Differences among plant species in acceptance by the spider mite Tetranychus urticae Koch
Boom, van den C.E.M.; Beek, van T.A.; Dicke, M.
2003-01-01
The spider mite Tetranychus urticae Koch has a broad range of host plants. However, the spider mite does not accept all plants to the same degree because of differences in nutritive and toxic constituents. Other factors, such as the induction of secondary metabolites, the morphology of a leaf
Martel, C.; Zhurov, V.; Navarro, M.; Martinez, M.; Cazaux, M.; Auger, P.; Migeon, A.; Santamaria, M.E.; Wybouw, N.; Diaz, I.; Van Leeuwen, T.; Navajas, M.; Grbic, M.; Grbic, V.
2015-01-01
The two-spotted spider mite Tetranychus urticae is one of the most significant mite pests in agriculture, feeding on more than 1,100 plant hosts, including model plants Arabidopsis thaliana and tomato, Solanum lycopersicum. Here, we describe timecourse tomato transcriptional responses to spider mite
Dicke, M.; Sabelis, M.W.; Groeneveld, A.
1986-01-01
volatile kairomone of the two-spotted spider mite,Tetranychus urticae, elicits a searching response of the phytoseiid predatorAmblyseius potentillae, only when the predator is reared on a carotenoid-free diet. However, after addition of crystalline betta-carotene or vitamin A acetate to the
Wybouw, N.R.
2015-01-01
Plant feeding arthropods adapt in diverse ways to dietary plant toxins. The genetic basis of these adaptations is not well characterized, especially in non-insect lineages. Using the sequenced genome of the herbivorous spider mite Tetranychus urticae as a starting point, this work aimed at
Protocols for the delivery of small molecules to the two-spotted spider mite, Tetranychus urticae.
Directory of Open Access Journals (Sweden)
Takeshi Suzuki
Full Text Available The two-spotted spider mite, Tetranychus urticae, is a chelicerate herbivore with an extremely wide host range and an extraordinary ability to develop pesticide resistance. Due to its responsiveness to natural and synthetic xenobiotics, the spider mite is becoming a prime pest herbivore model for studies of the evolution of host range, plant-herbivore interactions and mechanisms of xenobiotic resistance. The spider mite genome has been sequenced and its transcriptional responses to developmental and various biotic and abiotic cues have been documented. However, to identify biological and evolutionary roles of T. urticae genes and proteins, it is necessary to develop methods for the efficient manipulation of mite gene function or protein activity. Here, we describe protocols developed for the delivery of small molecules into spider mites. Starting with mite maintenance and the preparation of the experimental mite populations of developmentally synchronized larvae and adults, we describe 3 methods for delivery of small molecules including artificial diet, leaf coating, and soaking. The presented results define critical steps in these methods and demonstrate that they can successfully deliver tracer dyes into mites. Described protocols provide guidelines for high-throughput setups for delivery of experimental compounds that could be used in reverse genetics platforms to modulate gene expression or protein activity, or for screens focused on discovery of new molecules for mite control. In addition, described protocols could be adapted for other Tetranychidae and related species of economic importance such as Varroa, dust and poultry mites.
The twospotted spider mite, Tetranychus urticae (Acari: Tetranychidae), is an important pest of vegetables and other crops. This study was conducted to evaluate and compare the potential role of three commercially available predators, predatory gall midge, Feltiella acarisuga (Vallot) (Diptera: Ceci...
DEFF Research Database (Denmark)
Gotoh, T.; Sugimoto, N.; Pallini, A.
2010-01-01
The tomato red spider mite Tetranychus evansi Baker et Pritchard occurs on solanaceous plants, and causes serious damage to a variety of crops in Africa and Europe. In 2001 this species was also found in Japan, on nightshade (Solanum nigrum L.), and its invasion to solanaceous of agricultural imp...
Xu, Xuenong; Enkegaard, Annie
2010-01-01
The prey preference of polyphagous predators plays an important role in suppressing different species of pest insects. In this study the prey preference of the predatory mite, Amblyseius swirskii (Athias-Henriot) (Acari: Phytoseiidae) was examined between nymphs of the twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae) and first instar larvae of the western flower thrips, Frankliniella occidentalis (Pergande) (Thysanoptera: Thripidae), as well as between active and chrysa...
Spider mite control and resistance management: does a genome help?
Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.
2012-01-01
The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.
This paper evaluates the potential usefulness of low temperature-scanning electron microscopy (LT-SEM) to evaluate morphology and predation behavior of the six-spotted thrips (Scolothrips sexmaculatus Pergande) against the two-spotted spider mite (Tetranychus urticae (Koch)). Morphological features...
Wybouw, N.; Balabanidou, V.; Ballhorn, D.J.; Dermauw, W.; Grbić, M.; Vontas, J.; Van Leeuwen, T.
2012-01-01
The genome of the phytophagous two-spotted spider mite Tetranychus urticae was recently sequenced, representing the first complete chelicerate genome, but also the first genome of a highly polyphagous agricultural pest. Genome analysis revealed the presence of an unexpected high number of cases of
Li, Haiqiang; Pan, Hongsheng; Wang, Dongmei; Liu, Bing; Liu, Jian; Zhang, Jianping; Lu, Yanhui
2018-05-05
With the recent increase in planting of fruit trees in southern Xinjiang, the intercropping of fruit trees and cotton has been widely adopted. From 2014 to 2016, a large-scale study was conducted in Aksu, an important agricultural area in southern Xinjiang, to compare the abundance and species composition of spider mites in cotton fields under jujube-cotton, apple-cotton, and cotton monocrop systems. The abundance of spider mites in cotton fields under both intercropping systems was generally higher than in the cotton monocrop. The species composition of spider mites also differed greatly between cotton intercropped with apple or jujube compared to the cotton monocrop. The relative proportion of Tetranychus truncates Ehara (Acari: Tetranychidae) in the species complex generally increased while that of another spider mite, Tetranychus dunhuangensis Wang (Acari: Tetranychidae), decreased under fruit tree-cotton systems. More attention should be paid to the monitoring and management of spider mites, especially T. truncates in this important region of China.
Active optical sensor assessment of spider mite damage on greenhouse beans and cotton
The two-spotted spider mite, Tetranychus urticae Koch is an important pest of cotton in mid-southern United States and causes yield reduction, and deprivation in fiber fitness. A greenhouse colony of the spider mite was used to infest cotton and pinto beans at the three-leaf and trifoliate stages, r...
Fernández Ferrari, M. Celeste; Schausberger, Peter
2013-06-01
Prey perceiving predation risk commonly change their behavior to avoid predation. However, antipredator strategies are costly. Therefore, according to the threat-sensitive predator avoidance hypothesis, prey should match the intensity of their antipredator behaviors to the degree of threat, which may depend on the predator species and the spatial context. We assessed threat sensitivity of the two-spotted spider mite, Tetranychus urticae, to the cues of three predatory mites, Phytoseiulus persimilis, Neoseiulus californicus, and Amblyseius andersoni, posing different degrees of risk in two spatial contexts. We first conducted a no-choice test measuring oviposition and activity of T. urticae exposed to chemical traces of predators or traces plus predator eggs. Then, we tested the site preference of T. urticae in choice tests, using artificial cages and leaves. In the no-choice test, T. urticae deposited their first egg later in the presence of cues of P. persimilis than of the other two predators and cue absence, indicating interspecific threat-sensitivity. T. urticae laid also fewer eggs in the presence of cues of P. persimilis and A. andersoni than of N. californicus and cue absence. In the artificial cage test, the spider mites preferred the site with predator traces, whereas in the leaf test, they preferentially resided on leaves without traces. We argue that in a nonplant environment, chemical predator traces do not indicate a risk for T. urticae, and instead, these traces function as indirect habitat cues. The spider mites were attracted to these cues because they associated them with the existence of a nearby host plant.
Suspension of Egg Hatching Caused by High Humidity and Submergence in Spider Mites.
Ubara, Masashi; Osakabe, Masahiro
2015-08-01
We tested the effects of high humidity and submergence on egg hatching of spider mites. In both the high humidity and submergence treatments, many Tetranychus and Panonychus eggs did not hatch until after the hatching peak of the lower humidity or unsubmerged controls. However, after humidity decreased or water was drained, many eggs hatched within 1-3 h. This was observed regardless of when high humidity or submergence treatments were implemented: either immediately after oviposition or immediately before hatching was due. Normal eyespot formation was observed in most eggs in the high humidity and submergence treatments, which indicates that spider mite embryos develop even when eggs are underwater. Therefore, delays in hatching are not caused by delayed embryonic development. A delay in hatching was always observed in Panonychus citri (McGregor) but was more variable in Tetranychus urticae Koch and Tetranychus kanzawai Kishida. The high humidity and submergence treatments affected but did not suppress larval development in these species. In contrast, many Oligonychus eggs died following the high humidity treatments. In Tetranychus and Panonychus spider mites, suspension of egg hatching may mitigate the adverse effects of rainfall. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Learned predation risk management by spider mites
Directory of Open Access Journals (Sweden)
Thomas eHackl
2014-09-01
Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned
Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel
2003-12-01
Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.
Shinmen, Tsubasa; Yano, Shuichi; Osakabe, Mh
2010-10-01
As it walks, the two-spotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae) spins a trail of silk threads, that is followed by the predatory mite, Neoseiulus womersleyi Schicha (Acari: Phytoseiidae). Starved adult female N. womersleyi followed T. urticae trails laid down by five T. urticae females but did not follow a trail of one T. urticae female, suggesting that the amount of spun threads and their chemical components should correlate positively with the number of T. urticae individuals. To examine whether chemical components of T. urticae trails are responsible for the predatory mite's trail following, we collected separate T. urticae threads from the exuviae and eggs, and then washed the threads with methanol to separate chemical components from physical attributes of the threads. Female N. womersleyi did not follow T. urticae trails that had been washed with methanol but contained physical residues, but they did follow the direction to which the methanol extracts of the T. urticae trails was applied. These results suggest that the predatory mite follows chemical, not physical, attributes of T. urticae trails.
Tetranychus urticae mites do not mount an induced immune response against bacteria.
