science.gov (United States)

    Dos Santos, Emerson Alves; Almeida, Alex-Alan Furtado de; Ahnert, Dario; Branco, Marcia Christina da Silva; Valle, Raúl René; Baligar, Virupax C

    2016-01-01

    This study aimed to estimate the combining ability, of T. cacao genotypes preselected for drought tolerance through diallel crosses. The experiment was conducted under greenhouse conditions at the Cacao Research Center (CEPEC), Ilhéus, Bahia, Brazil, in a completely randomized block design, in an experimental arrangement 21 x 2 [21 complete diallel crosses and two water regimes (control and stressed)]. In the control, soil moisture was kept close to field capacity, with predawn leaf water potential (ΨWL) ranging from -0.1 to -0.5 MPa. In the drought regime, the soil moisture was reduced gradually by decreasing the amount of water application until ΨWL reached -2.0 to -2.5 MPa. Significant differences (p cacao crosses, except for SCA-6 x IMC-67, Catongo x SCA, MOC-01 x Catongo, Catongo x IMC-67 and RB-40 x Catongo. Multivariate analysis showed that stem diameter (CD), total leaf area (TLA), leaf dry biomass (LDB), stem dry biomass (SDB), root dry biomass (RDB), total dry biomass (TDB), root length (RL), root volume (RV), root diameter (RD) cacao genotypes in to tolerant and intolerant to soil water deficit.

  20. Use of a proteolytic enzyme in cocoa (Theobroma cacao L. processing

    Directory of Open Access Journals (Sweden)

    Edy Sousa de Brito

    2004-08-01

    Full Text Available Protein hydrolysis using an exogenous protease on cocoa nibs was performed to verify the formation of precursors and the effect on cocoa flavour. An experimental design was used to check the influence of temperature (30 to 70 ºC and enzyme : substrate ratio [E/S] (97.5 to 1267.5 U g-1 of protein. The % Degree of Hydrolysis (% DH was affected mainly by [E/S] leading to a 4-fold increase (from 5 to 20 % after 6 hours of treatment. During cocoa nibs roasting, there was a greater consumption of hydrolysis compounds in the sample treated with protease as compared to the control, indicating their participation in the Maillard reaction. An increased perception of chocolate flavour and bitter taste was observed in a product formulated with protease treated cocoa.Foi feita uma hidrólise da proteína dos nibs de cacau usando-se uma protease para verificar a formação de precursores e o efeito sobre o sabor do cacau. Um desenho experimental foi usado para verificar a influência da temperatura (30 a 70 ºC e razão enzima : substrato [E/S] (97,5 a 1267,5 U g-1 de proteína. O grau de hidrólise % (%DH foi afetado principalmente pela [E/S], tendo sofrido um aumento de 4 vezes (de 5 para 20 % após 6 horas de tratamento. Durante a torração dos nibs houve um consumo maior dos compostos de hidrólise na amostra tratada com protease em comparação com o controle, indicando a participação desses compostos na reação de Maillard. Foi observado um aumento na percepção do sabor de chocolate e do gosto amargo em um produto formulado com o cacau tratado com a protease.

  1. Use of a proteolytic enzyme in cocoa (Theobroma cacao L.) processing

    OpenAIRE

    Brito,Edy Sousa de; Pezoa García,Nelson Horacio; Amancio,Allan César

    2004-01-01

    Protein hydrolysis using an exogenous protease on cocoa nibs was performed to verify the formation of precursors and the effect on cocoa flavour. An experimental design was used to check the influence of temperature (30 to 70 ºC) and enzyme : substrate ratio [E/S] (97.5 to 1267.5 U g-1 of protein). The % Degree of Hydrolysis (% DH) was affected mainly by [E/S] leading to a 4-fold increase (from 5 to 20 %) after 6 hours of treatment. During cocoa nibs roasting, there was a greater consumption ...

  2. The age of chocolate: a diversification history of Theobroma and Malvaceae

    Science.gov (United States)

    Dated molecular phylogenies of broadly distributed lineages can help to compare patterns of diversification in different parts of the world. An explanation for greater Neotropical diversity compared to other parts of the tropics is that it was an accident of the Andean orogeny. Using dated phylogeni...

  3. Assessment of cocoa (Theobroma cacao L.) butter content and composition throughout fermentations.

    Science.gov (United States)

    Servent, Adrien; Boulanger, Renaud; Davrieux, Fabrice; Pinot, Marie-Neige; Tardan, Eric; Forestier-Chiron, Nelly; Hue, Clotilde

    2018-05-01

    Cocoa fermentation is a crucial step for the development of cocoa aroma and precursors of high quality cocoa and by-products. This bioprocess has been studied for years to understand cocoa chemical changes but some matters concerning changes in fat content remain that are investigated in this work. Changes in the quantity (free and total fat), extractability and composition of cocoa butter were assessed in samples from Madagascar, the Dominican Republic and Ecuador. Increases in free fat content were highlighted in samples from each origin thanks to the use of the 'soxtec' solvent method, which preserves the integrity of the butter. A 4.71% increase in free fat was measured in the Ecuadorian samples fermented for 144 h. Conversely, total fat content remained stable throughout fermentation. Protein and polyphenol contents decreases were linked to fat content augmentation by a strong negative interaction. Triglyceride and total and linked fatty acid kinetics (0 to 6 days) of the butter remained statistically stable during fermentation, as did unsaponifiable matter. The origin of fermentation had a predominant and significant impact on composition, revealed by PCA. This work underlines and explains the importance of fermentation process in improving yield of fat that can be extracted while preserving the composition of this cocoa butter. This study highlights an interaction in cocoa unfermented or partially fermented beans. This phenomenon causes butter content retention but is slowly broken after 72 h fermentation. Therefore, fermentation appears to be also necessary to enhance the cocoa butter content extracted from the nibs. Copyright © 2018 Elsevier Ltd. All rights reserved.

  4. Toward The identification Of candidate genes involved in black pod disease resistance in Theobroma cacao L.

    Science.gov (United States)

    Increasing yield, quality and disease resistance are important objectives for cacao breeding programs. Some of the diseases, such as black pod rot (Phytophtora spp), frosty pod (Moniliophthora roreri) and witches’ broom (M. perniciosa), produce significant losses in all or in some of the various pro...

  5. Strategies for Control of Moniliophthora roreri and Moniliophthora perniciosa in Theobroma cacao L.: A Systematic Review

    Directory of Open Access Journals (Sweden)

    Paola Andrea Tirado-Gallego,

    2016-09-01

    Full Text Available One of the most important limitations of cocoa production worldwide is primarily diseases caused by the pathogenic fungi of the genus Moniliophthora sp., especially, Moniliophthora roreri and Moniliophthora perniciosa, causing moniliasis and the witches' broom disease, respectively; both diseases are highly invasive and endemic in cocoa. The objective of this study was to describe the control strategies that can be used to handle the moniliasis and witches' broom diseases. This study was conducted in accor-dance with the Prisma (Preferred Reporting Items for Systematic Reviews and Meta-Analyses statement, for which a systematic literature search in the ScienceDirect, Springer Link and Scopus databases was used. Original investigation articles over the last 12 years were included, inclusion and exclusion criteria were also applied. In countries like Brazil and Costa Rica, the year with most reports of related articles was 2008. The most used strategies for the disease control are the phytosanitation, the copper-based fungicides and biologic agents control of fungus and bacteria, specially, Trichoderma sp. and Bacillus sp. One of the most recommended methodologies on the studied articles was the optimization of treatments employing the combination of physical, biological and chemical agents

  6. [Transmission of cutaneous leishmaniasis associated with cacao (Theobroma cacao) plantations in Tabasco].

    Science.gov (United States)

    Carrada Figueroa, Georgina Del Carmen; Leal Ascencio, Víctor Javier; Jiménez Sastré, Alejandro; López Álvarez, Jorge

    2014-01-01

    Tabasco is the Mexican state that reported the highest number (37.4%) of patients with leishmaniasis during 1990-2011. Close to 90% of these patients lived in Chontalpa, where the municipality of Cunduacán accounted for the majority of the cases. One of the characteristics of this region is that houses are located within cacao plantations. To determine if cacao plantations are a risk factor for leishmaniasis transmission in locations of Cunduacán, Tabasco. We performed an analytical and retrospective study of 115 locations in Cunduacán, analyzing the number of localities with or without patients with leishmaniasis registered between 2000-2011 and, additionally, if they had cacao plantations, using a map where different crops were georeferenced. We measured the magnitude of the association (odds ratio, 95% CI). During the period 2000-2011, cases of leishmaniasis were reported in 77 (67.0%) Cunduacán locations, of these, 55 (71.4%) had cocoa plantations, five (6.5%) of banana, five (6.5%) of cane, and 12 (15.6%) had no crops georeferenced. We found that cocoa crops are a risk factor for the transmission of leishmaniasis (OR: 3.438; 95% CI: 1,526-7,742). The probability of transmission of leishmaniasis in areas with cocoa crops is greater than in communities without this crop.

  7. Food Fingerprinting: Characterization of the Ecuadorean Type CCN-51 of Theobroma cacao L. Using Microsatellite Markers.

    Science.gov (United States)

    Herrmann, Luise; Felbinger, Christine; Haase, Ilka; Rudolph, Barbara; Biermann, Bernhard; Fischer, Markus

    2015-05-13

    The cocoa type "Colección Castro Naranjal 51" (CCN-51) is known for its resistance to specific climate conditions and its high yield, but it shows a weaker flavor profile and therefore is marketed as bulk cocoa. In a previous study, the two cocoa types Arriba and CCN-51 could easily be distinguished, but differences among the CCN-51 samples were observed. This was unexpected, as CCN-51 is reported to be a clone. To confirm whether CCN-51 is a pure clone, 10 simple sequence repeats (SSR) located on the nuclear genome were used to analyze various CCN-51 samples in comparison to the cocoa varieties Arriba and Criollo. As expected, there are differences in the SSR pattern among CCN-51, Arriba, and Criollo, but a variability within the CCN-51 sample set was detected as well. The previously described sequence variation in the chloroplast genome was confirmed by a variability in the microsatellite loci of the nuclear genome for a comprehensive cultivar collection of CCN-51 of both bean and leaf samples. In summary, beneath somaclonal variation, misidentification of plant collections and also sexual reproduction of CCN-51 can be suggested.

  8. Streptomyces cameroonensis sp. nov., a Geldanamycin Producer That Promotes Theobroma cacao Growth.

    Science.gov (United States)

    Boudjeko, Thaddée; Tchinda, Romaric Armel Mouafo; Zitouni, Mina; Nana, Joëlle Aimée Vera Tchatchou; Lerat, Sylvain; Beaulieu, Carole

    2017-03-31

    The taxonomy of an actinobacterial strain, designated JJY4 T , was established using a polyphasic approach. JJY4 T was isolated from the rhizosphere of Chromolaena odorata in Yaoundé (Cameroon) during a project for the selection of biological control agents. Strain JJY4 T exhibited antimicrobial activities against bacteria, fungi, and oomycetes. Strain JJY4 T also exhibited the traits of plant growth-promoting rhizobacteria such as the solubilization of inorganic phosphate, production of siderophores and indole-3-acetic acid, and 1-aminocyclopropane-1-carboxylate deaminase activity. In planta assays performed on cocoa plantlets confirmed that strain JJY4 T exhibited strong abilities to promote plant growth and protect against Phytophthora megakarya, the main causal agent of cocoa pod rot. The formation of rugose-ornamented spores in spiral spore chains by strain JJY4 T is a typical feature of members found in the Streptomyces violaceusniger clade and, similar to some members of the clade, strain JJY4 T produces geldanamycin. A phylogenetic analysis based on 16S rRNA gene sequences confirmed this classification and suggests that strain JJY4 T be added to the subclade constituted of the type strains Streptomyces malaysiensis DSM 41697 T and Streptomyces samsunensis DSM 42010 T . However, DNA-DNA relatedness and physiological characteristics allowed for the differentiation of strain JJY4 T from its closest phylogenetic relatives. Based on these results, strain JJY4 T (=NRRL B-65369, =NBRC 112705) appears to represent a novel species in the S. violaceusniger clade for which the proposed name is Streptomyces cameroonensis sp. nov.

  9. Biochemical precursor effects on the fatty acid production in cell suspension cultures of Theobroma cacao L.

    Science.gov (United States)

    Parra, O; Gallego, A M; Urrea, A; Rojas, L F; Correa, C; Atehortúa, L

    2017-02-01

    Cocoa butter (CB) is composed of 96% palmitic, stearic, oleic, linoleic and linolenic fatty acids that are responsible for the hardness, texture and fusion properties of chocolate. Through in vitro plant cell culture it is possible to modify CB lipid profiles and to study the fatty acid biosynthesis pathway on a subcellular level, evaluating fundamental aspects to enhance in vitro fatty acid production in a specific and controlled way. In this research, culture media was supplemented with acetate, biotin, pyruvate, bicarbonate and glycerol at three different concentrations and the effects on the biomass production (g/L), cell viability, and fatty acids profile and production was evaluated in in vitro cell suspensions culture. It was found that biotin stimulated fatty acid synthesis without altering cell viability and cell growth. It was also evident a change in the lipid profile of cell suspensions, increasing middle and long chain fatty acids proportion, which are unusual to those reported in seeds; thus implying that it is possible to modify lipid profiles according to the treatment used. According to the results of sucrose gradients and enzyme assays performed, it is proposed that cacao cells probably use the pentose phosphate pathway, mitochondria being the key organelle in the carbon flux for the synthesis of reductant power and fatty acid precursors. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  10. Utilization of wood ash as seedling media of Cocoa (Theobroma cacao

    Directory of Open Access Journals (Sweden)

    Fitria Nugraheni Sukmawati

    2016-12-01

    Full Text Available An effort to increase productivity is provision of inorganic fertilizers. Inorganic fertilizer application in longtem as found to attenuate the availability of micronutrients and to decrease soil fertility. One possibility to replace inorganic fertilizer is the use of ash derived from plants, such as wood ash. The purpose of this study was to determine the effect of wood ash on soil K availability and to optimize the dose of wood ash which can give good influence on the growth of cocoa seedlings. The experiment was conducted at the experimental station Polytechnic LPP in Wedomartani, Sleman, Yogyakarta. The design used is non factorial randomized block design with 5 treatments, which is the ratio of ash and soil 0: 1 (A1 / Control; 0.25: 1 (A2; 0.5: 1 (A3; 0.75: 1 (A4; and 1: 1 (A5. Observations of treatment effects were made on the seedling height, number of leaves, stem diameter, wet weight and dry weight. Soil analysis was conducted to determine the content of macro elements, micro elements, and pH media. The results showed that ash increases the pH of the media to alkaline range and increase the availability of P and K soil to toxic range. Giving ash reduced the availability of N and caused chlorosis on cocoa seedlings.

  11. Genetic identification of Theobroma cacao L. trees with high Criollo ancestry in Soconusco, Chiapas, Mexico.

    Science.gov (United States)

    Vázquez-Ovando, J A; Molina-Freaner, F; Nuñez-Farfán, J; Ovando-Medina, I; Salvador-Figueroa, M

    2014-12-12

    Criollo-type cacao trees are an important pool of genes with potential to be used in cacao breeding and selection programs. For that reason, we assessed the diversity and population structure of Criollo-type trees (108 cultivars with Criollo phenotypic characteristics and 10 Criollo references) using 12 simple sequence repeat (SSR) markers. Cultivars were selected from 7 demes in the Soconusco region of southern Mexico. SSRs amplified 74 alleles with an average of 3.6 alleles per population. The overall populations showed an average observed heterozygosity of 0.28, indicating heterozygote deficiency (average fixation index F = 0.50). However, moderate allelic diversity was found within populations (Shannon index for all populations I = 0.97). Bayesian method analysis determined 2 genetic clusters (K = 2) within individuals. In concordance, an assignment test grouped 37 multilocus genotypes (including 10 references) into a first cluster (Criollo), 54 into a second (presumably Amelonado), and 27 admixed individuals unassigned at the 90% threshold likely corresponding to the Trinitario genotype. This classification was supported by the principal coordinate analysis and analysis of molecular variance, which showed 12% of variation among populations (FST = 0.123, P cocoa.

  12. COCOA (Theobroma cacao) Polyphenol-Rich Extract Increases the Chronological Lifespan of Saccharomyces cerevisiae.

    Science.gov (United States)

    Baiges, I; Arola, L

    2016-01-01

    BACKGROUND: Saccharomyces cerevisiae is a model organism with conserved aging pathways. Yeast chronological lifespan experiments mimic the processes involved in human non-dividing tissues, such as the nervous system or skeletal muscle, and can speed up the search for biomolecules with potential anti-aging effects before proceeding to animal studies. OBJECTIVE: To test the effectiveness of a cocoa polyphenol-rich extract (CPE) in expanding the S. cerevisiae chronological lifespan in two conditions: in the stationary phase reached after glucose depletion and under severe caloric restriction. MEASUREMENTS: Using a high-throughput method, wild-type S. cerevisiae and its mitochondrial manganese-dependent superoxide dismutase null mutant (sod2Δ) were cultured in synthetic complete dextrose medium. After 2 days, 0, 5 and 20 mg/ml of CPE were added, and viability was measured throughout the stationary phase. The effects of the major components of CPE were also evaluated. To determine yeast lifespan under severe caloric restriction conditions, cultures were washed with water 24 h after the addition of 0 and 20 mg/ml of CPE, and viability was followed over time. RESULTS : CPE increased the chronological lifespan of S. cerevisiae during the stationary phase in a dose-dependent manner. A similar increase was also observed in (sod2Δ). None of the major CPE components (theobromine, caffeine, maltodextrin, (-)-epicatechin, (+)-catechin and procyanidin B2) was able to increase the yeast lifespan. CPE further increased the yeast lifespan under severe caloric restriction. CONCLUSION: CPE increases the chronological lifespan of S. cerevisiae through a SOD2-independent mechanism. The extract also extends yeast lifespan under severe caloric restriction conditions. The high-throughput assay used makes it possible to simply and rapidly test the efficacy of a large number of compounds on yeast aging, requiring only small amounts, and is thus a convenient screening assay to accelerate the search for biomolecules with potential anti-aging effects.

  13. Characterization of leaf, flower, and pod morphology among Vietnamese cocoa varieties (Theobroma cacao L.)

    International Nuclear Information System (INIS)

    Viet, L.T.; Hang, P.T.; Everaert, H.; Rottiers, H.; Dung, T.N

    2016-01-01

    This study examined the morphological traits of 63 cocoa varieties that have been imported and cultivated in Vietnam. These cocoa varieties were collected from five regions in Southern Vietnam and were classified into three groups based on their phylogenetic relationships. Their morphological features were individually evaluated and analysed. This included leaf characteristics (leaf and stem anatomy) and flower features (ligule shape, anther number, pollen, stamen and ovule, fruit, seed). The results of this study showed a large variation across all morphological characteristics of the evaluated cocoa varieties. The Vietnamese cocoa flower showed a diversity of morphological characteristics including five shapes of ligule (oval, broad, deltoid, elliptic and sub-lanceolate) and each stamen also has a bilobed anther with the exception of trilobed anther for TD11. Furthermore, the shape of pollen grains was found homogeneous in all 63 varieties. The colour of the stamens and ovules was purple and white respectively for all examined samples. Three kinds of fruit shapes were identified, namely Angoleta, Amelonado and Cundeamor, and these were of various colours. Additionally, an anatomical analysis on the midrib structure of the leaves from the 63 varieties showed the highest similarity, likewise the stem structure. The colour of young leaves was observed as being green and red. This is the primary research that scrutinizes the morphological biodiversity of Vietnamese cocoa varieties during the three-decade development of the Vietnam cocoa project. The results have a practical applications for cocoa cross-breeding and botanical taxonomy. (author)

  14. Theobroma cacao L., the Food of the Gods: a scientific approach beyond myths and claims.

    Science.gov (United States)

    Rusconi, M; Conti, A

    2010-01-01

    Cocoa beans are rich source of polyphenols, contributing about 10% of the dry weight of the whole bean and its derivative chocolate, particularly dark chocolate, is considered one of the major contributors of antioxidants to the American diet after fruits and vegetables. At present the wide variation in cocoa processing and in the content and profile of polyphenols make it difficult to determine to what extent the findings about positive effects expressed in different studies, translate into tangible clinical benefits. Moreover, before claiming any healthy properties to a plant, natural product or food item on human subject, a basic research project approved by scientific and ethical commissions has to be performed. Until now the definition, composition, manufacturing specifications, packaging and labelling of cocoa and chocolate products in Europe, are regulated by "Directive 2000/36/EC of the European parliament and of the council". The definitions take changes in consumer tastes, chocolate composition and labelling into account, but do not consider the real potential of healthy, beneficial and nutraceutical effects. In fact, they fail to establish an official analytical methodology for the quantification of phenolic compounds in cocoa and chocolate. Moreover quantification of these compounds is not used in product classification. This article reviews many qualitative differences of cocoa and chocolate, in particular dark chocolate, aiming to establish the different implications for public health through the use of the analyzed concentration of polyphenols in cocoa products. Copyright 2009 Elsevier Ltd. All rights reserved.

  15. Top Grafting Performance of Some Cocoa (Theobroma cacao L. Clones as Affected by Scion Budwood Number

    Directory of Open Access Journals (Sweden)

    Fakhrusy Zakariyya

    2015-12-01

    Full Text Available Reducing budwood number is an efficient effort to overcome problemsrelated with limited scion materials. The objective of this research was to studythe effect of scion budwood number in some clones on the performance of graftedcocoa seedlings. The research was conducted at Kaliwining Research Station,Indonesian Coffee and Cocoa Research Institute, Jember, Indonesia at an elevationof 48 m above sea level. Layout for this study used factorial with 2 factors inrandomized complete block design, with four replications for every treatment.The first factor was clone type, namely MCC 02 and Sulawesi 1; whereas the secondfactor was number of grafted scion budwood, namely one, two, and three graftedbudwoods. There was no interaction between clone and number of scion budwoodfor variables of shoot length, stem girth, content of total chlorophyll, chlorophylla, and chlorophyll b. Meanwhile, there was interaction for stomatal conductanceand stomatal diffusion resistance. Clone significantly affected photosynthesisand stomatal diffusion resistance, while number of scion budwood affected significantlythe shoot length. Photosynthesis activity of MCC 02 was higher comparedto Sulawesi 1. In average, stomatal diffusion resistance of Sulawesi 1 was higherthan MCC 02. The shoot length of one grafted budwood was higher than thetwo or three grafted budwood.

  16. EVALUASI MEDIA DAN FREKUENSI PENYIRAMAN TERHADAP PERTUMBUHAN BIBIT KAKAO (Theobroma cacao L

    Directory of Open Access Journals (Sweden)

    Reki Hendrata

    2010-03-01

    Full Text Available are oftentimes met by problem of availability  irrigating water. The aims  of this research was  to study the know influence of media and frequency of sprinkler irrigation  to growth of seed of cocoa plant, the best of media and also frequency of optimum sprinkler it to growth of seed. The research was conducted in month of April until July 2007 in  Wonocatur, Banguntapan subdistrict, Bantul Regency.The experiment was arranged in a  factorial completete romdomed design with two factor. The first factor were media ( M consisted to by 4 level, namely M1 : latosol soil , M2 : latosol soil + organic munure (2:1, M3 : sphagnum, and M4 : sphagnum + organic munure (2:1. The factor second  of sprinkler frequency irrigation (P, consisted of  3 level, with  P1 : 1 day, P2 : 2 day  and P3 : 3 day once, so that obtained  12 combination of treatment three repeated. The results showed that the kinds of media have an in with high seed, leaf amount, diamater, and the length root seed. The media  sphagnum + organic manure (M4 give influence tend to compared  by better could be leaf amount, high, and the diameter. The media organic  manure (M2 which were give effect tend to compared  by better of length root grow. The sprinkler irigation  3 day once (P3 show better effect to length root grow  seed, although was not  interakasion.

  17. The remineralization potential of cocoa (Theobroma cacao bean extract to increase the enamel micro hardness

    Directory of Open Access Journals (Sweden)

    Sulistianingsih Sulistianingsih

    2017-08-01

    Full Text Available Introduction: Remineralization is the process of returning mineral ions into a hydroxyapatite structure characterized by mineral deposition on the enamel surface. The presence of mineral deposition would affect the micro hardness of tooth enamel. The use of fluorine as remineralization agent with side effects such as fluorosis. Cocoa bean extract contains theobromin that can be used as an alternative remineralization ingredients. The objectives was to determine micro hardness email after remineralization using cocoa bean extract as natural material and to compare with fluorine use as synthetic material. Methods: Thirty-six maxillary first premolar tooth crown was cut and planted in the epoxy resin. Teeth were then immersed in demineralization solution at pH 4 for 6 hours. The sample were divided into 2 groups, 18 for the fluorine group and the remaining group of cocoa extract. Vickers microhardness test was used before treatment, after demineralized and after remineralization. Results: Enamel microhardness value before treatment in the fluorine group average value was 376.17 VHN and the cocoa extract group was 357.33 VHN. After demineralization in fluorine group was 268,13 VHN and cocoa extract group was 235,93 VHN. After remineralization in fluorine group was 321,08 VHN and cocoa extract group was 293,86 VHN. The results of the analysis showed that the level of micro hardness email after remineralization was not significantly different in two groups (p > 0.05. Conclusions: Cocoa extract is able to increase the microhardness of enamel so it can act as a substitution for fluorine remineralization.

  18. Fertilizer requirements of cacao (Theobroma cacao L.) in South-Western Nigeria

    NARCIS (Netherlands)

    Wessel, M.

    1971-01-01

    The studies reported on were conducted in the period 1961-1970 when the author was employed by the Cocoa Research Institute of Nigeria at Ibadan, formerly a sub-station of the West African Cocoa Research Institute.

    In the first three chapters information is given on the cacao industry and on

  19. A preliminary survey into ways of overcoming self-incompatibility in theobroma cacao L

    International Nuclear Information System (INIS)

    Adu-Ampomah, Y.; Klu, G.Y.P.; Lamptey, T.V.O.; Novak, F.

    1990-01-01

    Varying concentrations of NAA and GA 3 (100-500 mg/l) were applied to the base of self-incompatible cocoa flowers with the view to delaying floral abscission and thus lengthening the time needed for the fusion of self-incompatible male and female gametes. NAA above 300 mg/l slightly delayed floral abscission but this did not help overcome the self-incompatibility whilst none of the GA 3 concentrations used either delayed floral abscission or promoted self-compatibility. Similar concentrations of both hormones when applied to the stigma before selfing also did not help to overcome the self-incompatibility. Self-incompatibility was partially overcome by treating compatible pollen with 60Gy of gamma rays and mixing it with self-incompatible pollen. Compatible pollen treated at 60Gy and used alone to pollinate self-incompatible flowers resulted in 100 percent flat, non-viable cocoa beans whilst gamma treated pollen mixed with self-incompatible pollen produced about 30 percent fully formed and viable cocoa beans. This appears to suggest that the irradiated compatible pollen is acting as mentor pollen and promoting selfing. (author)

  20. Sintesis Sabun Lunak Yang Mengandung Polihidroksi Dari Minyak Biji Kakao (Theobroma cacao,L

    Directory of Open Access Journals (Sweden)

    Chairul Saleh

    2016-06-01

    Full Text Available The research about synthesis of  Soft Soap Containing polyhydroxy from Cocoa seed Oil, beginning with the manufacture of the polyhydroxy compound wherein the polyhydroxy compound is obtained through a process of epoxidation and hydroxylation by reacting oils cocoa beans with peroxide acetic acids (peroxy acetate was obtained from the reaction of glacial acetic acid with hydrogen peroxide with an acid catalyst sulfate followed by oxirane ring opening process (hydrolysis at a temperature of 40-45  oC for 2 hours, the results obtained with the reaction yield of 60 %. In the form of a mixture of soft soap is obtained by saponification of compounds polyhydroxy with Potassium Hydroxide at a temperature 70-75  oC for 1 hour with a yield of  86,45  %.  Polyhydroxy compound and soap from the cocoa bean oil was analyzed by FT-IR spectrophotometer. Respectively iodine from the cocoa bean oil 102,93mg I / gram of oil and polyhydroxy compound is 20,21 mg I / gram of oil. HLB of soap Software of oil and polyhydroxy cocoa beans from the cocoa bean oil is determined by titration method and obtained HLB of soft soap from the cocoa bean oil was 8.74 while the polyhydroxy from cacao seed oil is 10,94. Keywords: Cocoa bean oil, Polyhydroxy compound, Soft soap polyhydroxy.

  1. Effect of polyethylene glycol 6000 and storage period on seed quality of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Astiti Rahayu

    2014-05-01

    Full Text Available Increased productivity of cocoa needs high quality of cocoa seeds which are generally provided by certified seed gardens located far from smallholders farm, where seed delivery takes long time and may reduce physiological quality of seeds. One effort to maintain the seed quality is by treatment the seeds with polyethylene glycol6000 (PEG 6000. This study was aimed to study the interaction of PEG 6000 concentration and storage period on cocoa seed quality, and to determine the best concentration of PEG 6000 and storage period to maintain cocoa seed quality. The research was conducted in seed storage room, seed laboratory and green houseof PPPPTK, Cianjur. The experimental design used was a factorial completely randomized design and each combination treatment repeated three times. The first factor was concentration of PEG 6000 of 0%, 20%, 40%, and 60%, and the second factor was the storage period of 3 weeks, 6 weeks, 9 weeks, and 12 weeks. The results showed that concentration of PEG 60% with three weeks storage period was able to minimize the number of moldy seeds. The concentration of PEG 20%, 40%, and 60% were able to prevent seed germination in storage until six weeks. Concentration of PEG 6000 20% was able to maintain moisture content, seed germination, and germination rate.Key words:cocoa seed, storage, recalcitrant, PEG

  2. Dietary flavanols and procyanidin oligomers from cocoa (Theobroma cacao) inhibit platelet function.

    Science.gov (United States)

    Murphy, Karen J; Chronopoulos, Andriana K; Singh, Indu; Francis, Maureen A; Moriarty, Helen; Pike, Marilyn J; Turner, Alan H; Mann, Neil J; Sinclair, Andrew J

    2003-06-01

    Flavonoids may be partly responsible for some health benefits, including antiinflammatory action and a decreased tendency for the blood to clot. An acute dose of flavanols and oligomeric procyanidins from cocoa powder inhibits platelet activation and function over 6 h in humans. This study sought to evaluate whether 28 d of supplementation with cocoa flavanols and related procyanidin oligomers would modulate human platelet reactivity and primary hemostasis and reduce oxidative markers in vivo. Thirty-two healthy subjects were assigned to consume active (234 mg cocoa flavanols and procyanidins/d) or placebo (cocoa flavanols and procyanidins/d) tablets in a blinded parallel-designed study. Platelet function was determined by measuring platelet aggregation, ATP release, and expression of activation-dependent platelet antigens by using flow cytometry. Plasma was analyzed for oxidation markers and antioxidant status. Plasma concentrations of epicatechin and catechin in the active group increased by 81% and 28%, respectively, during the intervention period. The active group had significantly lower P selectin expression and significantly lower ADP-induced aggregation and collagen-induced aggregation than did the placebo group. Plasma ascorbic acid concentrations were significantly higher in the active than in the placebo group (P antioxidant status did not change in either group. Cocoa flavanol and procyanidin supplementation for 28 d significantly increased plasma epicatechin and catechin concentrations and significantly decreased platelet function. These data support the results of acute studies that used higher doses of cocoa flavanols and procyanidins.

  3. EFFECT LINDAK CACAO FRUIT MATURITY (THEOBROMA CACAO, F) WITH HIGH LEVEL OF POLYPHENOLS AS ANTIOXIDANT

    OpenAIRE

    Langkong, Jumriah

    2013-01-01

    Lindak cacao beans has polyphenol compounds that has a function as antioxidants which is important for the body to ward off a disease like cancer. The content of polyphenols in cocoa pods, influenced by post-harvest and processing. In addition, also influenced by fruit maturity level of lindak cocoa maturity level A (colored yellow on the entire surface of the fruit), B (yellow on the groove and back fruits), and C (colored yellow on the flow of fruit). The purpose of this study was to ana...

  4. Origin-based polyphenolic fingerprinting of Theobroma cacao in unfermented and fermented beans.

    Science.gov (United States)

    D'Souza, Roy N; Grimbs, Sergio; Behrends, Britta; Bernaert, Herwig; Ullrich, Matthias S; Kuhnert, Nikolai

    2017-09-01

    A comprehensive analysis of cocoa polyphenols from unfermented and fermented cocoa beans from a wide range of geographic origins was carried out to catalogue systematic differences based on their origin as well as fermentation status. This study identifies previously unknown compounds with the goal to ascertain, which of these are responsible for the largest differences between bean types. UHPLC coupled with ultra-high resolution time-of-flight mass spectrometry was employed to identify and relatively quantify various oligomeric proanthocyanidins and their glycosides amongst several other unreported compounds. A series of biomarkers allowing a clear distinction between unfermented and fermented cocoa beans and for beans of different origins were identified. The large sample set employed allowed comparison of statistically significant variations of key cocoa constituents. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Estado legal mundial del cadmio en cacao (Theobroma cacao): fantasía o realidad

    OpenAIRE

    Jiménez Tobón, Claudia Stella

    2015-01-01

    Colombian cacao is well positioned in the international markets, given its taste and aroma. There is, however, a concern under contamination terms at a national level, because there is cadmium in the seeds. This metal, in case of being accumulated in the human body, is the cause of several and serious diseases that slowly deteriorate it. Even though the fact that in 2019 the European Community will start to demand a maximum level of the cadmium allowed in the cacao and its derivat...

  6. Estado legal mundial del cadmio en cacao (Theobroma cacao): fantasía o realidad

    OpenAIRE

    Jiménez Tobón, Claudia Stella

    2015-01-01

    El cacao colombiano está bien posicionado en el mercado internacional por su sabor y aroma; sin embargo, en materia de contaminantes, existe a una preocupación a escala nacional debido a la presencia de cadmio en las semillas. Este metal, cuando se acumula en el organismo, es el responsable de serias enfermedades que lo deterioran lentamente. Aunque se conoce que a partir del 2019, la Comunidad Europea comenzará a exigir al cacao y sus derivados unos niveles máximos de cadmio, no es bien cono...

  7. Bioactive compounds in different cocoa (Theobroma cacao, L cultivars during fermentation

    Directory of Open Access Journals (Sweden)

    Jaqueline Fontes Moreau Cruz

    2015-06-01

    Full Text Available One component that contribute to the flavor and aroma of chocolate are the polyphenols, which have received much attention due to their beneficial implications to human health. Besides bioactive action, polyphenols and methylxantines are responsible for astringency and bitterness in cocoa beans. Another important point is its drastic reduction during cocoa processing for chocolate production and the difference between cultivars. Thus, the present study aimed to evaluate the modifications in monomeric phenolic compounds and methylxanthines during fermentation of three cocoa cultivars grown in southern Bahia. Cocoa beans from three cultivars were fermented and sun dried and monomeric phenolic compounds and methylxantines were determinated. The results showed that each cultivar have different amounts of phenolic compounds and the behaviour of them is different during fermentation. The amount of methylxantines varied but there was not a pattern for methylxantines behavior during process. In addition a huge reduction in phenolic compounds could be observed after drying. Differently of phenolic compounds, methylxantines did not have great modification after sun drying. So, the differences observed in this study between cultivars, take to the conclusion that the compounds studied in those cocoa cultivars have different behavior during fermentation and drying, which consequently, give to these cultivars differences in sensory characteristics.