Santos-Matos, Gonçalo; Wybouw, Nicky; Martins, Nelson E; Zélé, Flore; Riga, Maria; Leitão, Alexandre B; Vontas, John; Grbić, Miodrag; Van Leeuwen, Thomas; Magalhães, Sara; Sucena, Élio
2017-06-14
The genome of the spider mite Tetranychus urticae , a herbivore, is missing important elements of the canonical Drosophila immune pathways necessary to fight bacterial infections. However, it is not known whether spider mites can mount an immune response and survive bacterial infection. In other chelicerates, bacterial infection elicits a response mediated by immune effectors leading to the survival of infected organisms. In T. urticae , infection by either Escherichia coli or Bacillus megaterium did not elicit a response as assessed through genome-wide transcriptomic analysis. In line with this, spider mites died within days even upon injection with low doses of bacteria that are non-pathogenic to Drosophila Moreover, bacterial populations grew exponentially inside the infected spider mites. By contrast, Sancassania berlesei , a litter-dwelling mite, controlled bacterial proliferation and resisted infections with both Gram-negative and Gram-positive bacteria lethal to T. urticae This differential mortality between mite species was absent when mites were infected with heat-killed bacteria. Also, we found that spider mites harbour in their gut 1000-fold less bacteria than S. berlesei We show that T. urticae has lost the capacity to mount an induced immune response against bacteria, in contrast to other mites and chelicerates but similarly to the phloem feeding aphid Acyrthosiphon pisum Hence, our results reinforce the putative evolutionary link between ecological conditions regarding exposure to bacteria and the architecture of the immune response. © 2017 The Authors.
Krips, O.E.; Willems, P.E.I.; Gols, R.; Posthumus, M.A.; Dicke, M.
1999-01-01
When leaves of the ornamental crop Gerbera jamesonii are damaged by the spider mite Tetranychus urticae, they produce many volatile compounds in large quantities. Undamaged gerbera leaves produce only a few volatiles in very small quantities. In the headspace of spider mite-damaged gerbera leaves
Directory of Open Access Journals (Sweden)
Blas Agut
2018-02-01
Full Text Available Tetranychus urticae (T. urticae Koch is a cosmopolitan, polyphagous mite which causes economic losses in both agricultural and ornamental plants. Some traits of T. urticae hamper its management, including a short life cycle, arrhenotokous parthenogenesis, its haplodiploid sex determination system, and its extraordinary ability to adapt to different hosts and environmental conditions. Currently, the use of chemical and biological control are the major control methods used against this mite. In recent years, some studies have focused on plant defence mechanisms against herbivores. Various families of plant compounds (such as flavonoids, glucosinolates, or acyl sugars have been shown to behave as acaricides. Plants can be induced upon appropriate stimuli to increase their resistance against spider mites. This knowledge, together with the understanding of mechanisms by which T. urticae detoxifies and adapts to pesticides, may complement the control of this pest. Herein, we describe plant volatile compounds (VOCs with repellent activity, and new findings about defence priming against spider mites, which interfere with the T. urticae performance. The use of VOCs and defence priming can be integrated into current management practices and reduce the damage caused by T. urticae in the field by implementing new, more sustainable crop management tools.
Chen, Y-T; Zhang, Y-K; Du, W-X; Jin, P-Y; Hong, X-Y
2016-10-01
Wolbachia is an intracellular symbiotic bacterium that infects various spider mite species and is associated with alterations in host reproduction, which indicates the potential role in mite evolution. However, studies of Wolbachia infections in the spider mite Tetranychus pueraricola, a major agricultural pest, are limited. Here, we used multilocus sequence typing to determine Wolbachia infection status and examined the relationship between Wolbachia infection status and mitochondrial diversity in T. pueraricola from 12 populations in China. The prevalence of Wolbachia ranged from 2.8 to 50%, and three strains (wTpue1, wTpue2, and wTpue3) were identified. We also found double infections (wTpue1 + wTpue3) within the same individuals. Furthermore, the wTpue1 strain caused weak cytoplasmic incompatibility (CI) (egg hatchability ~55%), whereas another widespread strain, wTpue3, did not induce CI. There was no reduction in mitochondrial DNA (mtDNA) or nuclear DNA diversity among infected individuals, and mtDNA haplotypes did not correspond to specific Wolbachia strains. Phylogenetic analysis and analysis of molecular variance revealed that the distribution of mtDNA and nuclear DNA haplotypes were significantly associated with geography. These findings indicate that Wolbachia infection in T. pueraricola is complex, but T. pueraricola genetic differentiation likely resulted from substantial geographic isolation.
Wari, David; Yamashita, Jun; Kataoka, Yoko; Kohara, Yoko; Hinomoto, Norihide; Kishimoto, Hidenari; Toyoshima, Shingo; Sonoda, Shoji
2014-07-01
A population survey of phytoseiid mites and spider mites was conducted on peach leaves and wild plants in Japanese peach orchards having different pesticide practices. The phytoseiid mite species composition on peach leaves and wild plants, as estimated using quantitative sequencing, changed during the survey period. Moreover, it varied among study sites. The phytoseiid mite species compositions were similar between peach leaves and some wild plants, such as Veronica persica, Paederia foetida, Persicaria longiseta, and Oxalis corniculata with larger quantities of phytoseiid mites, especially after mid-summer. A PCR-based method to detect the ribosomal ITS sequences of Tetranychus kanzawai and Panonychus mori from phytoseiid mites was developed. Results showed that Euseius sojaensis (specialized pollen feeder/generalist predator) uses both spider mites as prey in the field.
Trandem, Nina; Berdinesen, Ronny; Pell, Judith K; Klingen, Ingeborg
2016-02-01
Introducing the predatory mite Phytoseiulus persimilis into two-spotted spider mite, Tetranychus urticae, populations significantly increased the proportion of T. urticae infected with the spider mite pathogen Neozygites floridana in one of two experiments. By the final sampling occasion, the number of T. urticae in the treatment with both the predator and the pathogen had declined to zero in both experiments, while in the fungus-only treatment T. urticae populations still persisted (20-40 T. urticae/subsample). Releasing P. persimilis into crops in which N. floridana is naturally present has the potential to improve spider mite control more than through predation alone. Copyright © 2016 Elsevier Inc. All rights reserved.
Xu, Zhifeng; Zhu, Wenyi; Liu, Yanchao; Liu, Xing; Chen, Qiushuang; Peng, Miao; Wang, Xiangzun; Shen, Guangmao; He, Lin
2014-01-01
The carmine spider mite (CSM), Tetranychus cinnabarinus, is an important pest mite in agriculture, because it can develop insecticide resistance easily. To gain valuable gene information and molecular basis for the future insecticide resistance study of CSM, the first transcriptome analysis of CSM was conducted. A total of 45,016 contigs and 25,519 unigenes were generated from the de novo transcriptome assembly, and 15,167 unigenes were annotated via BLAST querying against current databases, including nr, SwissProt, the Clusters of Orthologous Groups (COGs), Kyoto Encyclopedia of Genes and Genomes (KEGG) and Gene Ontology (GO). Aligning the transcript to Tetranychus urticae genome, the 19255 (75.45%) of the transcripts had significant (e-value insecticide resistance in arthropod were generated from CSM transcriptome, including 53 P450-, 22 GSTs-, 23 CarEs-, 1 AChE-, 7 GluCls-, 9 nAChRs-, 8 GABA receptor-, 1 sodium channel-, 6 ATPase- and 12 Cyt b genes. We developed significant molecular resources for T. cinnabarinus putatively involved in insecticide resistance. The transcriptome assembly analysis will significantly facilitate our study on the mechanism of adapting environmental stress (including insecticide) in CSM at the molecular level, and will be very important for developing new control strategies against this pest mite.
Active optical sensor assessment of spider mite damage on greenhouse beans and cotton.
Martin, Daniel E; Latheef, Mohamed A
2018-02-01
The two-spotted spider mite, Tetranychus urticae Koch, is an important pest of cotton in mid-southern USA and causes yield reduction and deprivation in fiber fitness. Cotton and pinto beans grown in the greenhouse were infested with spider mites at the three-leaf and trifoliate stages, respectively. Spider mite damage on cotton and bean canopies expressed as normalized difference vegetation index indicative of changes in plant health was measured for 27 consecutive days. Plant health decreased incrementally for cotton until day 21 when complete destruction occurred. Thereafter, regrowth reversed decline in plant health. On spider mite treated beans, plant vigor plateaued until day 11 when plant health declined incrementally. Results indicate that pinto beans were better suited as a host plant than cotton for rearing T. urticae in the laboratory.
Rhodes, Elena M; Liburd, Oscar E
2006-08-01
Greenhouse and field experiments were conducted from 2003 to 2005 to determine the effectiveness of two predatory mite species, Phytoseiulus persimilis Athias-Henriot and Neoseiulus californicus (McGregor), and a reduced-risk miticide, Acramite 50 WP (bifenazate), for control of twospotted spider mite, Tetranychus urticae Koch, in strawberries (Fragaria x ananassa Duchesne). In greenhouse tests, three treatments consisting of releases of P. persimilis, N. californicus, and an untreated control were evaluated. Both species of predatory mites significantly reduced twospotted spider mite numbers below those found in the control during the first 3 wk of evaluation. However, during week 4, twospotted spider mite numbers on the plants treated with P. persimilis increased and did not differ significantly from the control. Field studies used releases of P. persimilis and N. californicus, applications of Acramite, and untreated control plots. Both N. californicus and P. persimilis significantly reduced populations of twospotted spider mite below numbers recorded in the control plots. During the 2003-2004 field season P. persimilis took longer than N. californicus to bring the twospotted spider mite population under control (< 10 mites per leaflet). Acramite was effective in reducing twospotted spider mite populations below 10 mites per leaflet during the 2003-2004 field season but not during the 2004-2005 field season, possibly because of a late application. These findings indicate that N. californicus releases and properly timed Acramite applications are promising options for twospotted spider mite control in strawberries for growers in north Florida and other areas of the southeast.
International Nuclear Information System (INIS)
Ignatowicz, S.; Banasik-Solgala, K.
1999-01-01
The carmine spider mite, Tetranychus cinnabarinus (Boisd.), and the two-spotted spider mite, Tetranychus urticae Koch, are closely related species of tetranychid mites (Acarina, Tetranychidae) that respond to gamma irradiation in a similar way. Eggs of both species exposed to gamma radiation early in embryonic development were considerably more susceptible to irradiation than older eggs. The tolerance of eggs to gamma radiation increased in 3-4-day-old eggs, when eye-spots were formed. Nymphs were more resistant to gamma radiation than eggs and larvae. Deteriorative effects of irradiation treatment were reflected in the immatures by their mortality in subsequent developmental stages. A positive relationship between dosage and the percent egg mortality or the mortality of subsequent stages was usually found when the immature stages were irradiated. The sex ratio of adults developed from irradiated eggs, larvae, and nymphs was affected by the irradiation treatment; the ratio was usually skewed towards males. Irradiation of females resulted in increased mortality, lowered fecundity, reduced egg viability, and sex ratio distortion in their progeny. Two-day-old females of the carmine spider mite and the two-spotted spider mite irradiated with 200 or 300 Gy lived as long as the controls. Mortality occurred after 3 weeks. The number of eggs laid by irradiated females of spider mites was considerably lower than in the control, and it decreased as the absorbed dose increased. The higher the dose of gamma radiation applied to adults of the spider mites (the parental generation, P), the higher the mortality of the F1 mites during their embryonic development. Viability of eggs laid by irradiated females of spider mites mated with irradiated males was significantly reduced. Young females treated with a dose of 0.2 kGy produced 40-50% nonviable eggs, while control mites produced only 6.0-6.6% nonviable eggs. A dose of 0.3 kGy caused high mortality of eggs; 88% and 97% nonviable
Occhipinti, Andrea; Maffei, Massimo E
2013-10-01
Chlorophyll and chlorophyll degradation products were observed in the two-spotted spider mite (Tetranychus urticae) using epifluorescence microscopy (EFM) and confocal laser scanning microscopy (CLSM). A clear red fluorescence (EFM) and a fluorescence induced by a laser wavelength of 650 nm (CLSM) were observed. In the lateral caeca, in the ventriculus and in the excretory organ, a bright light blue fluorescence was observed in close association with chlorophyll by using EFM. The same material can be localized with CLSM by using a laser with a wavelength of 488 nm. By comparison with synthetic guanine, this bright fluorescence is supposed to be guanine. The presence of guanine fluorescence in the mite pellets confirms this hypothesis. A possible mechanism for guanine formation is discussed.
Palevsky, E; Walzer, A; Gal, S; Schausberger, P
2008-06-01
The goal of this study was to evaluate spider mite control efficacy of two dry-adapted strains of Neoseiulus californicus. Performance of these strains were compared to a commercial strain of Phytoseiulus persimilis on whole cucumber, pepper and strawberry plants infested with Tetranychus urticae at 50 +/- 5% RH. Under these dry conditions predators' performance was very different on each host plant. On cucumber, spider mite suppression was not attained by any of the three predators, plants 'burnt out' within 4 weeks of spider mite infestation. On strawberry, all predators satisfactorily suppressed spider mites yet they differed in short term efficacy and persistence. Phytoseiulus persimilis suppressed the spider mites more rapidly than did the BOKU and SI N. californicus strains. Both N. californicus strains persisted longer than did P. persimilis. The BOKU strain was superior to SI in population density reached, efficacy in spider mite suppression and persistence. On pepper, in the first 2 weeks of the experiment the BOKU strain was similar to P. persimilis and more efficacious in spider mite suppression than strain SI. Four weeks into the experiment the efficacy of P. persimilis dropped dramatically and was inferior to the SI and BOKU strains. Overall, mean predator density was highest on plants harbouring the BOKU strain, lowest on plants with P. persimilis and intermediate on plants with the SI strain. Implications for biocontrol of spider mites using phytoseiid species under dry conditions are discussed.
Alternative phenotypes of male mating behaviour in the two-spotted spider mite
Sato, Y.; Sabelis, M.W.; Egas, M.; Faraji, F.
2013-01-01
Severe intraspecific competition for mates selects for aggressive individuals but may also lead to the evolution of alternative phenotypes that do not act aggressively, yet manage to acquire matings. The two-spotted spider mite, Tetranychus urticae, shows male mate-guarding behaviour and male-male
Higher glandular trichome density in tomato leaflets and repellence to spider mites
International Nuclear Information System (INIS)
Maluf, Wilson Roberto; Inoue, Irene Fumi; Ferreira, Raphael de Paula Duarte; Gomes, Luiz Antonio Augusto; Castro, Evaristo Mauro de; Cardoso, Maria das Gracas
2007-01-01
The objective of this work was to evaluate the feasibility of selection for higher glandular trichome densities, as an indirect criterion of selection for increasing repellence to spider mites Tetranychus urticae, in tomato populations derived from an interspecific cross between Lycopersicon esculentum x L. hirsutum var. glabratum PI 134417. Trichome densities were evaluated in 19 genotypes, including 12 from advanced backcross populations, derived from the original cross L. esculentum x L. hirsutum var. glabratum PI 134417. Counts were made both on the adaxial and abaxial leaf surfaces, and trichomes were classified into glandular types IV and VI, other glandular types (types I+VII), and nonglandular types. Mite repellence was measured by distances walked by mites onto the tomato leaf surface after 20, 40 and 60 min. Spider mite repellence biotests indicated that higher densities of glandular trichomes (especially type VI) decreased the distances walked by the mites onto the tomato leaf surface. Selection of plants with higher densities of glandular trichomes can be an efficient criterion to obtain tomato genotypes with higher resistance (repellence) to spider mites. (author)
DEFF Research Database (Denmark)
Nachman, Gösta; Zemek, Rostislav
2003-01-01
Biological control, Bottom-up factor, Phytoseiulus persimilis, Plant condition, Predacious mites, Simulation model, Tetranychus urticae, Top-down factor, Two-spotted spider mites......Biological control, Bottom-up factor, Phytoseiulus persimilis, Plant condition, Predacious mites, Simulation model, Tetranychus urticae, Top-down factor, Two-spotted spider mites...
Induction of indirect defence against spider-mites in uninfested lima bean leaves.
Takabayashi, J.; Dicke, M.; Posthumus, M.A.
1991-01-01
Headspace analyses of uninfested Lima bean (Phaseolus lunatus) leaves show an absence of or only trace amounts of the terpenoids (E)--ocimene and (E)-4,8-dimethyl-1,3,7-nonatriene. Upon infestation by two-spotted spider-mites (Tetranychus urticae), Lima bean leaves produce (E)--ocimene and
DEFF Research Database (Denmark)
Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson
2013-01-01
Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...
Whiteflies interfere with indirect plant defense against spider mites in Lima bean
Zhang, Peng-Jun; Zheng, Si-Jun; van Loon, Joop J. A.; Boland, Wilhelm; David, Anja; Mumm, Roland; Dicke, Marcel
2009-01-01
Plants under herbivore attack are able to initiate indirect defense by synthesizing and releasing complex blends of volatiles that attract natural enemies of the herbivore. However, little is known about how plants respond to infestation by multiple herbivores, particularly if these belong to different feeding guilds. Here, we report the interference by a phloem-feeding insect, the whitefly Bemisia tabaci, with indirect plant defenses induced by spider mites (Tetranychus urticae) in Lima bean (Phaseolus lunatus) plants. Additional whitefly infestation of spider-mite infested plants resulted in a reduced attraction of predatory mites (Phytoseiulus persimilis) compared to attraction to plants infested by spider mites only. This interference is shown to result from the reduction in (E)-β-ocimene emission from plants infested by both spider mites and whiteflies. When using exogenous salicylic acid (SA) application to mimic B. tabaci infestation, we observed similar results in behavioral and chemical analyses. Phytohormone and gene-expression analyses revealed that B. tabaci infestation, as well as SA application, inhibited spider mite-induced jasmonic acid (JA) production and reduced the expression of two JA-regulated genes, one of which encodes for the P. lunatus enzyme β-ocimene synthase that catalyzes the synthesis of (E)-β-ocimene. Remarkably, B. tabaci infestation concurrently inhibited SA production induced by spider mites. We therefore conclude that in dual-infested Lima bean plants the suppression of the JA signaling pathway by whitefly feeding is not due to enhanced SA levels. PMID:19965373
Behavioural responses of two-spotted spider mites induced by predator-borne and prey-borne cues.
Gyuris, Enikő; Szép, Erna; Kontschán, Jenő; Hettyey, Attila; Tóth, Zoltán
2017-11-01
Applying predatory mites as biological control agents is a well established method against spider mites which are major pests worldwide. Although antipredator responses can influence the outcome of predator-prey interactions, we have limited information about what cues spider mites use to adjust their behavioural antipredator responses. We experimentally exposed two-spotted spider mites (Tetranychus urticae) to different predator-borne cues (using a specialist predator, Phytoseiulus persimilis, or a generalist predator, Amblyseius swirskii), conspecific prey-borne cues, or both, and measured locomotion and egg-laying activity. The reactions to predator species compared to each other manifested in reversed tendencies: spider mites increased their locomotion activity in the presence of P. persimilis, whereas they decreased it when exposed to A. swirskii. The strongest response was triggered by the presence of a killed conspecific: focal spider mites decreased their locomotion activity compared to the control group. Oviposition activity was not affected by either treatment. Our results point out that spider mites may change their behaviour in response to predators, and also to the presence of killed conspecifics, but these effects were not enhanced when both types of cues were present. The effect of social contacts among prey conspecifics on predator-induced behavioural defences is discussed. Copyright © 2017 Elsevier B.V. All rights reserved.
The genome of Tetranychus urticae reveals herbivorous pest adaptations
Grbić, M.; Van Leeuwen, T.; Clark, R.M.; Rombauts, S.; Grbić, V.; Osborne, E.J.; Dermauw, W.; Phuong, C.T.N.; Ortego, F.; Hernández-Crespo, P.; Diaz, I.; Martinez, M.; Navajas, M.; Sucena, E.; Magalhães, S.; Nagy, L.; Pace, R.M.; Djuranović, S.; Smagghe, G.; Iga, M.; Christiaens, O.; Veenstra, J.A.; Ewer, J.; Villalobos, R.M.; Hutter, J.L.; Hudson, S.D.; Velez, M.; Yi, S.V.; Zeng, J.; Pires-dasilva, A.; Roch, F.; Cazaux, M.; Navarro, M.; Zhurov, V.; Acevedo, G.; Bjelica, A.; Fawcett, J.A.; Bonnet, E.; Martens, C.; Baele, G.; Wissler, L.; Sanchez-Rodriguez, A.; Tirry, L.; Blais, C.; Demeestere, K.; Henz, S.R.; Gregory, T.R.; Mathieu, J.; Verdon, L.; Farinelli, L.; Schmutz, J.; Lindquist, E.; Feyereisen, R.; Van de Peer, Y.
2011-01-01
The spider mite Tetranychus urticae is a cosmopolitan agricultural pest with an extensive host plant range and an extreme record of pesticide resistance. Here we present the completely sequenced and annotated spider mite genome, representing the first complete chelicerate genome. At 90 megabases T.