  8. Estudo reológico de chocolates elaborados com diferentes cultivares de cacau (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Paula Bacelar Leite

    2013-09-01

    Full Text Available O chocolate pode ser definido como uma suspensão de partículas sólidas (açúcar, sólidos de cacau e sólidos de leite em uma fase gordurosa contínua, que contribui para o aroma, o sabor e a cor, além de promover forma ao produto final. A reologia de chocolates é quantificada durante a produção usando-se dois parâmetros: tensão inicial (yield stress e viscosidade aparente (plástica, em que, geralmente, se utiliza o modelo de Casson. O objetivo deste estudo foi avaliar reologicamente formulações de chocolates produzidos a partir de diferentes cultivares de cacau. As amostras de chocolate foram formuladas com 73,6% de cacau e foram realizadas as seguintes análises: determinação do teor de lipídeos; composição em triacilgliceróis; testes reológicos, e análise do tamanho máximo de partículas. O chocolate proveniente da cultivar PH16 apresentou menor conteúdo de gordura (36,53 g.100 g–1, maior tamanho de partículas (21 µm, maior valor de tensão inicial (20,91 Pa e maior área de histerese, com mais ampla tixotropia quando comparada às amostras dos chocolates provenientes das cultivares SR162 e Convencional. Os resultados encontrados no estudo reológico mostraram a interferência do conteúdo de gordura e do tamanho de partículas na tensão inicial dos produtos.

  9. Consumer perception, health information, and instrumental parameters of cupuassu (Theobroma grandiflorum) goat milk yogurts.

    Science.gov (United States)

    Costa, Marion P; Monteiro, Maria Lucia G; Frasao, Beatriz S; Silva, Vitor L M; Rodrigues, Bruna L; Chiappini, Claudete C J; Conte-Junior, Carlos A

    2017-01-01

    Although the demand for goat milk products has been growing, they have lower consumer acceptability than products derived from cow milk. However, the addition of cupuassu pulp can be used to improve the formulation of these products. For this reason, the aim of this study was to investigate the influence of new goat milk yogurt manufactured with cupuassu pulp on physicochemical properties, consumers' perceptions, and overall consumer acceptance. In addition, the effect of antioxidant health information on consumer acceptance and purchase intention of cupuassu goat milk yogurts was evaluated. The results demonstrated a positive expectation regarding linking and familiarity to goat milk products and products with cupuassu pulp. The pH, total phenolic content, lightness, redness, yellowness, and apparent viscosity were potentially affected by the addition of cupuassu, with the highest concentration of cupuassu (10%) exhibiting the greatest changes in parameters. Based on principal component analysis, partial least squares regression, and just-about-right and penalty analysis, the addition of cupuassu pulp improved some sensory attributes of goat milk yogurt, such as cupuassu aroma, cupuassu flavor, yellow color, consistency, and viscosity, which positively influenced product acceptance. In addition, antioxidant health information increased the acceptance and purchase intention of cupuassu goat milk yogurts. Taking into account the parameters investigated in this study, the best scoring formulation was goat milk yogurt with 10% cupuassu pulp. Our results suggest that cupuassu pulp can be considered a potential ingredient to improve the sensory and texture properties of goat milk yogurt. Furthermore, the antioxidant health information could be a sensory strategy to increase the acceptance of cupuassu goat milk yogurts. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  10. Determination of Selection Index of Cocoa (Theobroma Cacao L.) Yield Traits Using Regression Methods

    OpenAIRE

    Setyawan, Bayu; Taryono; Mitrowihardjo, Suyadi

    2016-01-01

    The increasing chocolate consumption has not been followed by growing production of dry cocoa beans. In order to support the increase in cocoa production, planting materials with high yield are needed. The objective of this research was to determine the components of cocoa traits affecting weight of dry cocoa beans, and set a selection index for superior cocoa trees. The experiment material were four cocoa hybrid populations of which their family ancestry were unknown, and were planted on Sam...

  11. Proximate Composition, Extraction, and Purification of Theobromine from Cacao Pod Husk (Theobroma Cacao L.

    Directory of Open Access Journals (Sweden)

    Van Tang Nguyen

    2017-04-01

    Full Text Available The aims of this study were to determine the proximate composition of cacao pod husk as well as the optimal conditions for extraction and purification of theobromine from cacao pod husk. The results indicated that cacao pod husk had high contents of moisture and carbohydrate (87.06% and 11.03% by fresh weight, respectively, but low contents of crude protein, crude lipid, and ash (0.31%, 0.12%, and 1.48% by fresh weight, respectively. The optimal conditions for extraction of theobromine from cacao pod husk were of 70% ethanol, with an extraction time of 90 min, and 1 as the number of extractions. A concentration of 10% by volume of 10% lead acetate solution was the best selection for purification of the crude extracts containing theobromine from cacao pod husk. Under these optimal conditions, theobromine content obtained from cacao pod husk was 6.79 mg/100 g dry weight. The finding from this study is a valuable contribution for obtaining theobromine from an abundant, inexpensive, renewable, and sustainable source for potential application in the nutraceutical, medical, and pharmaceutical industries.

  12. Nutritional value and antioxidant capacity of "cocoa honey" (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Elias Nascimento da Silva

    2014-12-01

    Full Text Available Cocoa honey is considered as the liquid portion of cocoa pulp that is released from the fruit soon after it is cut open and can be used before fermentation by simple extraction due to its nutritional characteristics. The objective of the present study is to determine the biochemical characteristics of a cocoa by-product, "cocoa honey" (CH, produced in the State of Bahia-Brazil. The biochemical characterization was conducted to determine reducing sugars, total sugars, vitamin C, total dietary fiber, flavonoids, and total antioxidant activity using an EC50. It was observed that cocoa honey can be considered a source of bioactive compounds, can be consumed in natura or processed, and used as an ingredient in the chocolate industry and in other food products. However, it is necessary to use complementary methods, such as HPLC, to quantify the phenolic compounds of this by-product.

  13. Nutritional value and antioxidant capacity of "cocoa honey" (Theobroma cacao L.)

    OpenAIRE

    Silva,Elias Nascimento da; Ramos,Danilo da Cruz; Menezes,Lígia Miranda; Souza,Alexilda Oliveira de; Lannes,Suzana Caetano da Silva; Silva,Marcondes viana da

    2014-01-01

    Cocoa honey is considered as the liquid portion of cocoa pulp that is released from the fruit soon after it is cut open and can be used before fermentation by simple extraction due to its nutritional characteristics. The objective of the present study is to determine the biochemical characteristics of a cocoa by-product, "cocoa honey" (CH), produced in the State of Bahia-Brazil. The biochemical characterization was conducted to determine reducing sugars, total sugars, vitamin C, total dietary...

  14. Pembuatan Sabun Cair Menggunakan Alkali Dari Kulit Coklat (Theobroma cacao L.) dengan Minyak Kelapa

    OpenAIRE

    Paduana, Aulia Bismar

    2017-01-01

    120405037 Penelitian ini bertujuan untuk mengetahui potensi kulit coklat sebagai alkali pada proses pembuatan sabun natural dan mengetahui sifat-sifat sabun natural yang dihasilkan dari minyak kelapa sebagai sumber asam lemak. Bahan ? bahan yang digunakan, antara lain minyak kelapa, alkali dari kulit coklat dan aquadest. Variabel ? variabel yang diamati, antara lain temperatur reaksi pembuatan sabun, waktu pengadukan dan waktu reaski penyabunan. Penelitian diawali dengan pembuatan alkali d...

  15. Competitividad de las organizaciones productoras de cacao (Theobroma cacao l en el sureste de Nicaragua

    Directory of Open Access Journals (Sweden)

    Norman Javier Saballos

    2018-02-01

    Full Text Available Se identificó los factores relacionados a la competitividad de las organizaciones de productores que comercializaron cacao durante el 2014, en la región sureste de Nicaragua. Para identificar los factores relacionados a la competitividad, se estudiaron a través de la “Cadena de Valor” cada una de las actividades primarias y de apoyo, así los indicadores de la competitividad; la productividad, calidad del producto, costos, cuota de mercado, permanencia en el mercado y la rentabilidad. El estudio se realizó mediante encuestas a representantes de siete organizaciones.

  16. Keberhasilan sambungan pada beberapa jenis batang atas dan famili batang bawah kakao (Theobroma cocoa L.. (Grafting performance of some scion clones and root-stock family on cocoa (Theobroma cocoa L.

    Directory of Open Access Journals (Sweden)

    Indah Anita Sari

    2012-08-01

    Full Text Available Differences in performance of grafting seedling were estimated from effect of using the root-stock and scion clones. This research aimed to study the differences of performance of some root-stock and scion clones on grafting seedling. The study used split plot design. First factor was root-stock consisted of ICS 60, Sca 6, Sca 12 and KW 165 and the second factor were 12 scions clones consisted of ICCRI 01, ICCRI 04, ICCRI 05, DR 2, Sulawesi 1, Sulawesi 2, KW 516, KW 514, KW 617, KW 570, KEE 2, and KW 604. There were three replication in each treatment and each replication consisted of 15 samples. Viability, lingkage diameter, ratio of root-stock and scion, hight of shoot, number of leaves and shoot were observed. The study showed that differences of root-stock just affected viability, lingkage diameter, and high of shoot. Scion clones factor affected to all of the characters. Their interaction caused the differences of all characters except of the number of shoot. Root-stock Sca 6 showed the lowest viability and number of the shoot, however root-stock KW 165 and ICS 60 showed the best performance to all parameters. The cluster analysis was done based on growth parameters and viability on lingkage distance of 15. There were three clusters; cluster 1 (KW 570, cluster 2 (ICCRI 04, ICCRI 05, Sulawesi 1, Sulawesi 2, KW 514, KW 165 and cluster 3 (ICCRI 01, DR 2, KW 516, KW 617, KW 604. Correlation analysis showed that main factor which affected the high viability root-stock diameter and diameter ratio of root-stock and scion were used.

  17. Microbiological analysis of coliforms and mesophilic aerobic spore formers in gamma irradiated cocoa beans (Theobroma cacao L.); Analise microbiologica de coliformes e aerobicos mesofilos em amendoas de cacau (Theobroma cacao L.) irradiadas com radiacao gama

    Energy Technology Data Exchange (ETDEWEB)

    Barata, Anderson Demetrio; Mansur Netto, Elias [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Faculdade de Farmacia

    1995-12-31

    The presence of coliforms in processed foods is an useful indicator of post-sanitization and post processing contamination, and members of the mesophilic aerobic spore formers have great importance in food spoilage. Spore - forming aerobic bacilli have been observed in fermenting cocoa in Jamaica and West Africa. The results of this work has shown a considerable reduction of the mesophilic aerobic spore formers in irradiated Brazilian Comun Cocoa beans as long as the irradiation dose was increased from 1.05 to 3.99 kGy. The presence of coliforms irradiated has not been found even in the coroa beans with the dose of 1.05 kGy. (author). 4 refs., 1 tab.

  18. EFEK KONSUMSI MINUMAN BUBUK KAKAO (Theobroma cacao L. BEBAS LEMAK TERHADAP SIFAT ANTIOKSIDATIF LIMFOSIT SUBYEK PEREMPUAN [The Effect of Fat Free Cocoa (Theobroma Cacao L. Powder Drinks Consumption on Antioxidative Activity of Lymphocyte of Women Subjects

    Directory of Open Access Journals (Sweden)

    Erniati1

    2012-06-01

    Full Text Available The health benefits of cocoa both in vivo and in vitro have been reported in many studies. Cocoa is a rich source of flavonoids known to have antioxidant activity, such as catechin, epicatechin and procyanidin. The aim of this research was to evaluate the effect of fat free cocoa powder drink consumption on antioxidative properties and proliferation activities of woman lymphocyte. Healthy woman subjects were divided into cocoa group (n = 9 and control group (n = 9. Cocoa powder drink containing skim milk and sugar was given to the cocoa groups every morning for 25 days. The control group received only water containing skim milk and sugar. Both cocoa and control group received physical medical checkup at the beginning and at the end of the intervention. Their peripheral blood was taken for lymphocyte antioxidant analysis. The measured antioxidant properties consisted of antiradical activity by DPPH method, malonaldehyde (MDA and glutathione levels. The data of cocoa group showed that there was a significant increase (p ≤ 0.05 in antiradical level from 31+11.2 to 40.19+7.42% and glutathione from 48.2±10.5 to 66.7±15.9 μmol/land a decrease in MDA level in the lymphocyte (p < 0.05 from 2.98±2.21 to 1.29±0.33 μmol/las compared to the control group (from 25.77±6.9 to 26.79±6.12%; 34.7±20.7 to 37.8±19.2 μmol/land 3.01±1.53 to 2.069±0.707 μmol/l respectively after consumption of the cocoa powder drink. The results of this research revealed that fat free cocoa powder has a strong antioxidant activity which was manifested up to the blood cells.

  19. Evaluación in vitro de Microorganismos Nativos por su Antagonismo contra Moniliophthora roreri Cif & Par en Cacao (Theobroma cacao L. In vitro evaluation of Native Microorganisms for their Antagonism against Moniliophthora roreri Cif & Parin Cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Villamil Carvajal

    2012-06-01

    Full Text Available Resumen. La moniliasis, causada por Moniliophthora roreri Cif & Par, se ha convertido en la principal enfermedad limitante de la producción de cacao en Colombia y otros países. Con el objetivo de explorar alternativas para el biocontrol de esta enfermedad, hongos y bacterias aislados de frutos y suelo rizosférico de lotes plantados con cacao fueron evaluados por su antagonismo contra M. roreri. La evaluación se realizó en cajas Petri con PDA, para lo cual se colocó en el centro de las mismas, un disco de 5 mm de diámetro colonizado por el patógeno y a 3 cm del borde, sobre los ejes horizontal y vertical, cada uno de los aislamientos. Los microorganismos nativos que inicialmente mostraron antagonismo fueron posteriormente evaluados in vitro por su capacidad de restringir el crecimiento y esporulación de M. roreri. Los resultados indicaron que de 53 aislamientos de frutos y suelo rizosférico, 7 mostraron antagonismo contra M. roreri y entre ellos los más efectivos fueron los hongos H5 y H20 y la bacteria B3, los hongos para la restricción tanto del crecimiento como de la esporulación y la bacteria para el crecimiento. El hongo H20 inhibió en su totalidad el crecimiento de M. roreri. Estos resultados hacen posible que estos aislamientos sean promisorios para su incorporación al manejo de la enfermedad bajo condiciones de campo. De acuerdo con la caracterización morfológica y las pruebas bioquímicas los hongos pertenecen al género Trichoderma y la bacteria al género Bacillus.Abstract. The moniliasis, caused by Moniliophthora roreri Cif & Par, has become the principal disease limiting cocoa production in Colombia and other countries. With the objective of exploring alternatives for the biocontrol of this disease, fungi and bacteria isolated from cocoa fruits and rhizospheric soil from plots planted to cocoa trees were evaluated for their antagonism against M. roreri. The evaluation was conducted in Petri dishes containing PDA, by placing in the center of the plate a 5 mm PDA disk colonized by the pathogen and at 3 cm of the edge, on the X and Y axis, each of the isolated microorganisms. The isolates which initially showed antagonism were then evaluated in vitro for their capacity to inhibit the growth and sporulation of M. roreri. The results indicated that of the 53 isolated microorganisms, seven showed antagonism against M. roreri and among them the most effective were the fungi H5 and H20 and the bacteria B3, the fungi for the restriction of the growth and sporulation and the bacteria for the growth. The fungus H20 totally inhibited the growth of M. roreri. These results generate the possibility that these promissory isolates can be incorporated to the management of the disease under field conditions. According to the morphological characterization and the biochemical tests both fungi belong to the genus Trichoderma and the bacteria to the genus Bacillus.

  20. Bacillus subtilis and Enterobacter cloacae endophytes from healthy Theobroma cacao L. trees can systemically colonize seedlings and promote growth.

    Science.gov (United States)

    Leite, Hianna Almeida Câmara; Silva, Anderson Barbosa; Gomes, Fábio Pinto; Gramacho, Karina Peres; Faria, José Cláudio; de Souza, Jorge Teodoro; Loguercio, Leandro Lopes

    2013-03-01

    Clonal genotypes resistant to fungal diseases are an important component of the cocoa production system in southeastern Bahia state (Brazil), so that technologies for faster production of stronger and healthier plantlets are highly desirable. In this study, the effects of inoculated bacterial endophytes isolated from healthy adult cacao plants on seedlings, and aspects related to inoculation methods, colonization patterns, and photosynthesis were investigated. Sequencing of 16S rRNA, hsp-60, and rpo-B genes placed the wild-type isolates within the species Enterobacter cloacae (isolates 341 and 344) and Bacillus subtilis (isolate 629). Spontaneous rifampicin-resistant (rif(R)) variants for 344 were also produced and tested. Endophytic application was either by immersion of surface sterilized seeds in bacterial suspensions or direct inoculation into soil, 20 days after planting non-inoculated seeds into pots. Results from in vitro recovery of inoculated isolates showed that the wild-type endophytes and rif(R) variants systemically colonized the entire cacao seedlings in 15-20 days, regardless of the inoculation method. Some endophytic treatments showed significant increases in seedlings' height, number of leaves, and dry matter. Inoculation methods affected the combined application of endophytes, which maintained the growth-promotion effects, but not in the same manner as in single applications. Interestingly, the 344-3.2 rif(R) variant showed improved performance in relation to both the wild type and another related variant. Photosynthetic rates and stomatal conductance increased significantly for some endophytic treatments, being partially associated with effects on growth and affected by the inoculation method. The results suggest that E. cloacae and B. subtilis endophytes from healthy adult plants (not transmitted by seeds) were able to promote vegetative growth on cacao seedlings. The development of products for large-scale use in seedlings/plantlets production systems was discussed.

  1. Characterization of a stearoyl-acyl carrier protein desaturase gene family from chocolate tree, Theobroma cacao L

    Science.gov (United States)

    Zhang, Yufan; Maximova, Siela N.; Guiltinan, Mark J.

    2015-01-01

    In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP) desaturase (SAD). The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance. PMID:25926841

  2. Gene structure, phylogeny and expression profile of the sucrose synthase gene family in cacao (Theobroma cacao L.).

    Science.gov (United States)

    Li, Fupeng; Hao, Chaoyun; Yan, Lin; Wu, Baoduo; Qin, Xiaowei; Lai, Jianxiong; Song, Yinghui

    2015-09-01

    In higher plants, sucrose synthase (Sus, EC 2.4.1.13) is widely considered as a key enzyme involved in sucrose metabolism. Although, several paralogous genes encoding different isozymes of Sus have been identified and characterized in multiple plant genomes, to date detailed information about the Sus genes is lacking for cacao. This study reports the identification of six novel Sus genes from economically important cacao tree. Analyses of the gene structure and phylogeny of the Sus genes demonstrated evolutionary conservation in the Sus family across cacao and other plant species. The expression of cacao Sus genes was investigated via real-time PCR in various tissues, different developmental phases of leaf, flower bud and pod. The Sus genes exhibited distinct but partially redundant expression profiles in cacao, with TcSus1, TcSus5 and TcSus6, being the predominant genes in the bark with phloem, TcSus2 predominantly expressing in the seed during the stereotype stage. TcSus3 and TcSus4 were significantly detected more in the pod husk and seed coat along the pod development, and showed development dependent expression profiles in the cacao pod. These results provide new insights into the evolution, and basic information that will assist in elucidating the functions of cacao Sus gene family.

  3. Two Theobroma cacao genotypes with contrasting pathogen tolerance show aberrant transcriptional and ROS responses after salicylic acid treatment.

    Science.gov (United States)

    Fister, Andrew S; O'Neil, Shawn T; Shi, Zi; Zhang, Yufan; Tyler, Brett M; Guiltinan, Mark J; Maximova, Siela N

    2015-10-01

    Understanding the genetic basis of pathogen susceptibility in various crop plants is crucial to increasing the stability of food, feed, and fuel production. Varietal differences in defence responses provide insights into the mechanisms of resistance and are a key resource for plant breeders. To explore the role of salicylic acid in the regulation of defence in cacao, we demonstrated that SA treatment decreased susceptibility to a pod rot pathogen, Phytophthora tropicalis in two genotypes, Scavina 6 and Imperial College Selection 1, which differ in their resistance to several agriculturally important pathogens. Transient overexpression of TcNPR1, a major transcriptional regulator of the SA-dependent plant immune system, also increased pathogen tolerance in cacao leaves. To explore further the genetic basis of resistance in cacao, we used microarrays to measure gene expression profiles after salicylic acid (SA) treatment in these two cacao genotypes. The two genotypes displayed distinct transcriptional responses to SA. Unexpectedly, the expression profile of the susceptible genotype ICS1 included a larger number of pathogenesis-related genes that were induced by SA at 24h after treatment, whereas genes encoding many chloroplast and mitochondrial proteins implicated in reactive oxygen species production were up-regulated in the resistant genotype, Sca6. Sca6 accumulated significantly more superoxide at 24h after treatment of leaves with SA. These experiments revealed critical insights regarding the molecular differences between cacao varieties, which will allow a better understanding of defence mechanisms to help guide breeding programmes. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  4. The storage capacity of cocoa seeds (Theobroma cacao L.) through giving Polyethylene Glycol (PEG) in the various of storage container

    Science.gov (United States)

    Lahay, R. R.; Misrun, S.; Sipayung, R.

    2018-02-01

    Cocoa is plant which it’s seed character is recalcitrant. Giving PEG and using various of storage containers was hoped to increase storage capacity of cocoa seeds as long as period of saving. The reseach was aimed to identify the storage capacity of cocoa seeds through giving PEG in the various of storage containers. Research took place in Hataram Jawa II, Kabupaten Simalungun, Propinsi Sumatera Utara, Indonesia. The method of this research is spit-split plot design with 3 replication. Storage period was put on main plot which was consisted of 4 level, PEG concentration was put on sub plot, consisted of 4 level and storage container was put on the sub sub plot consisted of 3 types. The results showed that until 4 days at storage with 45 % PEG concentration at all storage container, percentage of seed germination at storage can be decreased to be 2.90 %, and can be defensed until 16 days with 45 % PEG concentration at perforated plastic storage container. Percentage of molded seeds and seed moisture content were increased with added period of storage but seed moisture content was increased until 12 days at storage and was decreased at 16 days in storage.

  5. Assessing genetic diversity in java fine-flavor cocoa (theobroma cacao l.) Germplasm by simple sequence repeat (ssr) markers

    Science.gov (United States)

    Indonesia is the 3rd largest cocoa producing countries in the world, with an annual cacao bean production of 572,000 tons. The currently cultivated cacao varieties in Indonesia were inter-hybrids of various clones introduced from the Americas since the 16th century. Among them, “Java cocoa” is a wel...

  6. Environmental Growing Conditions in Five Production Systems Induce Stress Response and Affect Chemical Composition of Cocoa (Theobroma cacao L.) Beans.

    Science.gov (United States)

    Niether, Wiebke; Smit, Inga; Armengot, Laura; Schneider, Monika; Gerold, Gerhard; Pawelzik, Elke

    2017-11-29

    Cocoa beans are produced all across the humid tropics under different environmental conditions provided by the region but also by the season and the type of production system. Agroforestry systems compared to monocultures buffer climate extremes and therefore provide a less stressful environment for the understory cocoa, especially under seasonally varying conditions. We measured the element concentration as well as abiotic stress indicators (polyamines and total phenolic content) in beans derived from five different production systems comparing monocultures and agroforestry systems and from two harvesting seasons. Concentrations of N, Mg, S, Fe, Mn, Na, and Zn were higher in beans produced in agroforestry systems with high stem density and leaf area index. In the dry season, the N, Fe, and Cu concentration of the beans increased. The total phenolic content increased with proceeding of the dry season while other abiotic stress indicators like spermine decreased, implying an effect of the water availability on the chemical composition of the beans. Agroforestry systems did not buffer the variability of stress indicators over the seasons compared to monocultures. The effect of environmental growing conditions on bean chemical composition was not strong but can contribute to variations in cocoa bean quality.

  7. CONTRIBUIÇÃO AO ESTUDO ANATÔMICO DA FOLHA E DO CAULE DO CACAUEIRO (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    NAKAYAMA L.H.I

    1996-01-01

    Full Text Available O presente estudo teve como objetivo descrever a anatomia da folha e do caule adulto enfatizando a caracterização dos tricomas e das estruturas secretoras do cacaueiro. Foram analisadas amostras de caule e folhas (limbo e pecíolo, correspondente ao 3º nó, além de folhas novas de 5cm de comprimento. A lâmina foliar é hipoestomática, com estômatos do tipo anomocítico. Em ambas as faces do limbo ocorrem quatro tipos de tricomas: sendo dois tectores e dois glandulares. Na epiderme adaxial estão presentes as glândulas secretoras de mucilagem. O mesofilo é dorsiventral; o parênquima paliçádico é formado por duas ou três camadas. O parênquima lacunoso apresenta células coletoras. Ao longo do mesofilo predomina feixes colaterais envolvidos por bainha esclerenquimática que se estende até as epidermes. O padrão de venação é do tipo Camptodroma com ramificações mistas Brochidrodomas e Eucamptodromos. O pecíolo e o caule apresentam a epiderme com os tricomas descritos para o limbo; No parênquima cortical e medular do pecíolo e caule, há células contendo grãos de amido, idioblastos contendo drusas e canais de mucilagem. O sistema vascular ao longo do pecíolo se diferencia quanto a organização. O caule apresenta camadas de clorênquima, e de colênquima. Ocorre a esclerificação das células deste último, com o desenvolvimento. Segue-se um anel descontínuo de fibras do floema primário. A medula é ampla e se esclerifica com o desenvolvimento.

  8. In vitro pharmacological activity of the tetrahydroisoquinoline salsolinol present in products from Theobroma cacao L. like cocoa and chocolate.

    Science.gov (United States)

    Melzig, M F; Putscher, I; Henklein, P; Haber, H

    2000-11-01

    Cocoa and chocolate contain the tetrahydroisoquinoline alkaloid salsolinol up to a concentration of 25 microg/g. Salsolinol is a dopaminergic active compound which binds to the D(2) receptor family, especially to the D(3) receptor with a K(i) of 0.48+/-0.021 micromol/l. It inhibits the formation of cyclic AMP and the release of beta-endorphin and ACTH in a pituitary cell system. Taking the detected concentration and the pharmacological properties into account, salsolinol seems to be one of the main psychoactive compounds present in cocoa and chocolate and might be included in chocolate addiction.

  9. Influences of superheated steam roasting on changes in sugar, amino acid and flavour active components of cocoa bean (Theobroma cacao).

    Science.gov (United States)

    Zzaman, Wahidu; Bhat, Rajeev; Yang, Tajul Aris; Easa, Azhar Mat

    2017-10-01

    Roasting is one of the important unit operations in the cocoa-based industries in order to develop unique flavour in products. Cocoa beans were subjected to roasting at different temperatures and times using superheated steam. The influence of roasting temperature (150-250°C) and time (10-50 min) on sugars, free amino acids and volatile flavouring compounds were investigated. The concentration of total reducing sugars was reduced by up to 64.61, 77.22 and 82.52% with increased roasting temperature at 150, 200 and 250°C for 50 min, respectively. The hydrophobic amino acids were reduced up to 29.21, 36.41 and 48.87% with increased roasting temperature at 150, 200 and 250°C for 50 min, respectively. A number of pyrazines, esters, aldehydes, alcohols, ketones, carboxyl acids and hydrocarbons were detected in all the samples at different concentration range. Formation of the most flavour active compounds, pyrazines, were the highest concentration (2.96 mg kg -1 ) at 200°C for 10 min. The superheated steam roasting method achieves the optimum roasting condition within a short duration Therefore, the quality of cocoa beans can be improved using superheated steam during the roasting process. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  10. Microbiological analysis of coliforms and mesophilic aerobic spore formers in gamma irradiated cocoa beans (Theobroma cacao L.)

    International Nuclear Information System (INIS)

    Barata, Anderson Demetrio; Mansur Netto, Elias

    1995-01-01

    The presence of coliforms in processed foods is an useful indicator of post-sanitization and post processing contamination, and members of the mesophilic aerobic spore formers have great importance in food spoilage. Spore - forming aerobic bacilli have been observed in fermenting cocoa in Jamaica and West Africa. The results of this work has shown a considerable reduction of the mesophilic aerobic spore formers in irradiated Brazilian Comun Cocoa beans as long as the irradiation dose was increased from 1.05 to 3.99 kGy. The presence of coliforms irradiated has not been found even in the coroa beans with the dose of 1.05 kGy. (author). 4 refs., 1 tab

  11. Time-Related Changes in Volatile Compounds during Fermentation of Bulk and Fine-Flavor Cocoa (Theobroma cacao Beans

    Directory of Open Access Journals (Sweden)

    Juan Manuel Cevallos-Cevallos

    2018-01-01

    Full Text Available Chocolate is one of the most consumed foods worldwide and cacao fermentation contributes to the unique sensory characteristics of chocolate products. However, comparative changes in volatiles occurring during fermentation of Criollo, Forastero, and Nacional cacao—three of the most representative cultivars worldwide—have not been reported. Beans of each cultivar were fermented for five days and samples were taken every 24 hours. Volatiles from each sample were adsorbed into a solid phase microextraction fiber and analyzed by gas chromatography-mass spectrometry. Aroma potential of each compound was determined using available databases. Multivariate data analyses showed partial clustering of samples according to cultivars at the start of the fermentation but complete clustering was observed at the end of the fermentation. The Criollo cacao produced floral, fruity, and woody aroma volatiles including linalool, epoxylinalool, benzeneethanol, pentanol acetate, germacrene, α-copaene, aromadendrene, 3,6-heptanedione, butanal, 1-phenyl ethenone, 2-nonanone, and 2-pentanone. Nacional cacao produced fruity, green, and woody aroma volatiles including 2-nonanone, 3-octen-1-ol, 2-octanol acetate, 2-undecanone, valencene, and aromadendrene. The Forastero cacao yielded floral and sweet aroma volatiles such as epoxylinalool, pentanoic acid, benzeneacetaldehyde, and benzaldehyde. This is the first report of volatiles produced during fermentation of Criollo, Forastero, and Nacional cacao from the same origin.

  12. Comparación sensorial del cacao (Theobroma cacao L. Nacional fino de aroma cultivado en diferentes zonas del Ecuador

    Directory of Open Access Journals (Sweden)

    Eddyn Solórzano Chavez

    2015-12-01

    Full Text Available La presente investigación tuvo como objetivo comparar el perfil sensorial de muestras de cacao de varias zonas productoras del país. Con este propósito el Laboratorio de Calidad Integral de Cacao y Chocolate de la Estación Experimental Tropical Pichilingue del INIAP, recibió muestras de 11 asociaciones de productores. Un panel de cinco miembros con experiencia en degustación de pasta de cacao (licor produjo datos para los siguientes componentes del sabor: cacao, acidez, amargor, astringencia, caramelo, floral, frutal, nuez y verde. El análisis comparativo de las muestras se llevó a cabo mediante la prueba no paramétrica de Kruskal & Wallis. El grado de asociación de distintos pares de variables se examinó mediante un análisis correlacional. La relación entre muestras también se exploró mediante el análisis multivariado de componentes principales. Este análisis condujo a la identificación de las variables originales que más aportaron a la varianza de los dos primeros componentes principales. Diferencias estadísticamente significativas entre muestras se detectaron solo para el sabor a cacao. Las correlaciónes más altas se dieron entre las variables frutal y verde, frutal y astringencia, frutal y amargor, y frutal y nuez, la mayoría de signo negativo. Las variables con más aportación a la varianza (35.20% del primer componente principal fueron frutal, verde y amargor. Acidez, floral y nuez hicieron la mayor aportación al segundo componente principal. La aparente estructuración de dos grupos muestrales en el plano definido sugiere semejanzas y diferencias en su perfil sensorial.

  13. Behavior of introduced regional clones of Theobroma cacao toward the infection Moniliophthora roreri in three different regions of Colombia

    Directory of Open Access Journals (Sweden)

    Jaimes Yeirme

    2011-08-01

    Full Text Available

    Moniliasis (frosty pod rot, caused by Moniliophthora roreri, is the most limiting disease of cacao bean production in Colombia. Disease control has focused primarily on the implementation of cultural methods, which are inefficient and increase costs of production. A promising alternative for the control of M. roreri is the genetic approach, involving the search for plants with known resistance in the field. The aim of this study was to evaluate the behavior of 13 regional clones of Corpoica Selection Colombia (SCC, ten regional Fedecacao clones (with the initial F, three clones Caucasia (CAU and 13 introduced clones for resistance to M. roreri, by monitoring symptoms and signs of the pathogen in fruits of the cacao at three experimental sites located in Arauquita (Arauca, San Vicente and Rionegro (Santander. To estimate the degree of susceptibility or resistance of each clone, the pathogen was inoculated into fruits 75-5 days old. Eight weeks later, the variables Incidence, Internal Severity Index and External Severity Index were evaluated. In the three experimental sites, the ICS clone 95 behaved as a resistant plant with ISI ranging from 1.4 to 1.9. In the other clones tested, susceptibility varied according to altitude and environmental conditions. However, the ICS clone 95 showed partial resistance, varying the spread of the pathogen in the plant tissue.

  14. FORMULASI SEDIAAN MOUTHWASH PENCEGAH PLAK GIGI EKSTRAK BIJI KAKAO (Theobroma cacao L DAN UJI EFEKTIVITAS PADA BAKTERI Streptococcus mutans

    Directory of Open Access Journals (Sweden)

    Apriyanti Anastasia

    2017-03-01

    Full Text Available Research on the formulation of preparations mouthwash prevention of dental plaque extract of cocoa beans also has been tested in Streptococcus mutans bacteria by variations in the concentration of glycerin as a humectant in preparation which aims to determine the effect of different concentrations of glycerin as a humectant to the physical properties, chemical properties and inhibition zone Streptococcus mutans bacteria in mouthwash formula and to know the mouthwash formula that has the physical quality and the highest antibacterial activity. The method used includes the step of extraction of cocoa beans, preparation of a mouthwash with 4 formula using variations of glycerin F1 (0%, F2 (15%, F3 (20% and F4 (25% followed by an evaluation formula that includes organoleptic tests, pH test and the test of inhibition diameter. Tests performed on days 0, 7, 14 and 21. The results showed the concentration of glycerin as a humectant in a mouthwash formula cocoa seed extract has an effect on the diameter of inhibition zone, but did not have a significant effect on the physical and chemical properties of cocoa seed extracts mouthwash, The concentration of glycerin which meets the physical quality and the most excellent antibacterial activity that is 15% contained in the formula 2.

  15. Use of gamma rays to induce mutants resistant to cocoa swollen shoot disease in Theobroma cacao L

    International Nuclear Information System (INIS)

    Adu Ampomah, Y.; Owusu, G.K.; Sackey, S.; Padi, B.; Abdul Karimu, A.

    1996-01-01

    Vegetative buds of three cocoa varieties, ‘Amelonado’ (P30), ‘Trinitario’ (K5) and ‘Upper Amazon’ (T85/799) were irradiated with 15, 20 and 25 Gy of γ-rays, respectively, and budded on to rootstocks to generate MV1 shoots. The terminal buds of the shoots were removed to induce the formation of MV2 shoots, from which MV3 shoots were similarly derived. The MV3 plants were screened for resistance to the Cocoa Swollen Shoot Virus (CSSV) by patch-graft inoculation of the root-stocks. Only a few plants from each of the three cocoa varieties were found to be symptomless after indexing. These plants were multiplied by budding to the MV4 and MV5 stages and screened at each stage for CSSV resistance by inoculation using virus-carrying mealybugs. At the MV5 stage, some plants still remained symptomless and this was confirmed with enzyme-linked immunosorbent assay (ELISA). The study reveals that γ-rays can be used to induce genetic variability for resistance to CSSV in cocoa, as well as for other traits such as chlorophyll deficiency. (author)

  16. Aflatoxins and ochratoxin A in different cocoa clones (Theobroma cacao L.) developed in the southern region of Bahia, Brazil.