Saber, Moosa; Ahmadi, Zeinab; Mahdavinia, Gholamreza
2018-05-01
Two-spotted spider mite, Tetranychus urticae Koch, is one of the economically most important pests on a wide range of crops in greenhouses and orchards worldwide. Control of T. urticae has been largely based on the use of acaricides. Sublethal effects of spirodiclofen, pyridaben and abamectin were studied on life-table parameters of T. urticae females treated with the acaricides. LC 25 values of spirodiclofen, abamectin and pyridaben (3.84, 0.04 and 136.96 µg a.i./ml, respectively) were used for sublethal studies. All acaricides showed significant effects on T. urticae biological parameters including developmental time, survival rate, and fecundity. The females treated with spirodiclofen, abamectin and pyridaben at LC 25 exhibited significantly reduced net reproductive rate (R 0 ), finite rate of increase (λ) and intrinsic rate of increase (r). The intrinsic rate of increase in spirodiclofen, abamectin and pyridaben treated groups and control were 0.0138, 0.0273, 0.039 and 0.2481 female offspring per female per day, respectively. The results indicated that sublethal concentrations of tested pesticides strongly affected the life characteristics of spider mite and consequently may influence mite population growth in future generations.
DEFF Research Database (Denmark)
Jacobsen, Stine Kramer
The two spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), is a major cause of pest damage worldwide. Its host range includes among many the strawberry crop, a high value crop in Denmark as well as in many other temperate and subtropical regions. Chemical control of T. urticae...... occurrence and diversity of predatory insects and predatory mites in Danish strawberry fields and surrounding vegetation is lacking, as is the knowledge of the potential of generalist insect predators to control T. urticae. The overall objective of this PhD thesis was to investigate the trophic interactions...... between natural enemies, in particular generalist predators and the two spotted spider mite, T. urticae, in strawberry. This was done by investigating interactions of T. urticae and its natural enemies as influenced by cropping practice and the surrounding vegetation (Manuscript I) as well as more...
Directory of Open Access Journals (Sweden)
Zhifeng Xu
Full Text Available The carmine spider mite (CSM, Tetranychus cinnabarinus, is an important pest mite in agriculture, because it can develop insecticide resistance easily. To gain valuable gene information and molecular basis for the future insecticide resistance study of CSM, the first transcriptome analysis of CSM was conducted. A total of 45,016 contigs and 25,519 unigenes were generated from the de novo transcriptome assembly, and 15,167 unigenes were annotated via BLAST querying against current databases, including nr, SwissProt, the Clusters of Orthologous Groups (COGs, Kyoto Encyclopedia of Genes and Genomes (KEGG and Gene Ontology (GO. Aligning the transcript to Tetranychus urticae genome, the 19255 (75.45% of the transcripts had significant (e-value <10-5 matches to T. urticae DNA genome, 19111 sequences matched to T. urticae proteome with an average protein length coverage of 42.55%. Core Eukaryotic Genes Mapping Approach (CEGMA analysis identified 435 core eukaryotic genes (CEGs in the CSM dataset corresponding to 95% coverage. Ten gene categories that relate to insecticide resistance in arthropod were generated from CSM transcriptome, including 53 P450-, 22 GSTs-, 23 CarEs-, 1 AChE-, 7 GluCls-, 9 nAChRs-, 8 GABA receptor-, 1 sodium channel-, 6 ATPase- and 12 Cyt b genes. We developed significant molecular resources for T. cinnabarinus putatively involved in insecticide resistance. The transcriptome assembly analysis will significantly facilitate our study on the mechanism of adapting environmental stress (including insecticide in CSM at the molecular level, and will be very important for developing new control strategies against this pest mite.
International Nuclear Information System (INIS)
Liburd, O.E.; White, J.C.; Rhodes, E.M.; Browdy, A.A.
2007-01-01
The residual effects of several reduced-risk and conventional miticides were evaluated in strawberries (Fragaria × ananassa Duchesne) on the twospotted spider mite (TSSM), Tetranychus urticae Koch (Acari: Tetranychidae) and on 2 predatory mites, Neoseiulus californicus McGregor and Phytoseiulus persimilis Athias-Henriot (Acari: Phytoseiidae). Experiments were conducted in the laboratory and greenhouse. The greenhouse experiments also tested the direct effects of the miticides on TSSM. The efficacy of conventional and reduced-risk miticides was evaluated on strawberry leaf discs and on whole plants for control of TSSM. Furthermore, the residual effects of these miticides were evaluated on whole strawberry plants against selective predatory mites. For TSSM, 5 treatments were evaluated: a conventional miticide; fenbutatin-oxide (Vendex[reg]) and 3 reduced-risk miticides; binfenazate (Acramite 50WP[reg]), activated garlic extract (Repel[reg]), sesame seed and castor oil (Wipeout[reg]), and a water-treated control. For predatory mites, the residual effects of only Acramite[reg] and Vendex[reg] were evaluated. Acramite[reg] was the most effective acaricide in reducing TSSM populations in both the laboratory and greenhouse experiments. Vendex[reg] and Wipeout[reg] were also effective in the laboratory, but did not cause significant reduction of TSSM in the greenhouse. Repel[reg] was the least effective of the 4 pesticides evaluated. Neither Acramite[reg] nor Vendex[reg] had a significant effect on either predatory mite species. However, there appeared to be more predatory mites on the Vendex[reg]-treated plants than on the Acramite[reg]-treated plants. There were significantly more predatory mites of both species on the cue plants, which were inoculated with TSSM versus the non-cue plants, which were not inoculated. (author) [es
Voluntary Falling in Spider Mites in Response to Different Ecological Conditions at Landing Points
Ohzora, Yousuke; Yano, Shuichi
2011-01-01
We examined voluntary-falling behaviour by adult females of the two-spotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae) and one of its major predators Neoseiulus californicus McGregor (Acari: Phytoseiidae). Experiments were conducted using a setup in which mites could only move onto one of two landing points by falling. Significantly more T. urticae females fell onto available food leaves compared to non-food or heavily infested leaves, whereas significantly fewer females fell...
Koveos, Dimitrios S; Suzuki, Takeshi; Terzidou, Anastasia; Kokkari, Anastasia; Floros, George; Damos, Petros; Kouloussis, Nikos A
2017-01-01
Egg hatchability of four predatory mites-Phytoseiulus persimilis Athias-Henriot, Iphiseius [Amblyseius] degenerans Berlese, Amblyseius swirskii Athias-Henriot, and Euseius finlandicus Oudemans (Acari: Phytoseiidae)-and the spider mite Tetranychus urticae Koch (Acari: Tetranychidae) was determined under various UV-B doses either in constant darkness (DD) or with simultaneous irradiation using white light. Under UV-B irradiation and DD or simultaneous irradiation with white light, the predator's eggs hatched in significantly lower percentages than in the control non-exposed eggs, which indicates deleterious effects of UV-B on embryonic development. In addition, higher hatchability percentages were observed under UV-B irradiation and DD in eggs of the predatory mites than in eggs of T. urticae. This might be caused by a higher involvement of an antioxidant system, shield effects by pigments or a mere shorter duration of embryonic development in predatory mites than in T. urticae, thus avoiding accumulative effects of UV-B. Although no eggs of T. urticae hatched under UV-B irradiation and DD, variable hatchability percentages were observed under simultaneous irradiation with white light, which suggests the involvement of a photoreactivation system that reduces UV-B damages. Under the same doses with simultaneous irradiation with white light, eggs of T. urticae displayed higher photoreactivation and were more tolerant to UV-B than eggs of the predatory mites. Among predators variation regarding the tolerance to UV-B effects was observed, with eggs of P. persimilis and I. degenerans being more tolerant to UV-B radiation than eggs of A. swirskii and E. finlandicus.
Directory of Open Access Journals (Sweden)
Katarina KOS
2018-04-01
Full Text Available The two spotted spider mite, Tetranychus urticae C. L. Koch, 1836 is one of the most important pests of greenhouse crops worldwide. Due to its polyphagic range of hosts and rapid development it forms great populations and as such represents a suitable host/prey for lots of natural enemies usable in biological control. Most commonly used predators of Tetranychid mites are predatory mites (Phytoseiulus persimilis Athias-Henriot, 1957, Amblyseius swirskii Athias-Henriot, 1962 ,…, but among most voracious predators is the larva of a predatory gall midge, Feltiella acarisuga (Vallot, 1827 that was found also in greenhouses of the Biotechnical Faculty in Ljubljana on eggplant leaves in 2017. Besides the predatory gall midge also another predator, staphylinid Oligota oviformis Casey, 1893 beetles and larvae were found in great numbers. After positive identification of F. acarisuga found naturally in Slovenia, it can be added to the list of indigenous species of natural enemies and thus can be used in biological control programs in greenhouse crop protection against spider mites.
Li, M; Zhang, Y; Ding, W; Luo, J; Li, S; Zhang, Q
2018-06-01
This study aimed to evaluate the acaricidal activity of lettuce (Lactuca sativa) extracts against carmine spider mites (Tetranychus cinnabarinus Boisd.) and isolate the acaricidal components. Acaricidal activities of lettuce extracts isolated from different parts (the leaf, root and seed) using various solvents (petroleum ether, acetone and methanol) were evaluated with slide-dip bioassay and relatively high median lethal concentration (LC50) values were detected. Acetone extracts of lettuce leaves harvested in July and September were fractionated and isolated with silica gel and thin-layer chromatography. Consequently, acetone extracts of lettuce leaves harvested in July exhibited higher acaricidal activity than those harvested in September, with an LC50 value of 0.268 mg ml-1 at 72 h post-treatment. A total of 27 fractions were obtained from the acetone extract of lettuce leaves harvested in July, and mite mortalities with the 11th and 12th fractions were higher than those with the other 25 fractions (LC50: 0.751 and 1.258 mg ml-1 at 48 h post-treatment, respectively). Subsequently, active acaricidal components of the 11th fraction were identified by infrared, nuclear magnetic resonance and liquid chromatography/mass spectrometry. Five components were isolated from the 11th fraction, with components 11-a and 11-b showing relatively high acaricidal activities (LC50: 0.288 and 0.114 mg ml-1 at 48 h post-treatment, respectively). Component 11-a was identified as β-sitosterol. In conclusion, acetone extracts of lettuce leaves harvested in July might be used as a novel phytogenic acaricide to control mites.