    Science.gov (United States)

    Maciel, Leonardo Fonseca; Felício, Ana Lúcia de Souza Madureira; Miranda, Lucas Caldeirão Rodrigues; Pires, Tassia Cavalcante; Bispo, Eliete da Silva; Hirooka, Elisa Yoko

    2018-01-01

    Brazil is the sixth largest producer of cocoa beans in the world, after Côte d'Ivoire, Ghana, Indonesia, Nigeria and Cameroon. The southern region of Bahia stands out as the country's largest producer, accounting for approximately 60% of production. Due to damage caused by infestation of the cocoa crop with the fungus Moniliophthora perniciosa, which causes 'witch's broom disease', research in cocoa beans has led to the cloning of species that are resistant to the disease; however, there is little information about the development of other fungal genera in these clones, such as Aspergillus, which do not represent a phytopathogenicity problem but can grow during the pre-processing of cocoa beans and produce mycotoxins. Thus, the aim of this work was to determine the presence of aflatoxin (AF) and ochratoxin A (OTA) in cocoa clones developed in Brazil. Aflatoxin and ochratoxin A contamination were determined in 130 samples from 13 cocoa clones grown in the south of Bahia by ultra-performance liquid chromatography with a fluorescence detector. The method was evaluated for limit of detection (LOD) (0.05-0.90 μg kg -1 ), limit of quantification (0.10-2.50 μg kg -1 ) and recovery (RSD) (89.40-95.80%) for AFB 1 , AFB 2 , AFG 1 , AFG 2 and OTA. Aflatoxin contamination was detected in 38% of the samples in the range of

  17. Relationship between fermentation index and other biochemical changes evaluated during the fermentation of Mexican cocoa (Theobroma cacao) beans.

    Science.gov (United States)

    Romero-Cortes, Teresa; Salgado-Cervantes, Marco Antonio; García-Alamilla, Pedro; García-Alvarado, Miguel Angel; Rodríguez-Jimenes, Guadalupe del C; Hidalgo-Morales, Madeleine; Robles-Olvera, Víctor

    2013-08-15

    During traditional cocoa processing, the end of fermentation is empirically determined by the workers; consequently, a high variability on the quality of fermented cocoa beans is observed. Some physicochemical properties (such as fermentation index) have been used to measure the degree of fermentation and changes in quality, but only after the fermentation process has concluded, using dried cocoa beans. This would suggest that it is necessary to establish a relationship between the chemical changes inside the cocoa bean and the fermentation conditions during the fermentation in order to standardize the process. Cocoa beans were traditionally fermented inside wooden boxes, sampled every 24 h and analyzed to evaluate fermentation changes in complete bean, cotyledon and dried beans. The value of the fermentation index suggested as the minimal adequate (≥1) was observed at 72 h in all bean parts analyzed. At this time, values of pH, spectral absorption, total protein hydrolysis and vicilin-class globulins of fermented beans suggested that they were well fermented. Since no difference was found between the types of samples, the pH value could be used as a first indicator of the end of the fermentation and confirmed by evaluation of the fermentation index using undried samples, during the process. © 2013 Society of Chemical Industry.

  18. In vitro hypoglycemic and cholesterol lowering effects of dietary fiber prepared from cocoa (Theobroma cacao L.) shells.

    Science.gov (United States)

    Nsor-Atindana, John; Zhong, Fang; Mothibe, Kebitsamang Joseph

    2012-10-01

    Three dietary fiber (DF) powders; soluble dietary fiber (SDF), insoluble dietary fiber (IDF) and total dietary fiber (TDF) were prepared from cocoa bean shells (CBS) by enzymatic treatment. These DFs were evaluated for their effects on glucose adsorption, glucose diffusion, starch hydrolysis, cholesterol binding, sodium cholate binding and oil binding capacities using in vitro model systems by simulating gastric intestinal conditions. The results showed that SDF generally exhibited significantly (p 0.05) glucose dialysis retardation index (GDRI) and oil binding capacity, when compared with IDF and TDF which both showed similar effects. Moreover, it was discovered that the three CBS dietary fiber powders contained intrinsic antioxidants (phenolic compounds). The study suggested that CBS could be an alternative cheap source of DF with additional benefits. Thus, CBS fibers could be incorporated as low calorie bulk ingredients in high-fiber diet to reduce calorie and cholesterol levels and control blood glucose level.

  19. Investigations on the Aroma of Cocoa Pulp ( Theobroma cacao L.) and Its Influence on the Odor of Fermented Cocoa Beans.

    Science.gov (United States)

    Chetschik, Irene; Kneubühl, Markus; Chatelain, Karin; Schlüter, Ansgar; Bernath, Konrad; Hühn, Tilo

    2018-03-14

    The odor-active constituents of cocoa pulp have been analyzed by aroma extract dilution analysis (AEDA) for the first time. Pulps of three different cocoa varieties have been investigated. The variety CCN51 showed low flavor intensities, in terms of flavor dilution (FD) factors, in comparison to varieties FSV41 and UF564, for which floral and fruity notes were detected in higher intensities. To gain first insights on a molecular level of how the cocoa pulp odorants affected the odor quality of cocoa beans during fermentation, quantitative measurements of selected aroma compounds were conducted in pulp and bean at different time points of the fermentation. The results showed significantly higher concentrations of 2-phenylethanol and 3-methylbutyl acetate in pulp than in the bean during the different time steps of the fermentation, whereas the reverse could be observed for the odorants linalool and 2-methoxyphenol. The findings of this study constitute a basis for further investigations on the aroma formation of cocoa during fermentation.

  20. Effect of pulp preconditioning on acidification, proteolysis, sugars and free fatty acids concentration during fermentation of cocoa (Theobroma cacao) beans.

    Science.gov (United States)

    Afoakwa, Emmanuel Ohene; Quao, Jennifer; Budu, Agnes Simpson; Takrama, Jemmy; Saalia, Firibu Kwesi

    2011-11-01

    Changes in acidification, proteolysis, sugars and free fatty acids (FFAs) concentrations of Ghanaian cocoa beans as affected by pulp preconditioning (pod storage or PS) and fermentation were investigated. Non-volatile acidity, pH, proteolysis, sugars (total, reducing and non-reducing) and FFAs concentrations were analysed using standard methods. Increasing PS consistently decreased the non-volatile acidity with concomitant increase in pH during fermentation of the beans. Fermentation decreased the pH of the unstored beans from 6.7 to 4.9 within the first 4 days and then increased slightly again to 5.3 by the sixth day. Protein, total sugars and non-reducing sugars decreased significantly (p cocoa beans was largely affected by fermentation than by PS.

  1. Flavanols, proanthocyanidins and antioxidant activity changes during cocoa (Theobroma cacao L.) roasting as affected by temperature and time of processing.

    Science.gov (United States)

    Ioannone, F; Di Mattia, C D; De Gregorio, M; Sergi, M; Serafini, M; Sacchetti, G

    2015-05-01

    The effect of roasting on the content of flavanols and proanthocyanidins and on the antioxidant activity of cocoa beans was investigated. Cocoa beans were roasted at three temperatures (125, 135 and 145 °C), for different times, to reach moisture contents of about 2 g 100 g(-1). Flavanols and proanthocyanidins were determined, and the antioxidant activity was tested by total phenolic index (TPI), ferric reducing antioxidant power (FRAP) and total radical trapping antioxidant parameter (TRAP) methods. The rates of flavanol and total proanthocyanidin loss increased with roasting temperatures. Moisture content of the roasted beans being equal, high temperature-short time processes minimised proanthocyanidins loss. Moisture content being equal, the average roasting temperature (135 °C) determined the highest TPI and FRAP values and the highest temperature (145 °C) determined the lowest TPI values. Moisture content being equal, low temperature-long time roasting processes maximised the chain-breaking activity, as determined by the TRAP method. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Heavy metal accumulation in leaves and beans of cacao (Theobroma cacao L.) in major cacao growing regions in Peru.

    Science.gov (United States)

    Arévalo-Gardini, Enrique; Arévalo-Hernández, Cesar O; Baligar, Virupax C; He, Zhenli L

    2017-12-15

    Peru is one of the leading exporters of organic cacao beans in the world. However, the accumulation of heavy metals in cacao beans represents a problem for cocoa bean export and chocolate quality. The aim of this study was to investigate the distribution and accumulation of heavy metals in cacao leaves and cocoa beans in three major cacao growing regions of Peru. The study was conducted in cacao plantations of 10 to 15years old in three regions of Peru: North (Regions of Tumbes, Piura, Cajamarca, and Amazonas); Center (Regions of Huánuco and San Martin) and South (Junin and Cuzco). Samples of leaf and cacao beans were collected from 70 cacao plantations, and the nature of cacao clone or genotype sampled was recorded. The concentrations of heavy metals such as Cd, Cr, Cu, Fe, Mn, Ni, Pb and Zn in leaves and beans were determined using atomic absorption spectrophotometer. Overall, concentrations of heavy metals were below the critical limits; however, the presence of high levels of Cd in cacao grown in Amazonas, Piura, and Tumbes regions is of primary concern. Plantations of cacao with different cacao clones show differences in Cd accumulation both in leaves and cocoa beans. Therefore, it is promising to screen low Cd accumulator cacao genotypes for safe production of cacao on lightly to moderately Cd contaminated soils. Also, synergism between Zn and Cd present both in plant and soil suggests that Zn has a direct effect on Cd accumulation in cacao. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Deciphering the Theobroma cacao self-incompatibility system: from genomics to diagnostic markers for self-compatibility.

    Science.gov (United States)

    Lanaud, Claire; Fouet, Olivier; Legavre, Thierry; Lopes, Uilson; Sounigo, Olivier; Eyango, Marie Claire; Mermaz, Benoit; Da Silva, Marcos Ramos; Loor Solorzano, Rey Gaston; Argout, Xavier; Gyapay, Gabor; Ebaiarrey, Herman Ebai; Colonges, Kelly; Sanier, Christine; Rivallan, Ronan; Mastin, Géraldine; Cryer, Nicholas; Boccara, Michel; Verdeil, Jean-Luc; Efombagn Mousseni, Ives Bruno; Peres Gramacho, Karina; Clément, Didier

    2017-10-13

    Cocoa self-compatibility is an important yield factor and has been described as being controlled by a late gameto-sporophytic system expressed only at the level of the embryo sac. It results in gametic non-fusion and involves several loci. In this work, we identified two loci, located on chromosomes 1 and 4 (CH1 and CH4), involved in cocoa self-incompatibility by two different processes. Both loci are responsible for gametic selection, but only one (the CH4 locus) is involved in the main fruit drop. The CH1 locus acts prior to the gamete fusion step and independently of the CH4 locus. Using fine-mapping and genome-wide association studies, we focused analyses on restricted regions and identified candidate genes. Some of them showed a differential expression between incompatible and compatible reactions. Immunolocalization experiments provided evidence of CH1 candidate genes expressed in ovule and style tissues. Highly polymorphic simple sequence repeat (SSR) diagnostic markers were designed in the CH4 region that had been identified by fine-mapping. They are characterized by a strong linkage disequilibrium with incompatibility alleles, thus allowing the development of efficient diagnostic markers predicting self-compatibility and fruit setting according to the presence of specific alleles or genotypes. SSR alleles specific to self-compatible Amelonado and Criollo varieties were also identified, thus allowing screening for self-compatible plants in cocoa populations. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  4. Characterization of a stearoyl-acyl carrier protein desaturase gene family from chocolate tree, Theobroma cacao L.

    Science.gov (United States)

    Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J

    2015-01-01

    In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP) desaturase (SAD). The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance.

  5. Effect of genotype of cocoa (Theobroma cacao) on attractiveness to the mirid Sahlbergella singularis (Hemiptera: Miridae) in the laboratory.

    Science.gov (United States)

    Dibog, Luc; Babin, Régis; Mbang, Joseph Amang A; Decazy, Bernard; Nyassé, Salomon; Cilas, Christian; Eskes, Albertus B

    2008-09-01

    Mirids are a major constraint to cocoa growing in Africa. Cocoa breeding for tolerance/resistance could be effective in an integrated pest management system. Attractiveness is one aspect of tolerance/resistance, and decreasing the attractiveness of cocoa trees should be a good way of reducing damage. Small-scale laboratory tests were carried out in Cameroon to assess differences in the attractiveness to mirids of eleven cocoa genotypes. The genotypes were ranked according to their attractiveness score and a distance from a mean value. An analysis of variance was performed and revealed significant differences between cocoa genotypes (F=3.15, Pcocoa genotype groupings revealed three major categories, with BE10 and SNK413 proving to be the most attractive. In contrast, five genotypes, IMC60, the Catongo Trinitario genotypes, Playa Alta2 (from Venezuela), SIC5 and SNK614, proved to be less attractive than the mean. Four genotypes (PA107, SNK619, UPA134 and T60/887) displayed similar attractiveness to the mean. The circular microtest offered the advantage of not needing a reference cocoa genotype. The least attractive clones, such as IMC60, were also the most tolerant in the field. Comparisons with the results of other studies are proposed.

  6. Effect of Cryopreservation and Post-Cryopreservation Somatic Embryogenesis on the Epigenetic Fidelity of Cocoa (Theobroma cacao L.).

    Science.gov (United States)

    Adu-Gyamfi, Raphael; Wetten, Andy; Marcelino Rodríguez López, Carlos

    2016-01-01

    While cocoa plants regenerated from cryopreserved somatic embryos can demonstrate high levels of phenotypic variability, little is known about the sources of the observed variability. Previous studies have shown that the encapsulation-dehydration cryopreservation methodology imposes no significant extra mutational load since embryos carrying high levels of genetic variability are selected against during protracted culture. Also, the use of secondary rather than primary somatic embryos has been shown to further reduce the incidence of genetic somaclonal variation. Here, the effect of in vitro conservation, cryopreservation and post-cryopreservation generation of somatic embryos on the appearance of epigenetic somaclonal variation were comparatively assessed. To achieve this we compared the epigenetic profiles, generated using Methylation Sensitive Amplified Polymorphisms, of leaves collected from the ortet tree and from cocoa somatic embryos derived from three in vitro conditions: somatic embryos, somatic embryos cryopreserved in liquid nitrogen and somatic embryos generated from cryoproserved somatic embryos. Somatic embryos accumulated epigenetic changes but these were less extensive than in those regenerated after storage in LN. Furthermore, the passage of cryopreserved embryos through another embryogenic stage led to further increase in variation. Interestingly, this detected variability appears to be in some measure reversible. The outcome of this study indicates that the cryopreservation induced phenotypic variability could be, at least partially, due to DNA methylation changes. Phenotypic variability observed in cryostored cocoa somatic-embryos is epigenetic in nature. This variability is partially reversible, not stochastic in nature but a directed response to the in-vitro culture and cryopreservation.

  7. Sensory-guided decomposition of roasted cocoa nibs (Theobroma cacao) and structure determination of taste-active polyphenols.

    Science.gov (United States)

    Stark, Timo; Bareuther, Sabine; Hofmann, Thomas

    2005-06-29

    Sequential application of solvent extraction, gel permeation chromatography, and RP-HPLC in combination with taste dilution analyses, followed by LC-MS and 1D/2D-NMR experiments and thiolytic degradation, revealed that, besides theobromine and caffeine, the flavan-3-ols epicatechin, catechin, procyanidin B-2, procyanidin B-5, procyanidin C-1, [epicatechin-(4beta-->8)](3)-epicatechin, and [epicatechin-(4beta-->8)](4)-epicatechin were among the key compounds contributing to the bitter taste as well as the astringent mouthfeel imparted upon consumption of roasted cocoa. In addition, a series of quercetin, naringenin, luteolin, and apigenin glycopyranosides as well as a family of not previously identified amino acid amides, namely, (+)-N-[4'-hydroxy-(E)-cinnamoyl]-L-aspartic acid, (+)-N-[3',4'-dihydroxy-(E)-cinnamoyl]-L-aspartic acid, (-)-N-[3',4'-dihydroxy-(E)-cinnamoyl]-L-glutamic acid, (-)-N-[4'-hydroxy-(E)-cinnamoyl]-L-glutamic acid, (-)-N-[4'-hydroxy-(E)-cinnamoyl]-3-hydroxy-L-tyrosine, (+)-N-[4'-hydroxy-3'-methoxy-(E)-cinnamoyl]-L-aspartic acid, and (+)-N-(E)-cinnamoyl-L-aspartic acid, have been identified as key astringent compounds of roasted cocoa. Furthermore, (-)-N-[3',4'-dihydroxy-(E)-cinnamoyl]-3-hydroxy-l-tyrosine (clovamide), (-)-N-[4'-hydroxy-(E)-cinnamoyl]-L-tyrosine (deoxyclovamide), and (-)-N-[3',4'-dihydroxy-(E)-cinnamoyl]-L-tyrosine, reported previously as antioxidants, have been found as contributors of cocoa's astringent taste. By means of the half-tongue test, the taste thresholds of flavan-3-ols and glycosides have been determined.

  8. Association mapping for #Phytophthora# pod rot resistance in a cacao (#Theobroma cacao# L.) population grown in farmers' field

    OpenAIRE

    Efombagn, Mousseni Ives Bruno; Sounigo, Olivier; Courtois, Brigitte; Fouet, Olivier; Jeanneau, Mélanie; Lemainque, Arnaud; Pavek, Sylvana; Lanaud, Claire

    2016-01-01

    Phytophthora pod rot (PPR) caused by the specie Phytophthora megakarya is an important disease of cacao tree. Association mapping identified markers linked to PPR resistance in a cacao population of 260 trees planted under high disease pressure in a single plantation in a farmer's field. These cacao trees were derived from both selfing and full-sib progenies. The resistance traits were assessed through field observations of the natural pod attacks of the disease on the trunk (PRTnk) or the ca...

  9. Development in nursery of different clones of cupuaçu tree (Theobroma grandiflorum (Wild. Ex Spreng. Schum

    Directory of Open Access Journals (Sweden)

    D. Franciskievicz

    2013-11-01

    Full Text Available This work aimed to present the results of initial development in nursery of 4 genetic materials of cupuaçu trees, being one a material without selection (control and three clones of cupuaçu tree resistant to the fungus Moniliophthora perniciosa, causal agent of Witches' Broom. The seeds from Embrapa Amazônia Oriental (Belém - PA were put in seed bed for germination. After 25 days of seedling emergence these were transplanted in to plastic bags, arranged in a shade house (60%, and containing agricultural substrate and forest humus (1: 3. At the end of 130 days after sowing were compared the patterns of development of girth, height and relation height / girth in a randomized block design consisting of 4 treatments and 4 replicates, each replicate consisting of 16 seedlings. Results were subjected to analysis of variance (ANOVA and the averages compared by Tukey (5%. The values ​​obtained to girth not differ, presented as overall mean 5.08 mm, however in relation to height cultivar 215 (31cm excelled on the cultivar 174 (25 cm and control (23 cm, however their average not differ of material 186 (27 cm. As regards the height / girth the values ​​obtained for the control and cultivars 175, 186 and 215, were respectively, 4.6, 5.2, 5.1 and 5.9 cm / mm, being cultivar 215 different to control.

  10. Crecimiento de plántulas de cacao (Theobroma cacao L. en diferentes tamaños de contenedor

    Directory of Open Access Journals (Sweden)

    Mónica Andrea Osorio G.

    2017-12-01

    Full Text Available El volumen del contenedor para la propagación del cacao es determinante, ya que su tamaño influye en el crecimiento y desarrollo de las plántulas, siendo un factor definitivo para el establecimiento del cultivo. En este trabajo se comparó el efecto que tienen diferentes tamaños de contenedor 0,01; 0,02 y 0,1m3 (volumen de sustrato y la duración en vivero, sobre el crecimiento de plantas de cacao, además, se evaluaron los cambios en el sustrato confinado. Se sembraron semillas de cacao en contenedores de diferentes alturas: 25, 45 y 70cm. Se midió la temperatura de las hojas y se colectaron plántulas, para cuantificar la biomasa particionada y crecimiento de la raíz principal. Simultáneamente fueron evaluadas la resistencia a la penetración, la temperatura, la humedad y la porosidad del sustrato. Los resultados evidenciaron diferencias significativas (P<0,05 en la acumulación de fitomasa total. En los contenedores de mayor tamaño (0,1m3 hubo mayor biomasa total, mayor longitud de raíces: 62,17cm, el sustrato presentó menor resistencia a la penetración (0,52Kg cm-2 y temperatura. La temperatura de las hojas se relacionó directamente con la temperatura del suelo e inversamente con la humedad del suelo. Se comprobó que el tamaño del contenedor afecta las características físicas del sustrato y el crecimiento de las plantas, lo cual sugiere que con 0,02m2 (con 45cm altura del contenedor las plantas pueden permanecer 180 días en vivero.

  11. Evolution of soil organic carbon during a chronosequence of transformation from cacao (Theobroma cacao l. plantation to grassland

    Directory of Open Access Journals (Sweden)

    Pedro Salvador Morales

    2017-10-01

    Full Text Available The aim of this research was to evaluate the impact of the soil use change of the Cocoa Agroforestry System (CAS on soil organic carbon (SOC levels and other indicating soil chemical fertility properties (apparent density ρb, cation exchange capacity CEC, total soil N TSN, when a soil use change occurs from CAS to grassland (GL. For this, in order to be selected was recorded, considering different time intervals (1-5, 6-10 y 11-20 years. However, a CAS of 20-35 years was considered as a reference. In addition, soil samples were taken at -30 cm depth to determine the contents of SOC, TSN, CEC, ρb, soil organic matter (SOM and the soil C/N relationship. Consequently, an in situ resistance to soil penetration was evaluated. The results indicated the change in soil use from CAS to GL, did not cause a significant decrease in the amount of stored SOC (0-30 cm during the considered time with respect to CAS. However, if only the first -10 cm of soil is sampled, a significant soil compaction is observed throughout a decrease in the CEC value in the long term (20 years.

  12. Protein (Viridiplantae): 417622 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 09 ... 214909:3609 ... 3640:3609 ... 3641:3609 ... Uncharacterized protein TCM_008191 Theobroma cacao MEETSLGLSFTKDENFREWYSEIYFVAVNSEMIECNDISSYYILRSRAISIGRLTCTFPAAVCTPEIKASFNILLRVNDVQ

  13. Efecto del ácido giberélico y la 6-bencilaminopurina sobre el desarrollo de yemas en injertos de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Cárdenas-Hernández Julián F.

    2010-04-01

    Full Text Available

    Gran parte de los cultivos de cacao en el país son viejos y necesitan ser renovados debido a sus bajos rendimientos. Por esta razón se aborda la producción masiva de plántulas injertadas con materiales de alta productividad, que sin embargo presentan problemas en el prendimiento y desarrollo de las yemas. En el Centro de Investigación Nataima-Corpoica (Espinal, Tolima, plántulas de cacao del clon IMC67 tratadas con desbrote apical fueron injertadas con yemas de los clones CCN51 e ICS95. El ensayo siguió un diseño completamente aleatorizado con siete tratamientos, tres de ellos correspondientes a concentraciones de 5, 10 y 15 mg L-1 de ácido giberélico (AG3, y otros tres aplicando 6-bencilaminopurina (6BAP en las mismas concentraciones, más un testigo sin aplicación de hormonas. Cada 3 días se midieron la altura, el diámetro, la longitud, el número de hojas y el área foliar del injerto, además de su masa fresca y seca al final del experimento, el cual duró 30 días. El AG3 permitió alcanzar los mayores valores en longitud, número de hojas, área foliar y masa fresca y seca del injerto. Para los mismos parámetros, los tratamientos con 6BAP alcanzaron valores similares a los obtenidos con AG3 (con diferencias estadísticas en algunos casos, además de los mayores diámetros del injerto. Dentro de las aplicaciones de AG3, la realizada a una concentración de 10 mg L-1 mostró los mejores resultados en ambos clones. Sin la aplicación de hormonas, las yemas del clon ICS95 desarrollaron una mayor área foliar y alcanzaron mayores valores de masa fresca y seca que las yemas del clon CCN51. Sin embargo, después de aplicar los tratamientos, los dos clones presentaron valores similares.

  14. First typology of cacao (Theobroma cacao L.) systems in Colombian Amazonia, based on tree species richness, canopy structure and light availability.

    Science.gov (United States)

    Suárez Salazar, Juan Carlos; Ngo Bieng, Marie Ange; Melgarejo, Luz Marina; Di Rienzo, Julio A; Casanoves, Fernando

    2018-01-01

    We present a typology of cacao agroforest systems in Colombian Amazonia. These systems had yet to be described in the literature, especially their potential in terms of biodiversity conservation. The systems studied are located in a post-conflict area, and a deforestation front in Colombian Amazonia. Cacao cropping systems are of key importance in Colombia: cacao plays a prime role in post conflict resolution, as cacao is a legal crop to replace illegal crops; cacao agroforests are expected to be a sustainable practice, promoting forest-friendly land use. We worked in 50 x 2000 m2 agroforest plots, in Colombian Amazonia. A cluster analysis was used to build a typology based on 28 variables characterised in each plot, and related to diversity, composition, spatial structure and light availability for the cacao trees. We included variables related to light availability to evaluate the amount of transmitted radiation to the cacao trees in each type, and its suitability for cacao ecophysiological development. We identified 4 types of cacao agroforests based on differences concerning tree species diversity and the impact of canopy spatial structure on light availability for the cacao trees in the understorey. We found 127 tree species in the dataset, with some exclusive species in each type. We also found that 3 out of the 4 types identified displayed an erosion of tree species diversity. This reduction in shade tree species may have been linked to the desire to reduce shade, but we also found that all the types described were compatible with good ecophysiological development of the cacao trees. Cacao agroforest systems may actually be achieving biodiversity conservation goals in Colombian Amazonia. One challenging prospect will be to monitor and encourage the conservation of tree species diversity in cacao agroforest systems during the development of these cropping systems, as a form of forest-friendly management enhancing sustainable peace building in Colombia.

  15. DESEMPENHO E DIGESTIBILIDADE DE OVINOS ALIMENTADOS COM FARELO DE CACAU (Theobroma cacao L. EM DIFERENTES NÍVEIS DE SUBSTITUIÇÃO

    Directory of Open Access Journals (Sweden)

    Cristina Mattos Veloso

    2006-10-01

    Full Text Available O objetivo deste trabalho foi avaliar o desempenho e digestibilidade aparente de ovinos alimentados com dietas contendo farelo de cacau em substituição ao concentrado (milho e farelo de soja. Utilizaram-se dezesseis ovinos Santa Inês, fêmeas, não prenhes, não lactantes, com peso médio inicial de 25 kg e aproximadamente doze meses de idade, mantidos em baias individuais. O experimento teve a duração de 78 dias, sendo 15 de período pré-experimental e 63 dias de período experimental. Forneceram-se as dietas em mistura completa, na proporção 50:50% (volumoso:concentrado,sendo utilizado como volumoso o feno da parte aérea da mandioca, com níveis de inclusão de farelo de cacau no concentrado de 0%, 10%, 20% e 30%. Forneciam-se dietas pela manhã, sendo ajustadas de forma a sobrar 10%. Semanalmente, coletaram-se as sobras e amostras de alimentos para análises laboratoriais. Avaliaram-se o consumo, o ganho médio diário de peso, a conversão alimentar e a digestibilidade aparente. A inclusão do farelo de cacau não promoveu diferença nos consumos de matéria seca, proteína bruta e fibra em detergente neutro, no ganho de peso médio diário,na conversão alimentar e digestibilidade dos nutrientes. O consumo de fibra em detergente ácido aumentou linearmente com a inclusão do farelo de cacau na dieta. PALAVRAS-CHAVE: Alimentação, concentrado, confinamento, ruminante, subproduto.

  16. Comparison of polyphenol concentration and composition between genetically diverse cacao (Theobroma cacao L.) accessions selected for high yield and disease resistance

    Science.gov (United States)

    There is abundant evidence that consumption of cacao and dark chocolate promotes human health and that the main cacao components contributing positive health effects are polyphenols. The polyphenols in cacao bean constitute 12–18% dry weight of the whole bean and are predominantly catechins (37% w/w...

  17. Caracterización de cultivares de cacao (Theobroma cacao L) por su respuesta de defensa a Moniliophthora roreri y su polimorfismo de SSRs

    OpenAIRE

    Martínez Botello, Darwin Hernando

    2015-01-01

    La moniliasis del Cacao producida por Moniliophthora roreri, es un hongo basidiomiceto considerado como la enfermedad potencial más limitante de la producción en el cultivo en Colombia. La respuesta de defensa frente a su infección actualmente es considerada como susceptible en todos los materiales comerciales utilizados para el cultivo en el mundo. En Colombia, recientemente se han identificado algunos materiales regionales con un comportamiento fitosanitario en campo favorabl...

  18. Heavy metal accumulations in cacao (Theobroma cacao L.) leaves and cocoa beans grown at three main cacao growing regions of Peru

    Science.gov (United States)

    Peru is one of the leading exporters of organic cocoa beans in the world. However, the accumulation of heavy metals in cacao beans represents a considerable quality problem. The aim of this study was to investigate the distribution and accumulation of heavy metals in cacao plants grown at three dif...

  19. Processo de alcalinização dos "nibs" de cacau (Theobroma cacao L.) e avaliação da qualidade do pó

    OpenAIRE

    Eliete da Silva Bispo

    1999-01-01

    Resumo: Com o lançamento de novos produtos, que vem ocorrendo nos últimos anos, em virtude de fatores como o desenvolvimento tecnológico, crescimento da concorrência externa, competitividade do setor e exigência do consumidor, que incorporou novos valores às suas preferências, as indústrias do Brasil, estão necessitando aprimorar o processo de desenvolvimento de novos produtos, visando uma velocidade de lançamento cada vez maior, de maneira mais econômica e eficiente. Diante deste cenário, a...

  20. Estudo do melhoramento do sabor de cacau (Theobroma cacao L.) atraves de ação enzimatica durante a fermentação

    OpenAIRE

    Marinalda da Silva Soares

    2001-01-01

    Resumo: A fermentação das sementes de cacau é uma atividade indispensável para o desenvolvimento dos precursores do aroma de chocolate. Durante essa etapa a polpa que envolve as sementes é metabolizada por microrganismos, produzindo, principalmente, etanol e ácido acético, que são absorvidos pelos cotilédones causando a morte da semente e promovendo alterações físico-químicas importantes na constituição do sabor. Entre essas, pode-se ressaltar a formação de aminoácidos e açúcares redutores li...

  1. OBTAINING AND USE OF POLYPHENOLOXIDASE ENZYME EXTRACTED FROM RIPE CUSTARD APPLE (Annona squamosa L.) PULP ON THE COCOA (Theobroma cacao L.) NIBS IN TASTE IMPROVEMENT

    OpenAIRE

    LIMA, ELIZA DOROTEA POZZOBON DE ALBUQUERQUE; PASTORE, GLÁUCIA MARIA; BARBERY, SANDRA DRINA FERNANDEZ; GARCIA, NELSON HORÁCIO PEZOA; BRITO, EDY SOUSA DE; LIMA, CARLOS ALBERTO DE ALBUQUERQUE

    2001-01-01

    O presente trabalho teve como objetivo estudar a obtenção e a utilização da enzima polifenoloxidase (PPO) extraída de polpa de pinha madura na redução do teor de compostos polifenólicos com a finalidade de diminuir a adstringência e o amargor das amêndoas de cacau processadas na forma de "nibs". A PPO foi extraída com tampão fosfato de potássio 0,025M (pH 7,5), adicionando sulfato de amônio para a precipitação da enzima. O material em pó obtido foi denominado de enzima parcialmente purificada...

  2. Estudo do melhoramento do sabor de cacau (Theobroma cacao L.) utilizando polifenoloxidase extraida da pinha (Annona squamosa L.) e tratamento termico não convencional

    OpenAIRE

    Sandra Drina Fernandez Barbery

    1999-01-01

    Resumo: Existem grandes diferenças no sabor de cacau dependendo de sua origem de produção, certas regiões produzem amêndoas com excessivo sabor ácido e amargo e forte adstringência. Em geral as amêndoas de cacau produzidas no Brasil e na Malásia, têm apresentado teores excessivos de acidez comparados com amêndoas provenientes do leste africano, por este motivo estas amêndoas são utilizadas em quantidades limitadas nas formulações. A presença do ácido acético e láctico seja de forma individual...

  3. The effectiveness of betel leaf (Piper betle Linn extract gel and cocoa bean (Theobroma cacao L extract gel application against the hardness of enamel surface in vitro.

    Directory of Open Access Journals (Sweden)

    Juni Jekti Nugroho

    2017-04-01

    Full Text Available Objective : Nowadays several ways  have been evolved  to increase the hardness of the enamel surface as an effort to prevent caries. One of the alternatives that can be used is application of gel with herbal basic material. Material and Methods : The use of herbal basic material is preferred by people because the side effects are relatively small compared to synthetic drugs. Piper betle and cocoa beans are medicinal plants that is often used by people to inhibit caries. This is because piper betle and cocoa beans contain hardness that may influence the enamel surface. The purpose of this research was to determine the effect of piper betle extract gel and cocoa bean extract gel against the hardness of enamel surface. The samples, maxillary first premolar teeth, which has been extracted and does not have caries, were divided into 3 treatment groups: piper betle extract gel, cocoa bean extract gel, and distilled water as a negative control. Each treatment group consisted of 8 samples. The samples are decoronated in cemento-enamel junction (CEJ areas and planted on orthoplast blocks with labial surface facing up. Samples were applied in labial enamel surface to 5, 15 and 35 minutes period times. Samples before and after the application in each treatment group were measured using Universal Hardness Tester. Data were collected and analyzed using ANNOVA Repeated test. Results : Showed there were significant differences (p 0.05 of enamel surface hardness before and after the application of piper betel extract gel and distilled water. Conclusion : Therefore it can be concluded that cocoa been extract gel is more effective to increase the hardness of email surface.

  4. Evaluación microbiológica y sensorial de fermentados de pozol blanco, con cacao (Theobroma cacao y coco (Cocos nucifera

    Directory of Open Access Journals (Sweden)

    Román Jiménez Vera

    2010-07-01

    Full Text Available El pozol es una bebida de maíz que se consume en el sureste de México y en algunos países de Centroamérica. Se puede consumir recién elaborado o fermentado. Tradicionalmente se consume solo (pozol blanco, aunque también es común agregarle cacao o coco. En este trabajo se evaluaron cambios microbiológicos durante la fermentación natural a temperatura ambiental, de tres tipos de pozol: blanco, con cacao y coco. La concentración de bacterias coliformes disminuyó a partir del tercer día de fermentación y a los 12 días se obtuvo una concentración de 2,20 log UFC/g. En las bacterias lácticas se observó el mayor crecimiento; ellas alcanzaron una concentración de 8,00 log UFC/g a los 3 días de fermentación que se mantuvo durante los 9 días siguientes. Se realizaron pruebas de nivel de agrado y preferencia con 31 jueces consumidores. La adición de ingredientes como el cacao o el coco no mejoraron el nivel de agrado entre los consumidores evaluados (p > 0,05. El pozol blanco y fresco fue el preferido (32 %. En el futuro, estos resultados pueden ser utilizados para clasificar al pozol como una bebida funcional, debido a la presencia de bacterias lácticas en concentración similar a la encontrada en el yogur.

  5. Production of bioplastic from jackfruit seed starch (Artocarpus heterophyllus) reinforced with microcrystalline cellulose from cocoa pod husk (Theobroma cacao L.) using glycerol as plasticizer

    Science.gov (United States)

    Lubis, M.; Gana, A.; Maysarah, S.; Ginting, M. H. S.; Harahap, M. B.