Khodayari, Samira; Moharramipour, Saeid; Larvor, Vanessa; Hidalgo, Kévin; Renault, David
2013-01-01
Diapause is a common feature in several arthropod species that are subject to unfavorable growing seasons. The range of environmental cues that trigger the onset and termination of diapause, in addition to associated hormonal, biochemical, and molecular changes, have been studied extensively in recent years; however, such information is only available for a few insect species. Diapause and cold hardening usually occur together in overwintering arthropods, and can be characterized by recording changes to the wealth of molecules present in the tissue, hemolymph, or whole body of organisms. Recent technological advances, such as high throughput screening and quantification of metabolites via chromatographic analyses, are able to identify such molecules. In the present work, we examined the survival ability of diapausing and non-diapausing females of the two-spotted spider mite, Tetranychus urticae, in the presence (0 or 5°C) or absence of cold acclimation. Furthermore, we examined the metabolic fingerprints of these specimens via gas chromatography-mass spectrophotometry (GC-MS). Partial Least Square Discriminant Analysis (PLS-DA) of metabolites revealed that major metabolic variations were related to diapause, indicating in a clear cut-off between diapausing and non-diapausing females, regardless of acclimation state. Signs of metabolic depression were evident in diapausing females, with most amino acids and TCA cycle intermediates being significantly reduced. Out of the 40 accurately quantified metabolites, seven metabolites remained elevated or were accumulated in diapausing mites, i.e. cadaverine, gluconolactone, glucose, inositol, maltose, mannitol and sorbitol. The capacity to accumulate winter polyols during cold-acclimation was restricted to diapausing females. We conclude that the induction of increased cold hardiness in this species is associated with the diapause syndrome, rather than being a direct effect of low temperature. Our results provide novel
Holt, Kiffnie M; Opit, George P; Nechols, James R; Margolies, David C
2006-01-01
The compatibility of the selective insecticide spinosad (Conserve SC), at rates recommended for thrips control in greenhouses, with release of the predatory mite Phytoseiulus persimilis Athias-Henriot (Acari: Phytoseiidae) to control spider mites, was investigated in a crop of ivy geranium Pelargonium peltatum, cultivar 'Amethyst 96.' Plants were inoculated with twospotted spider mites, Tetranychus urticae Koch (Acari: Tetranychidae), 2 weeks before treatments were applied. There were three treatment variables, each at two levels: predators (released or not), spray application (water or Conserve SC at 2 ml/3.79 l), and timing of spray (1 day before or after predators were released). Twospotted spider mite populations then were sampled twice each week over a three-week period. The application or timing of spinosad had no effect on the ability of the predator to reduce the population of spider mites. Spider mite populations in the no-predator treatment continued to expand over the course of the experiment, while those in the predator-release treatment declined. We conclude that P. persimilis can be used in conjunction with spinosad on ivy geraniums without causing obvious detrimental effects to this predator or leading to a reduction in biological control.
Two-spotted spider mite (TSSM), Tetranychus urticae (Koch), is an early season pest of cotton in the mid-southern United States and causes reduction in yield, fiber quality and impaired seed germination. Objectives of this study were to investigate the efficacy of abamectin and spiromesifen with two...
Energy Technology Data Exchange (ETDEWEB)
Calvitti, M [ENEA, Centro Ricerche Casaccia, Roma (Italy). Dip. Innovazione
1995-12-01
This work is a brief review of the actual knowledge about biological and ecological characteristics of two species of mites: Tetranychus urticae Koch (Acarina Tetranychidae) (two-spotted spider mite) and the predaceous mite Phytoseiulus persimilis Athias Henriot (Acarina Phytoseiidae). Success obtained in biological control of spider mite, by mass release of P. persimilis, has increased the interest in biological and ecological study of these mites. Particularly, the following biological and ecological aspects of both P. persimilis and T. urticae are hereby discussed: reproductive biology; population dynamics (spider mites outbreaks) and natural regulation of the trophic interaction; feeding behaviour; biological control of two-spotted spider mite by P. persimilis. In this report experimental data obtained in laboratory have been integrated with bibliographic information concerning studies produced in natural conditions.
Differential Timing of Spider Mite-Induced Direct and Indirect Defenses in Tomato Plants1[w
Kant, Merijn R.; Ament, Kai; Sabelis, Maurice W.; Haring, Michel A.; Schuurink, Robert C.
2004-01-01
Through a combined metabolomics and transcriptomics approach we analyzed the events that took place during the first 5 d of infesting intact tomato (Lycopersicon esculentum) plants with spider mites (Tetranychus urticae). Although the spider mites had caused little visible damage to the leaves after 1 d, they had already induced direct defense responses. For example, proteinase inhibitor activity had doubled and the transcription of genes involved in jasmonate-, salicylate-, and ethylene-regulated defenses had been activated. On day four, proteinase inhibitor activity and particularly transcript levels of salicylate-regulated genes were still maintained. In addition, genes involved in phospholipid metabolism were up-regulated on day one and those in the secondary metabolism on day four. Although transcriptional up-regulation of the enzymes involved in the biosynthesis of monoterpenes and diterpenes already occurred on day one, a significant increase in the emission of volatile terpenoids was delayed until day four. This increase in volatile production coincided with the increased olfactory preference of predatory mites (Phytoseiulus persimilis) for infested plants. Our results indicate that tomato activates its indirect defenses (volatile production) to complement the direct defense response against spider mites. PMID:15122016
Prey preference of the phytoseiid mite Typhlodromus pyri. 1. Response to volatile kairomones.
Dicke, M.
1988-01-01
Using a Y-tube olfactometer, a study has been made of the response of females of the predatory miteTyphlodromus pyri Scheuten (Acarina: Phytoseiidae) to volatile kairomones of three prey species: the European red spider mite (Panonychus ulmi (Koch)), the two-spotted spider mite (Tetranychus urticae
The use of synthetic herbivore-induced plant volatiles (HIPV) to attract natural enemies has received interest as a tool to enhance conservation biological control (CBC). Methyl salicylate (MeSA) is a HIPV that is attractive to several key predators of two-spotted spider mite, Tetranychus urticae K...
DEFF Research Database (Denmark)
Ullah, M. S.; Moriya, D.; Badii, M.H.
2011-01-01
We investigated the effect of temperature on development and demographic parameters such as the intrinsic rate of natural increase (rm) of the two spider mite species Tetranychus merganser Boudreaux and T. kanzawai Kishida at eleven constant temperatures ranging from 15 to 40C at intervals of 2.5...
van den Boom, C E M; van Beek, T A; Dicke, M
2002-12-01
Plants infested with the spider mite Tetranychus urticae Koch, may indirectly defend themselves by releasing volatiles that attract the predatory mite Phytoseiulus persimilis Athias-Henriot. Several plants from different plant families that varied in the level of spider mite acceptance were tested in an olfactometer. The predatory mites were significantly attracted to the spider mite-infested leaves of all test plant species. No differences in attractiveness of the infested plant leaves were found for predatory mites reared on spider mites on the different test plants or on lima bean. Thus, experience with the spider mite-induced plant volatiles did not affect the predatory mites. Jasmonic acid was applied to ginkgo leaves to induce a mimic of a spider mite-induced volatile blend, because the spider mites did not survive when incubated on ginkgo. The volatile blend induced in ginkgo by jasmonic acid was slightly attractive to predatory mites. Plants with a high degree of direct defence were thought to invest less in indirect defence than plants with a low degree of direct defence. However, plants that had a strong direct defence such as ginkgo and sweet pepper, did emit induced volatiles that attracted the predatory mite. This indicates that a combination of direct and indirect defence is to some extent compatible in plant species.
Kappers, Iris F; Verstappen, Francel W A; Luckerhoff, Ludo L P; Bouwmeester, Harro J; Dicke, Marcel
2010-05-01
Cucumber plants (Cucumis sativus L.) respond to spider-mite (Tetranychus urticae) damage with the release of specific volatiles that are exploited by predatory mites, the natural enemies of the spider mites, to locate their prey. The production of volatiles also can be induced by exposing plants to the plant hormone jasmonic acid. We analyzed volatile emissions from 15 cucumber accessions upon herbivory by spider mites and upon exposure to jasmonic acid using gas chromatography-mass spectrometry. Upon induction, cucumber plants emitted over 24 different compounds, and the blend of induced volatiles consisted predominantly of terpenoids. The total amount of volatiles was higher in plants treated with jasmonic acid than in those infested with spider mites, with (E)-4,8-dimethyl-1,3,7-nonatriene, (E,E)-alpha-farnesene, and (E)-beta-ocimene as the most abundant compounds in all accessions in both treatments. Significant variation among the accessions was found for the 24 major volatile compounds. The accessions differed strongly in total amount of volatiles emitted, and displayed very different odor profiles. Principal component analysis performed on the relative quantities of particular compounds within the blend revealed clusters of highly correlated volatiles, which is suggestive of common metabolic pathways. A number of cucumber accessions also were tested for their attractiveness to Phytoseiulus persimilis, a specialist predator of spider mites. Differences in the attraction of predatory mites by the various accessions correlated to differences in the individual chemical profiles of these accessions. The presence of genetic variation in induced plant volatile emission in cucumber shows that it is possible to breed for cucumber varieties that are more attractive to predatory mites and other biological control agents.
Ochiai, Noriaki; Mizuno, Masayuki; Mimori, Norihiko; Miyake, Toshihiko; Dekeyser, Mark; Canlas, Liza Jara; Takeda, Makio
2007-01-01
Bifenazate is a novel carbazate acaricide discovered by Uniroyal Chemical (now Chemtura Corporation) for the control of phytophagous mites infesting agricultural and ornamental crops. Its acaricidal activity and that of its principal active metabolite, diazene, were characterized. Bifenazate and diazene had high toxicity and specificity both orally and topically to all life stages of Tetranychus urticae and Panonychus citri. Acute poisoning was observed with no temperature dependency. No cross-resistance was found to mites resistant to several other classes of acaricides, such as tebufenpyrad, etoxazole, fenbutatin oxide and dicofol. Bifenazate remained effective for a long time with only about a 10% loss of efficacy on T. urticae after 1 month of application in the field. All stages of development of the predatory mites, Phytoseiulus persimilis and Neoseiulus californicus, survived treatment by both bifenazate and diazene. When adult females of the two predatory mite species were treated with either bifenazate or diazene, they showed a normal level of fecundity and predatory activity in the laboratory, effectively suppressing spider mite population growth. Even when the predators were fed spider mite eggs that had been treated previously with bifenazate, they survived. These findings indicate that bifenazate is a very useful acaricide giving high efficacy, long-lasting activity and excellent selectivity for spider mites. It is, therefore, concluded that bifenazate is an ideal compound for controlling these pest mites.
Resistance in Cucumis sativus L. to Tetranychus urticae Koch
Ponti, de, O.M.B.
1980-01-01
Chapter 1
The role of plant breeding and particularly of host plant resistance in integrated control is discussed. Host plant resistance to insects and mites, especially to Tetranychus urticae is reviewed. A standard terminology for disease and pest resistance is recommended.
Schimmel, Bernardus C J; Ataide, Livia M S; Kant, Merijn R
2017-10-03
When feeding from tomato (Solanum lycopersicum), the generalist spider mite Tetranychus urticae induces jasmonate (JA)- and salicylate (SA)-regulated defense responses that hamper its performance. The related T. evansi, a Solanaceae-specialist, suppresses these defenses, thereby upholding a high performance. On a shared leaf, T. urticae can be facilitated by T. evansi, likely via suppression of defenses by the latter. Yet, when infesting the same plant, T. evansi outcompetes T. urticae. Recently, we found that T. evansi intensifies suppression of defenses locally, i.e., at its feeding site, after T. urticae mites were introduced onto adjacent leaf tissue. This hyper-suppression is paralleled by an increased oviposition rate of T. evansi, probably promoting its competitive population growth. Here we present additional data that not only provide insight into the spatiotemporal dynamics of defense induction and suppression by mites, but that also suggest T. evansi to manipulate more than JA and SA defenses alone.
Gent, D H; James, D G; Wright, L C; Brooks, D J; Barbour, J D; Dreves, A J; Fisher, G C; Walton, V M
2009-02-01
Twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), and hop aphid, Phorodon humuli (Schrank) (Hemiptera: Aphididae), are the most important arthropod pests of hop (Humulus lupulus L.) in the Northern Hemisphere. A potential barrier for greater adoption of conservation biological control strategies for spider mites and hop aphid is the extensive use of fungicides for management of hop powdery mildew, Podosphaera macularis (Wallr.:Fr.) U. Braun & S. Takamatsu. Field studies conducted in experimental plots in Oregon and Washington in 2005 and 2006 quantified the effects of powdery mildew fungicide programs (i.e., sulfur, paraffinic oil, and synthetic fungicides) on arthropod pests and natural enemies on hop. Fungicide treatment significantly affected spider mite populations in all four studies. Multiple applications of sulfur fungicides applied before burr development resulted in 1.4-3.3-fold greater spider mite populations during summer. Near the cessation of the sulfur applications, or after a lag of 20-30 d, spider mite populations increased significantly faster on sulfur treated plants compared with water-treated plants in three of four experiments. The effect of paraffinic oil on spider mites was varied, leading to exacerbation of spider mites in Oregon and Washington in 2005, suppression of mites in Oregon in 2006, and no significant effect compared with water in Washington in 2006. Significant relative treatment effects for cone damage due to spider mite feeding were detected in Oregon in 2005 in plots treated with sulfur and paraffinic oil compared with water and synthetic fungicides. Mean populations of hop aphids were similar among treatments in Oregon, although sulfur treatment suppressed hop aphid populations in Washington in 2005 and 2006. Populations of individual predacious insect species and cumulative abundance of macropredators were not consistently suppressed or stimulated by treatments in all trials. However, predatory mite
Balkema-Boomstra, A.G.; Zijlstra, S.; Verstappen, F.W.A.; Inggamer, H.; Mercke, P.
2003-01-01
Cucurbitacins are bitter triterpenoid compounds that are toxic to most organisms and occur widely in wild and cultivated Cucurbitaceae. The only cucurbitacin identified in Cucumis sativus is cucurbitacin C. The bitter taste of cucumber has been correlated with resistance to the spider mite
Ament, Kai; Kant, Merijn R.; Sabelis, Maurice W.; Haring, Michel A.; Schuurink, Robert C.
2004-01-01
The tomato (Lycopersicon esculentum) mutant def-1, which is deficient in induced jasmonic acid (JA) accumulation upon wounding or herbivory, was used to study the role of JA in the direct and indirect defense responses to phytophagous mites (Tetranychus urticae). In contrast to earlier reports, spider mites laid as many eggs and caused as much damage on def-1 as on wild-type plants, even though def-1 lacked induction of proteinase inhibitor activity. However, the hatching-rate of eggs on def-1 was significantly higher, suggesting that JA-dependent direct defenses enhanced egg mortality or increased the time needed for embryonic development. As to gene expression, def-1 had lower levels of JA-related transcripts but higher levels of salicylic acid (SA) related transcripts after 1 d of spider mite infestation. Furthermore, the indirect defense response was absent in def-1, since the five typical spider mite-induced tomato-volatiles (methyl salicylate [MeSA], 4,8,12-trimethyltrideca-1,3,7,11-tetraene [TMTT], linalool, trans-nerolidol, and trans-β-ocimene) were not induced and the predatory mite Phytoseiulus persimilis did not discriminate between infested and uninfested def-1 tomatoes as it did with wild-type tomatoes. Similarly, the expression of the MeSA biosynthetic gene salicylic acid methyltransferase (SAMT) was induced by spider mites in wild type but not in def-1. Exogenous application of JA to def-1 induced the accumulation of SAMT and putative geranylgeranyl diphosphate synthase transcripts and restored MeSA- and TMTT-emission upon herbivory. JA is therefore necessary to induce the enzymatic conversion of SA into MeSA. We conclude that JA is essential for establishing the spider mite-induced indirect defense response in tomato. PMID:15310835
The twospotted spider mite, Tetranychus urticae Koch, is a worldwide pest of numerous agronomic and horticultural plants. Sulfur fungicides are known to induce outbreaks of this pest on several crops, although mechanisms associated with sulfur-induced mite outbreaks are largely unknown. Studies were...
Directory of Open Access Journals (Sweden)
Zeinab YOUSEFI
2017-12-01
Full Text Available Two-spotted spider mite (Tetranychus urticae C. L. Koch, 1836, is one of the most destructive herbivores of common bean. Very little is known about the diversity among resistant sources in this crop. The present study was conducted to characterize 22 resistant and susceptible common bean genotypes by 8 Simple Sequence Repeats (SSRs and 8 Random Amplified Polymorphic DNA (RAPD markers. These SSR and RAPD primers produced 100 % and 81.8 % polymorphic bands. Based on RAPD fingerprints and SSR profiles, pairwise genetic similarity ranged from 0.0 to 0.857 and from 0.125 to 1, respectively. The resistant and susceptible common bean accessions were grouped together in the dendrograms generated from RAPD and SSR clustering analyses. The results indicate that RAPD and SSR analysis could be successfully used for the estimation of genetic diversity among genotypes. SSR markers could group genotypes according to their resistibility and susceptibility to the spotted spider mite but RAPD could not. Therefore, the SSR markers can facilitate the development of resistant common bean cultivars through breeding programs against T. urticae.
Pavlidi, N.; Tseliou, V.; Riga, M.; Nauen, R.; Van Leeuwen, T.; Labrou, N.E.; Vontas, J.
2015-01-01
The two-spotted spider mite Tetranychus urticae is one of the most important agricultural pests world-wide. It is extremely polyphagous and develops resistance to acaricides. The overexpression of several glutathione S-transferases (GSTs) has been associated with insecticide resistance. Here, we
A burst of ABC genes in the genome of the polyphagous spider mite Tetranychus urticae.
Dermauw, Wannes; Osborne, Edward John; Clark, Richard M; Grbić, Miodrag; Tirry, Luc; Van Leeuwen, Thomas
2013-05-10
The ABC (ATP-binding cassette) gene superfamily is widespread across all living species. The majority of ABC genes encode ABC transporters, which are membrane-spanning proteins capable of transferring substrates across biological membranes by hydrolyzing ATP. Although ABC transporters have often been associated with resistance to drugs and toxic compounds, within the Arthropoda ABC gene families have only been characterized in detail in several insects and a crustacean. In this study, we report a genome-wide survey and expression analysis of the ABC gene superfamily in the spider mite, Tetranychus urticae, a chelicerate ~ 450 million years diverged from other Arthropod lineages. T. urticae is a major agricultural pest, and is among of the most polyphagous arthropod herbivores known. The species resists a staggering array of toxic plant secondary metabolites, and has developed resistance to all major classes of pesticides in use for its control. We identified 103 ABC genes in the T. urticae genome, the highest number discovered in a metazoan species to date. Within the T. urticae ABC gene set, all members of the eight currently described subfamilies (A to H) were detected. A phylogenetic analysis revealed that the high number of ABC genes in T. urticae is due primarily to lineage-specific expansions of ABC genes within the ABCC, ABCG and ABCH subfamilies. In particular, the ABCC subfamily harbors the highest number of T. urticae ABC genes (39). In a comparative genomic analysis, we found clear orthologous relationships between a subset of T. urticae ABC proteins and ABC proteins in both vertebrates and invertebrates known to be involved in fundamental cellular processes. These included members of the ABCB-half transporters, and the ABCD, ABCE and ABCF families. Furthermore, one-to-one orthologues could be distinguished between T. urticae proteins and human ABCC10, ABCG5 and ABCG8, the Drosophila melanogaster sulfonylurea receptor and ecdysone-regulated transporter E
Bernardi, Daniel; Botton, Marcos; da Cunha, Uemerson Silva; Bernardi, Oderlei; Malausa, Thibaut; Garcia, Mauro Silveira; Nava, Dori Edson
2013-01-01
The spider mite, Tetranychus urticae, is the major strawberry pest in Brazil. The main strategies for its control comprise synthetic acaricides and predatory mites. The recent register of a commercial formula of azadirachtin (Azamax(®) 12 g L(-1) ) can be viable for control of T. urticae. In this work, the effects of azadirachtin on T. urticae and its compatibility with predatory mites Neoseiulus californicus and Phytoseiulus macropilis in the strawberry crop were evaluated. Azadirachtin was efficient against T. urticae, with a mortality rate similar to that of abamectin. In addition, the azadirachtin showed lower biological persistence (7 days) than abamectin (21 days). Azadirachtin did not cause significant mortality of adult predatory mites (N. californicus and P. macropilis), but it did reduce fecundity by 50%. However, egg viability of the azadirachtin treatments was similar to that of the control (>80% viability). The use of azadirachtin and predatory mites is a valuable tool for controlling T. urticae in strawberry crop. Azadirachtin provided effective control of T. urticae and is compatible with the predatory mites N. californicus and P. macropilis. It is an excellent tool to be incorporated into integrated pest management for strawberry crop in Brazil. Copyright © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Maria L Pappas
Full Text Available Many predatory insects that prey on herbivores also feed on the plant, but it is unknown whether plants affect the performance of herbivores by responding to this phytophagy with defence induction. We investigate whether the prior presence of the omnivorous predator Macrolophus pygmaeus (Rambur on tomato plants affects plant resistance against two different herbivore species. Besides plant-mediated effects of M. pygmaeus on herbivore performance, we examined whether a plant defence trait that is known to be inducible by herbivory, proteinase inhibitors (PI, may also be activated in response to the interactions of this predator with the tomato plant. We show that exposing tomato plants to the omnivorous predator M. pygmaeus reduced performance of a subsequently infesting herbivore, the two-spotted spider mite Tetranychus urticae Koch, but not of the greenhouse whitefly Trialeurodes vaporariorum (Westwood. The spider-mite infested tomato plants experience a lower herbivore load, i.e., number of eggs deposited and individuals present, when previously exposed to the zoophytophagous predator. This effect is not restricted to the exposed leaf and persists on exposed plants for at least two weeks after the removal of the predators. The decreased performance of spider mites as a result of prior exposure of the plant to M. pygmaeus is accompanied by a locally and systemically increased accumulation of transcripts and activity of proteinase inhibitors that are known to be involved in plant defence. Our results demonstrate that zoophytophagous predators can induce plant defence responses and reduce herbivore performance. Hence, the suppression of populations of certain herbivores via consumption may be strengthened by the induction of plant defences by zoophytophagous predators.