    2018-02-01

    The production of bioplastic from jackfruit seed starch reinforced with microcrystalline cellulose (MCC) cocoa pod husk using glycerol as plasticizer was investigated to determine the most optimum mass and volume of MCC and glycerol in producing bioplastics. To produce MCC, Cocoa pod husk was subjected to alkali treatment, bleaching, and hydrochloric acid hydrolysis. The degree of crystallinity of MCC, were determined by XRD, functional group by FT-IR and morphologycal analysis by SEM. Analysis of bioplastic mechanical properties includes tensile strength and elongation at break based on ASTM D882 standard. Bioplastics were produced by casting method from jackfruit seed starch and reinforced with MCC from cocoa pod husk at starch mass to MCC ratio of 6:4, 7:3, 8:2, and 9:1, using glycerol as plasticizer at 20%, 25%, 30% (wt/v of glycerol to starch). From the result, the isolated MCC from cocoa pod husk were in a form of rod-like shape of length 5-10 µm with diameter 11.635 nm and 74% crystallinity. The highest tensile strength of bioplastics was obtained at starch to MCC mass ratio of 8:2, addition of 20% glycerol with measured tensile strength of 0.637 MPa and elongation at break of 7.04%. Transform infrared spectroscopy showed the functional groups of bioplastics, which the majority of O-H groups were found at the bioplastics with reinforcing filler MCC that represented substantial hydrogen bonds.

  6. The content of polyphenolic compounds in cocoa beans (Theobroma cacao L.), depending on variety, growing region, and processing operations: a review.

    Science.gov (United States)

    Oracz, Joanna; Zyzelewicz, Dorota; Nebesny, Ewa

    2015-01-01

    Polyphenols form the largest group of compounds among natural antioxidants, which largely affect the overall antioxidant and anti-free radical activity of cocoa beans. The qualitative and quantitative composition of individual fractions of polyphenolic compounds, even within one species, is very diverse and depends on many factors, mainly on the area of cocoa trees cultivation, bean maturity, climatic conditions during growth, and the harvest season and storage time after harvest. Thermal processing of cocoa beans and cocoa derivative products at relatively high temperatures may in addition to favorable physicochemical, microbiological, and organoleptic changes result in a decrease of polyphenols concentration. Technological processing of cocoa beans negatively affects the content of polyphenolic compounds.

  7. Analysis of community income on suren (Toona sureni (Blume) Merr.) and cacao crops (Theobroma cacao L.) in Simalungun, North Sumatera-Indonesia

    Science.gov (United States)

    Latifah, S.; Afifuddin, Y.; Widya, S.

    2018-02-01

    Agroforestry is the management and integration of trees, crops and/or livestock on the same plot of land and can be an integral component of productive agriculture. It may include existing native forests and forests established by landholders. The study was conducted in Mekar Sari Raya village, Panei sub, Simalungun regency, North Sumatera. This study aims to gain the ability to use agroforestry in suren crops and cocoa that provides benefits to farmers and the feasibility of the model farm. The study site has Net Present Value (NPV) is 2,670,306,905 ( IDR) for 15 of year, Gross B/C Ratio (BCR) is 2.3; Internal Rate of Return ( IRR) is 28 %; and Payback Period (PP) for 5 years 4 months 24 days. Agroforestry using commodities cacao and suren crops are financially feasible to be cultivated and developed.

  8. Successful pod infections by Moniliophthora roreri result in differential Theobroma cacao gene expression depending on the clone’s level of tolerance

    Science.gov (United States)

    As many of the tolerant cacao clones are slowly losing the tolerance against Frosty pod rot (FPR) caused by Moniliophthora roreri, the knowledge of this tolerance at the molecular level can help to generate more stable tolerant clone against FPR. RNA-Seq analysis was carried out to obtain a comparat...

  9. Evaluación de fungicidas sistémicos y de contacto en el control de la moniliasis (Moniliophthora roreri) del cacao (Theobroma cacao).

    OpenAIRE

    Quevedo Damián, Isaí

    2012-01-01

    La moniliasis causada por Moniliophthora roreri, es una de las enfermedades más destructivas del cacao en América. Afecta exclusivamente al fruto en cualquier etapa de desarrollo, causando pérdidas de hasta el 100% de la producción. Las prácticas culturales han sido el método más aplicado para el combate de la enfermedad, por lo que la selección de fungicidas adecuados contra M. roreri que puedan ser incluidos en programas de manejo de la enfermedad. El objetivo de la presente investigación f...

  10. Development of a nopal fiber (Opuntia ficus-indica and powdered cocoa (Theobroma cacao added beef patties, nutritive, physicochemical and sensory characteristics

    Directory of Open Access Journals (Sweden)

    F.H. Chamorro-Ramirez

    2013-12-01

    Full Text Available The objective of this work was to evaluate addition effect of 3% of nopal fiber (FN and cacao powder (CA on the physicochemical, nutritional content and sensory acceptation of patty meat. A total of 144 patties were elaborated in three different batches: Control (TC no addition; FN with 3% of FN; and CA with 3% of CA. Physicochemical tests (pH, Aw, texture (TPA and instrumental color (CIE-Lab at different storage times (0, 2, 7, 14 and 28 days, besides to nutritional content and acceptation test. pH increased in all the treatments at 28 days of storage, where CA addition decreased luminosity (P>0.05 and maintained higher a* values (P0.05. FN or CA addition increased fiber content (P<0.05. Patties with FN showed a moderate acceptation. Since addition of FN or CA did not decreased consumer acceptation, these can be employed as ingredients in the development of functional foods.

  11. Impacto de las condiciones de beneficio sobre los compuestos precursores de aroma en granos de cacao (Theobroma cacao L del clon CCN-51.

    Directory of Open Access Journals (Sweden)

    Andrea Pallares Pallares

    2016-01-01

    Full Text Available Abstract The influence of the days of fermentation and drying in the aroma compounds (volatile fraction of cocoa beans CCN-51 was evaluated. The method used was Gas ChromatographyMass Spectrometry, coupled to Head Space Solid Phase Micro Extraction (HS-SPMEGC-GS. A multifactorial experimental design was created, containing 15 experiments per repetition. The fermentation technique was microfermentation in boxes, while drying was achieved by exposing the samples to the sun. A Principal Component Analysis (PCA allowed to explain 68% of the total variability associated with aroma characteristics (volatile compounds. Both, desirable and undesirable compounds were identified throughout the processes of fermentation and drying. The benefit process (fermentation and drying was divided in stages depending on the degree of fermentation. The desirable compounds identified were: 3-methy-1-butanol, 2-phenyl-ethanol, benzaldehyde, phenyl acetaldehyde, ethylhexanoate, ethyl benzoate, ethylphenyl acetate and 2-phenyl ethyl acetate, which are associated with odoriferous notes very nice (chocolate, candy, sweet, nutty, honey, fruity, floral. Finally, a pre-treatment of cocoa beans CCN-51 prior to fermentation was proposed to be incorporated during the benefit of the beans as it seems to enhance the formation of desirable aroma compounds.

  12. SISTEM PENDUKUNG KEPUTUSAN TEKNOLOGI PENANGANAN DAN KELAYAKAN INVESTASI PASCAPANEN KAKAO (Theobroma cacao L. (STUDI KASUS DI KABUPATEN PIDIE JAYA, PROPINSI ACEH

    Directory of Open Access Journals (Sweden)

    Raida Agustina

    2013-06-01

    Full Text Available Cocoa beans produced by smallholders have low quality because of gaps in information on post-harvest tecnology. Information is needed to provide decision-support making for choosing one alternative implementation of the handling technology cocoa most appropriate and in accordance with the conditions of its territory which can improve the quality of dried cocoa beans. The purpose of this study was developed an  decision-support system software as a tool for decision making cocoa post-harvest handling, obtain the best alternative based on technical analysis and economic analysis, evaluate the feasibility of investment, and know the value of the sensitivity of each alternative. This study was carried out from July to December 2010 in Bandar Baru sub district, Pidie Jaya district of Aceh province. Survey and interview were used to collecting data. Collected data used to create a database for a decision-support system model of cocoa post-harvest handling technology, which was processed using  the Java programming language. Based on the analysis post harvest technology of cocoa to farmers and investors indicated a mechanical alternative is the best alternative because it produces the greatest benefits. Mechanical alternative  gives farmers a profit of Rp.1,419,279,165 per year and gives investors a profit of Rp. 1,023,246,397 per year and feasibility analysis shows NPV Rp 923,577,155 and the value of R/C ratio of 3 is also available in mechanical alternative. The results of sensitivity analysis on each alternative show that the most influential variables on the profitability of farmers and investors is wage labor, the price of fresh cacao fruit, and the price of dry beans. Keywords: Decision-support system, information, cocoa, post harvest technology   ABSTRAK Biji kakao yang dihasilkan perkebunan rakyat memiliki mutu yang rendah karena adanya kesenjangan dalam informasi mengenai teknologi penanganan pascapanen. Informasi dibutuhkan untuk memberi dukungan bagi pengambil keputusan dalam  memilih salah satu alternatif yang tepat dan sesuai dengan kondisi wilayahnya sehingga bisa meningkatkan kualitas biji kering kakao. Tujuan penelitian ini adalah membangun sebuah software sistem pendukung keputusan sebagai alat bantu pengambilan keputusan teknologi penanganan pascapanen kakao, memperoleh alternatif terbaik berdasarkan analisis teknis dan analisis ekonomi, mengevaluasi tingkat kelayakan investasi, dan mengetahui nilai sensitivitas dari setiap alternatif. Penelitian ini dilaksanakan pada bulan Juli 2010 sampai dengan bulan Desember 2010 di Kecamatan Bandar Baru, Kabupaten Pidie Jaya, Propinsi Aceh. Metode yang digunakan adalah survey lapangan dan wawancara. Hasil pengambilan data di lapangan dianalisis untuk tujuan penyusunan database model sistem pendukung keputusan teknologi penanganan pascapanen kakao, dan diolah menggunakan bahasa program Java. Berdasarkan hasil analisis teknologi penanganan pascapanen kakao untuk petani dan investor menunjukkan bahwa alternatif mekanis merupakan alternatif terbaik karena menghasilkan keuntungan terbesar. Untuk petani alternatif mekanis  memberikan keuntungan sebesar Rp 1.419.279.165,00 per tahun sedangkan untuk investor keuntungan sebesar Rp 1.023.246.397,00 per tahun  dan analisis kelayakan menunjukkan nilai NPV sebesar Rp 923.577.155,00 dan  nilai R/C ratio sebesar 3,00 juga didapatkan pada alternatif mekanis. Dari hasil analisis sensitivitas pada setiap alternatif, variabel yang paling berpengaruh terhadap keuntungan petani dan  investor adalah upah tenaga kerja, harga buah kakao segar, dan harga biji kering. Kata kunci: Sistem pendukung keputusan, informasi, kakao, teknologi pascapanen

  13. Shade tree diversity and aboveground carbon stocks in Theobroma cacao agroforestry systems: implications for REDD+ implementation in a West African cacao landscape.

    Science.gov (United States)

    Dawoe, Evans; Asante, Winston; Acheampong, Emmanuel; Bosu, Paul

    2016-12-01

    The promotion of cacao agroforestry is one of the ways of diversifying farmer income and creating incentives through their inclusion in REDD+ interventions. We estimated the aboveground carbon stocks in cacao and shade trees, determined the floristic diversity of shade trees and explored the possibility of implementing REDD+ interventions in cacao landscapes. Using replicated multi-site transect approach, data were collected from nine 1-ha plots established on 5 km long transects in ten cacao growing districts in Ghana West Africa. Biomass of cacao and shade trees was determined using allometric equations. One thousand four hundred and one (1401) shade trees comprising 109 species from 33 families were recorded. Total number of species ranged from 34 to 49. Newbouldia laevis (Bignoniacea) was the most frequently occurring specie and constituted 43.2 % of all shade trees. The most predominant families were Sterculiaceae and Moraceae (10 species each), followed by Meliaceae and Mimosaceae (8 species each) and Caesalpiniacaea (6 species). Shannon diversity indices (H', H max and J') and species richness were low compared to other similar studies. Shade tree densities ranged from 16.2 ± 3.0 to 22.8 ± 1.7 stems ha -1 and differed significantly between sites. Carbon stocks of shade trees differed between sites but were similar in cacao trees. The average C stock in cacao trees was 7.45 ± 0.41 Mg C ha -1 compared with 8.32 ± 1.15 Mg C ha -1 in the shade trees. Cacao landscapes in Ghana have the potential of contributing to forest carbon stocks enhancement by increasing the stocking density of shade trees to recommended levels.

  14. Near infra-red characterization of changes in flavan-3-ol derivatives in cocoa (Theobroma cacao L.) as a function of fermentation temperature.

    Science.gov (United States)

    Hue, Clotilde; Brat, Pierre; Gunata, Ziya; Samaniego, Ivan; Servent, Adrien; Morel, Gilles; Kapitan, André; Boulanger, Renaud; Davrieux, Fabrice

    2014-10-15

    Flavan-3-ols were successfully extracted from cocoa by the Fast-Prep device and analyzed by HPLC-DAD, and their identifications were confirmed by injection of authentic standards. (-)-Epicatechin was the most abundant component with an average of 9.4 mg/g dried cocoa powder. More than 700 cocoa samples were used to calibrate the NIRS. An efficient calibration model was developed to accurately determine any flavan-3-ol compound of ground dried cocoa beans (SEP = 2.33 mg/g in the case of total flavan-3-ols). This performance enabled NIRS to be used as an efficient and easy-to-use tool for estimating the level of targeted compounds. The analysis of the PLS loadings of the model and pure epicatechin spectra gave proof that NIRS was calibrated on an indirect strong correlation resulting in the changes in flavan-3-ols during fermentation and their interaction with some major components, such as proteins. Total flavan-3-ol concentration fell from an average of 33.3 mg/g for unfermented samples to an average of 6.2 mg/g at the end of fermentation. Changes in flavan-3-ol content were dependent upon the origin and highly correlated to the fermentation level expressed as the sum of temperatures (average R(2) = 0.74), a good marker of the fermentation process and of the heterogeneity of the batch.

  15. Theobroma cacao L., "The food of the gods": Quality determinants of commercial cocoa beans, with particular reference to the impact of fermentation

    NARCIS (Netherlands)

    Líma, L.J.R.; Almeida, M.H.; Nout, M.J.R.; Zwietering, M.H.

    2011-01-01

    The quality of commercial cocoa beans, the principal raw material for chocolate production, relies on the combination of factors that include the type of planting material, the agricultural practices, and the post-harvest processing. Among these, the fermentation of the cocoa beans is still the most

  16. Multi-element, multi-compound isotope profiling as a means to distinguish the geographical and varietal origin of fermented cocoa (Theobroma cacao L.) beans.

    Science.gov (United States)

    Diomande, Didier; Antheaume, Ingrid; Leroux, Maël; Lalande, Julie; Balayssac, Stéphane; Remaud, Gérald S; Tea, Illa

    2015-12-01

    Multi-element stable isotope ratios have been assessed as a means to distinguish between fermented cocoa beans from different geographical and varietal origins. Isotope ratios and percentage composition for C and N were measured in different tissues (cotyledons, shells) and extracts (pure theobromine, defatted cocoa solids, protein, lipids) obtained from fermented cocoa bean samples. Sixty-one samples from 24 different geographical origins covering all four continental areas producing cocoa were analyzed. Treatment of the data with unsupervised (Principal Component Analysis) and supervised (Partial Least Squares Discriminant Analysis) multiparametric statistical methods allowed the cocoa beans from different origins to be distinguished. The most discriminant variables identified as responsible for geographical and varietal differences were the δ(15)N and δ(13)C values of cocoa beans and some extracts and tissues. It can be shown that the isotope ratios are correlated with the altitude and precipitation conditions found in the different cocoa-growing regions. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Changes in physical and chemical characteristics of fermented cocoa(Theobroma cacaobeans with manual and semi-mechanized transfer, between fermentation boxes

    Directory of Open Access Journals (Sweden)

    Pedro. P. Peláez

    2016-01-01

    Full Text Available The aim of this study was to evaluate variation in the physical and chemical properties of fermented cocoa beans with cocoa beans transfer between wooden fermentation boxes manually (M and semi - mechanized (SM way. Mass temperature, moisture, pH, and total acidity of the cotyledon and pulp; the total polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content in fresh, fermented, and dried beans; and percentage of fermented beans and time required to move beans during fermentation were determined. The cocoa used grew in the Pachiza district of the San Martin region of Peru. Cocoa sampling w as each 0, 48, 72, 96, 120, 144, and 168 h of fermentation. The cocoa mass temperature was highest with both removal systems after 96 h of fermentation. M cotyledon and pulp samples had the highest moisture content and titratable acidity, while cotyledon a nd pulp pH with both systems were statistically equal. In contrast, fermented beans had a higher polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content with SM. SM produced the greatest amount of fermentation (91.67% and required the s hortest amount of time to move beans (78.56 min. In conclusion, the system of fermentation of cocoa beans with SM was faster and produced fermented grains with high chemical quality.

  18. Major phytopathogens and strains from cocoa (Theobroma cacao L.) are differentiated by MALDI-MS lipid and/or peptide/protein profiles.

    Science.gov (United States)

    Dos Santos, Fábio Neves; Tata, Alessandra; Belaz, Kátia Roberta Anacleto; Magalhães, Dilze Maria Argôlo; Luz, Edna Dora Martins Newman; Eberlin, Marcos Nogueira

    2017-03-01

    Phytopathogens are the main disease agents that promote attack of cocoa plantations in all tropical countries. The similarity of the symptoms caused by different phytopathogens makes the reliable identification of the diverse species a challenge. Correct identification is important in the monitoring and management of these pests. Here we show that matrix-assisted laser desorption ionization mass spectrometry (MALDI-MS) in combination with multivariate data analysis is able to rapidly and reliably differentiate cocoa phytopathogens, namely Moniliophthora perniciosa, Phytophthora palmivora, P. capsici, P. citrophthora, P. heveae, Ceratocystis cacaofunesta, C. paradoxa, and C. fimbriata. MALDI-MS reveals unique peptide/protein and lipid profiles which differentiate these phytopathogens at the level of genus, species, and single strain coming from different hosts or cocoa tissues collected in several plantations/places. This fast methodology based on molecular biomarkers is also shown to be sufficiently reproducible and selective and therefore seems to offer a suitable tool to guide the correct application of sanitary defense approaches for infected cocoa plantations. International trading of cocoa plants and products could also be efficiently monitored by MALDI-MS. It could, for instance, prevent the entry of new phytopathogens into a country, e.g., as in the case of Moniliophthora roreri fungus that is present in all cocoa plantations of countries bordering Brazil, but that has not yet attacked Brazilian plantations. Graphical Abstract Secure identification of phytopathogens attacking cocoa plantations has been demonstrated via typical chemical profiles provided by mass spectrometric screening.

  19. Enzymatic activity of proteases and its isoenzymes in fermentation process in cultivars of cocoa (Theobroma cacao L. produced in southern Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Luciane Santos SOUSA

    Full Text Available Abstract The fermentation of cocoa seeds envolves microbial processes and the action of enzymes. To identify the possible differences in the cocoa fermentation process, with regards to proteolysis, this study has the objective of determining protease activity (under predetermined conditions and its isoenzymes in two cocoa cultivars (PH-16 and HRT-1188 in different cocoa fermentation times, in addition to establishing the microbial load (molds and yeasts and aerobic mesophilic. Protease and its isoenzymes were extracted and partially purified and the enzymatic activities determined by spectrophotometry. The results showed that the proteases activity was higher at 66h of fermentation for both cultivars. When the isoenzymes activity was evaluated, the results demonstrated similar activity behavior for both cultivars, with regards to the isoenzymes aminopeptidase and carboxypeptidase, although the behavior of the endoprotease isoenzyme activity proved to be a little different for TSH-1188 cultivar. Concerning microbiological analyses, the results indicate that the period after molds and yeast counting reduction is consistent with the period of protease activity increase.

  20. Identification of candidate genes involved in Witches' broom disease resistance in a segregating mapping population of Theobroma cacao L. in Brazil.

    Science.gov (United States)

    Royaert, Stefan; Jansen, Johannes; da Silva, Daniela Viana; de Jesus Branco, Samuel Martins; Livingstone, Donald S; Mustiga, Guiliana; Marelli, Jean-Philippe; Araújo, Ioná Santos; Corrêa, Ronan Xavier; Motamayor, Juan Carlos

    2016-02-11

    Witches' broom disease (WBD) caused by the fungus Moniliophthora perniciosa is responsible for considerable economic losses for cacao producers. One of the ways to combat WBD is to plant resistant cultivars. Resistance may be governed by a few genetic factors, mainly found in wild germplasm. We developed a dense genetic linkage map with a length of 852.8 cM that contains 3,526 SNPs and is based on the MP01 mapping population, which counts 459 trees from a cross between the resistant 'TSH 1188' and the tolerant 'CCN 51' at the Mars Center for Cocoa Science in Barro Preto, Bahia, Brazil. Seven quantitative trait loci (QTL) that are associated with WBD were identified on five different chromosomes using a multi-trait QTL analysis for outbreeders. Phasing of the haplotypes at the major QTL region on chromosome IX on a diversity panel of genotypes clearly indicates that the major resistance locus comes from a well-known source of WBD resistance, the clone 'SCAVINA 6'. Various potential candidate genes identified within all QTL may be involved in different steps leading to disease resistance. Preliminary expression data indicate that at least three of these candidate genes may play a role during the first 12 h after infection, with clear differences between 'CCN 51' and 'TSH 1188'. We combined the information from a large mapping population with very distinct parents that segregate for WBD, a dense set of mapped markers, rigorous phenotyping capabilities and the availability of a sequenced genome to identify several genomic regions that are involved in WBD resistance. We also identified a novel source of resistance that most likely comes from the 'CCN 51' parent. Thanks to the large population size of the MP01 population, we were able to pick up QTL and markers with relatively small effects that can contribute to the creation and selection of more tolerant/resistant plant material.

  1. Optimization of Culture Medium for the Growth of Candida sp. and Blastobotrys sp. as Starter Culture in Fermentation of Cocoa Beans (Theobroma cacao) Using Response Surface Methodology (RSM).

    Science.gov (United States)

    Mahazar, N H; Zakuan, Z; Norhayati, H; MeorHussin, A S; Rukayadi, Y

    2017-01-01

    Inoculation of starter culture in cocoa bean fermentation produces consistent, predictable and high quality of fermented cocoa beans. It is important to produce healthy inoculum in cocoa bean fermentation for better fermented products. Inoculum could minimize the length of the lag phase in fermentation. The purpose of this study was to optimize the component of culture medium for the maximum cultivation of Candida sp. and Blastobotrys sp. Molasses and yeast extract were chosen as medium composition and Response Surface Methodology (RSM) was then employed to optimize the molasses and yeast extract. Maximum growth of Candida sp. (7.63 log CFU mL-1) and Blastobotrys sp. (8.30 log CFU mL-1) were obtained from the fermentation. Optimum culture media for the growth of Candida sp., consist of 10% (w/v) molasses and 2% (w/v) yeast extract, while for Blastobotrys sp., were 1.94% (w/v) molasses and 2% (w/v) yeast extract. This study shows that culture medium consists of molasses and yeast extract were able to produce maximum growth of Candida sp. and Blastobotrys sp., as a starter culture for cocoa bean fermentation.

  2. Theobroma cacao L., "The food of the Gods": quality determinants of commercial cocoa beans, with particular reference to the impact of fermentation.

    Science.gov (United States)

    Lima, Lídia J R; Almeida, M Helena; Nout, M J Rob; Zwietering, Marcel H

    2011-09-01

    The quality of commercial cocoa beans, the principal raw material for chocolate production, relies on the combination of factors that include the type of planting material, the agricultural practices, and the post-harvest processing. Among these, the fermentation of the cocoa beans is still the most relevant since it is the process whereby the precursors of the cocoa flavor arise. The formation of these precursors depends on the activity of different microbial groups on the beans pulp. A comparison of fermentations in different countries showed that a well-defined microbial succession does not always take place and that the role of Bacillus spp. in this process remains unclear. Considering the overriding importance of the fermentation to achieve high quality commercial cocoa beans, we discuss the need of addressing the impact of the farming system, the ripeness state of the pods, and the role of microbial interactions on the fermentation in future research. In addition, the problem of high acidification cocoa beans, aspects dealing with the volatile fraction of the flavor, and the cocoa butter properties, all were identified as critical aspects that need further investigation. The standardization of the microbiological methods and the application of metagenomic approaches would magnify the knowledge in this domain.

  3. Flavor Profile of Clone CCN 51 Cocoa (Theobroma cacao L. Produced in Three Farms Municipality of San Vicente de Chucurí

    Directory of Open Access Journals (Sweden)

    Lucas Fernando Quintana Fuentes

    2011-04-01

    Full Text Available Colombia is one of the bigger producers of cocoa in America, the production is consumed in the totally in internal form. The department of Santander is me bigger producer of cocoa in Colombia and the municipality of San Vicente de Chucuri is considered the cocoa capital of the country. Actually theColombian federation of cocoa (Fedecacao together with the Unad have an agreement of cooperation for the strengthening of the evaluating capacity of the sensorial quality of the cocoa.In the process of evaluation of the sensorial quality of the cocoa liqueur (clone CNN 51 we established the needs in accordance to the current regulations for the implementation of a panel of trained judges, from the preselection, selection, specific training, training evaluation and the evaluation of the final samples ofthree representative farms in where is cultivated the clone CCN 51 in San Vicente del Chucuri.We conform a group of eleven trained judges and we obtained the sensorial profile of flavor for the samples for three representative farms of the municipality.

  4. ESTUDO PROSPECTIVO DA FERMENTAÇÃO DO CACAU (Theobroma cacao L. SOB O ENFOQUE EM PEDIDOS DE PATENTES DEPOSITADOS NO MUNDO ENTRE 1899 A 2012

    Directory of Open Access Journals (Sweden)

    Adrielle Souza Leão Macêdo

    2014-07-01

    Full Text Available O cacaueiro tem importância econômica no contexto internacional por ser um commodity de participação relevante no comércio mundial de produtos agrícolas tanto em importações quanto exportações. As etapas de beneficiamento do cacau, principalmente a fermentação, devem ser conduzidas com excelência para garantir a  uniformidade das amêndoas de cacau e chocolates de alta qualidade. Este estudo tem por objetivo identificar patentes depositadas que tratam de  fermentação  do cacau. A pesquisa foi realizada nas bases de Espacenet (EP, utilizando como palavras-chave cocoa*and fermentation*. Foram encontradas 75 patentes depositadas nessa base de dados e nenhuma no Brasil (INPI. Observou-se que nos anos de 1991 e 2012, foram depositadas 48 patentes de novas tecnologias, métodos e equipamentos aplicáveis ao processo de fermentação de cacau, provavelmente pelo incentivo recebido pelos pesquisadores das áreas. O Reino Unido, Rússia e Estados Unidos, apesar de não produzir cacau, apresentam-se como países com maior investimento em relação à esta tecnologia de processamento.

  5. Flavor Profile of Clone CCN 51 Cocoa (Theobroma cacao L.) Produced in Three Farms Municipality of San Vicente de Chucurí

    OpenAIRE

    Lucas Fernando Quintana Fuentes; Salomón Goméz Castelblanco

    2011-01-01

    Colombia is one of the bigger producers of cocoa in America, the production is consumed in the totally in internal form. The department of Santander is me bigger producer of cocoa in Colombia and the municipality of San Vicente de Chucuri is considered the cocoa capital of the country. Actually theColombian federation of cocoa (Fedecacao) together with the Unad have an agreement of cooperation for the strengthening of the evaluating capacity of the sensorial quality of the cocoa.In the proces...

  6. Actividad antioxidante de clones de cacao (Theobroma cacao l.) finos y aromáticos cultivados en el estado de Chiapas-México

    OpenAIRE

    Ramírez González, Martha Beatriz; Cely Niño, Víctor Hugo; Ramírez, Sandra Isabel

    2013-01-01

    Objetivo: determinar la capacidad antioxidante y contenido de grasa de clones de cacao, provenientes de especies nativas del Estado de Chiapas, México. Materiales y métodos: en extractos de 34 muestras semillas de cacao diluidas en metanol al 95% y clasificadas según pH en tres grupos: I (5,52-5,90), II (5,91- 6,28) y III (6,29-6,67), se realizaron ensayos analíticos de variables físicas y químicas. Se evaluó la inhibición de radicales 2,2-difenil-2-picrilhidrazil (DPPH) a 517 nm, el contenid...

  7. ANÁLISIS DE LA ESTRUCTURA ARBÓREA DEL SISTEMA AGROFORESTAL DE CACAO (Theobroma cacao L. EN EL SOCONUSCO, CHIAPAS - MÉXICO

    Directory of Open Access Journals (Sweden)

    Hugo Alexander Roa Romero

    2009-09-01

    Full Text Available Se determinó la abundancia, riqueza, importancia, equidad y diversidad de los árboles encontrados en sistemas agroforestales de cacao, del Soconusco, Chiapas, México. La presente investigación, se desarrolló en la región costera del Soconusco, ubicada al sur del estado de Chiapas; se muestrearon los municipios de Huehuetán, Tapachula y Tuxtla Chico, por ser los más representativos en área sembrada de cacao. En cada municipio, se establecieron al azar siete parcelas temporales de 50 x 50 m cada una, lo que suma en total 5,25 hectáreas, en las cuales se registraron variables como el diámetro a la altura del pecho (DAP: 1,3 m sobre el nivel del suelo, área basal, y sombrío en el cacaotal. Se encontraron 46 especies agrupadas en 21 familias, las especies con el mayor valor de importancia fueron Mangifera indica y Pouteria sapota, convirtiéndose en las especies de sombra más frecuentemente encontradas. La composición florística denotó una mayor similitud en los municipios de Tapachula y Huehuetán, como lo muestra el mayor porcentaje del índice de Jaccard y en lo que respecta a diversidad, el municipio de Tuxtla Chico presentó el mayor valor según el índice de Shannon. Este estudio determina la existencia de una cobertura definitiva de preferencia asociada a los árboles frutales.

  8. First typology of cacao (Theobroma cacao L.) systems in Colombian Amazonia, based on tree species richness, canopy structure and light availability

    Science.gov (United States)

    Suárez Salazar, Juan Carlos; Melgarejo, Luz Marina; Di Rienzo, Julio A.; Casanoves, Fernando

    2018-01-01

    Aim and background We present a typology of cacao agroforest systems in Colombian Amazonia. These systems had yet to be described in the literature, especially their potential in terms of biodiversity conservation. The systems studied are located in a post-conflict area, and a deforestation front in Colombian Amazonia. Cacao cropping systems are of key importance in Colombia: cacao plays a prime role in post conflict resolution, as cacao is a legal crop to replace illegal crops; cacao agroforests are expected to be a sustainable practice, promoting forest-friendly land use. Material and methods We worked in 50 x 2000 m2 agroforest plots, in Colombian Amazonia. A cluster analysis was used to build a typology based on 28 variables characterised in each plot, and related to diversity, composition, spatial structure and light availability for the cacao trees. We included variables related to light availability to evaluate the amount of transmitted radiation to the cacao trees in each type, and its suitability for cacao ecophysiological development. Main results We identified 4 types of cacao agroforests based on differences concerning tree species diversity and the impact of canopy spatial structure on light availability for the cacao trees in the understorey. We found 127 tree species in the dataset, with some exclusive species in each type. We also found that 3 out of the 4 types identified displayed an erosion of tree species diversity. This reduction in shade tree species may have been linked to the desire to reduce shade, but we also found that all the types described were compatible with good ecophysiological development of the cacao trees. Main conclusions and prospects Cacao agroforest systems may actually be achieving biodiversity conservation goals in Colombian Amazonia. One challenging prospect will be to monitor and encourage the conservation of tree species diversity in cacao agroforest systems during the development of these cropping systems, as a form of forest-friendly management enhancing sustainable peace building in Colombia. PMID:29401499

  9. The effect of fermented cocoa pod (Theobroma cacao) husk supplemented with mineral on in vitro digestibility, rumen bacteria population and rumen liquid characteristics

    Science.gov (United States)

    Nurhaita; Definiati, N.; Santoso, U.; Akbar, S. A.; Henuk, Y. L.

    2018-02-01

    This study aimed to determine the effect of mineral supplementation, such as S, P and Zn on the nutrients digestibility of fermented cocoa pod husk, the population of rumen bacteria and rumen liquid characteristics in vitro. The study used a randomized block design with 5 treatments and 4 replicates. The treatments tested were: T0 = without minerals; T1 = 0.2% S mineral; T2 = 0.27% P mineral; T3 = S and P; and T4 = S, P and Zn at 50 ppm. Parameters measured were: (1) digestibility of dry matter and organic matter; (2) rumen bacterial and cellulolytic bacterial populations; (3) characteristics of rumen liquid in vitro. The results of the study showed that mineral supplementation significantly (P digestibility. Mineral supplementation had no effect on the total population of rumen bacteria and cellulolytic rumen bacterial populations. The characteristics of rumen liquid such pH, VFA and NH3 were in optimal condition. In conclusion supplementation of S, P and Zn simultaneously gave the best results to improve the digestibility of dry matter and organic matter and to maintain rumen liquid characteristics under optimal conditions for growth and microbial activity

  10. First typology of cacao (Theobroma cacao L. systems in Colombian Amazonia, based on tree species richness, canopy structure and light availability.

    Directory of Open Access Journals (Sweden)

    Juan Carlos Suárez Salazar

    Full Text Available We present a typology of cacao agroforest systems in Colombian Amazonia. These systems had yet to be described in the literature, especially their potential in terms of biodiversity conservation. The systems studied are located in a post-conflict area, and a deforestation front in Colombian Amazonia. Cacao cropping systems are of key importance in Colombia: cacao plays a prime role in post conflict resolution, as cacao is a legal crop to replace illegal crops; cacao agroforests are expected to be a sustainable practice, promoting forest-friendly land use.We worked in 50 x 2000 m2 agroforest plots, in Colombian Amazonia. A cluster analysis was used to build a typology based on 28 variables characterised in each plot, and related to diversity, composition, spatial structure and light availability for the cacao trees. We included variables related to light availability to evaluate the amount of transmitted radiation to the cacao trees in each type, and its suitability for cacao ecophysiological development.We identified 4 types of cacao agroforests based on differences concerning tree species diversity and the impact of canopy spatial structure on light availability for the cacao trees in the understorey. We found 127 tree species in the dataset, with some exclusive species in each type. We also found that 3 out of the 4 types identified displayed an erosion of tree species diversity. This reduction in shade tree species may have been linked to the desire to reduce shade, but we also found that all the types described were compatible with good ecophysiological development of the cacao trees.Cacao agroforest systems may actually be achieving biodiversity conservation goals in Colombian Amazonia. One challenging prospect will be to monitor and encourage the conservation of tree species diversity in cacao agroforest systems during the development of these cropping systems, as a form of forest-friendly management enhancing sustainable peace building in Colombia.

  11. Evaluación del desempeño de un secador solar directo sobre semillas de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Enrique Romero Frasca

    2016-01-01

    Full Text Available Se desarrolló un secador solar directo con un diseño basado en dispositivos deshidratadores rudimentarios de uso regular, en granjas cacaoteras de Tabasco; con el objetivo de evaluar su desempeño en la obtención de cacao seco con- forme a la NMX-F-352-S-1980, mediante una exposición a luz solar durante cuatro días. Re- sultados: disminución paulatina del contenido de humedad hasta en un 7.50%, en promedio, en un producto con valor comercial a insertarse en el mercado.

  12. Changes in physical and chemical characteristics of fermented cocoa (Theobroma cacao beans with manual and semi-mechanized transfer, between fermentation boxes

    Directory of Open Access Journals (Sweden)

    Pedro. P. Peláez

    2016-06-01

    Full Text Available The aim of this study was to evaluate variation in the physical and chemical properties of fermented cocoa beans with cocoa beans transfer between wooden fermentation boxes manually (M and semi-mechanized (SM way. Mass temperature, moisture, pH, and total acidity of the cotyledon and pulp; the total polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content in fresh, fermented, and dried beans; and percentage of fermented beans and time required to move beans during fermentation were determined. The cocoa used grew in the Pachiza district of the San Martin region of Peru. Cocoa sampling was each 0, 48, 72, 96, 120, 144, and 168 h of fermentation. The cocoa mass temperature was highest with both removal systems after 96 h of fermentation. M cotyledon and pulp samples had the highest moisture content and titratable acidity, while cotyledon and pulp pH with both systems were statistically equal. In contrast, fermented beans had a higher polyphenol, anthocyanin, reducing sugar, theobromine, and caffeine content with SM. SM produced the greatest amount of fermentation (91.67% and required the shortest amount of time to move beans (78.56 min. In conclusion, the system of fermentation of cocoa beans with SM was faster and produced fermented grains with high chemical quality.

  13. El polisulfuro de calcio en el manejo de la moniliasis Moniliophthora roreri (Cif & Par. Evans et al. del cacao Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Sandra Ramírez González

    2011-05-01

    Full Text Available El cacao es severamente afectado por el hongo Moniliophthora roreri (Cif & Par. Evans et al., el cual daña los frutos y puede ocasionar pérdidas totales y su control es principalmente cultural. El objetivo del trabajo es determinar la efectividad del polisulfuro de calcio (PC como alternativa para su manejo. El patógeno fue aislado y cultivado in vitro y se evaluó el efecto del PC sobre la germinación y formación de conidias; en el campo, sobre frutos se asperjó PC antes y después de la inoculación con M. roreri y se determinó la incidencia e índices de severidad interna y externa. En una plantación de cacao se asperjó PC y se determinó su incidencia y producción. El PC in vitro inhibió el crecimiento y la formación de conidias; la aplicación de PC antes o después de la inoculación artificial con M. roreri sobre frutos inhibe completamente el desarrollo de la enfermedad; con aspersiones de PC en plantaciones de cacao la incidencia de la enfermedad fue de 0,53%, mientras que fue de 21% con manejo cultural y del 69,6% con testigo de inoculación natural; la producción de cacao seco/año fue de un 90,6% más con PC que en el testigo de inoculación natural, por lo que resulta viable integrar PC en el manejo deM. roreri.

  14. Eficiencia fisiológica de uso de NPK en clones autoincompatible y autocompatible de cacao (Theobroma cacao L. en Colombia

    Directory of Open Access Journals (Sweden)

    Yina Jazbleidi Puentes-Páramo

    2016-06-01

    Full Text Available La investigación tuvo como objetivo evaluar la eficiencia fisiológica de N-P-K en clones de cacao de sabor y aroma autocompatible (CCN-51, ICS-95 y autoincompatible: (TSH-565, ICS-39, con la finalidad de determinar la capacidad de producción de grano seco por unidad de nutriente absorbido. Se utilizó un diseño en bloques completos al azar con cinco tratamientos y cuatro repeticiones, los tratamientos fueron diseñados a partir del nivel de fertilidad natural del suelo (TR-Tratamiento de referencia y sobre este el 25, 50, 75 y 100% más de Nitrógeno-Fósforo-Potasio (N-P-K, correspondiente al T1, T2, T3 y T4. Los resultados evidencian que hay diferencias altamente significativas entre clones para los nutrientes N-P-K absorbidos, exhibiendo mayor absorción de nitrógeno, seguido de potasio y por ultimo fósforo, en este sentido, el clon autocompatible CCN-51 mostro mayor habilidad de absorción para la mayoría de nutrientes, excepto fósforo, sin embargo, no es generalizada la mayor habilidad para clones autocompatibles con respecto a clones autoincompatibles.  La mayor eficiencia fisiológica de uso de nutrientes N-P-K se presentó en el tratamiento uno y la menor capacidad de producción de grano seco de cacao por unidad de nutriente se presentó con la dosis nutricional más alta en el tratamiento cuatro, lo cual sugiere que a mayor dosis disminuye la eficiencia fisiológica de uso de nitrógeno, fósforo y potasio de los clones.

  15. Associação micorrízica e teores de nutrientes nas folhas de cupuaçuzeiro (Theobroma grandiflorum e guaranazeiro (Paullinia cupana de um sistema agroflorestal em Manaus, Amazonas Arbuscular mycorrhizal association and foliar nutrient concentrations of cupuassu (Theobroma grandiflorum and guaraná (Paullinia cupana plants in an agroforestry system in Manaus, AM, Brazil

    Directory of Open Access Journals (Sweden)

    A. N. Oliveira

    2004-12-01

    Full Text Available As micorrizas arbusculares podem ser importantes na nutrição das plantas em solos ácidos e de baixa fertilidade, como são os da Amazônia de modo geral. Avaliaram-se a colonização radicular por fungos micorrízicos arbusculares (FMAs nativos e os teores de nutrientes em cupuaçuzeiro e guaranazeiro em um sistema agroflorestal no município de Manaus, Amazonas. Dez plantas de cada espécie foram selecionadas, das quais foram coletadas amostras de raiz, folha e solo durante o período seco e chuvoso da região de Manaus. Os guaranazeiros e os cupuaçuzeiros apresentaram maior colonização radicular por FMAs na época chuvosa. Os teores foliares de Ca, Mg, K, P, Zn, Cu e Mn nas duas espécies não foram influenciados pelas épocas de amostragem. O teor de Fe nas folhas dos cupuaçuzeiros foi maior na época chuvosa, enquanto o dos guaranazeiros, na época seca. A colonização micorrízica correlacionou-se com a concentração foliar de Ca, Mg, P e Cu nos cupuaçuzeiros e com a de Ca, Fe, Zn e Cu nos guaranazeiros.Arbuscular mycorrhiza can be important for plant nutrition in acid and low fertility soils such as those of the Amazon. The present study evaluated the mycorrhizal colonization by native arbuscular mycorrhizal fungi (AMF and nutrient concentrations of cupuassu and guarana leaves in an agroforestry system in Manaus, Amazonas State, Brazil. Ten plants of each species were selected, of which the roots, soil and leaves were sampled during the rainy and dry seasons. Guarana and cupuassu trees presented higher levels of AMF colonization during the rainy season. Ca, Mg, K, P, Zn, Cu, and Mn concentrations in both species were not affected by the season. Fe concentration was higher during the rainy season in the cupuassu leaves, but higher in the dry season in the guarana leaves. Mycorrhizal colonization correlated with Ca, Mg, P, and Cu concentrations in cupuassu plants and with Ca, Fe, Zn, and Cu in guarana plants.

  16. Physicochemical characteristcs and enzymatic activity of peroxidase and polyphenoloxidase in four genotypes of cupuaçu (Theobroma grandiflorum Willd ex-Spreng Schum submitted to freezingCaracterísticas físico-químicas e atividade da peroxidase e polifenoloxidase em genótipos de cupuaçu (Theobroma grandiflorum Willd ex-Spreng Schum submetidos ao congelamento

    Directory of Open Access Journals (Sweden)

    Salomão Rocha Martim

    2013-10-01

    Full Text Available During the freezing of fruits pulps, the enzyme activity is not finished completely. Sensory, nutritional and coloring changes may occur on fruits due to the action of oxidative enzymes such as peroxidase and polyphenoloxidase. The frozen cupuaçu pulps, sold in Brazil, have a shelf life of one year and become browned during this period. The aim of this study was to evaluate the effect of frozen storage on the physicochemical characteristics, polyphenoloxidase activity and soluble and ionically bound peroxidases presented in the pulps of four new cupuaçu genotypes over twelve months. The cupuaçu genotypes developed by the West Amazonian Agroforestry Research Center (EMBRAPA were pulped, frozen and stored at – 30 °C. The polyphenoloxidase of the four cupuaçu genotypes showed an increase in activity according to the storage time with peaks in the sixth, ninth and tenth months, but the peroxidases exhibited oscillations in the enzyme activity. The physicochemical properties of the pulps showed variations during the twelve months of storage under freezing. The vitamin C content of D 28-10 and P 3-10 genotypes decreased from the fourth and tenth months, respectively. Moreover P 9-8 e B 28-7 genotypes remained stable. In relation the acidity of citric acid, the B-28-7, D 28-10 and P 9-8 samples were not different, but P 3-10 genotype presented a reduction. The pH and total soluble solids of all genotypes decreased over the study period. There was an increase in sugar concentration of B 28-7, P 3-10 and P 9-8 genotypes, except for D 28-10 sample which remained unchanged. All genotypes were in accordance with physical-chemicals standards required by legislation, except for P 3-10 genotype that showed a lower acidity. In respect of the enzymatic parameters, there were variations in the activity of peroxidase and polyphenoloxidases of all genotypes. No congelamento de polpas de frutas a atividade enzimática não é completamente cessada. Podem ocorrer mudanças sensoriais, nutricionais e de coloração devido à ação de enzimas oxidativas, como a peroxidase e a polifenoloxidase. Considerando que as polpas de cupuaçu congeladas, comercializadas no Brasil, têm um prazo de validade de um ano e tornam-se escurecidas ao longo deste período, objetivou-se neste estudoavaliar o efeito do tempo de congelamento nas características físico-químicas e nas atividades da polifenoloxidase e peroxidases solúvel e insolúvel presentes nas polpas de quatro novos genótipos de cupuaçu, durante doze meses. Os frutos dos genótipos de cupuaçu, desenvolvidos pela Embrapa Amazônia Ocidental, foram despolpados, congelados e armazenados à temperatura de –30 ºC. A polifenoloxidase das polpas dos quatro genótipos apresentou aumento na sua atividade com picos no sexto, nono e décimo mês e as peroxidases apresentaram oscilações na atividade enzimática. As propriedades físico-químicas das polpas apresentaram variações durante os doze meses de armazenamento sob congelamento. O teor de vitamina C dos genótipos D 28-10 e P 3-10 diminuiu a partir do 4º e 10º mês, respectivamente. Por outro lado os genótipos B 28-7 e P 9-8 permaneceram estáveis. Em relação à acidez em ácido cítrico, as amostras B-28-7, D 28-10 e P 9-8 não diferiram, havendo redução no genótipo P 3-10. O valores de pH e sólidos solúveis totais de todos os genótipos diminuíram ao longo do período avaliado. Houve aumento na concentração de açúcares das polpas dos genótipos B 28-7, P 3-10 e P 9-8, com exceção da amostra D 28-10 que permaneceu inalterada. Todos os genótipos apresentaram-se dentro dos padrões físico-químicos exigidos pela legislação, com exceção do genótipo P 3-10 que apresentou acidez inferior. Em relação aos parâmetros enzimáticos, houve variações na atividade das peroxidases e polifenoloxidases de todos os genótipos avaliados.

  17. Influencia de factores agroambientales sobre la calidad del clon de cacao (Theobroma cacao L. PH-16 en la región cacaotera de Bahia, Brasil/Inuence of agro-environmental factors on the quality of cacao (Theobroma cacao L. clone PH-16 in the cacao region of Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Guilherme Amorim Homem de Abreu Loureiro

    2017-09-01

    Full Text Available Los desafíos técnicos y cientícos actuales para el cultivo del cacao implican la necesidad de evaluar múltiples atributos relacionados con la producción primaria y con los criterios de calidad. El estudio se realizó con el clon de cacao PH-16 en la zona húmeda de la región cacaotera de Bahia, Brasil. El objetivo fue conocer la inuencia del sitio de cultivo sobre las variables físicas y químicas antes y después de la fermentación de los granos de cacao. Las variables químicas más inuenciadas por el medio ambiente fueron el pH y la acidez total de los granos con mucílago, y el pH, acidez total e índice de pigmentos de los granos fermentados. El sitio de cultivo que corresponde al Argisol Amarillo Distróco latosólico, en el sistema agroforestal Cabruca con densidad media de 35 árboles de sombra por hectárea, presentó los granos con mejores atributos de calidad.

  18. Studies on the translocation pattern, persistence characteristics and metabolic pathway of sumithion [O, O-dimethyl-O-(3-methyl-4-nitrophenyl) phosphorothioate] in the cocoa tree Theobroma Cacao L; Etudes sur la repartition par translocation, les caracteristiques de persistance et les processus metabolitiques du sumithion [O, O-dimethyl-O-(3-methyl-4-nitrophenyl) phosphorothionate] dans le cacaoyer Theobroma Cacao L

    Energy Technology Data Exchange (ETDEWEB)

    Sundaram, Alamelu; Sundaram, K. M.S. [Department of Chemistry, University of Ghana, Legon (Ghana)

    1970-01-15

    The translocation pattern and metabolic pathway of the contact insecticide sumithion in cocoa trees, following a foliar application, was examined using {sup 32}P-labelled and non-radioactive sumithion. The translocation pattern revealed that initially the radioactivities of bark samples were the highest while those of pod samples (cocoa beans in particular) were the smallest; but in the course of ca. 2,5 months, the radioactivities of bark samples decreased rapidly while those of cocoa beans increased steadily. This shows that {sup 32}P from the insecticide was eventually incorporated into the proteins which tended to be accumulated in the cocoa beans. The chloroform/water partition technique, employed to separate the anticholinesterase agents (sumithion and its oxidation product, sumioxon) from the hydrolysed and/or metabolized product(s), divulged the absence of any measurable radioactivities in the chloroform extract of the bark and xylem samples after a period of 15 days from the date of application, thus indicating that the absorbed sumithion (and also sumioxon) underwent complete degradation within that period. Furthermore, the radioactivities of the water layer decreased with time (within one month) while those of the residue increased, hence indicating that the water- soluble {sup 32}P-materials were converted into water-insoluble materials which were incorporated in the residue. Spectrophotometric and column-chromatographic methods, adopted to detect and to estimate the amounts of anticholinesterase agents in the leaves of the sumithion-treated cocoa seedlings at various intervals after treatment, revealed that sumithion absorbed by the plant (only in very small quantities, 9 ± 3 ppm) underwent complete oxidation within a period of five days after application, because no sumithion was detectable in the plant after this period. Also sumioxon, which was detectable in the plant (in quantities of 15 ± 4 ppm) only after this 5-day period, seemed to have undergone complete degradation within an interval of 10 days after treatment, i. e. within an interval of 5 days after the day from which it was detectable. Thus the presence of anticholinesterase agents in the cocoa plants was shown to be practically nil after a period of 10 days from the date of application. In the present investigation it became evident from the uptake studies that {sup 32}P-materials were detectable in the tree even up to 72 days after the insecticide was applied; the chloroform/water partition technique showed the presence of {sup 32}P-materials in the water layer and in the residue up to 28 days after treatment whereas the spectrophotometric and column-chromatographic techniques were able to detect sumithion and sumioxon only up to 10 days after application. This definitely indicated that during this 10-day period sumithion and sumioxon underwent complete degradation and were hydrolysed into water-soluble phosphoric and substituted phosphoric acid-{sup 32}P which were probably utilised later in the formation of water-insoluble proteins- {sup 32}P of high molecular weights. These proteins- {sup 32}P seem to persist for a considerable length of time in the tree thus accounting for the persistent radioactivity even up to ca. 3 months after application. (author) [French] Les auteurs ont étudié la répartition par translocation et les processus métabolitiques du sumithion, insecticide par contact, dans le cacaoyer, après application foliaire de ce produit, soit ordinaire, soit marqué avec {sup 32}P. La répartition par translocation montre que la radioactivité est initialement le plus élevée dans les échantillons d’écorce et le plus faible dans les échantillons de fruits (fèves de cacao en particulier). Ensuite, pendant environ deux mois et demi, la radioactivité de l'écorce décroît rapidement alors que celle des fèves augmente constamment, ce qui prouve que {sup 32}P de l'insecticide finit par être incorporé dans les protéines qui tendent à s'accumuler dans les fèves de cacao. En séparant les agents anticholinestérasiques (sumithion et son dérivé, le sumioxon) des produits hydrolisés ou métabolisés, par partage chloroforme/eau, on met en évidence 1’ absence de toute radioactivité décelable dans l'extrait chloroformique d'échantillons d'écorce-et de xylème, quinze jours après l'application du radioisotope; on voit ainsi que le sumithion absorbé (de même que le sumioxon) sont complètement dégradés au cours de cette période. En outre, la radioactivité de la couche aqueuse décroît avec le temps (pendant un mois), alors que la radioactivité du résidu augmente, ce qui montre que les substances hydrosolubles contenant {sup 32}P se sont transformées en matières insolubles, incorporées aux résidus. L’ analyse qualitative et quantitative, par spectrophotométrie et Chromatographie sur colonne, des agents anticholinestérasiques dans les feuilles de jeunes, cacaoyers traités au sumithion, â différents intervalles de temps après le traitement, montre que le sumithion absorbé par la plante (en très faible quantité uniquement, 9± 3 ppm) est complètement oxydé au cours des cinq jours suivant l’application, car il n'est plus décelable dans la plante après cette période. Le sumioxon, qui devient décelable dans la plante (en quantités de 15 ± 4 ppm) seulement après cette période de cinq jours, semble être complètement dégradé dans les dix jours suivant le traitement, c’est-à-dire au cours d’une période de cinq jours après le moment où il devient décelable. On peut en conclure que la présence d’agents anticholinestérasiques dans les cacaoyers devient pratiquement nulle dix jours après le traitement. Au cours des recherches, les études sur la translocation ont montré à V évidence que les produits marqués avec {sup 32}P restent décelables dans l'arbre jusqu' à 72 jours après le traitement par l'insecticide. Le partage chloroforme/eau révèle la présence de substances marquées avec {sup 32}P dans la couche aqueuse et dans le résidu jusqu' à 28 jours après le traitement, alors que la spectrophotométrie et la Chromatographie sur colonne ne décèlent le sumithion et le sumioxon que jusqu' à 10 jours après l'application. Il est donc évident qu' au cours de cette période de 10 jours le sumithion et le sumioxon sont complètement dégradés et hydrolisés en acide phosphorique et en acide phosphorique ({sup 32}P) solubles dans l' eau, probablement utilisés ultérieurement pour la formation des protéines ({sup 32}P) de haut poids moléculaire, insolubles dans l'eau. Ces protéines ({sup 32}P) semblent persister dans l' arbre pendant un temps remarquablement long, pouvant ainsi expliquer la présence d' une radioactivité jusqu’ à environ trois mois après le traitement. (author)

  19. Caracterización fisicoquímica y fisiológica del fruto de maraco (Theobroma bicolor H.B.K. durante su desarrollo Physicochemical and physiological characterization of the fruit of macaro (Theobroma bicolor H.B.K. during its development

    Directory of Open Access Journals (Sweden)

    Hernández G. María Soledad

    1998-12-01

    Full Text Available El presente estudio tuvo como objetivo caracterizar fisiológicamente el desarrollo y la maduración del fruto de maraca y encontrar parámetros que permitan su adecuado manejo en pre y poscosecha. Las muestras de los frutos requeridos para el trabajo procedieron del Centro Experimental El Trueno del Instituto Amazónico de Investigaciones Científicas SINCHI. Los análisis de laboratorio se llevaron a cabo en el Laboratorio de Postcosecha de la Planta de Vegetales del ICTA de la Universidad Nacional. Para alcanzar los objetivos se determinaron los cambios fisiológicos y fisicoquímicos más importantes durante la fase reproductiva del cultivo, estableciéndose la curva del patrón respiratorio y las variaciones de pH, acidez (% Acido cítrico, grados brix (%, azúcares reductores y totales (mg glu/100 g pulpa, vitamina C (mg Acido ascórbico/100g pulpa e índice de madurez. La fase de madurez comercial se contempló desde los 83 días, donde la respiración mostró valores muy bajos; sólo a los 113 días, al finalizar el estudio se observó un incremento de la intensidad respiratoria, condición característica de los frutos clirnatéricos. Este comportamiento estuvo acompañado de un ascenso del pH y descenso de la acidez; hubo un aumento significativo de los grados brix y azúcares reductores y totales.

    This study was carried out to characterize the physiological developement and maturity of maraco fruit in arder to determine an adequate harvest and postharvest handling of the fruit. It was measured the physiological and physicochemical changes during the reproductive stage of the plant. It was determined a respiratory curve of either pH, acidity, brix, reduced and total sugars, vitamin C and maturity index variations. The commercial ripening stage was considered from 83 day, where the respiratory intensity showed the lowest value to the day 113. At this point it was observed an increase of the respiratory intensity, indicative of the climateric condition of maraco's fruit. This behavior was also accompanied with an increase in
    pH, brix and total and reduced sugars.

  20. Cinética de secagem da polpa cupuaçu (Theobroma grandiflorum pré desidratada por imersão-impregnação Kinetic drying of cupuaçu pulp (Theobroma grandiflorum pre-dehydrated by immersion-impregnation

    Directory of Open Access Journals (Sweden)

    Luty Gomezcaceres Perez

    2013-03-01

    Full Text Available A desidratação osmótica é uma operação unitária importante para transformar os frutos perecíveis em novos produtos com valor agregado e com maior vida de prateleira. A aplicação dos modelos matemáticos confiáveis permite prever o comportamento dos diversos fenômenos que ocorrem durante o processo de secagem, o que implica na redução do custo operacional. A polpa do cupuaçu é comumente usada para preparar sucos e sorvetes, mas durante a safra é produzida em grande quantidade, que muitas vezes, é descartada devido ao custo de produção ser mais alto do que o da comercialização. O objetivo desse estudo foi investigar o efeito da solução binária e da ternária na taxa da secagem por convecção e avaliar a adequação dos modelos matemáticos na descrição das curvas da secagem do cupuaçu. No experimento, a pré-desidratação foi feita com solução binária (sacarose a 40 ºBrix e ternária (80% de sacarose/20% de cloreto de sódio, durante três horas em temperatura ambiente, seguida pela secagem convencional na estufa (ar circulante a 65 ºC, até peso constante. Os dados experimentais foram ajustados utilizando os modelos de Page e Midilli, Kucuk e Yapar. A solução binária usada na pré-secagem reduziu o tempo da subseqüente secagem convencional. Com variação de 99,64 a 99,77% no coeficiente de determinação (R², o modelo de Page apresentou o melhor ajuste aos dados experimentais.The osmotic dehydration is an important unitary operation to transform the perishable fruits in new products with added value and longer shelf life. The application of reliable mathematical models allows prediction the behavior of various phenomena that occur during the drying process, which implies in reduction of operating cost. The cupuaçu pulp is commonly used to prepare juices and ice creams, but during the crop it is produced in large quantity, which is often discarded because of the cost of production is higher than the selling price. The aim of this study was to investigate the effect of binary and ternary solutions at the rate of convective drying and evaluate the adequacy of mathematical models to describe the drying curves of the cupuaçu. In the experiment, osmotic dehydration was carried out with binary (sucrose at 40 ºBrix and ternary (80% sucrose/20% sodium chloride solutions for three hours at room temperature, followed by conventional drying in an oven (air-circulating at 65 °C to constant weight. The experimental data were adjusted using the models of Page and Midilli, Kucuk and Yapar. The binary solution used during pre-drying, reduced the time of the subsequent conventional drying. Varying from 99.64 to 99.77% in the coefficient of determination (R², the Page model showed a better adjustment to experimental data.

  1. OBTENÇÃO E UTILIZAÇÃO DA ENZIMA POLIFENOLOXIDASE EXTRAÍDA DE POLPA DE PINHA (Annona squamosa L. MADURA NO MELHORAMENTO DO SABOR DO CACAU (Theobroma cacao L. OBTAINING AND USE OF POLYPHENOLOXIDASE ENZYME EXTRACTED FROM RIPE CUSTARD APPLE (Annona squamosa L. PULP ON THE COCOA (Theobroma cacao L. NIBS IN TASTE IMPROVEMENT

    Directory of Open Access Journals (Sweden)

    ELIZA DOROTEA POZZOBON DE ALBUQUERQUE LIMA

    2001-12-01

    Full Text Available O presente trabalho teve como objetivo estudar a obtenção e a utilização da enzima polifenoloxidase (PPO extraída de polpa de pinha madura na redução do teor de compostos polifenólicos com a finalidade de diminuir a adstringência e o amargor das amêndoas de cacau processadas na forma de "nibs". A PPO foi extraída com tampão fosfato de potássio 0,025M (pH 7,5, adicionando sulfato de amônio para a precipitação da enzima. O material em pó obtido foi denominado de enzima parcialmente purificada, sendo que a análise de atividade enzimática foi realizada, utilizando-se de catecol como substrato. As características bioquímicas apresentadas foram pH de estabilidade de 6,0 a 6,5 e temperatura de estabilidade de 10 a 30°C. Os "nibs" foram autoclavados (121°C por 15 minutos e não autoclavados de amêndoas cruas insuficientemente fermentadas e secas, da mesma origem, sendo embebidas em 25 mL de uma solução da enzima contendo 200 unidades/min/mL, durante 30; 60; 90; 210 e 360 minutos, a 23°C e pH 6,0. Os "nibs" foram homogeneizados com a solução de enzima a cada 15 minutos, secos, moídos e desengordurados. Após o tratamento enzimático durante 210 minutos realizado nos "nibs" de cacau desengordurado não autoclavados foi possível observar diminuição de 15% nas concentrações de fenóis totais, 15% de taninos, 10% de flavan-3-ois e 18% de antocianidinas. Os "nibs" de cacau desengordurado autoclavados apresentaram diminuição de 25% nas concentrações de fenóis totais, 26% de taninos, 23% de flavan-3-ois e 51% de antocianidinas.The present work had as aim to study the obtaining and the uses of polyphenoloxidase enzyme (PPO extracted from ripe custard apple pulp on the reduction of polyphenolic compounds with decrease adstringency and bitterness of cocoa nuts processed at nibs form. The PPO was extracted with 0.025M potassium phosphate buffer (pH 7.5, adding ammonium sulfate to the enzyme precipitation. The powdered material obtained was called partially purified enzyme, being the analyses of activity carried out with catechol as substract, showing biochemical characteristics of 5.0 to 6.5 stability pH and 10 to 30°C stability temperature the nibs were autoclaved (121°C for 15 minutes and non-autoclaved from the same origin, raw nuts insuficiently fermented and dried were soaked in a solution of the enzyme containing 200 units/min/mL, for 30, 60, 90, 210 and 360 minutes, at 23°C and pH 6.0 . The nibs were homogeneized with the enzyme solution each 15 minutes, dried, ground and became unfatted. After enzymatic treatment over 210 minutes carried out on the non-autoclaved unfatted cocoa nibs, it was possible to observe diminishing of 15% in the total phenol, 15% tannin content, 10% of flavan-3-ois and 18% of anthocyanidins concentrations. The nibs of autoclaved unfatted cacao showed diminishing of 25% in the total phenol, 26% of tannins 23% of flavan-3-ois, and 51% of anthocyanidins concentrations.

  2. Farelo de cacau (Theobroma cacao L. e torta de dendê (Elaeis guineensis, Jacq na alimentação de cabras em lactação: consumo e produção de leite Effects of feeding cocoa meal (Theobroma cacao L. and palm kernel cake (Elaeis guineensis, Jacq on milk intake and yield for lactating goats

    Directory of Open Access Journals (Sweden)

    Herymá Giovane de Oliveira Silva

    2005-10-01

    Full Text Available Foram avaliados o consumo e a produção de leite de cabras recebendo dietas contendo farelo de cacau (FC ou torta de dendê (TD em substituição ao milho e ao farelo de soja da ração concentrada. Foram utilizadas cinco cabras da raça Saanen, com produção média diária de 2,0 kg de leite e aos 60 dias de lactação, distribuídas em um quadrado latino 5 x 5. Os períodos experimentais tiveram duração de 14 dias, em que os dez primeiros foram destinados à adaptação e os quatro últimos, à coleta de amostras. As rações foram isoprotéicas, com 13,2% de proteína bruta. As dietas constituíram-se de 36% de volumoso (silagem de milho e 64% de concentrado na matéria seca. Os tratamentos consistiram de concentrado à base de milho e soja com 0, 15 e 30% de FC ou TD. Os consumos de matéria seca, matéria orgânica, proteína bruta, nutrientes digestíveis totais, carboidratos totais e carboidratos não-fibrosos reduziram com a inclusão de 30% de FC. Os consumos de fibra em detergente neutro e extrato etéreo (EE não foram alterados pelas dietas. O consumo de fibra em detergente ácido diferiu apenas entre os tratamentos com 30% de TD e 30% de FC, sendo 0,94 e 0,59% do peso vivo animal, respectivamente. O tratamento com 30% de FC proporcionou menor produção de leite (1,208 kg/dia, se assemelhando apenas ao tratamento com inclusão de 30% de TD quando a produção foi corrigida para 3,5% de gordura. O FC e a TD apresentam viabilidade de uso como alternativa na dieta de cabras em lactação em até 9,13 e 18,81% da matéria seca, respectivamente.The effects of replacing corn and soybean meal with cocoa meal (CF or palm kernel cake (PKC in the concentrate on milk intake and yield of goats were evaluated. Five Saanen goats, averaging 2 kg daily milk yield at 60 days of lactation, were assigned to a 5 x 5 Latin square experimental design. The experiment lasted 14 days, with 10 days for adaptation period and four days for sample collection. Diets contained: 36% of roughage (corns silage and 64% of concentrate, dry matter basis, formulated toyield 13.2% of crude protein. The treatments were as follows: 0, 15 and 30% CF or PKC, all with concentrate (corn and soybean meal. Dry matter, organic matter, crude protein, total digestible nutrients, total carbohydrates and nonfiber carbohydrates intakes decreased as affected by the highest replacement level (30% CF. No significant differences on neutral detergent fiber and ether extract intake were observed. Acid detergent fiber intake differed only between 30% PKC and 30% CF-based diets, with 0.94 and 0.59% body weight, respectively. The 30% CF-based diet showed lower milk production value, as kg/dia (1.208 kg, but similar to 30% PKC-based diet, when corrected for 3.5% fat. Replacing corn and soybean with CF and PKC in the diet of lactating goats is viable up to 9.13 and 18.81% dry matter, respectively.

  3. Efeitos do alagamento do substrato no crescimento e na composição química de genótipos clonais de Theobroma cacao L. Effects of substrate flooding on growth and chemical composition of Theobroma cacao L. clonal genotypes

    Directory of Open Access Journals (Sweden)

    Bruna Carmo Rehem

    2009-09-01

    Full Text Available O alagamento do solo pode promover alterações no metabolismo celular e causar desvios nas condições ótimas de crescimento das plantas, gerando uma condição de estresse. Objetivou-se no presente trabalho avaliar os efeitos do alagamento no crescimento e na nutrição mineral de seis clones de T. cacao (CP-49, CCN-10, CP-06, CEPEC-2007, CEPEC-2008 e PS-1319, para elucidar possíveis mecanismos de tolerância ao alagamento. Mudas clonais de T. cacao, com 6 meses de idade, foram submetidas ao alagamento, juntamente com o tratamento-controle (não alagado, por 30 dias. Observou-se, no final desse período, que o alagamento promoveu diminuição nas taxas de crescimento relativo radicular (exceto para CP-06 e de área foliar, acúmulo de matéria seca e incremento nas taxas de crescimento relativo caulinar (exceto para os clones CP-06 e CEPEC-2008 e assimilatória líquida (exceto para o clone alagado PS-1319 e de massa foliar específica para os clones CP-49, CCN-10 e CP-06. Os clones que sobreviveram aos 30 dias de alagamento apresentaram baixos valores de razão de área foliar. De modo geral, o alagamento do substrato acarretou deficiência na absorção de macro e micronutrientes minerais, exceto de Fe. Dentre os clones avaliados, o CP-49 foi tolerante e o CEPEC-2008 não tolerante ao alagamento. Os demais clones ficaram numa posição intermediária. Logo, o clone CP-49 tem grande potencial para ser cultivado em condições de alagamento.Soil flooding can induce changes in cell metabolism and cause deviations in optimum conditions for plant growth, creating a stress condition. The objective of this work was to evaluate the effects of flooding on growth and mineral nutrition of six T. cacao clones (CP-49, CCN-10, CP-06, CEPEC-2007, CEPEC-2008 and PS-1319, aiming to clarify the possible mechanisms of soil flooding tolerance. Plants of T. cacao with 6 months of age were subject to soil flooding, along with the control treatment (not flooded, for 30 days. At the end of the experiment, flooding induced decreases in the root growth rates (except for CP-06 and leaf area, increases in the dry mass, in the stem relative growth rate (except for the clones CP-06 and CEPEC-2008, in the net assimilation rates (except for PS-1319 and in the specific leaf mass of the clones CP-49, CCN-10 and CP-06. Plants that survived the 30 days of flooding also presented low values of the leaf area ratio. In general, substrate flooding has caused disability in the absorption of macro and micro nutrients, with exception for Fe. Among all clones evaluated, CP-49 was considered as tolerant and CEPEC-2008 as non-tolerant to soil flooding. The other clones are in an intermediate position. Therefore, the clone CP-49 presents a great potential to be cultivated in flood prone environments.

  4. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L. In vitro effect of essential oils of three Lippia species on Moniliophthora roreri (Cif. and Par. Evans et al., causative agent of moniliasis of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Betty Stefany Lozada

    2012-04-01

    Full Text Available Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aislado M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibición del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. origanoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno, g-terpineno, acetato de timilo, carvacrol, b-mirceno, trans-b-cariofileno. Diferencias significativas (P The in vitro antifungal effect of five essential oils (EOs (EO1, EO2, EO3, EO4 and EO5 extracted from Lippia origanoides, L. citriodora and L. alba on isolates of Monilia (Moniliophthora roreri was evaluated. Lippia plants were collected at five locations in Colombia, and monilia isolates were obtained from infected cocoa fruits collected in San Vicente de Chucurí, Santander, Colombia. The fungi strains (M1, M2, M3, M4 and M5 were characterized by morphology, germination and growth in culture media. Antifungal activity of different concentrations of EOs was evaluated against the M2 and the isolated strain of M. roreri (ATCC 64239 determining their effect on germination and mycelial growth inhibition. The five essential oils studied inhibited 100% germination and micelial growth when they were used at concentrations from 800 to 1000 µg/ml. Concentrations of 200 µg/ml also showed an effect on fungal isolates, being the EOs obtained from L. origanoides (EO2 and EO3 the most active. These were mainly composed of thymol, p-cymene, g-terpinene, timilo acetate, carvacrol, b-myrcene, trans- b-caryophyllene. Significant differences (P < 0.05 on susceptibility were observed between the two fungal strains studied, being generally more susceptible the isolated M2 that the ATCC strain. The EOs of L. origanoides are candidates for use as biofungicides possible to control the moniliasis. Future studies oriented to determinate the in vivo antifungal activity of these EOs and its major components are required.