DEFF Research Database (Denmark)
Nachman, Gösta
2006-01-01
The spatial distributions of two-spotted spider mites Tetranychus urticae and their natural enemy, the phytoseiid predator Phytoseiulus persimilis, were studied on six full-grown cucumber plants. Both mite species were very patchily distributed and P. persimilis tended to aggregate on leaves...
Khajehali, J.; Van Nieuwenhuyse, P.; Demaeght, P.; Tirry, L.; Van Leeuwen, T.
2011-01-01
BACKGROUND: Spider mites are important crop pests that rapidly develop resistance to acaricides. To investigate whether acaricide resistance is a threat to greenhouse rose culture in the Netherlands, the susceptibility of 15 strains of Tetranychus urticae was tested to several currently used
Directory of Open Access Journals (Sweden)
J. Lima-Espíndola
2017-09-01
Full Text Available The spider mite Tetranychus merganser occurs in some crops in Mexico and USA. This mite could be considered a potential pest in countries like Japan. In this work we recorded the damages that T. merganser causes to the nopal verdura (prickly pear vegetable crop in one of the principal cactus crop regions of Mexico.
Spectral response of spider mite infested cotton: Mite density and miticide rate study
Two-spotted spider mites are important pests in many agricultural systems. Spider mites (Acari: Tetranychidae) have been found to cause economic damage in corn, cotton, and sorghum. Adult glass vial bioassays indicate that Temprano™ (abamectin) is the most toxic technical miticide for adult two-spot...
van Wijk, M.; de Bruijn, P.J.A.; Sabelis, M.W.
2010-01-01
Phytoseiulus persimilis is a predatory mite that in absence of vision relies on the detection of herbivore-induced plant odors to locate its prey, the two-spotted spider-mite Tetranychus urticae. This herbivorous prey is feeding on leaves of a wide variety of plant species in different families. The
Woods, J L; James, D G; Lee, J C; Gent, D H
2011-12-01
The use of synthetic herbivore-induced plant volatiles (HIPV) to attract natural enemies has received interest as a tool to enhance conservation biological control (CBC). Methyl salicylate (MeSA) is a HIPV that is attractive to several key predators of two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), and hop aphid, Phorodon humuli (Schrank) (Homoptera: Aphididae). A 2-year study was conducted to evaluate the recommended commercial use of MeSA in hop yards in Oregon. Slow-release MeSA dispensers were stapled to supporting poles in 0.5 ha plots and these plots were compared to a paired non-treated plot on each of three farms in 2008 and 2009. Across both years, there was a trend for reduced (range 40-91%) mean seasonal numbers of T. urticae in five of the six MeSA-baited plots. Stethorus spp., key spider mite predators, tended to be more numerous in MeSA-baited plots compared to control plots on a given farm. Mean seasonal densities of hop aphid and other natural enemies (e.g., Orius spp. and Anystis spp.) were similar between MeSA-treated and control plots. Variability among farms in suppression of two-spotted spider mites and attraction of Stethorus spp. suggests that the use of MeSA to enhance CBC of spider mites in commercial hop yards may be influenced by site-specific factors related to the agroecology of individual farms or seasonal effects that require further investigation. The current study also suggests that CBC of hop aphid with MeSA in this environment may be unsatisfactory.
Jonckheere, Wim; Dermauw, Wannes; Khalighi, Mousaalreza; Pavlidi, Nena; Reubens, Wim; Baggerman, Geert; Tirry, Luc; Menschaert, Gerben; Kant, Merijn R; Vanholme, Bartel; Van Leeuwen, Thomas
2018-01-01
The salivary protein repertoire released by the herbivorous pest Tetranychus urticae is assumed to hold keys to its success on diverse crops. We report on a spider mite-specific protein family that is expanded in T. urticae. The encoding genes have an expression pattern restricted to the anterior podocephalic glands, while peptide fragments were found in the T. urticae secretome, supporting the salivary nature of these proteins. As peptide fragments were identified in a host-dependent manner, we designated this family as the SHOT (secreted host-responsive protein of Tetranychidae) family. The proteins were divided in three groups based on sequence similarity. Unlike TuSHOT3 genes, TuSHOT1 and TuSHOT2 genes were highly expressed when feeding on a subset of family Fabaceae, while expression was depleted on other hosts. TuSHOT1 and TuSHOT2 expression was induced within 24 h after certain host transfers, pointing toward transcriptional plasticity rather than selection as the cause. Transfer from an 'inducer' to a 'noninducer' plant was associated with slow yet strong downregulation of TuSHOT1 and TuSHOT2, occurring over generations rather than hours. This asymmetric on and off regulation points toward host-specific effects of SHOT proteins, which is further supported by the diversity of SHOT genes identified in Tetranychidae with a distinct host repertoire.
Szczepaniec, Adrianna; Raupp, Michael J.; Parker, Roy D.; Kerns, David; Eubanks, Micky D.
2013-01-01
Background Chemical suppression of arthropod herbivores is the most common approach to plant protection. Insecticides, however, can cause unintended, adverse consequences for non-target organisms. Previous studies focused on the effects of pesticides on target and non-target pests, predatory arthropods, and concomitant ecological disruptions. Little research, however, has focused on the direct effects of insecticides on plants. Here we demonstrate that applications of neonicotinoid insecticides, one of the most important insecticide classes worldwide, suppress expression of important plant defense genes, alter levels of phytohormones involved in plant defense, and decrease plant resistance to unsusceptible herbivores, spider mites Tetranychus urticae (Acari: Tetranychidae), in multiple, distantly related crop plants. Methodology/Principal Findings Using cotton (Gossypium hirsutum), corn (Zea mays) and tomato (Solanum lycopersicum) plants, we show that transcription of phenylalanine amonia lyase, coenzyme A ligase, trypsin protease inhibitor and chitinase are suppressed and concentrations of the phytohormone OPDA and salicylic acid were altered by neonicotinoid insecticides. Consequently, the population growth of spider mites increased from 30% to over 100% on neonicotinoid-treated plants in the greenhouse and by nearly 200% in the field experiment. Conclusions/Significance Our findings are important because applications of neonicotinoid insecticides have been associated with outbreaks of spider mites in several unrelated plant species. More importantly, this is the first study to document insecticide-mediated disruption of plant defenses and link it to increased population growth of a non-target herbivore. This study adds to growing evidence that bioactive agrochemicals can have unanticipated ecological effects and suggests that the direct effects of insecticides on plant defenses should be considered when the ecological costs of insecticides are evaluated. PMID
Rojas, M Guadalupe; Morales-Ramos, Juan Alfredo
2010-12-01
The impact of linamarin and lotaustralin content in the leaves of lima beans, Phaseolus lunatus L., on the second and third trophic levels was studied in the two-spotted spider mite, Tetranychus urticae (Koch), and its predator Phytoseiulus persimilis Athias-Henriot. The content of linamarin was higher in terminal trifoliate leaves (435.5 ppm) than in primary leaves (142.1 ppm) of Henderson bush lima beans. However, linamarin concentrations were reversed at the second trophic level showing higher concentrations in spider mites feeding on primary leaves (429.8 ppm) than those feeding on terminal trifoliate leaves (298.2 ppm). Concentrations of linamarin in the predatory mites were 18.4 and 71.9 ppm when feeding on spider mites grown on primary and terminal leaves, respectively. The concentration of lotaustralin in primary lima bean leaves was 103.12 ppm, and in spider mites feeding on these leaves was 175.0 ppm. Lotaustralin was absent in lima bean terminal trifoliate leaves and in mites feeding on these leaves. Fecundity of spider mites feeding on lima bean leaves (primary or trifoliate) was not significantly different from mites feeding on red bean, Phaseolus vulgaris L., primary leaves. However, the progeny sex ratio (in females per male) of spider mites feeding on lima bean leaves was significantly lower than progeny of spider mites feeding on red bean leaves (control). Fecundity and progeny sex ratio of P. persimilis were both significantly affected by the concentration of linamarin present in the prey. Changes in concentration of linamarin in living tissue across the three trophic levels are discussed.
Directory of Open Access Journals (Sweden)
Nicolas Bensoussan
2016-07-01
Full Text Available The two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae, is one of the most polyphagous herbivores feeding on cell contents of over 1,100 plant species including more than 150 crops. It is being established as a model for chelicerate herbivores with tools that enable tracking of reciprocal responses in plant-spider mite interactions. However, despite their important pest status and a growing understanding of the molecular basis of interactions with plant hosts, knowledge of the way mites interface with the plant while feeding and the plant damage directly inflicted by mites is lacking. Here, utilizing histology and microscopy methods, we uncovered several key features of T. urticae feeding. By following the stylet path within the plant tissue, we determined that the stylet penetrates the leaf either in between epidermal pavement cells or through a stomatal opening, without damaging the epidermal cellular layer. Our recordings of mite feeding established that duration of the feeding event ranges from several minutes to more than half an hour, during which time mites consume a single mesophyll cell in a pattern that is common to both bean and Arabidopsis plant hosts. In addition, this study determined that leaf chlorotic spots, a common symptom of mite herbivory, do not form as an immediate consequence of mite feeding. Our results establish a cellular context for the plant-spider mite interaction that will support our understanding of the molecular mechanisms and cell signaling associated with spider mite feeding.