  5. Fosfito de potássio na indução de resistência a Verticillium dahliae Kleb., em mudas de cacaueiro (Theobroma cacao L. Effect of potassium phosphite on the induction of resistance in cocoa seedlings (Theobroma cacao L. against Verticillium dahliae Kleb

    Directory of Open Access Journals (Sweden)

    Pedro Martins Ribeiro Júnior

    2006-08-01

    Full Text Available Há vários relatos da utilização de fosfitos no controle de doenças de plantas, por meio de ação direta, antifúngica e indireta por indução de resistência. Essa atuação como indutor é questionada, não sendo encontradas, em muitos desses trabalhos, evidências de respostas de defesa ativadas pelos sais de fosfito. Com o presente trabalho, objetivou-se estudar o efeito de doses (0,62; 1,25; 2,5 e 5 mL.L-1 de água de fosfito de potássio na indução de resistência em mudas de cacaueiro a V. dahliae, além de investigar os possíveis mecanismos envolvidos na resposta de defesa. Foram realizados experimentos no Laboratório de Fisiologia do Parasitismo e casa-de-vegetação do Departamento de Fitopatologia UFLA. A aplicação foliar do fosfito foi realizada 7 dias antes das inoculações e as avaliações de severidade foram realizadas aos 20, 30, 40, 50 e 60 dias após a inoculação. Foi realizado também um experimento para verificar o efeito tóxico direto e outro para avaliar a atividade das enzimas peroxidases e polifenoloxidases e a concentração de lignina. O tratamento com o fosfito de potássio (1,25 mL.L-1 de água proporcionou 10% de redução na área abaixo da curva de progresso da severidade da murcha-de-Verticillium (AACPD, 60 dias após aplicação foliar, não diferindo de nenhuma das doses, nem da testemunha. Todas as doses utilizadas apresentaram efeito fungitóxico, inibindo a germinação de V. dahliae. A aplicação do fosfito de potássio (1,25 mL.L-1 de água não induziu aumento na atividade das enzimas peroxidases e polifenoloxidases em relação à testemunha. Plantas tratadas com esse produto apresentaram um pequeno incremento na concentração de lignina, não apresentando diferença significativa da testemunha absoluta.There are several reports concerning with the use of phosphites for controlling of plant diseases, through direct action, antifungal, and indirect, by resistance induction. The performance of phosphites as inducer of resistance is questioned, not finding in many of those papers, evidences of defense responses activated by these salts. The present work aimed at studying the effect of doses (0.62; 1.25; 2.5 and 5.0 mL.L-1 of water of potassium phosphite on the protection of cocoa seedlings against V. dahliae, besides investigating the possible mechanisms involved in the defense response. Experiments were accomplished at the laboratory of Physiopathology and in a greenhouse at the Plant Pathology Department - UFLA. Foliar applications of phosphite were carried out 7 days before inoculation and severity assessments at 20, 30, 40, 50 and 60 days after inoculation. Experiments were also set to verify the toxic effect of phosphites and to evaluate the action of the enzymes peroxidases and polyphenoloxidases and the lignin content. The treatment with the potassium phosphite (1.25 mL.L-1 of water provided only 10% reduction in the area under the disease progress curve (AUDPC, 60 days after spraying, not differing from none of the doses, nor from the dose zero. All the used doses presented antifungal effect, inhibiting the germination of V. dahliae conidia. The application of the potassium phosphite (1.25 mL.L-1 of water did not induce increase in the activities of the enzymes peroxidases and polyphenoloxidases in relation to the control. Treated plants with that product presented a small increment in the lignin content, not presenting a significant difference to the absolute control.

  6. Study of root and leaf rachis of Spathelia excelsa: phytochemistry and activity against fungus Moniliophthora perniciosa associated with cupuassu (Theobroma grandiflorum); Estudo em raiz e raquis foliar de Spathelia excelsa: fitoquimica e atividade frente ao fungo Moniliophthora perniciosa associado ao cupuacuzeiro (Theobroma grandiflorum)

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Loretta Ennes de; Lima, Maria da Paz; Maximo, Ariane da Costa; Pereira, Elaine Cristina da Silva; Moreira, Wagner Alan dos Santos [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil). Coordenacao de Pesquisas em Tecnologia e Inovacao; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Quimica; Veras, Solange de Mello [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias; Souza, Maria Geralda de, E-mail: mdapaz@inpa.gov.br [Empresa Brasileira de Pesquisa Agropecuaria (EMBRAPA), Manaus, AM (Brazil)

    2012-07-01

    The chemical composition of Spathelia excelsa (Krause) R. S. Cowan and Brizicky was investigated and the limonoids harrisonin (1) and deacetylspathelin (2), alkaloids folinin and casimiroin mixture (3a,b), plus a further casimiroin (3b) were identified in methanol extract from root. The CH{sub 2}Cl{sub 2} extract from the rachis yielded protolimonoid 3{beta}-angeloyl-21,24-epoxy-7{alpha},21{alpha},23{alpha},25-tetrahydroxy-4{alpha},4{beta},8{beta},10{beta}-tetramethyl -25-dimethyl-14,18-cyclo-5{alpha},13{alpha},14{alpha},17{alpha}-cholestane (4), and methanol extract, the limonoids limonin diosphenol (5) and perforatin (6), as well as the chromone biflorin (7). Harrisonin and biflorin were isolated for the first time in this genus. On the antifungal assay against witches' broom (Moniliophthora perniciosa) compound 3b was found to be active. (author)

  7. Study of root and leaf rachis of Spathelia excelsa: phytochemistry and activity against fungus Moniliophthora perniciosa associated with cupuassu (Theobroma grandiflorum); Estudo em raiz e raquis foliar de Spathelia excelsa: fitoquimica e atividade frente ao fungo Moniliophthora perniciosa associado ao cupuacuzeiro (Theobroma grandiflorum)

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, Loretta Ennes de; Lima, Maria da Paz; Maximo, Ariane da Costa; Pereira, Elaine Cristina da Silva; Moreira, Wagner Alan dos Santos [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil). Coordenacao de Pesquisas em Tecnologia e Inovacao; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Quimica; Veras, Solange de Mello [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias; Souza, Maria Geralda de, E-mail: mdapaz@inpa.gov.br [Empresa Brasileira de Pesquisa Agropecuaria (EMBRAPA), Manaus, AM (Brazil)

    2012-07-01

    The chemical composition of Spathelia excelsa (Krause) R. S. Cowan and Brizicky was investigated and the limonoids harrisonin (1) and deacetylspathelin (2), alkaloids folinin and casimiroin mixture (3a,b), plus a further casimiroin (3b) were identified in methanol extract from root. The CH{sub 2}Cl{sub 2} extract from the rachis yielded protolimonoid 3{beta}-angeloyl-21,24-epoxy-7{alpha},21{alpha},23{alpha},25-tetrahydroxy-4{alpha},4{beta},8{beta},10{beta}-tetramethyl -25-dimethyl-14,18-cyclo-5{alpha},13{alpha},14{alpha},17{alpha}-cholestane (4), and methanol extract, the limonoids limonin diosphenol (5) and perforatin (6), as well as the chromone biflorin (7). Harrisonin and biflorin were isolated for the first time in this genus. On the antifungal assay against witches' broom (Moniliophthora perniciosa) compound 3b was found to be active. (author)

  8. Release Properties of Paracetamol Granulationa Formulated with ...

    African Journals Online (AJOL)

    Theobroma cacao gum, TCG was derived as a dry powder from fresh fruits of Theobroma cacao. Various granulations of paracetamol were prepared with TCG at the concentrations of 0.5 – 4% w/w. Similar formulations were prepared using sodium carboxymethyl cellulose, SCMC and acacia gums as standards. In each ...

  9. Fungal species associated with Vigna unguiculata (L.) Walp (Cowpea)

    African Journals Online (AJOL)

    Aspergillus niger Van Tieghem, Botryodiplodia theobromae (Pat) Novel, Fusarium oxysporum Schlecht and Rhizopus stolonifer Ehrenb ex Link were isolated from both blotter and agar methods. Botryodiplodia theobromae had the highest mean occurrence (42.37%) followed by Fusarium oxysporum (30.02%), Aspergillus ...

  10. Facilitating the use of alternative capsid control methods towards sustainable production of organic cocoa in Ghana

    NARCIS (Netherlands)

    Ayenor, G.K.; Huis, van A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.

    2007-01-01

    Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma

  11. The pathogenesis-related protein PR-4b from Theobroma cacao presents RNase activity, Ca(2+) and Mg(2+) dependent-DNase activity and antifungal action on Moniliophthora perniciosa.

    Science.gov (United States)

    Pereira Menezes, Sara; de Andrade Silva, Edson Mario; Matos Lima, Eline; Oliveira de Sousa, Aurizângela; Silva Andrade, Bruno; Santos Lima Lemos, Livia; Peres Gramacho, Karina; da Silva Gesteira, Abelmon; Pirovani, Carlos Priminho; Micheli, Fabienne

    2014-06-11

    The production and accumulation of pathogenesis-related proteins (PR proteins) in plants in response to biotic or abiotic stresses is well known and is considered as a crucial mechanism for plant defense. A pathogenesis-related protein 4 cDNA was identified from a cacao-Moniliophthora perniciosa interaction cDNA library and named TcPR-4b. TcPR-4b presents a Barwin domain with six conserved cysteine residues, but lacks the chitin-binding site. Molecular modeling of TcPR-4b confirmed the importance of the cysteine residues to maintain the protein structure, and of several conserved amino acids for the catalytic activity. In the cacao genome, TcPR-4b belonged to a small multigene family organized mainly on chromosome 5. TcPR-4b RT-qPCR analysis in resistant and susceptible cacao plants infected by M. perniciosa showed an increase of expression at 48 hours after infection (hai) in both cacao genotypes. After the initial stage (24-72 hai), the TcPR-4b expression was observed at all times in the resistant genotypes, while in the susceptible one the expression was concentrated at the final stages of infection (45-90 days after infection). The recombinant TcPR-4b protein showed RNase, and bivalent ions dependent-DNase activity, but no chitinase activity. Moreover, TcPR-4b presented antifungal action against M. perniciosa, and the reduction of M. perniciosa survival was related to ROS production in fungal hyphae. To our knowledge, this is the first report of a PR-4 showing simultaneously RNase, DNase and antifungal properties, but no chitinase activity. Moreover, we showed that the antifungal activity of TcPR-4b is directly related to RNase function. In cacao, TcPR-4b nuclease activities may be related to the establishment and maintenance of resistance, and to the PCD mechanism, in resistant and susceptible cacao genotypes, respectively.

  12. The pathogenesis-related protein PR-4b from Theobroma cacao presents RNase activity, Ca2+ and Mg2+ dependent-DNase activity and antifungal action on Moniliophthora perniciosa

    Science.gov (United States)

    2014-01-01

    Background The production and accumulation of pathogenesis-related proteins (PR proteins) in plants in response to biotic or abiotic stresses is well known and is considered as a crucial mechanism for plant defense. A pathogenesis-related protein 4 cDNA was identified from a cacao-Moniliophthora perniciosa interaction cDNA library and named TcPR-4b. Results TcPR-4b presents a Barwin domain with six conserved cysteine residues, but lacks the chitin-binding site. Molecular modeling of TcPR-4b confirmed the importance of the cysteine residues to maintain the protein structure, and of several conserved amino acids for the catalytic activity. In the cacao genome, TcPR-4b belonged to a small multigene family organized mainly on chromosome 5. TcPR-4b RT-qPCR analysis in resistant and susceptible cacao plants infected by M. perniciosa showed an increase of expression at 48 hours after infection (hai) in both cacao genotypes. After the initial stage (24-72 hai), the TcPR-4b expression was observed at all times in the resistant genotypes, while in the susceptible one the expression was concentrated at the final stages of infection (45-90 days after infection). The recombinant TcPR-4b protein showed RNase, and bivalent ions dependent-DNase activity, but no chitinase activity. Moreover, TcPR-4b presented antifungal action against M. perniciosa, and the reduction of M. perniciosa survival was related to ROS production in fungal hyphae. Conclusion To our knowledge, this is the first report of a PR-4 showing simultaneously RNase, DNase and antifungal properties, but no chitinase activity. Moreover, we showed that the antifungal activity of TcPR-4b is directly related to RNase function. In cacao, TcPR-4b nuclease activities may be related to the establishment and maintenance of resistance, and to the PCD mechanism, in resistant and susceptible cacao genotypes, respectively. PMID:24920373

  13. OBTENÇÃO E UTILIZAÇÃO DA ENZIMA POLIFENOLOXIDASE EXTRAÍDA DE POLPA DE PINHA (Annona squamosa L.) MADURA NO MELHORAMENTO DO SABOR DO CACAU (Theobroma cacao L.)

    OpenAIRE

    LIMA,ELIZA DOROTEA POZZOBON DE ALBUQUERQUE; PASTORE,GLÁUCIA MARIA; BARBERY,SANDRA DRINA FERNANDEZ; GARCIA,NELSON HORÁCIO PEZOA; BRITO,EDY SOUSA DE; LIMA,CARLOS ALBERTO DE ALBUQUERQUE

    2001-01-01

    O presente trabalho teve como objetivo estudar a obtenção e a utilização da enzima polifenoloxidase (PPO) extraída de polpa de pinha madura na redução do teor de compostos polifenólicos com a finalidade de diminuir a adstringência e o amargor das amêndoas de cacau processadas na forma de "nibs". A PPO foi extraída com tampão fosfato de potássio 0,025M (pH 7,5), adicionando sulfato de amônio para a precipitação da enzima. O material em pó obtido foi denominado de enzima parcialmente purificada...

  14. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Betty Stefany Lozada

    2012-04-01

    Full Text Available Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aislado M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibición del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. origanoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno, g-terpineno, acetato de timilo, carvacrol, b-mirceno, trans-b-cariofileno. Diferencias significativas (P < 0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en general más susceptible el aislado M2 que la cepa ATCC. Los AEs de L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.

  15. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Lozada Betty Stefany

    2012-11-01

    Full Text Available

    Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aisla- do M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibi- ción del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. ori- ganoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno,

    y-terpineno, acetato de timilo, carvacrol, 1-mirceno, trans-1ccariofileno. Diferencias significativas (P <

    0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en gene- ral más susceptible el aislado M2 que la cepa ATCC. Los AEs de L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.

  16. Efecto del pH, la luz y la concentración de sacarosa en la Embriogénesis somática de cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Lisette Valverde Cerdas

    2016-03-01

    Full Text Available Se llevó a cabo una investigación con el fin de establecer la metodología adecuada para inducir embriogénesis somática en cacao, a partir de semillas maduras. Se estudió el efecto del pH, la luz y la concentración de sacarosa sobre la respuesta embriogénica. Los dos cultivares mostraron diferente respuesta morfogénica y en ambos, estuvo influenciada por el pH, la luz y la concentración de sacarosa. La mejor respuesta embriogénica se obtuvo con un pH de 6,7. El número de embriones producidos fue mayor bajo condiciones de oscuridad que en presencia de luz. La formación de callo y la diferenciación de embriones somáticos estuvo directamente influenciada por la concentración de azúcar en el medio de cultivo. La mayor cantidad de embriones se obtuvo con niveles de sacarosa entre 4% y 6% para el híbrido UF-613xIMC-67 y niveles entre 2% y 4% de sacarosa para el cultivar CATIE-1000. Se presento una embriogénesis somática directa. Los resultados obtenidos sugieren la necesidad de continuar realizando estudios con esta especie.

  17. Embriogénesis somática secundaria en el genotipo de cacao (Theobroma cacao L.) inifap 1 y su descripción histológica

    OpenAIRE

    Lázaro, A. Alejandro; Azpeitia-Morales, A.; Sáenz-Carbonell, L.; Mirafuentes Hernández, F.

    2015-01-01

    La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS) en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de las fi...

  18. Embriogénesis somática secundaria en el genotipo de cacao (Theobroma cacao L. inifap 1 y su descripción histológica

    Directory of Open Access Journals (Sweden)

    A. Alejandro-Lázaro

    2015-01-01

    Full Text Available La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de las fitohormonas ácido 2,4-Diclorofenoxiácetico (2,4-D y thidiazuron (TDZ son importantes para inducir la embriogénesis somática (ES primaria en cacao. Adicionalmente para generar la ESS se han utilizado fitohormonas. En la presente investigación, fueron establecidos cuatro tratamientos con fregmentos de cotiledón, con 2,4-D y TDZ en forma combinada e independiente, incluyendo un testigo sin fitohormonas. Los resultados mostraron, que los fragmentos de cotiledón cultivados sin fitohormonas favorece la ESS, obteniendo un promedio de seis embriones somáticos secundarios (ESs a los 210 días de cultivo contra uno para el tratamiento suplementado con TDZ. El meristemo apical y radicular se presentó en un periodo de 240 días, se observaron embriones somáticos con estructuras externas como: cotiledones, ápices y raíces. Los resultados mostraron que la exclusión del 2,4-D y el thidiazuron no son importantes para inducir la ESS. El mayor número de ESs se encontró en un medio desprovisto de fitohormonas por lo que esta información es relevante, debido a que los explantes de cotiledones procedentes de embriones somáticos primarios, generan mayor número de ESs en esta especie. Estos resultados constituyen el primer reporte de la inducción de la ESs sin fitohormonas.

  19. Embriogénesis somática secundaria en el genotipo de cacao (Theobroma cacao L.) inifap 1 y su descripción histológica

    OpenAIRE

    A. Alejandro-Lázaro; A. Azpeitia-Morales; L. Sáenz-Carbonell; F . Mirafuentes Hernández

    2015-01-01

    La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS) en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de l...

  20. Evaluación mediante la tecnología NIRS de los insumos, su transformación y el chocolate elaborado con cacao (Theobroma cacao L.) de Tabasco.

    OpenAIRE

    Pons Burelo, Clara Inés

    2010-01-01

    En el CODEX STAN 87-1891 se definen las características que contiene los chocolates de mesa y golosina, indicando los parámetros: proteína, humedad, ceniza y grasa y los contenidos máximos y mínimos permitidos. Los métodos convencionales de análisis para determinar estos parámetros son necesarios para el control de calidad y es un prerrequisito para el etiquetado nutrimental del alimento. Una alternativa metodológica de análisis utilizada para obtener no solo lo que contiene la muestra sino d...

  1. Efeito da temperatura e taxa de cisalhamento nas propriedades de escoamento da polpa de Cupuaçu (T. grandiflorum Schum integral Effect of temperature and shear rate in the properties of whole flow Cupuassu pulp (Theobroma grandiflorum

    Directory of Open Access Journals (Sweden)

    Gilvanete Maria Ferreira

    2008-06-01

    Full Text Available O comportamento reológico da polpa de cupuaçu integral foi determinado na faixa de temperatura de 10 a 60ºC. Os efeitos da temperatura e da taxa de deformação foram avaliados por meio de testes em cisalhamento estacionário. As análises reológicas foram conduzidas num reômetro Thermo Haake RheoStress 1. Os reogramas foram descritos pelos modelos reológicos de Ostwald-de-Waelle e o de Herschel-Bulkley. As curvas de escoamento mais bem ajustadas pelo modelo de Ostwald-de-Waelle. O produto apresentou comportamento pseudoplástico, e o índice de comportamento de fluxo (n decresceu com o aumento da temperatura. O efeito da temperatura sobre a viscosidade aparente foi descrita por uma equação tipo Arrhenius e discutida em termos de energia de ativação. Essa energia aumentou com o aumento da taxa de deformação, sendo obtidos valores na faixa de 1 a 2 kcal/gmol.The rheological behavior of the entire cupuassu pulp was determined in the temperature range 10 - 60ºC. The effects of temperature and deformation rate were evaluated by means of shear flow tests. Rheometry analyses were conducted with a Thermo Haake RheoStress 1 system. Rheograms were described by models by Ostwald-of-Waelle and Herschel-Bulkley. The Ostwald-of-Waelle model successfully represented pulp flow behavior. The product presented shear-thinning behavior and the flow behavior index (n decreased with the increase of temperature. The effect of temperature on the apparent viscosity in cupuassu pulp was described by an Arrhenius equation and discussed in terms of activation energy. The increase in shear rate caused an energy increase, and values were obtained in the range of a line from 1 to 2 kcal/gmol.

  2. DESENVOLVIMENTO DE CALOS EM EXPLANTES DE CUPUAÇUZEIRO (Theobroma grandiflorum Schum. EM FUNÇÃO DA CONCENTRAÇÃO DE AUXINAS E DO MEIO LÍQUIDO

    Directory of Open Access Journals (Sweden)

    FERREIRA MARIA DAS GRAÇAS RODRIGUES

    2001-01-01

    Full Text Available Objetivou-se estudar o efeito da concentração de auxina e do meio líquido sobre o desenvolvimento de calos de cupuaçuzeiro. Segmentos de eixos embrionários e cotilédones, obtidos de frutos de cupuaçu dos tipos Mamorana e Redondo, foram cultivados em 4 meios de cultura diferentes: 1 meio MS (50%, suplementado com 2,4-D (1; 2; 4; 8 mg/L; 2 sais N6 (SIGMA (4 g/L, acrescidos de 2,4-D (0; 2; 4 mg/L e ANA (0; 3; 5 mg/L; 3 igual ao anterior, suplementado apenas com ANA (3 mg/L; e 4 meio MS, acrescido com ANA (1 mM. Calos com aspecto branco e brilhante foram observados em segmentos de eixos embrionários e cotilédones, cultivados nas menores concentrações de meio 1 (1 e 2 mg/L, enquanto nas maiores concentrações (4 e 8 mg/L se observou a formação de calos e massa calosa branco-opaca, em eixos embrionários e em segmentos cotiledonares, estas estruturas tornaram-se escuras dentro de oito semanas. Usando o meio 2, um grande número de raízes foram formadas, enquanto o mesmo meio suplementado apenas com ANA (3; 5 mg/L originou uma massa calosa. A combinação de ANA e 2,4-D, 3 e 2 mg/L, respectivamente, promoveu a formação de calos brancos e raízes. A transferência das culturas para meio líquido, sem regulador de crescimento, promoveu aumento de tamanho dos explantes e escurecimento dos mesmos. O cultivo desses explantes no meio 3 resultou no aparecimento de calos amarelos, com aspecto friável, que permaneceram com a mesma aparência no meio 4.

  3. Calidad físico química y sensorial de granos y licor de cacao (Theobroma Cacaol. Usando cinco métodos de fermentación

    Directory of Open Access Journals (Sweden)

    MSc. José Nicasio Quevedo Guerrero

    2018-04-01

    Full Text Available La investigación se realizó en la Granja Experimental Santa Inés de la Universidad Técnica de Machala, durante el segundo semestre del 2016. El objetivo de la investigación fue comparar la eficiencia los fermentadores más usados por los pequeños productores cacaoteros de El Oro, en el beneficio de los granos de cacao, con un nuevo método denominado rotor de madera, propuesto por los autores del presente trabajo, mediante el análisis de variables físico-químicas y la evaluación sensorial del licor de cacao. El ensayo constó de los tratamientos: saco de yute (T1, rotor de madera (T2, rumo o montón (T3, caja de madera (T4 y balde plástico (T5, los cuales se evaluaron bajo un diseño de bloques al azar con tres repeticiones. El secado se efectuó de forma natural en marquesinas bajo cubierta de plástico calibre 6. El análisis de variables químicas, físicas y sensoriales reveló diferencias significativas (p < 0.05 entre tratamientos. El T2 registró 96% de calidad física del grano y el mejor perfil sensorial con calificaciones altas en sabores cacao, floral, frutal, nuez y caramelo y calificaciones bajas en sabor astringente y amargo. La fermentación se desarrolló dentro de la plantación de cacao, esto permitió la presencia de Drosophila melanogaster M., vector de Saccharomyces cerevisiae y otras levaduras que pudieron haber inferido en la calidad de los granos. Palabras clave: Astringente, pizarrosas, Drosophila melanogaster M., levaduras.

  4. Volatile composition of some Brazilian fruits: umbu-caja (Spondias citherea), camu-camu (Myrciaria dubia), Araça-boi (Eugenia stipitata), and Cupuaçu (Theobroma grandiflorum).

    Science.gov (United States)

    Franco, M R; Shibamoto, T

    2000-04-01

    Twenty-one volatile compounds were identified for the first time by GC-MS in umbu-caja and in camu-camu, plus 30 volatile compounds were identified in araça-boi samples. Terpenic compounds predominated among the volatile compounds in these fruit samples, with the major compounds being identified as cis-beta-ocimene and caryophyllene in the northeastern fruit; alpha-pinene and d-limonene were the most abundant volatile compounds in the headspace of the Amazonian fruit camu-camu. Sesquiterpenes were the most abundant compounds in the araça-boi sample, with germacrene D presenting a higher relative percentage. The chemical class of esters predominated in the cupuaçu sample. Ethyl butyrate and hexanoate were the major compounds in the headspace of this Amazonian fruit.

  5. Redução de aminoácidos em polpas de bacuri (Platonia insignis Mart, cupuaçu (Theobroma grandiflorum Willd ex-Spreng Schum e murici (Byrsonima crassifolia L. processado (aquecido e alcalinizado Amino acids reduction in processed (heated and alkalinized pulps of bacuri (Platonia insignis Mart, cupuaçu (Theobroma grandiflorum Willd ex-Spreng Schum and murici (Byrsonima crassifolia L.

    Directory of Open Access Journals (Sweden)

    Alexandre Porte

    2010-09-01

    Full Text Available A literatura científica é pobre a respeito de frutas da Amazônia, como o murici, e suas características químicas devem ser estudadas. Por isso, esta pesquisa teve por proposta determinar o perfil aminoacídico das polpas de bacuri, cupuaçu e murici sob diferentes valores de pH (3,3, 5,8, 8,0 e 12,0, sem aquecimento ou com aquecimento por 12 horas/100 ºC com agitação e refluxo. Valores de pH, glicose, frutose e sacarose também foram determinados nas polpas sem aquecimento. Os nutrientes foram determinados por CLAE (Cromatografia Líquida de Alta Eficiência. As polpas de bacuri, cupuaçu e murici apresentaram valores de pH 3,2, 3,6 e 3,35, respectivamente. A sacarose foi, quantitativamente, o principal carboidrato nas polpas de cupuaçu (38,34% e bacuri (36,93%, sendo que os teores de frutose e glicose foram similares, tanto na polpa de cupuaçu (8,93% e 9,03% como na de bacuri (12,63% e 11,65%, respectivamente. Em contraste, a polpa de murici foi quase isenta de sacarose (0,57%, mas não de frutose (11,51% ou glicose (11,39%. Nas polpas sem aquecimento, os principais aminoácidos foram: ácido glutâmico (46,6 mg/kg, ácido aspártico (28,8 mg/kg e arginina (25,3 mg/kg na polpa de bacuri; ácido aspártico (56,3 mg/kg, ácido glutâmico (44,0 mg/kg e alanina (24,2 mg/kg na polpa de cupuaçu; prolina (73,5 mg/kg, ácido glutâmico (23,7 mg/kg e ácido aspártico (23,5 mg/kg na polpa de murici. O aquecimento reduziu as concentrações de todos os aminoácidos nas 3 polpas. O meio fortemente alcalino (pH 12 produziu a maior degradação de aminoácidos. Lisina foi mais sensível ao aquecimento do que outros aminoácidos em pH 12.Scientific literature presents few studies about fruits of the Amazonia, like murici, and yours chemical characteristics should be studied. Therefore, amino acid profiles of the bacuri, cupuaçu and murici pulps were determined under different values of pH (3.3, 5.8, 8.0 and 12.0 with heating (12 hours/100 ºC, with stirring and refluxing or without heating. Glucose, fructose, sucrose and pH values also were obtained in the pulps without heating. All nutrients were analised by HPLC. The pHs were: 3.2, 3.6 and 3.35 in the bacuri, cupuaçu and murici pulps, respectively. Sucrose (38.34% and 36.93% was the major carbohydrate while fructose (8.93% and 12.63% and glucose (9.03% and 11.65% shown similar percentages in the cupuaçu and bacuri pulps. Murici pulp was almost free of sucrose (0.57%, but not of fructose (11.51% or glucose (11.39%. In the pulps without heating the major amino acids were: glutamic acid (46.6 mg/kg, aspartic acid (28.8 mg/kg and arginine (25.3 mg/kg in the bacuri pulp; aspartic acid (56.3 mg/kg, glutamic acid (44.0 mg/kg and alanine (24.2 mg/kg in the cupuaçu pulp; proline (73.5 mg/kg, glutamic acid (23.7 mg/kg and aspartic acid (23.5 mg/kg in the murici pulp. The heating of the 3 pulps decresead the concentration of all amino acids. The medium strongly alkaline (pH 12 produced more degradation of the amino acids than others pHs. Lysine was more sensible to the heating than others amino acids in pH 12.

  6. Prefactibilidad técnico-económica para el procesamiento del arazá (Eugenia stipitata Me Vaugh y del copoazú (Theobroma grandiflorum WiII. ex Spreng, en la zona de colonización de San José del Guaviare Technic and economic feasibillty for the arazá (Eugenia stipitata me vaugh and the copoazu (theobroma grandiflorum will ex spreng at the Guaviare region

    Directory of Open Access Journals (Sweden)

    Barrera Jaime A.

    1996-06-01

    Full Text Available A partir de la metodología de evaluación financiera de proyectos de inversión, se analizó la rentabilidad y sensibilidad de un proyecto de agroindustrialización del arazá y del copoazú en la zona de colonizaciónde San José del Guaviare. Basados en su buen comportamiento agronómico y características de olor y sabor agradables, se plantea el montaje de una planta procesadora de frutas en la región, de tal modo, que los posibles productores y usuarios de un programa de fomento puedan asegurar la venta de sus productos a precios adecuados, tanto para productores como para procesadores. Mediante la simulación del proceso comercial de obtención y almacenamiento de pulpas, se estableció la calidad técnica y se estimaron los posibles resultados económicos que se podrían obtener en su producción. Los resultados muestran que los procesos de transformación generados para las especies garantizan un retorno económico adecuado y los rendimientos obtenidos en planta permiten la viabilidad económica del proyecto, lo cual garantiza al inversionista menores riesgos y favorables alternativas de inversión para la región. La sensibilidad del proyecto es alta, lo cual implica un estricto manejoy administración del proyecto para obtener los resultados esperados. Igualmente, se demuestra que la implementación de una planta procesadora de frutas garantiza para los agricultores un poder de compra estable, con lo cual se evitarían las trabas comunes que conlleva la comercialización agrícola en la región.
    This study was carry out in arder to analize the feasibility of the araza and the copoazu transformation at the Guaviare department in the colombian amazonic region. These crops are very interesting for the agroindustry as a result of their great productitivity capacity in the poor amazonic soils, and their fruits organoleptics characteristics. The transfomation will lead either crop productors and agroindustrialmen to obtain profit from these fruits trees. It was simulated the agroindustrial pulp transformation procedure to get more information about commercial technics and economics results that would be receive from a transformation pulp plant at the region. The results demonstrated the project will have a great viability with adequate economic return to the investors. That will conduct to new investments alternatives for the region taking care of a good administration of the project to attain the expecting results. The plant at the region will guarantee power sales for the farmers to lower the commercial problems. Also it will supply permanently raw materials for the pulp plant.

  7. The graft copolymerisation of acrylamide onto cellulose using ...

    African Journals Online (AJOL)

    Theobroma cacao) wood meal have been produced using hydroquinone enhanced Fe2+/H2O2 redox system. The addition of hydroquinone to the redox system affected the effectiveness of the redox system to initiate graft copolymer formation.

  8. Influence of gamma irradiation on pollen viability, germination ability ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-12-15

    Dec 15, 2009 ... minor cross-incompatibilities and physiological studies of incompatibility ... campanula shape of the flowers attractive for insect. (bees are ..... irradiation of cacao (Theobroma cacao L.) pollen: Effect on pollen grain viability ...

  9. comparative in vitro antioxidant properties of water juice from ...

    African Journals Online (AJOL)

    JUICE FROM SELECTED AFRICAN FRUITS CONSUMED IN ... from African star apple (Chrysophyllumafricanum) and cocoa (Theobroma cacao) were significantly (p<0.05) higher .... the formula as given by Chinaka and colleagues, and.

  10. 2007-IJBCS-Article-Pierre Effa Onomo

    African Journals Online (AJOL)

    hp

    Phenolic content and heritability of resistance in four hybrid populations of. Theobroma .... ANOVA and Tukey test permitted to analyse and compare the susceptibility level of better progenies ..... behaviour. Hybrids selected for the estimation.

  11. Foliar epidermal characters of some Sterculiaceae species in Nigeria

    African Journals Online (AJOL)

    DR. AWORINDE D.O

    curve and slightly curved. All the species except Cola nitida (Vent) Schott, Malachanta alnifolia (Bak) Pierre, Mansonia altissima (A.Chev) R.Capuron, Theobroma cacao Linn and Waltheria indica Linn are amphistomatic. Stomata types included ...

  12. A physiological production model for cacao : results of model simulations

    NARCIS (Netherlands)

    Zuidema, P.A.; Leffelaar, P.A.

    2002-01-01

    CASE2 is a physiological model for cocoa (Theobroma cacao L.) growth and yield. This report introduces the CAcao Simulation Engine for water-limited production in a non-technical way and presents simulation results obtained with the model.

  13. Fungal Planet description sheets: 371–399

    NARCIS (Netherlands)

    Crous, P.W.; Wingfield, M.J.; Le Roux, J.J.; Richardson, D.M.; Strasberg, D.; Shivas, R.G.; Alvarado, P.; Edwards, J.; Moreno, G.; Sharma, R.; Sonawane, M.S.; Tan, Y.P.; Altés, A.; Barasubiye, T.; Barnes, C.W.; Blanchette, R.A.; Boertmann, D.; Bogo, A.; Carlavilla, J.R.; Cheewangkoon, R.; Daniel, R.; Beer, de Z.W.; Jesús Yáñez-Morales, de M.; Doung, T.A.; Fernández-Vicente, J.; Geering, A.D.W.; Guest, D.I.; Held, B.W.; Keykoop, M.; Hubka, V.; Ismail, A.M.; Kajale, S.C.; Khemmuk, W.; Kolařík, M.; Kurli, R.; Lebeuf, R.; Lévesque, C.A.; Lombard, L.; Magista, D.; Manjón, J.L.; Marincowitz, S.; Mohedano, J.M.; Nováková, A.; Oberlies, N.H.; Otto, E.C.; Paguigan, N.D.; Pascoe, I.G.; Pérez-Butrón, J.L.; Perrone, G.; Rahi, P.; Raja, H.A.; Rintoul, T.; Sanhueza, R.M.V.; Scarlett, K.; Shouche, Y.S.; Shuttleworth, L.A.; Taylor, P.W.J.; Thorn, R.G.; Vawdrey, L.L.; Solano-Vidal, R.; Voitk, A.; Wong, P.T.W.; Wood, A.R.; Zamora, J.C.; Groenewald, J.Z.

    2015-01-01

    Novel species of fungi described in the present study include the following from Australia: Neoseptorioides eucalypti gen. & sp. nov. from Eucalyptus radiata leaves, Phytophthora gondwanensis from soil, Diaporthe tulliensis from rotted stem ends of Theobroma cacao fruit, Diaporthe vawdreyi from

  14. Identification and phytochemical screening of Endophytic fungi from ...

    African Journals Online (AJOL)

    SARAH

    2015-06-30

    Jun 30, 2015 ... Penicillium (03), Trichoderma (01) and Fusarium (01). The phytochemical ... guajava, Citrus spp. and Theobroma cacao (Dibong et al., 2011). ... Fermentation and extraction of metabolites: Each isolated ... Penicillium sp.1.

  15. Molecular Characterization of Cocoa, Mango, Banana and Yam ...

    African Journals Online (AJOL)

    Molecular Characterization of Cocoa, Mango, Banana and Yam Isolates of Botryodiplodia theobromae in Ghana. ... A total of 25 fungal isolates were sampled from cocoa, mango, banana and yam within four ... HOW TO USE AJOL.

  16. In-vitro evaluation of plant extracts against Lasiodiplodia ...

    African Journals Online (AJOL)

    USER

    2015-04-01

    Apr 1, 2015 ... aidan (Tetrapleura tetraptera), and neem (Azadirachta indica) were ... was recorded in extract of A. hispida at 40% concentration. ... controlling L. theobromae with the ultimate goal of eliminating pesticide residues in the ...

  17. Equilibrium and Kinetic Studies of Cu (II), Cd (II), Pb (II) and Fe (II ...

    African Journals Online (AJOL)

    ADOWIE PERE

    from Aqueous Solution Using Cocoa (Theobroma cacao) Pod Husk. *1. OBIKE, AI;. 1. IGWE, JC;. 1. EMERUWA, CN;. 2. UWAKWE, KJ. 1 Department of Pure & Industrial Chemistry, Abia State University, Uturu, Abia State, ..... Eclectica Quimica.

  18. Origin and domestication of native Amazonian crops

    OpenAIRE

    Clément, R. Charles; De Cristo-Araujo, Michelly; Coppens D'Eeckenbrugge, Géo; Alves Pereira, Allessandro; Picanço-Rodrigues, Doriane

    2010-01-01

    Molecular analyses are providing new elements to decipher the origin, domestication and dispersal of native Amazonian crops in an expanding archaeological context. Solid molecular data are available for manioc (Manihot esculenta), cacao (Theobroma cacao), pineapple (Ananas comosus), peach palm (Bactris gasipaes) and guaraná (Paullinia cupana), while hot peppers (Capsicum spp.), inga (Inga edulis), Brazil nut (Bertholletia excelsa) and cupuassu (Theobroma grandiflorum) are being studied. Emerg...

  19. Facilitating the use of alternative capsid control methods towards sustainable production of organic cocoa in Ghana

    OpenAIRE

    Ayenor, G.K.; Huis, van, A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.

    2007-01-01

    Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma (Distant) (both Hemiptera: Miridae). Annual crop loss caused by capsids is estimated at 25¿30%. To control capsids, formal research recommends application of synthetic insecticides four times between Augu...

  20. Metodologies per l'estudi de compostos fenòlics i alcaloides en el cacau (theobroma cacao) i la garrofa (ceratonia siliqua L.): bextracció, caracterització i avaluació de la digestibilitat en model in-vitro

    OpenAIRE

    Ortega Olivé, Nàdia

    2010-01-01

    Actualment hi ha un especial interès pels compostos fenòlics dels aliments en àmbits de la nutrició, salut i medicina en base a diferents evidències que suggereixen que poden actuar com a potents antioxidants i/o moduladors de funcions biològiques claus en els mamífers. Paral·lelament, hi ha una demanda per part dels consumidors en quant a la informació dels aliments que s'ingereix, de les necessitats nutricionals així com de la millora de salut. Tots aquest conceptes juntament amb la definic...

  1. Aplicación de Antagonistas Microbianos para el Control Biológico de Moniliophthora roreri Cif & Par en Theobroma cacao L. Bajo Condiciones de Campo / Application of Microbial Antagonists for the Biological Control of Moniliophthora roreri Cif & Par in

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Villamil Carvajal

    2014-12-01

    Full Text Available Resumen. En Colombia, las pérdidas ocasionadas porMoniliophthora roreri Cif & Par en el cultivo de cacao continúansiendo considerables. El objetivo del presente estudio fue investigarla actividad antagónica de dos aislamientos autóctonos deTrichoderma sp. y uno de Bacillus sp. ante M. roreri, en condicionesde campo. Los tratamientos fueron: T1, hongo H5; T2, hongo H20;T3, bacteria B3 y T4, testigo. Se evaluó incidencia y severidadexterna e interna en los frutos. Los resultados de severidad externae interna mostraron que respecto al control la disminucióndel daño en los frutos fue del 19,5 y 11,2% en el T1, del 28 y19,5% en el T2 y del 13,5 y 8,5% en el T3, respectivamente condiferencias estadísticas a favor del T2. Se concluye que entre lostres antagonistas evaluados, el hongo H20 (Trichoderma sp. tieneel mayor potencial para el control de la moniliasis del cacao encondiciones de campo. / Abstract. In Colombia, the economic losses caused byMoniliophthora roreri Cif & Par in the cocoa cultivation continuebeing considerable. The objective of this study was to investigatethe antagonistic activity of two indigenous isolates of Trichodermasp and one of Bacillus sp. over M. roreri under field conditions. Thetreatments were: T1, fungus H5; T2, fungus H20; T3, bacteria B3; T4,control. The variables evaluated on the cocoa fruits were incidenceand external and internal severity. The results of the externaland internal severity showed that with respect to the control thedamage reduction on the cocoa fruits was 19,5 and 11,2% in T1,28 and 19,5% in T2, and 13,5 and 8,5% in T3, respectively withstatistical differences in favor of T2. It is concluded that amongthe three evaluated antagonists, the fungus H20 (Trichoderma sp.has the greatest potential for the biocontrol of frosty pod rot in thecocoa cultivation under field conditions.

  2. Cancro em mogno africano no estado do Pará

    Directory of Open Access Journals (Sweden)

    Célia Regina Tremacoldi

    2013-06-01

    Full Text Available Sintomas de cancro foram observados em plantios de mogno africano, no município de Dom Eliseu, Pará. Os fungos associados aos tecidos sintomáticos foram identificados como Lasiodiplodia theobromae e Fusarium subglutinans. Culturas puras desses fungos foram testadas quanto à patogenicidade em mudas de mogno africano sadias. Apenas L. theobromae produziu cancro, por meio de inoculação por ferimento e alta umidade. A confirmação de L. theobromae como agente causal do cancro ocorreu após o reisolamento do fungo a partir das plantas inoculadas em casa de vegetação, concluindo a primeira verificação do postulado de Koch para esse patossistema.

  3. Protocol for isolation of Moniliophthora roreri (Cif and Par Evans et al. from cacao fruits cv. `National' in the Ecuadorian Amazonia

    Directory of Open Access Journals (Sweden)

    Karina Carrera-Sánchez

    2014-07-01

    Full Text Available Moniliophthora roreri is a pathogen of cocoa (Theobroma cacao L. that causes high economic losses in Ecuador. This paper is intended to present a protocol for the isolation of the pathogen from cocoa fruits cv. `National', showing signs and symptoms of disease. The fruits were collected on farms of Napo (Ecuador. By wet chamber, it was able to induce profusely, sporulation on the surface of selected lesions. The isolations were performed from conidia directly located on the surface of fruits with brown powdery appearance. Isolation procedures and suggested of possible applications are presented.   Key words: amazonia, basidiomycetes, fungi, moniliasis, Theobroma cacao L.

  4. Determination of high molecular mass compounds from Amazonian plant's leaves; Determinacao de compostos de massa molecular alta em folhas de plantas da Amazonia

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de [Universidade Federal, Rio de Janeiro, RJ (Brazil). Inst. de Quimica]. E-mail: ladetec@iq.gov.br; Cabral, Jose Augusto; Ferreira, Carlos Alberto Cid [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil); Simoneit, Bernd R.T. [Oregon State Univ., Corvallis, OR (United States). College of Oceanic and Atmospheric Sciences. Petroleum and Environmental Geochemistry Group; Elias, Vladimir O. [Analytical Solution, Rio de Janeiro, RJ (Brazil)

    2003-10-01

    The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ({sup 1}H and {sup 13}C NMR, IR). (author)

  5. Determination of high molecular mass compounds from Amazonian plant's leaves

    International Nuclear Information System (INIS)

    Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de; Simoneit, Bernd R.T.

    2003-01-01

    The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ( 1 H and 13 C NMR, IR). (author)

  6. Cancro em Paricá (Schizolobium parahyba var. amazonicum no Estado do Pará Canker Disease of Parica (Schizolobium parahyba var. amazonicum in Para State, Brazil

    Directory of Open Access Journals (Sweden)

    Célia Regina Tremacoldi

    2010-02-01

    Full Text Available

    Plantios de paricá, avaliados no Município de Dom Eliseu, Estado do Pará, apresentaram sintomas de cancro. Várias espécies de fungos foram associadas ao cancro observado no campo, mais notavelmente Lasiodiplodia theobromae e Pestalotiopsis sp. Culturas isoladas destes fungos, frequentemente associados a outros (incluindo Fusarium oxysporum, Alternaria e basidiomicetes, foram testadas quanto à patogenicidade em plantas jovens de paricá, com aproximadamente um metro de altura. Apenas L. theobromae produziu cancro sob as condições testadas, quando discos de cultura foram aplicados usando técnicas de inoculação por ferimento e alta umidade, reproduzindo perfeitamente os sintomas do campo. Pestalotiopsis sp. causou danos muito menores quando comparado a L. theobromae. A confirmação de L. theobromae como agente causal do cancro em paricá ocorreu após o reisolamento do fungo a partir dos tecidos sintomáticos das plantas inoculadas em casa-de-vegetação, concluindo a verificação dos Postulados de Koch. Este é o primeiro relato deste patógeno em paricá.

     

    Doi: 10.4336/2009.pfb.59.69

    Canker have been found in field plantings of parica examined in Dom Eliseu county, Para State,
    Brazil. Several fungal species were associated with the field canker, most notably Lasiodiplodia theobromae
    and Pestalotiopsis sp. Isolated cultures of these fungi together with other often associated fungi (including
    Fusarium oxysporum, Alternaria, basidiomycetes were tested for pathogenicity on young parica plants, with
    approximately one meter height. Only L. theobromae produced canker under the conditions tested when discs
    of culture were applied using wound inoculation techniques and high humidity, which closely mimicked the field
    symptoms. Pestalotiopsis sp. proved much less damaging compared to L. theobromae. The acknowledgment of
    L. theobromae as the causal agent of parica canker came after the

  7. Determinação de compostos de massa molecular alta em folhas de plantas da Amazônia

    Directory of Open Access Journals (Sweden)

    Siqueira Denilson Soares de

    2003-01-01

    Full Text Available The fractIons of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae, caapi (Banisteriopsis caapi - Malpighiaceae, cocoa (Theobroma cacao - Sterculiaceae, Brazil nut (Bertholletia excelsa - Lecytidaceae, cupuaçu (Theobroma grandiflorum - Sterculiaceae, marupá (Simaruba amara - Simaroubaceae and rubber tree (Hevea brasiliensis - Euphorbiaceae, were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data (¹H and 13C NMR, IR.

  8. Molecular characterization of cocoa beans from different geographical origins: a metabolomics approach with a focus on peptides, amino acids and aroma compounds

    OpenAIRE

    Marseglia, Angela

    2015-01-01

    Il cacao (Theobroma cacao L.) e il cioccolato sono fra i prodotti alimentari più apprezzati nel mondo. Il nome 'Theobroma' significa 'cibo degli dei', sottolineando le quasi divine qualità nutritive del cacao e del cioccolato. I prodotti a base di cacao sono ottenuti a partire dalle fave di cacao, che rappresentano i semi della pianta del cacao, la quale cresce in una zona geografica limitata, di circa 20 gradi a nord e a sud dell'equatore. I prodotti a base di cioccolato sono ottenuti con un...

  9. Modified Atmosphere Packaging and Biodeterioration of Plantain ...

    African Journals Online (AJOL)

    Fruits of two local plantain cultivars and a disease-resistant tetraploid hybrid were subjected to modified atmosphere packaging. The same organisms namely Colletotricum musae, Botryodiplodia theobromae, Fusarium monilifomae, Aspergillus niger and Aspergillus flavus, were isolated from the local cultivars and the ...

  10. Combination of RNAseq and SNP nanofluidic array reveals the center of genetic diversity of cacao pathogen Moniliophthora roreri in the upper Magdalena Valley of Colombia and its clonality

    Science.gov (United States)

    Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR) disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population ma...

  11. Nitrogen forms and levels influence on growth and nutrition of cacao

    Science.gov (United States)

    Ammonium and nitrate are the major forms of N present in tropical soils. A climatically controlled growth chamber experiment was conducted to assess the influence of forms (NO3-, NH4+, and mix of NO3- + NH4+) and levels (1.5 to 12.0 mM) of N on the growth and nutrition of cacao (Theobroma cacao L). ...

  12. Unexpected Genome Variability at Multiple Loci Suggests Cacao Swollen Shoot Virus Comprises Multiple, Divergent Molecular Variants.

    Science.gov (United States)

    Cacao swollen shoot virus (CSSV) [Badnavirus, Caulimoviridae] causes swollen shoot disease of Theobroma cacao L. in West Africa. Since ~2000, various diagnostic tests have failed to detect CSSV in ~50-70% of symptomatic cacao plants, suggesting the possible emergence of new, previously uncharacteriz...

  13. Yield performance and bean quality traits of cacao propagated by grafting and somatic embryo-derived cuttings

    Science.gov (United States)

    Cacao (Theobroma cacao) has great potential as a component of a small tropical farming system. It adapts to a wide range of soils of climatic conditions, grows well under minimum tillage, adapts to temporary intercropping, has the potential of being sold in local and export markets and the pods are ...

  14. Macro and micro nutrient uptake parameters and use efficiency in cacao genotypes influenced by deficient to excess levels of soil K

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important economic crop for many of the tropical countries. Adequate levels of soil K are essential for good growth and achieving high cocoa bean yields. Soils under cacao invariably have low levels of plant available K to support good cacao growth. Growth chamber ex...

  15. Horticultural traits associated with cacao accessions recommended for Puerto Rico

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important agricultural product from which the international chocolate industry is based upon. Increasing demand for chocolate, especially in emerging markets in Asia, coupled with reduced worldwide production has led to shortfalls in cacao ‘bean’ supplies. Deficits...

  16. Origin, dispersal and current global distribution of cacao genetic diversity

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is cultivated globally as the unique source of cocoa butter and powder for the confectionery industries. In spite of its economical importance, cocoa was and continues to be dominantly produced in low-input and low-output systems. Production constraints, including depletio...

  17. Coffee vs. Cacao: A Case Study from the Vietnamese Central Highlands

    Science.gov (United States)

    Ha, Dang Thanh; Shively, Gerald

    2005-01-01

    Mr. Nam, the vice chair of a village in Dak Lak province of Vietnam, was keen to protect farmers in his village from the sharp decline in prices of coffee ("Coffea canephora" Pierre ex Froehner). He did this by encouraging farmers in his village to plant cacao ("Theobroma cacao" L. subsp. "cacao"). Cacao was suitable…

  18. Cacao genetic resources research at the USDA-ARS Tropical Agriculture Research Station, Mayaguez, Puerto Rico

    Science.gov (United States)

    The current USDA ARS Tropical Agriculture Research Station’s (TARS) cacao (Theobroma cacao L.) collection in Mayaguez, Puerto Rico, consists of 262 clonally propagated accessions. Each accession is represented by six individual trees grafted onto a common ‘Amelonado’ seedling rootstock and planted ...

  19. Evaluation of soil amendments as a remediation alternative for cadmium contaminated soils under cacao plantations

    Science.gov (United States)

    Elevated plant-available cadmium (Cd) in soils results in contamination to cacao (Theobroma cacao L) beans. Effectiveness of vermicompost and zeolite in reducing available Cd in three cacao-growing soils was studied under laboratory conditions. Sorption-desorption experiments were conducted in soils...

  20. Phytophthora megakarya and P. palmivora, closely related causal agents of cacao black pod induce similar reactions when infecting pods of a susceptible cacao genotype

    Science.gov (United States)

    Phytophthora megakarya (Pmeg) and Phytophthora palmivora (Ppal) cause black pod rot of Theobroma cacao. Of these two clade 4 species; Pmeg is more virulent and is displacing Ppal on cacao in many cacao production areas in Africa. To understand the advantages Pmeg has over Ppal, we compared symptom...

  1. Soil physical and chemical properties of cacao farms in the south western region of cameroon

    Science.gov (United States)

    The low macro nutrient content (K, Ca and Mg) in soils under cacao is one of the major causes of the poor cacao (Theobroma cacao L) yields. Efforts were made to assess the major physical and chemical properties of soils from some important cacao zones of the South West Region of Cameroon in order t...

  2. Cocoa/Cotton Comparative Genomics

    Science.gov (United States)

    With genome sequence from two members of the Malvaceae family recently made available, we are exploring syntenic relationships, gene content, and evolutionary trajectories between the cacao and cotton genomes. An assembly of cacao (Theobroma cacao) using Illumina and 454 sequence technology yielded ...

  3. Microsatellite-aided detection of genetic redundancy improves management of the International Cocoa Genebank, Trinidad

    Science.gov (United States)

    Cacao (Theobroma cacao L.), the tree from which cocoa butter and chocolate is derived, is conserved in field genebanks. The largest of these ex situ collections in the public domain is the International Cocoa Genebank, Trinidad (ICG,T). Reduction of genetic redundancy is essential to improve the acc...

  4. Accurate determination of genetic identity for a single cacao bean, using molecular markers with a nanofluidic system, ensures cocoa authenticity and traceability

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is an important tropical crop since it is the source of cocoa butter and powder for the confectionery industry. Production and marketing of premium high-value fine flavored cacao provide opportunities for cacao growers, the chocolate industry and consumers. The higher far...

  5. Impact of soils and cropping systems on composition of mineral elements of dry cacao beans

    Science.gov (United States)

    In view of its high economic value, cacao (Theobroma cacao L.) researchers are seeking technological innovations that increase production and improve the quality of cacao beans. The objective of this study was to characterize the mineral (P, K, Ca, Mg, Si, Fe, Mn, Zn, Cu, Cd, Ba) composition of caca...

  6. Genetic identity, ancestry and parentage in farmer selections of cacao from Aceh, Indonesia revealed by single nucleotide polymorphism (SNP) markers

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is the source of cocoa powder and butter used for chocolate and this species originated in the rainforests of South America. Indonesia is the 3rd largest cacao producer in the world with an annual cacao output of 0.55 million tons. Knowledge of on-farm genetic diversity is...

  7. Impacts of Climate Change and Climate Variability on Cocoa ...

    African Journals Online (AJOL)

    Impacts of Climate Change and Climate Variability on Cocoa ( Theobroma Cacao ) Yields in Meme Division, South West Region of Cameroon. ... Farm selection was based on age, consistency of sizes and management practices in an attempt to keep the factors affecting cocoa yield constant. Data on cocoa yield, flowering, ...

  8. Better chocolate through genomics

    Science.gov (United States)

    Theobroma cacao, the cacao or chocolate tree, is a tropical understory tree whose seeds are used to make chocolate. And like any important crop, cacao is the subject of much research. On September 15, 2010, scientists publicly released a preliminary sequence of the cacao genome--which contains all o...

  9. How dark chocolate is processed

    Science.gov (United States)

    This month’s column will continue the theme of “How Is It Processed?” The column will focus on dark chocolate. The botanical name for the cacao tree is Theobroma cacao, which literally means “food of the Gods.” Dark chocolate is both delicious and nutritious. Production of dark chocolate will be des...

  10. Effect of liquid nitrogen storage time on the survival and ...

    African Journals Online (AJOL)

    Investigations were undertaken on the effect of liquid nitrogen (LN) storage time on survival and regeneration of somatic embryos of cocoa (Theobroma cacao l.). Somatic embryos from different cocoa genotypes (AMAZ 3-2, AMAZ 10-1, AMAZ 12, SIAL 93, and IMC 14) at 15.45% moisture content were cryopreserved in LN ...

  11. Molecular and metabolic changes of cherelle wilt of cacao and its effect on Moniliophthora roreri

    Science.gov (United States)

    The seeds of Theobroma cacao L. pods are processed into cocoa products. Cherelle wilt is physiological thinning of young pods that result in loss of potential pods. Cherelle wilt first occurs 50 days after pollination (DAP) and a second thinning occurs around 70 DAP. Cherelles are also highly sus...

  12. Microbial ecology of the cocoa chain : quality aspects and insight into heat-resistant bacterial spores

    NARCIS (Netherlands)

    Líma, L.J.R.

    2012-01-01

    Cocoa beans (Theobroma cacaoL.) are the basis for chocolate and cocoa powder production. The first step in the production of these food products consists of a spontaneous fermentation of the beans in the tropical producing countries, in order to allow the formation of the essential

  13. The Graft Copolymerisation of Acrylamide onto Cellulose using ...

    African Journals Online (AJOL)

    DR. MIKE HORSFALL

    ABSTRACT: Graft copolymers of acrylamide onto holocellulose derived from cocoa. (Theobroma cacao) wood meal have been produced using hydroquinone enhanced Fe2+/H2O2 redox system. The addition of hydroquinone to the redox system affected the effectiveness of the redox system to initiate graft copolymer ...

  14. The relic Criollo cacao in Belize- genetic diversity and relationship with Trinitario and other cacao clones held in the International Cocoa Genebank, Trinidad

    Science.gov (United States)

    Cacao (Theobroma cacao L.) is native to the South American rainforest but it was domesticated in Mesoamerica. The relic Criollo cocoa in Belize has been well known in the premium chocolate market for its high-quality. Knowledge of genetic diversity in this variety is essential for efficient conserva...

  15. Fungal Planet description sheets: 371 - 399

    NARCIS (Netherlands)

    Crous, P W; Wingfield, M J; Le Roux, J J; Richardson, D M; Strasberg, D; Shivas, R G; Alvarado, P; Edwards, J; Moreno, G; Sharma, R; Sonawane, M S; Tan, Y P; Altes, A; Barasubiye, T; Barnes, C W; Blanchette, R A; Boertmann, D; Bogo, A; Carlavilla, J R; Cheewangkoon, R; Daniel, R; de Beer, Z W; de Jesús Yáñez-Morales, M; Duong, T A; Fernandez-Vicente, J; Geering, A D W; Guest, D I; Held, B W; Heykoop, M; Hubka, V; Ismail, A M; Kajale, S C; Khemmuk, W; Kolarik, M; Kurli, R; Lebeuf, R; Levesque, C A; Lombard, L; Magista, D; Manjon, J L; Marincowitz, S; Mohedano, J M; Novakova, A; Oberlies, N H; Otto, E C; Paguigan, N D; Pascoe, I G; Perez-Butron, J L; Perrone, G; Rahi, P; Raja, H A; Rintoul, T; Sanhueza, R M V; Scarlett, K; Shouche, Y S; Shuttleworth, L A; Taylor, P W J; Thorn, R G; Vawdrey, L L; Solano-Vidal, R; Voitk, A; Wong, P T W; Wood, A R; Zamora, J C; Groenewald, J Z

    2015-01-01

    Novel species of fungi described in the present study include the following from Australia: Neoseptorioides eucalypti gen. and sp. nov. from Eucalyptus radiata leaves, Phytophthora gondwanensis from soil, Diaporthe tulliensis from rotted stem ends of Theobroma cacao fruit, Diaporthe vawdreyi from

  16. Antifungal Activities of Some Leaf Extracts on Seed-borne Fungi of ...

    African Journals Online (AJOL)

    The efficacy of leaf extracts of basil (Ocimum basilicum), bitter leaf (Vernonia amygdalina), lemon grass (Cymbopogen citratus), neem (Azadirachta indica) and paw-paw (Carica papaya) on major seed-borne fungi: Aspergillus niger, Aspergillus flavus, Botryodiplodia theobromae and Fusarium moniliforme of African yam ...

  17. International Journal of Biological and Chemical Sciences - Vol 8 ...

    African Journals Online (AJOL)

    Phenolic content and heritability of resistance in four hybrid populations of Theobroma cacao L. after leaves inoculation with Phytophthora megakarya Bras. et Grif · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ML Ondobo, P Effa Onomo, PF Djocgoue, J Manga ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 391 ... Journal of the Ghana Science Association. ... Vol 1, No 1 (1998), Lindane and Endosulfan residues in water and fish in the Ashanti Region of Ghana, Abstract. S. Osafo Acquaah, E. Frempong ... and Yam Isolates of Botryodiplodia theobromae in Ghana, Abstract. P Twumasi, E Moses, G Ohene-Mensah.

  19. Biotechnology for cocoa pod borer resistance in cocoa

    NARCIS (Netherlands)

    Chaidamsari, T.

    2005-01-01

    The cocoa tree ( Theobroma cacao L.) produces the beans that are the source of cacao, the basis for chocolate production, and an important commodity crop in South America, West Africa, and Southeast Asia.Cocoa Pod

  20. Tree diversity and canopy cover in cocoa systems in Ghana

    DEFF Research Database (Denmark)

    Asare, Richard; Ræbild, Anders

    2016-01-01

    Cocoa (Theobroma cacao L.) growing systems in Ghana and West Africa consist of diverse tree species and densities.This study was conducted to determine factors that influence tree species configurations and how tree characteristics affect canopy cover in cocoa farms. Eighty-six farmers...

  1. Isolation and characterization of an AGAMOUS homologue from cocoa

    NARCIS (Netherlands)

    Chaidamsari, T.; Sugiarit, H.; Santoso, D.; Angenent, G.C.; Maagd, de R.A.

    2006-01-01

    We report the cloning of a cDNA from TcAG, an AG (Arabidopsis thaliana MADS-box C-type transcription factor gene AGAMOUS) homologue from cocoa (Theobroma cacao L.). TcAG was in the cocoa flower expressed primarily in stamens and ovaries, comparable to AG in Arabidopsis. Additionally, we found that

  2. Bio-deterioration of sweet potato (ipomoea batatas lam) in storage ...

    African Journals Online (AJOL)

    Michael Horsfall

    ABSTRACT: The biodeterioration of sweet potato (Ipomoea batatas) was investigated at Port. Harcourt, south southern Nigeria. Aspergillus niger, Fusarium oxysporum, Rhizopus stolonifer,. Botryodiplodia theobroma and Penicillium sp. were found to be associated with deteriorating sweet potato tubers and used for ...

  3. Detection and Management of Mango Dieback Disease in the United Arab Emirates

    Science.gov (United States)

    Saeed, Esam Eldin; Sham, Arjun; A. Al Shurafa, Khawla; S. Al Naqbi, Tahra; Iratni, Rabah; El-Tarabily, Khaled; F. AbuQamar, Synan

    2017-01-01

    Mango is affected by different decline disorders causing significant losses to mango growers. In the United Arab Emirates (UAE), the pathogen was isolated from all tissues sampled from diseased trees affected by Lasiodiplodia theobromae. Symptoms at early stages of the disease included general wilting appearance of mango trees, and dieback of twigs. In advanced stages, the disease symptoms were also characterized by the curling and drying of leaves, leading to complete defoliation of the tree and discolouration of vascular regions of the stems and branches. To substantially reduce the devastating impact of dieback disease on mango, the fungus was first identified based on its morphological and cultural characteristics. Target regions of 5.8S rRNA (ITS) and elongation factor 1-α (EF1-α) genes of the pathogen were amplified and sequenced. We also found that the systemic chemical fungicides, Score®, Cidely® Top, and Penthiopyrad®, significantly inhibited the mycelial growth of L. theobromae both in vitro and in the greenhouse. Cidely® Top proved to be a highly effective fungicide against L. theobromae dieback disease also under field conditions. Altogether, the morphology of the fruiting structures, molecular identification and pathogenicity tests confirm that the causal agent of the mango dieback disease in the UAE is L. theobromae. PMID:29053600

  4. Biodeterioration of the African star apple (Chrysophylum albidum) in ...

    African Journals Online (AJOL)

    The biodeterioration of the African star apple fruits in storage was investigated at Ibadan, southwestern Nigeria. Eight fungal isolates were found associated with the deteriorating fruits. The fungi are Botryodiplodia theobromae, Rhizopus stolonifer, Aspergillus niger, A. tamarii, A. flavus, Fusarium spp, Penicilium spp and ...

  5. Variation of β-1,3-Glucanase, Chitinase and Polyphenoloxidase

    African Journals Online (AJOL)

    Cacao (Theobroma cacao L.) clones that differ in susceptibility to black pod disease were analysed for response to stress induced by pod inoculation with the fungus Phytophthora megakarya Braz. Et Griff. Fungal inoculation significantly stimulated β-1,3-glucanase activity in both soluble and ionically-bound fractions of the ...

  6. Protective effect and expression of defense-related ESTs induced by ...

    African Journals Online (AJOL)

    Witches' broom disease (WBD), caused by the fungus Moniliophthora perniciosa, is one of the main diseases in cocoa (Theobroma cacao) and has caused severe economic losses. Integrated disease management has been the focus for its control and therefore, the identification of new inducers of plant resistance is ...

  7. Mass Loss and Nutrient Release through Leaching in Tectona ...

    African Journals Online (AJOL)

    Tectona grandis and Theobroma cacao are common plantation tree crops planted to replace natural forest in Nigeria because of their faster growth rate and economic values. The changes in land use have marked effects on the soil nutrients and organic matter stock, thereby affecting physical, chemical properties and soil ...

  8. Biological control of Black Pod Disease and Seedling Blight of cacao caused by Phytophthora Species using Trichoderma from Aceh Sumatra

    Science.gov (United States)

    The cocoa tree, Theobroma cacao L., suffers large yield losses in Aceh Indonesia to the disease black pod rot, caused by Phytophthora spp. Despite having the largest area under cacao production in Sumatra, farmers in the Aceh region have low overall production because of losses to insect pests and b...

  9. Physico-chemical properties of topsoil under indigenous and exotic ...

    African Journals Online (AJOL)

    This study evaluated selected physico-chemical properties of topsoil under monoculture plantation of an indigenous tree species - Nauclea diderrichii, and those of four exotic tree species – Theobroma cacao, Gmelina arborea, Pinus caribaea and Tectona grandis, located in Omo Biosphere Reserve, Ogun State, Nigeria.

  10. The Search for Value and Meaning in the Cocoa Supply Chain in Costa Rica

    Science.gov (United States)

    Jessica Haynes; Frederick Cubbage; D. Evan Mercer; Erin Sills

    2012-01-01

    Qualitative interviews with participants in the cocoa (Theobroma cacao) supply chain in Costa Rica and the United States were conducted and supplemented with an analysis of the marketing literature to examine the prospects of organic and Fairtrade certification for enhancing environmentally and socially responsible trade of cocoa from Costa Rica. Respondents were...

  11. Die-back of kiaat ( Pterocarpus angolensis ) in southern Africa: a ...

    African Journals Online (AJOL)

    A pathology study conducted at three locations in South Africa on diseased and dying trees resulted in the collection of 199 fungal isolates; comprising saprophytic species such as Candida, Penicillium and Humicola, and potentially pathogenic species such as Lasiodiplodia theobromae, Cytospora spp. and Fusarium spp.

  12. Rapidly disintegrating vagina retentive cream suppositories of progesterone: development, patient satisfaction and in vitro/in vivo studies.

    Science.gov (United States)

    Bendas, Ehab Rasmy; Basalious, Emad B

    2016-01-01

    Our objective was to develop novel vagina retentive cream suppositories (VRCS) of progesterone having rapid disintegration and good vaginal retention. VRCS of progesterone were prepared using oil in water (o/w) emulsion of mineral oil or theobroma oil in hard fat and compared with conventional vaginal suppositories (CVS) prepared by hard fat. VRCS formulations were tested for content uniformity, disintegration, melting range, in vitro release and stability studies. The most stable formulation (VRCS I) was subjected to scaling-up manufacturing and patients' satisfaction test. The rapid disintegration, good retentive properties are applicable through the inclusion of emulsified theobroma oil rather than hydrophilic surfactant into the hard fat bases. The release profile of progesterone from VRCS I showed a biphasic pattern due to the formation of progesterone reservoir in the emulsified theobroma oil. All volunteers involved in patients' satisfaction test showed high satisfactory response to the tested formulation (VRCS). The in vivo pharmacokinetic study suggests that VRCS of progesterone provided higher rate and extent of absorption compared to hard fat based suppositories. Our results proposed that emulsified theobroma oil could be promising to solve the problems of poor patients' satisfaction and variability of drug absorption associated with hard fat suppositories.

  13. Effects of interacting variables on the release properties of ...

    African Journals Online (AJOL)

    Purpose: The individual and interaction effects of formulation variables on the release of suppositories were investigated using a 23 factorial experimental design. The variables studied were nature of base (B), type of drug (D), and presence of surfactant (S). Method: Suppositories were formulated with theobroma oil and ...

  14. Soil microbial communities under cacao agroforestry and cover crop systems in Peru

    Science.gov (United States)

    Cacao (Theobroma cacao) trees are grown in tropical regions worldwide for chocolate production. We studied the effects of agroforestry management systems and cover cropping on soil microbial communities under cacao in two different replicated field experiments in Peru. Two agroforestry systems, Imp...

  15. Variability and correlation of physical attributes of soils cultivated with cacao trees in two climate zones in southern Bahia, Brazil

    Science.gov (United States)

    Cacao (Theobroma cacao) is a very important crop in southern Bahia, Brazil, which needs good climate and soil conditions and management for great productivity. In this region, the culture is developed in a large variety of soils, which indicates differentiated products. The aim of this study was to ...

  16. Author Details

    African Journals Online (AJOL)

    Osafo, E L. Vol 47, No 1 (2014) - Articles Some blood indices in finisher broiler chickens fed cocoa pod husk (Theobroma cacao L.) fermented with Pleurotus ostreatus or treated with enzymes as ingredients in their diets. Abstract. ISSN: 0855-0042. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 283 ... Vol 4 (2004): Supplement, Polyphenol oxidase and peroxidase analysis in newly selected clones of Theobroma cacao L. after inoculation with Phytophthora megakarya bra and grif, Abstract PDF. Djioda Joseph Nankeu, Annie Ewane, Thaddee Boudjeko, Nicolas Niemenak, Pierre François Djocgoue, ...

  18. Influence of plant growth regulators on somatic embryos induction ...

    African Journals Online (AJOL)

    TANOH

    2013-04-17

    Theobroma cacao L.) using Thidiazuron. In vitro Cell Dev. Biol. 34:293-299. Michaux-Ferrière N, Carron MP (1989). Histology of early somatic embryogenesis in Hevea brasiliensis. The importance of timing of subculturing. Plant Cell Tiss ...

  19. Separation and characterization of phenolic compounds from ...

    African Journals Online (AJOL)

    Attioua

    2013-07-03

    Jul 3, 2013 ... (Theobroma cacao). J. Mass Spectrom. 38:35-42. Sanchez R, Jauregui LR, Viladomat B, Codina (2004). Qualitative analysis of phenolic compounds in apple Pomace using liquid chromatography coupled to mass spectrometry in tandem mode. Rapid Communun Mass Spectrom. 18:553-563. Saulo LDS ...

  20. Mycological evaluation of a ground cocoa-based beverage ...

    African Journals Online (AJOL)

    Cocoa beans (Theobroma cacao) are processed into cocoa beverage through fermentation, drying, roasting and grounding of the seed to powder. The mycological quality of 39 samples of different brand of these cocoa – based beverage referred to as 'eruku oshodi' collected from 3 different markets in south – west Nigeria ...

  1. Effect of pre-budwood collection treatment on budding success in ...

    African Journals Online (AJOL)

    The inconsistencies in success of budding exercises pose great problem in the rapid multiplication of desirable genotypes for germplasm, clonal plot and seed garden establishment in cacao, Theobroma cacao L. This study was carried out at Cocoa Research Institute of Nigeria, Ibadan to determine the effects of ...

  2. Evaluation of fertilizer application on some peasant cocoa farms in ...

    African Journals Online (AJOL)

    Theobroma cacao L.) on peasant farms in Ghana. The objective of the trial is to evaluate the effect of fertilizer application on yields of cocoa (T. cacao L.) under peasant farmers' management in Ghana with the aim of introducing fertilizers to ...

  3. Highly efficient production of nootkatone, the grapefruit aroma from valencene, by biotransformation.

    Science.gov (United States)

    Furusawa, Mai; Hashimoto, Toshihiro; Noma, Yoshiaki; Asakawa, Yoshinori

    2005-11-01

    Nootkatone, the most important and expensive aromatic of grapefruit, decreases the somatic fat ratio, and thus its demand is increasing in the cosmetic and fiber sectors. A sesquiterpene hydrocarbon, (+)-valencene, which is cheaply obtained from Valencia orange, was biotransformed by the green algae Chlorella species and fungi such as Mucor species, Botryosphaeria dothidea, and Botryodiplodia theobromae to afford nootkatone in high yield.

  4. 1876-IJBCS-Article-Kicho Denis Yapo

    African Journals Online (AJOL)

    hp

    Polyphenols have gained much interest recently due to their antioxidant capacity and possible benefits to human health. Cocoa (Theobroma cacao) is a rich source of polyphenols and has higher antioxidant activity than teas and red wines. Cocoa and its derived products contain different types of polyphenols and possess.

  5. Concentration of Cadmium in Cacao Beans and its Relationship with Soil Cadmium in Southern Ecuador

    Science.gov (United States)

    The concentration of cadmium (Cd) in cacao (Theobroma cacao, L.) beans above a critical level (0.6 mg kg-1 established by the European Union) has raised concerns of safety in the consumption of cacao-based chocolate (dark chocolate). Currently, little is available regarding Cd concentration in soil,...

  6. Variability of in vitro and phenological behaviours of cocoa hybrids ...

    African Journals Online (AJOL)

    Cultivated cocoa species (Theobroma cacao L.) is originated from tropical rainforests of South and Central America. Its fermented and dried seeds constitute the raw material for the chocolate manufacture. In order to analyse the variability of the in vitro and phenological behaviours of 6 cocoa hybrids, the typological and ...

  7. Aspergillus oryzae NRRL 35191 from coffee, a non-toxigenic endophyte with the ability to synthesize kojic acid

    Science.gov (United States)

    Aspergillus oryzae was isolated as an endophyte from coffee leaves and found to produce kojic acid in culture. When inoculated in cacao seedlings (Theobroma cacao L.), A. oryzae grew endophytically and synthesize kojic acid in planta. Cacao seedlings inoculated with A. oryzae produced higher levels...

  8. The antagonistic activity of Trichoderma virens strain TvSUT10 ...

    African Journals Online (AJOL)

    In this current study, the beneficial filamentous fungi, Trichoderma virens, isolated from cassava field were investigated for antagonistic mode of action against Lasiodiplodia theobromae, the causal agent of cassava stem rot in Thailand. In vitro screening using the dual culture technique was undertaken to assess the ...

  9. Antifungal Effects Of Botanical Leaf Extracts On Tuber Rots Of Yam ...

    African Journals Online (AJOL)

    The fungicidal effects of dry and fresh leaf extracts of Axardirachta indica (L) and Ocimum grattissimum on the rot of yam tubers were investigated. Fusaruim oxysporium, Rhjzopus stolonifer, Botryodiplodia theobromae and Aspergillus Niger (root pathogens) were isolated from the rotted yam. Both dry and fresh leaf extracts ...

  10. Bio-deterioration of breadfruit (Artocarpus Communis) in storage ...

    African Journals Online (AJOL)

    The bio-deterioration of breadfruit in storage and its effects on the nutrient composition of the fruit was investigated at Ibadan, Southwestern Nigeria. Freshly dropped fruits were stored under laboratory conditions for a period of 9 days. Aspergillus niger, Rhizopus stolonifer, Botryodiplodia theobromae, Mycovellosiella fulva, ...

  11. Vascular Streak Dieback of cacao in Southeast Asia and Melanesia: in planta detection of the pathogen and a new taxonomy.

    Science.gov (United States)

    Samuels, Gary J; Ismaiel, Adnan; Rosmana, Ade; Junaid, Muhammad; Guest, David; McMahon, Peter; Keane, Philip; Purwantara, Agus; Lambert, Smilja; Rodriguez-Carres, Marianela; Cubeta, Marc A

    2012-01-01

    Vascular Streak Dieback (VSD) disease of cacao (Theobroma cacao) in Southeast Asia and Melanesia is caused by a basidiomycete (Ceratobasidiales) fungus Oncobasidium theobromae (syn. =Thanatephorus theobromae). The most characteristic symptoms of the disease are green-spotted leaf chlorosis or, commonly since about 2004, necrotic blotches, followed by senescence of leaves beginning on the second or third flush behind the shoot apex, and blackening of infected xylem in the vascular traces at the leaf scars resulting from the abscission of infected leaves. Eventually the shoot apex is killed and infected branches die. In susceptible cacao the fungus may grow through the xylem down into the main stem and kill a mature cacao tree. Infections in the stem of young plants prior to the formation of the first 3-4 lateral branches usually kill the plant. Basidiospores released from corticioid basidiomata developed on leaf scars or along cracks in the main vein of infected leaves infect young leaves. The pathogen commonly infects cacao but there are rare reports from avocado. As both crops are introduced to the region, the pathogen is suspected to occur asymptomatically in native vegetation. The pathogen is readily isolated but cultures cannot be maintained. In this study, DNA was extracted from pure cultures of O. theobromae obtained from infected cacao plants sampled from Indonesia. The internal transcribed spacer region (ITS), consisting of ITS1, 5.8S ribosomal RNA and ITS2, and a portion of nuclear large subunit (LSU) were sequenced. Phylogenetic analysis of ITS sequences placed O. theobromae sister to Ceratobasidium anastomosis groups AG-A, AG-Bo, and AG-K with high posterior probability. Therefore the new combination Ceratobasidium theobromae is proposed. A PCR-based protocol was developed to detect and identify C. theobromae in plant tissue of cacao enabling early detection of the pathogen in plants. A second species of Ceratobasidium, Ceratobasidium ramicola

  12. Variación de las propiedades físicas de la grasa de cacao con la temperatura

    OpenAIRE

    de Dios Alvarado, Juan

    1994-01-01

    Values of physical properties determined at different temperatures in fat extracted from fresh cacao seeds (Theobroma cacao) are presented. Linear relationships define the effect of temperature on the refraction index, density and surface tension, a logarithmic function was established for viscosity. The values of density and viscosity are used to determine the coefficient of volumetric thermal expansion and activation energy, respectively. Data of specific heat, thermal diffusivity and therm...

  13. Ecological Diversity of Soil Fauna as Ecosystem Engineers in Small-Holder Cocoa Plantation in South Konawe

    OpenAIRE

    Laode Muhammad Harjoni Kilowasid; Tati Suryati Syamsudin; Franciscus Xaverius Susilo; Endah Sulistyawati

    2012-01-01

    Taxa diversity within soil fauna functional groups can affected ecosystem functioning such as ecosystem engineers,which influence decomposition and nutrient cycling. The objective of this study is to describe ecological diversityvariation within soil fauna as ecosystem engineers in soil ecosystem of cocoa (Theobroma cacao L.) plantation.Sampling was conducted during one year period from five different ages of plantation. Soil fauna removed from soilcore using hand sorting methods. A total of ...

  14. Understanding sensory and analytical relationships in cocoa-based products

    OpenAIRE

    Sundara, Ramana; Festring, Daniel

    2015-01-01

    The distinctive flavour of cocoa or chocolate made from fermented and roasted cocoa beans (Theobroma cacao L.) is familiar to everybody in the cocoa consuming world. The industry differentiates between cocoa processing and chocolate manufacturing. Cocoa processing covers the activity of converting the beans into nib, liquor, butter, cake and powder. Chocolate manufacturing covers the blending and refining of cocoa liquor, cocoa butter and various optional ingredients, such as milk...

  15. Combination of RNAseq and SNP nanofluidic array reveals the center of genetic diversity of cacao pathogen Moniliophthora roreri in the upper Magdalena Valley of Colombia and its clonality

    OpenAIRE

    Ali, Shahin S.; Shao, Jonathan; Strem, Mary D.; Phillips-Mora, Wilberth; Zhang, Dapeng; Meinhardt, Lyndel W.; Bailey, Bryan A.

    2015-01-01

    Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR) disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population may allow the population to adapt to changing environmental conditions and adapt to enhanced resistance in the host plant. The present study developed single nucleotide polymorphism (SNP) markers fro...

  16. Moniliophthora roreri (Cif y Par) Evans et al. en el cultivo de cacao

    OpenAIRE

    Sánchez Mora, Fernando David; Garcés Fiallos, Felipe Rafael

    2012-01-01

    More than a century, cacao (Theobroma cacao L.) in Ecuador has been an important source of income for farmers and currency for the country, becoming one of the biggest exporters worldwide. Then, gradually lost that status due to the attack of diseases, including moniliasis caused by [Moniliophthora roreri (Cif and Par) Evans et al.]. It can cause damage of up to 80% in production. Currently there is little scientific date information on its occurrence, symptoms, etiology, epidemiology, life c...

  17. Biotechnology for cocoa pod borer resistance in cocoa

    OpenAIRE

    Chaidamsari, T.

    2005-01-01

    The cocoa tree ( Theobroma cacao L.) produces the beans that are the source of cacao, the basis for chocolate production, and an important commodity crop in South America, West Africa, and Southeast Asia.Cocoa Pod Borer (CPB,( Conopomorpha cramerella)has been the single most important limiting factor for cacao production in Southeast Asia.So far, there has been no single cost effective and environmentally safe way to control this pest.This thesis describes the first steps in a biotechnologica...

  18. Efecto preventivo de un extracto de cacao enriquecido en polifenoles sobre ratas con alteraciones endocrino metabólicas inducidas por sacarosa

    OpenAIRE

    Villagarcía, Hernán Gonzalo; González Arbeláez, Luisa Fernanda; Castro, María Cecilia; Ríos, José Luis; Massa, María Laura; Schinella, Guillermo Raúl; Francini, Flavio

    2016-01-01

    Existe una creciente evidencia de que el consumo de ciertos alimentos, suplementos alimenticios o bebidas tradicionales puede reducir el daño oxidativo en diferentes sistemas biológicos. Alimentos derivados del cacao, tales como polvos de cacao, chocolate y otros productos relacionado con el cacao son alimentos ricos en polifenoles derivados de las semillas fermentadas, tostados y procesados industrialmente de Theobroma cacao L. (Sterculiaceae). Estos productos, consumidos en todo el mundo...

  19. TOTAL POLYPHENOLS ANALYSIS OF MATURE SEEDS AND TISSUE CULTURES OF SOME COLOMBIAN COCOA VARIETIES

    OpenAIRE

    ROJAS, LUISA F.; LONDOÑO, JULIÁN; GALLEGO, ADRIANA M.; HERRERA, ANDREA L.; AGUILERA, CAROLINA; ATEHORTÚA, LUCÍA

    2008-01-01

    The aim of this research was to establish cocoa (Theobroma cacao) cell suspensions culture to analyze the total polyphenols content for two Colombian cocoa varieties and to compare the results with the total polyphenols content from the same field varieties. The final results showed that it is possible to produce big amount of cocoa cell biomass able to synthesize the metabolites without loosing its organoleptic properties (smell, color, and flavor), and to produce an acceptable content of to...

  20. CACAO TO COCOA TO CHOCOLATE: HEALTHY FOOD?

    OpenAIRE

    ROYA KELISHADI

    2010-01-01

    ABSTRACT Chocolate is derived from cocoa beans - the fruit of the cacao tree or Theobroma cacao (the latin term: food of the gods). Recent published articles demonstrate that the quality and quantity of the antioxidants in cocoa and chocolate are very high and their flavonoids are believed to reduce the number of free radicals in the body that contribute to medical problems, such as cardiovascular disease and cancer and also to offer some anti-aging health benefits. Cocoa can lower the leukot...

  1. Moniliophthora perniciosa Necrosis- and Ethylene-Inducing Protein 2 (MpNep2) as a Metastable Dimer in Solution: Structural and Functional Implications

    OpenAIRE

    de Oliveira, Guilherme A. P.; Pereira, Elen G.; Dias, Cristiano V.; Souza, Theo L. F.; Ferretti, Giulia D. S.; Cordeiro, Yraima; Camillo, Luciana R.; Cascardo, Júlio; Almeida, Fabio C.; Valente, Ana Paula; Silva, Jerson L.

    2012-01-01

    Understanding how Nep-like proteins (NLPs) behave during the cell cycle and disease progression of plant pathogenic oomycetes, fungi and bacteria is crucial in light of compelling evidence that these proteins play a role in Witches` Broom Disease (WBD) of Theobroma cacao, one of the most important phytopathological problems to afflict the Southern Hemisphere. The crystal structure of MpNep2, a member of the NLP family and the causal agent of WBD, revealed the key elements for its activity. Th...

  2. KOKO KL.xps

    African Journals Online (AJOL)

    HP Pro 2000

    En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point.

  3. (Hétéroptères) A

    African Journals Online (AJOL)

    AISA

    cacaoyers dans ces plantations a été comprise entre 1525 et 2225 plantes/ha. Tous les cacaoyers rencontrés dans les parcelles appartiennent à l'espèce Theobroma cacao et en majorité à la variété «Amelonado Ouest. Africain». Les Miridae sont des insectes déprédateurs du cacaoyer. Les femelles pondent en moyenne.

  4. Physiological attributes of fungi associated with stem end rot of mango (mangifera indica l.) cultivars in postharvest fruit losses

    International Nuclear Information System (INIS)

    Maqsood, A.; Nafees, M.; Ashraf, I.; Qureshi, R.

    2014-01-01

    Stem end rot majorly contribute in post-harvest losses of mango during storage. Maximum disease incidence (70%) was recorded in Sindhari cultivar followed by Chaunsa (64%), Fajri (62.5%) and 50% in both Langra and Anwar ratol. In vitro studies were carried out to identifyfungal pathogens responsible for rotting and decaying mango fruits during storage along with isolation and testing their pathogencity on healthy fruits. Results revealed that all selected commercial mango varieties infected by stem end rot. Colletotrichum gloeosporioides, Lasidodiplodia theobromae, Alternaria alternate, Aspergillus niger, Dothiorella domonicana were identified from Sindhri mango fruits, in which of C. gloeosporioides was found the most prevalent. Phomopsis mangiferae, Botryodiplodia theobromae, Altrnaria spp. Aspergillus niger, A. flavis were found in Chaunsa and Phomopsis mangiferae was most prevalent, while Botryodiplodia theobromae caused infection to locally cosumed Fajri variety. Effect of abiotic factors like pH, temperature, light intensity and carbon sources were tested against these isolates. The most efficient carbon source was glucose, which supported the maximum growth of the P. mangiferae and L. Theobromae, while C. gloeosporioides had maximum growth on lactose. All fungi had maximum growth at pH range of 6-6.5 and temperature range of 25-30 degree C on PDA medium. Alternate cycles of 12hr light and 12 hr darkness resulted maximum mycelial growth as compared to the 24 hour continuous exposure to either dark or light. Susceptibility of fungi with cultivars and intensity of spread under specific abiotic conditions provides basic information in this paper to minimize stem end rot of mango in field and storage conditions. (author)

  5. The relevance of theobromine for the beneficial effects of cocoa consumption

    OpenAIRE

    Mart?nez-Pinilla, Eva; O?atibia-Astibia, Ainhoa; Franco, Rafael

    2015-01-01

    Cocoa consumption began in America and in the mid sixteenth Century it quickly spread to Europe. Beyond being considered a pleasant habit due to its rich sweet lingering taste, chocolate was considered a good nutrient and even a medicine. Traditionally, health benefits of cocoa have been related with the high content of antioxidants of Theobroma cocoa beans. However, the direct psychoactive effect due to methylxanthines in cocoa is notable. Theobromine and caffeine, in the proportions found i...

  6. Theobromine up-regulates cerebral brain-derived neurotrophic factor and facilitates motor learning in mice

    OpenAIRE

    Yoneda, Mitsugu; Sugimoto, Naotoshi; Katakura, Masanori; Matsuzaki, Kentaro; Tanigami, Hayate; Yachie, Akihiro; Ohno-Shosaku, Takako; Shido, Osamu

    2017-01-01

    Theobromine, which is a caffeine derivative, is the primary methylxanthine produced by Theobroma cacao. Theobromine works as a phosphodiesterase (PDE) inhibitor to increase intracellular cyclic adenosine monophosphate (cAMP). cAMP activates the cAMP-response element-binding protein (CREB), which is involved in a large variety of brain processes, including the induction of the brain-derived neurotrophic factor (BDNF). BDNF supports cell survival and neuronal functions, including learning and m...

  7. PHYLOGENETIC RELATIONSHIPS AMONG VIETNAMESE COCOA ACCESSIONS USING A NON-CODING REGION OF THE CHLOROPLAST DNA

    OpenAIRE

    Lam Thi, Viet Ha; D.T., Khang; Everaert, Helena; T.N, Dung; P.H.D, Phuoc; H.T., Toan; Dewettinck, Koen; Messens, Kathy

    2017-01-01

    Cocoa (Theobroma cacao L.) cultivation has increased in tropical areas around the world, including Vietnam, due to the high demand of cocoa beans for chocolate production. The genetic diversity of cocoa genotypes is recognized to be complex, however, their phylogenetic relationships need to be clarified. The present study aimed to classify the cocoa genotypes that are imported and cultivated in Vietnam based on a chloroplast DNA region. Sixty-three Vietnamese Cocoa accessions were collected f...

  8. Vitamins in fruits and vegetables of the Amazon. 1. Methods for the determination of β—carotene, tocopherol and ascorbic acid with high performance liquid chromatography (HPLC)

    OpenAIRE

    Marx, F.; Maia, J.G.S.

    1983-01-01

    Summary At the beginning of on inventory of the chemical composition of regional fruits and vegetables of the Amazon, analytical methods were adapted for the high performance liquid chromatography (HPLC) determination of pro-vitamin A (β—carotene), vitamin C (ascorbic acid) and vitamin E (tocopherol) The first analyses indicate as excellent sources of β—carotene, Mauritia flexuosa L., Astrocaryum tucuma Mart. and Cucurbita pepa L.; of asco bic acid Theobroma grandiflorum (Culis ex Spreng.) Sc...

  9. FREQUENCY OF QUIESCENT FUNGI AND POST-HARVEST ALTERNATIVE MANAGEMENT OF STEM END ROT IN PAPAYA

    OpenAIRE

    DANIELA DAMBROS AMARAL; ANA LETICIA ROCHA MONTEIRO; ELIAS INÁCIO DA SILVA; SEVERINA RODRIGUES DE OLIVEIRA LINS; SONIA MARIA ALVES DE OLIVEIRA

    2017-01-01

    The aim of this study was to evaluate the frequency of quiescent fungi and the effect of phosphites under modified atmosphere on Lasiodiplodia theobromae in papaya. The fruits were treated with a range of doses of phosphites and their actions evaluated under conditions of ambient and modified atmosphere. Of the eight fungal genera found, Lasiodiplodia was the most common. No interaction was observed between the evaluated factors and only atmosphere and dose were independently significant. The...

  10. FREQUENCY OF QUIESCENT FUNGI AND POST-HARVEST ALTERNATIVE MANAGEMENT OF STEM END ROT IN PAPAYA

    OpenAIRE

    AMARAL, DANIELA DAMBROS; MONTEIRO, ANA LETICIA ROCHA; SILVA, ELIAS INÁCIO DA; LINS, SEVERINA RODRIGUES DE OLIVEIRA; OLIVEIRA, SONIA MARIA ALVES DE

    2017-01-01

    ABSTRACT The aim of this study was to evaluate the frequency of quiescent fungi and the effect of phosphites under modified atmosphere on Lasiodiplodia theobromae in papaya. The fruits were treated with a range of doses of phosphites and their actions evaluated under conditions of ambient and modified atmosphere. Of the eight fungal genera found, Lasiodiplodia was the most common. No interaction was observed between the evaluated factors and only atmosphere and dose were independently signifi...

  11. Cassia renigera Wall.: novo hospedeiro de Ceratocystis fimbriata Ell. & Halst. Cassia renigera Wall.: a new host of Ceratocystis fimbriata Ell. & Halst.

    Directory of Open Access Journals (Sweden)

    Ivan José Antunes Ribeiro

    1987-01-01

    Full Text Available Ceratocystis fimbriata foi descrito pela primeira vez em 1984, causando murcha em plantas de Cassia renigera, em Campinas (SP. Foram realizadas inoculações cruzadas com dois isolados de C. fimbriata obtidos de Cassia renigera e mangueira (Mangifera indica em plantas de: acácia-negra (Acacia decurrens, cacaueiro (Theobroma cacao, crotalária (Crotalaria juncea, feijão-guandu (Cajanus cajan, figueira (Ficus carica, gamelina (Gmelina arborea, mangueira (Mangifera indica, seringueira (Hevea brasilienses, Cassia sp., C. carnaval, C. ferruginea, C. grandis, C. moschata, C. multijuga, C. nodosa, C. renigera, C. siamea e C. speciosa. Os dois isolados do fungo foram patogênicos a todas as plantas testadas, com exceção de cacaueiro, gamelina e C. grandis.Ceratocystis fimbriata Ell. & Halst. is described for the first time in 1984 on Cassia renigera, in Campinas, State of São Paulo, Brazil. In cross inoculation, the isolates of C. fimbriata obtained from Cassia renigera and from Mangifera indica showed pathogenicity to the following plants: Acacia decurrens, Theobroma cacao, Crotalaria juncea, Cajanus cajan, Ficus Carica, Gmelina arborea, Mangifera indica, Hevea brasiliensis, Cassia sp., C. carnaval, C. ferruginea, C. grandis, C. moschata, C. multijuga, C. nodosa, C. renigera, C. siamea and C. speciosa. The isolates of C. fimbriata were pathogenic to all tested plants, except for Theobroma cacao, Gmelina arborea and C. grandis.

  12. Pathogenic characterization of lasiodplodia causing stem end rot of mango and its control using botanicals

    International Nuclear Information System (INIS)

    Ullah, S. F.; Hussain, Y.; Iram, S.

    2017-01-01

    Two widely cultivated mango fruit varieties White chounsa and Sindhri were collected from two major mango growing areas of Punjab and Sindh Provinces of Pakistan. This study was focused on pathological characterization of predominant postharvest diseases such as stem end rot of mango (Mangifera indica) caused by Lasiodiplodia theobromae, and evaluation of bio-control activity by different plant extracts. L. theobromae aggressiveness of isolates was tested by artificial inoculations under controlled conditions, all isolates proved pathogenic in varying degree of aggressiveness on (Sindhri and White chounsa) with reference to control. Calculated standard error mean varied in lesion area produced by pathogens 6-63cm/sup 2/ (Sindhri) and 60-170 cm/sup 2/ (White chounsa). Re-isolation of respective fungi verified the Koch's postulates. Plant extract of Datura stramonium, Aloe-vera, Eucalyptus camaldulensis, were used to control the radial growth of L. theobromae. Comparative analysis showed D. Stramonium and E. camaldulensis extracts most efficiently reduced the growth of Lasiodiplodia isolates, in comparison to Aloe-vera extract, restrict the 15-20% growth. All pathological results and treatments were significant at p<0.05 through ANOVA. This study emphasizes the behavior of pathogens which could be helpful in mango breeding to introduce resistance toward Lasiodiplodia and referred plants provide the best alternative of chemical fungicides. (author)

  13. Diversity of plant oil seed-associated fungi isolated from seven oil-bearing seeds and their potential for the production of lipolytic enzymes.

    Science.gov (United States)

    Venkatesagowda, Balaji; Ponugupaty, Ebenezer; Barbosa, Aneli M; Dekker, Robert F H

    2012-01-01

    Commercial oil-yielding seeds (castor, coconut, neem, peanut, pongamia, rubber and sesame) were collected from different places in the state of Tamil Nadu (India) from which 1279 endophytic fungi were isolated. The oil-bearing seeds exhibited rich fungal diversity. High Shannon-Index H' was observed with pongamia seeds (2.847) while a low Index occurred for coconut kernel-associated mycoflora (1.018). Maximum Colonization Frequency (%) was observed for Lasiodiplodia theobromae (176). Dominance Index (expressed in terms of the Simpson's Index D) was high (0.581) for coconut kernel-associated fungi, and low for pongamia seed-borne fungi. Species Richness (Chao) of the fungal isolates was high (47.09) in the case of neem seeds, and low (16.6) for peanut seeds. All 1279 fungal isolates were screened for lipolytic activity employing a zymogram method using Tween-20 in agar. Forty isolates showed strong lipolytic activity, and were morphologically identified as belonging to 19 taxa (Alternaria, Aspergillus, Chalaropsis, Cladosporium, Colletotrichum, Curvularia, Drechslera, Fusarium, Lasiodiplodia, Mucor, Penicillium, Pestalotiopsis, Phoma, Phomopsis, Phyllosticta, Rhizopus, Sclerotinia, Stachybotrys and Trichoderma). These isolates also exhibited amylolytic, proteolytic and cellulolytic activities. Five fungal isolates (Aspergillus niger, Chalaropsis thielavioides, Colletotrichum gloeosporioides, Lasiodiplodia theobromae and Phoma glomerata) exhibited highest lipase activities, and the best producer was Lasiodiplodia theobromae (108 U/mL), which was characterized by genomic sequence analysis of the ITS region of 18S rDNA.

  14. Fungos conidiais associados ao folhedo de Clusia melchiorii Gleason e C. nemorosa G. Mey. (Clusiaceae em fragmento de Mata Atlântica, BA, Brasil Conidial fungi associated to leaf litter of Clusia melchiorii Gleason and C. nemorosa G. Mey (Clusiaceae in a fragment of Atlantic rainforest, Bahia State, Brazil

    Directory of Open Access Journals (Sweden)

    Flávia Rodrigues Barbosa

    2009-03-01

    Full Text Available Visando ampliar o conhecimento sobre diversidade de fungos conidiais, 10 folhas mortas de três indivíduos de C. melchiorii e de C. nemorosa foram coletadas bimestralmente na Serra da Jibóia, Bahia, no período de outubro/2005 a junho/2006. As folhas foram lavadas em água corrente e mantidas em câmara-úmida durante 30 dias. As estruturas fúngicas foram retiradas para estudo morfológico. Foram identificados 79 táxons de Ascomycota na forma anamórfica. Destes, 78 são hifomicetos e um celomiceto. Do total, 87% ocorreram sobre C. melchiorii e 55% sobre C. nemorosa. A maioria dos fungos apresentou freqüência esporádica e constância acidental. As espécies mais freqüentes foram: Beltrania rhombica Penz., Chaetopsina fulva Rambelli, Dactylaria ficusicola Paulus, Gadek & Hyde, Verticillium theobromae (Turconi Mason & Hughes e Volutella sp. 1 (sobre C. melchiorii e Atroseptaphiale flagelliformis Matsush., Pseudobeltrania sp., Zygosporium gibbum (Sacc., Rousseau & Bommer Hughes, Verticillium theobromae (Turconi Mason & Hughes e Volutella sp. 1 (sobre C. nemorosa. A similaridade de fungos entre as duas espécies de Clusia atingiu 60% e 11 táxons foram constantes nos dois hospedeiros: Atrosetaphiale flagelliformis, Beltraniella portoricensis (Stevens Piroz. & Patil, Chalara alabamensis Jones & Ingram., Cryptophiale kakombensis Piroz., Parasympodiella laxa (Subram. & Vittal, Speiropsis scopiformis Kuthub. & Nawawi, Thozetella cristata Piroz. & Hodges, Umbellidion radulans Sutton & Hodges, Verticillium theobromae, Volutella sp. 2 e Zygosporium gibbum. Os dados mostram que o folhedo produzido por C. melchiorii e C. nemorosa, na Serra da Jibóia, é rico em fungos conidiais. Esses fungos, como decompositores, são importantes para a dinâmica do ecossistema estudado.In order to increase the diversity knowledge of conidial fungi, 10 dead leaves from three individuals of C. nemorosa and C. melchiorii were bimonthly collected at the "Serra da Jib

  15. The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.

    Science.gov (United States)

    Motamayor, Juan C; Mockaitis, Keithanne; Schmutz, Jeremy; Haiminen, Niina; Livingstone, Donald; Cornejo, Omar; Findley, Seth D; Zheng, Ping; Utro, Filippo; Royaert, Stefan; Saski, Christopher; Jenkins, Jerry; Podicheti, Ram; Zhao, Meixia; Scheffler, Brian E; Stack, Joseph C; Feltus, Frank A; Mustiga, Guiliana M; Amores, Freddy; Phillips, Wilbert; Marelli, Jean Philippe; May, Gregory D; Shapiro, Howard; Ma, Jianxin; Bustamante, Carlos D; Schnell, Raymond J; Main, Dorrie; Gilbert, Don; Parida, Laxmi; Kuhn, David N

    2013-06-03

    Theobroma cacao L. cultivar Matina 1-6 belongs to the most cultivated cacao type. The availability of its genome sequence and methods for identifying genes responsible for important cacao traits will aid cacao researchers and breeders. We describe the sequencing and assembly of the genome of Theobroma cacao L. cultivar Matina 1-6. The genome of the Matina 1-6 cultivar is 445 Mbp, which is significantly larger than a sequenced Criollo cultivar, and more typical of other cultivars. The chromosome-scale assembly, version 1.1, contains 711 scaffolds covering 346.0 Mbp, with a contig N50 of 84.4 kbp, a scaffold N50 of 34.4 Mbp, and an evidence-based gene set of 29,408 loci. Version 1.1 has 10x the scaffold N50 and 4x the contig N50 as Criollo, and includes 111 Mb more anchored sequence. The version 1.1 assembly has 4.4% gap sequence, while Criollo has 10.9%. Through a combination of haplotype, association mapping and gene expression analyses, we leverage this robust reference genome to identify a promising candidate gene responsible for pod color variation. We demonstrate that green/red pod color in cacao is likely regulated by the R2R3 MYB transcription factor TcMYB113, homologs of which determine pigmentation in Rosaceae, Solanaceae, and Brassicaceae. One SNP within the target site for a highly conserved trans-acting siRNA in dicots, found within TcMYB113, seems to affect transcript levels of this gene and therefore pod color variation. We report a high-quality sequence and annotation of Theobroma cacao L. and demonstrate its utility in identifying candidate genes regulating traits.

  16. Terpene Profile, Leaf Anatomy, and Enzyme Activity of Resistant and Susceptible Cocoa Clonesto Vascular Streak Dieback Disease

    Directory of Open Access Journals (Sweden)

    Adi Prawoto

    2014-10-01

    Full Text Available Vascular-streak dieback (VSD, Oncobasidium theobromae is the most prevalent disease of Theobroma cacao L. in Indonesia. This study aims to analyze resistance mechanism to VSD based on terpene profile, leaf anatomy, chitinase, and peroxidase study. Resistant clones of Sulawesi 1 and Sca 6 and susceptible clones of ICS 60 and TSH 858 were used for terpene profile, leaf anatomy analysis, chitinase, peroxides, polyphenol, lignin, and cellulose analysis. Those clones and KEE 2, KKM 22 and ICS 13 were used for peroxides analysis. For trichome study, the resistant clones of Sulawesi 1, Sca 6, KEE 2, and KKM 22, and susceptible clones of ICS 60 and TSH 858 were used. GCMS analysis showed that chromatogram pattern of resistant and susceptible groups were quite similar, but resistant clones contained 22% more components than the susceptible ones. Resistant clones contained groups of pinene, decane, myrcene, and octadecanoic acid, while those substances on usceptible clones were absent. Trichome was thicker on younger leaf, and its density on the basal was higher than that on the middle and tip leaf parts. Trichome density of resistant clone was not always thicker than that of susceptible ones. On resistant clones, stomatal density was lower and width of stomate pits was narrower, while thickness of epidermis layer and pallisade parenchym were higher. Polyphenol content of resistant clones were higher but lignin and cellulose of both groups were similar. Chitinase activity which has a role in hydrolysis of mycelia cell wall was higher on the resistant clones, but peroxides which has a role in polymeration of lignin biosynthesis was similar between both groups. It is concluded that groups of terpene pinene, decane, myrcene, and octadecanoic acid, thickness of leaf epidermis, density and width of stomata pit, and chitinase activity plays important role in cocoa resistance to VSD. Key words: Theobroma cacaoL., clone, vascular-streak dieback, resistance, leaf

  17. COMPORTAMIENTO DE ESPECIES DE FRUTALES AMAZÓNICOS DE UN MODELO DIVERSIFICADO EN AREAS DE LA “ASOCIACIÓN DE PRODUCTORES AGROPECUARIOS VEINTICUATRO DE OCTUBRE”

    Directory of Open Access Journals (Sweden)

    Agustín Gonzáles Coral

    2011-12-01

    Full Text Available El objetivo del estudio fue evaluar el comportamiento de cuatro especies de frutales amazónicos bajo  un modelo de diversificación instalada en la parcela del Sr. Ezequiel García Tapullima (UTM 9548994; 0669126. El suelo del área es desde franco (0-20cm a franco arcilloso (20-40 cm, pH fuertemente ácido y porcentaje (% de materia orgánica  de medio a bajo. La metodología del trabajo consistió en Investigación Acción  Participativa. Se instaló un modelo diversificado (5m x 5m  con plantones de macambo (Theobroma bicolor, caimito (Pouteria caimito, copoazú (Theobroma grandiflorum  y cacao (Theobroma cacao, sembrados con una densidad de 400 plantas por hectárea (5m x 5m. A los 15 meses de instalado, se evaluó el porcentaje de prendimiento, mediciones biométricas trimestrales del crecimiento en 10 individuos por especie, elegidos al azar de un área de 0.5 hectáreas. Se encontró que el 80% de plantas de las cuatro especies se encontraban en  estado de foliación. Las especies que presentaron mejor comportamiento fueron T. bicolor y P. caimito  con una altura de 293.1 cm y 193.2 cm; y un diámetro basal promedio de 5.8 cm y 2.1 cm respectivamente, T. grandiflorum  presentó los menores registros con una altura promedio de 84.3 cm y diámetro basal de 1.4 cm.

  18. The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color

    Science.gov (United States)

    2013-01-01

    Background Theobroma cacao L. cultivar Matina 1-6 belongs to the most cultivated cacao type. The availability of its genome sequence and methods for identifying genes responsible for important cacao traits will aid cacao researchers and breeders. Results We describe the sequencing and assembly of the genome of Theobroma cacao L. cultivar Matina 1-6. The genome of the Matina 1-6 cultivar is 445 Mbp, which is significantly larger than a sequenced Criollo cultivar, and more typical of other cultivars. The chromosome-scale assembly, version 1.1, contains 711 scaffolds covering 346.0 Mbp, with a contig N50 of 84.4 kbp, a scaffold N50 of 34.4 Mbp, and an evidence-based gene set of 29,408 loci. Version 1.1 has 10x the scaffold N50 and 4x the contig N50 as Criollo, and includes 111 Mb more anchored sequence. The version 1.1 assembly has 4.4% gap sequence, while Criollo has 10.9%. Through a combination of haplotype, association mapping and gene expression analyses, we leverage this robust reference genome to identify a promising candidate gene responsible for pod color variation. We demonstrate that green/red pod color in cacao is likely regulated by the R2R3 MYB transcription factor TcMYB113, homologs of which determine pigmentation in Rosaceae, Solanaceae, and Brassicaceae. One SNP within the target site for a highly conserved trans-acting siRNA in dicots, found within TcMYB113, seems to affect transcript levels of this gene and therefore pod color variation. Conclusions We report a high-quality sequence and annotation of Theobroma cacao L. and demonstrate its utility in identifying candidate genes regulating traits. PMID:23731509

  19. Aislamiento de microorganismos para control biológico de Moniliophthora roreri

    OpenAIRE

    Liliana Yanet Suárez Contreras; Alba Luz Rangel Riaño

    2013-01-01

    Moniliophthora roreri es un hongo que causa la moniliasis, una enfermedad de la mazorca en el cultivo de cacao (Theobroma cacao), con pérdidas hasta del 60% de la cosecha. El control biológico utilizando microorganismos endófitos surge como una alternativa para el manejo de esta enfermedad. En la presente investigación se evaluaron microorganismos con potencial para control biológico de M. roreri en Norte de Santander, Colombia. Para el efecto, se aisló e identificó este fitopatógeno y se uti...

  20. Avaliação da diversidade genética e associação com patogenicidade de isolados de Moniliophthora perniciosa oriundos da Amazônia Brasileira

    OpenAIRE

    Angela Sanche Artero Freitas

    2012-01-01

    O fungo Moniliophthora perniciosa é o agente causal da vassoura de bruxa no cacaueiro (Theobroma cacao L.). Três biótipos distintos (biótipos -C, -L e -S) são reconhecidos de acordo com a especificidade quanto ao hospedeiro. O presente estudo teve como objetivo a análise da diversidade genética com o uso de marcadores microssatélites de 134 isolados dos biótipos -C, -L e -S de M. perniciosa coletados principalmente na Amazônia Brasileira e áreas de cultivo. A diversidade genética foi associad...