Skirvin, D J; de Courcy Williams, M
1999-06-01
The influence of plant species on the population dynamics of the spider mite pest, Tetranychus urticae, and its predator, Phytoseiulus persimilis, was examined as a prerequisite to effective biological control on ornamental nursery stock. Experiments have been done to investigate how the development, fecundity and movement of T. urticae, and the movement of P. persimilis were affected by plant species. A novel experimental method, which incorporates plant structure, was used to investigate the functional response of P. persimilis. Development times for T. urticae were consistent with published data and did not differ with plant species in a biologically meaningful way. Plant species was shown to have a major influence on fecundity (P < 0.001) and movement of the pest mite (P < 0.01), but no influence on the movement of the predator. The movement of both pest and predator was shown to be related to the density of the adult pest mites on the plant (P < 0.001). Plant structure affected the functional response, particularly in relation to the ability of the predator to locate prey at low densities. The impact of these findings on the effective use of biological control on ornamental nursery stock is discussed.
Woods, J L; Dreves, A J; Fisher, G C; James, D G; Wright, L C; Gent, D H
2012-06-01
The twospotted spider mite, Tetranychus urticae Koch, is a worldwide pest of numerous agronomic and horticultural plants. Sulfur fungicides are known to induce outbreaks of this pest on several crops, although mechanisms associated with sulfur-induced mite outbreaks are largely unknown. Studies were conducted during 2007-2009 in Oregon and Washington hop yards to evaluate the effect of timing of sulfur applications on T. urticae and key predators. In both regions, applications of sulfur made relatively late in the growing season (mid-June to mid-July) were associated with the greatest exacerbation of spider mite outbreaks, particularly in the upper canopy of the crop. The severity of mite outbreaks was closely associated with sulfur applications made during a relatively narrow time period coincident with the early exponential phase of spider mite increase and rapid host growth. A nonlinear model relating mean cumulative mite days during the time of sulfur sprays to the percent increase in total cumulative mite days (standardized to a nontreated plot) explained 58% of the variability observed in increased spider mite severity related to sulfur spray timing. Spatial patterns of spider mites in the Oregon plots indicated similar dispersal of motile stages of spider mites among leaves treated with sulfur versus nontreated leaves; however, in two of three years, eggs were less aggregated on leaves of sulfur-treated plants, pointing to enhanced dispersal. Apart from one experiment in Washington, relatively few predatory mites were observed during the course of these studies, and sulfur-induced mite outbreaks generally occurred irrespective of predatory mite abundance. Collectively, these studies indicate sulfur induces mite outbreaks through direct or indirect effects on T. urticae, mostly independent of predatory mite abundance or toxicity to these predators. Avoidance of exacerbation of spider mite outbreaks by sulfur sprays was achieved by carefully timing
Wybouw, N; Van Leeuwen, T; Dermauw, W
2018-06-01
A number of horizontal gene transfers (HGTs) have been identified in the spider mite Tetranychus urticae, a chelicerate herbivore. However, the genome of this mite species has at present not been thoroughly mined for the presence of HGT genes. Here, we performed a systematic screen for HGT genes in the T. urticae genome using the h-index metric. Our results not only validated previously identified HGT genes but also uncovered 25 novel HGT genes. In addition to HGT genes with a predicted biochemical function in carbohydrate, lipid and folate metabolism, we also identified the horizontal transfer of a ketopantoate hydroxymethyltransferase and a pantoate β-alanine ligase gene. In plants and bacteria, both genes are essential for vitamin B5 biosynthesis and their presence in the mite genome strongly suggests that spider mites, similar to Bemisia tabaci and nematodes, can synthesize their own vitamin B5. We further show that HGT genes were physically embedded within the mite genome and were expressed in different life stages. By screening chelicerate genomes and transcriptomes, we were able to estimate the evolutionary histories of these HGTs during chelicerate evolution. Our study suggests that HGT has made a significant and underestimated impact on the metabolic repertoire of plant-feeding spider mites. © 2018 The Royal Entomological Society.
Riga, M.; Tsakireli, D.; Ilias, A.; Morou, E.; Myridakis, A.; Stephanou, E.G.; Nauen, R.; Dermauw, W.; Van Leeuwen, T.; Paine, M.; Vontas, J.
2014-01-01
Abamectin is one of the most important insecticides worldwide. It is used against major agricultural pests and insects of public health importance, as well as against endoparasites in animal health. Abamectin has been used successfully for the control of the spider mite Tetranychus urticae, a major
Nachman, Gösta; Zemek, Rostislav
2003-01-01
To investigate the relative contributions of bottom-up (plant condition) and top-down (predatory mites) factors on the dynamics of the two-spotted spider mite (Tetranychus urticae), a series of experiments were conducted in which spider mites and predatory mites were released on bean plants. Plants inoculated with 2, 4, 8, 16, and 32 adult female T. urticae were either left untreated or were inoculated with 3 or 5 adult female predators (Phytoseiulus persimilis) one week after the introduction of spider mites. Plant area, densities of T. urticae and P. persimilis, and plant injury were assessed by weekly sampling. Data were analysed by a combination of statistical methods and a tri-trophic mechanistic simulation model partly parameterised from the current experiments and partly from previous data. The results showed a clear effect of predators on the density of spider mites and on the plant injury they cause. Plant injury increased with the initial number of spider mites and decreased with the initial number of predators. Extinction of T. urticae, followed by extinction of P. persimilis, was the most likely outcome for most initial combinations of prey and predators. Eggs constituted a relatively smaller part of the prey population as plant injury increased and of the predator population as prey density decreased. We did not find statistical evidence of P. persimilis having preference for feeding on T. urticae eggs. The simulation model demonstrated that bottom-up and top-down factors interact synergistically to reduce the density of spider mites. This may have important implications for biological control of spider mites by means of predatory mites.
Wang, Jin-Jun; Zhang, Jian-Ping; He, Lin; Zhao, Zhi-Mo
2006-01-01
Development, reproduction and acaricide susceptibility of Tetranychus cinnabarinus (Boisduvals) (Acari: Tetranychidae) were investigated after long-term (about 40 generations) exposure to various levels of acid rain; pH 2.5, 3.0, 4.0, and 5.6. Deionized water (pH 6.8) served as a control. The mites were reared on eggplant leaves at 28?C, 80%RH and a photoperiod of 14:10 (L:D) in the laboratory. The results showed that the duration of the immature stage was significantly affected by acid rain ...
Directory of Open Access Journals (Sweden)
Yayan Sanjaya
2013-12-01
Full Text Available The pathogenicity of three entomopathogenic fungal species to Tetranychus kanzawai was investigated. Seven isolates of Metarhizium anisopliae, six isolates of Beauveria bassiana, and an isolate of Paecilomyces lilacinus from the Philippines and Indonesia were evaluated. The following studies were undertaken: (1 screening of M. anisoplae, B. bassiana and P. lilicanus pathogenic to T. kanzawai, and (2 bioefficacy studies of the selected entomopathogenic fungi under greenhouse conditions. Conidia of each isolate were mass-produced on potato dextrose agar (PDA at 26+-1 oC and a 12-hour photophase for a maximum of 21 days. Preliminary screening for the most pathogenic isolate within the same species was determined using suspension with 104 to 108 conidia ml-1. At 4 days after treatment (DAT, the pathogenicity within M. anisopliae isolates in decreasing order was Ma5>Ma6>Ma4>Ma2>Ma1>Ma3>Ma7 while for B. bassiana, was Bb6>Bb5>Bb4>Bb3>Bb1>Bb2. The top three most pathogenic isolates within the two species were subjected to further studies to determine the most virulent isolate against T. kanzawai. At 5 DAT, the LC50 values of M. anisopliae isolates ranged from 5.0 x102 to 1.4x103 while for B. bassiana ranged from 1.2 x 103 to 2.4x 103 conidia ml-1. Based on LC50, the virulence of the fungal isolates within the species in decreasing order was Ma6>Ma5>Ma4 and Bb6>Bb5>Bb4. However, the LC50 values are not significantly different from each other. Green house trials showed that the epizootic of entomopathogenic fungus can regulate the population of mites. The fungal isolates used in the study, although not originally isolated from mites were virulent to T. kanzawai, indicating their wide host range.
Directory of Open Access Journals (Sweden)
Salmane Ineta
2015-04-01
Full Text Available The aim of the present study was to determine the seasonal pattern of two-spotted spider mite Tetranychus urticae on strawberries cultivated in polythene-covered high tunnels in temperate climatic conditions. Various cultivars were used and the effect of modification of plant covering indices on abundance and incidence of these mites was also tested. The number of two-spotted spider mites was relatively low at the beginning of the vegetation season and started to increase when average air temperature rose above 20 to 25 °C. In the experiment two types of tunnels differing in additional plant cover were used. The maximum mite abundance did not significantly vary between varieties in tunnel 1 conditions, but it was significantly lower for variety 'Sonata' in tunnel 2 conditions. Mite numbers significantly declined after strawberry foliage mowing and removal of polythene cover. Mite development was prolonged in tunnel 1, where additional cover of plants was used and higher early season air temperature was recorded in comparison to tunnel 2. It was concluded that increase in early season temperature can increase two-spotted spider mite abundance and have a more negative effect on strawberry plants in respect of foliage damage by mites.
Alternative phenotypes of male mating behaviour in the two-spotted spider mite.
Sato, Yukie; Sabelis, Maurice W; Egas, Martijn; Faraji, Farid
2013-09-01
Severe intraspecific competition for mates selects for aggressive individuals but may also lead to the evolution of alternative phenotypes that do not act aggressively, yet manage to acquire matings. The two-spotted spider mite, Tetranychus urticae, shows male mate-guarding behaviour and male-male combat for available females. This may provide opportunity for weaker males to avoid fighting by adopting alternative mating behaviour such as sneaker or satellite tactics as observed in other animals. We investigated male precopulatory behaviour in the two-spotted spider mite by means of video-techniques and found three types of male mating behaviour: territorial, sneaker and opportunistic. Territorial and sneaker males associate with female teleiochrysales and spend much time guarding them. Territorial males are easily disturbed by rival males and engage themselves in fights with them. However, sneaker males are not at all disturbed by rival males, never engage in fights and, strikingly, never face attack by territorial males. Opportunistic males wander around in search of females that are in the teleiochrysalis stage but very close to or at emergence. To quickly classify any given mate-guarding male as territorial or sneaker we developed a method based on the instantaneous response of males to disturbance by a live male mounted on top of a brush. We tested this method against the response of the same males to natural disturbance by two or three other males. Because this method proved to be successful, we used it to collect territorial and sneaker males, and subjected them to morphological analysis to assess whether the various behavioural phenotypes are associated with different morphological characters. However, we found no statistical differences between territorial and sneaker males, concerning the length of the first legs, the stylets, the pedipalps or the body.
Khodayari, Samira; Abedini, Fatemeh; Renault, David
2018-05-01
The plant stress hypothesis posits that a herbivore's reproductive success increases when it feeds on stressed plants, while the plant vigor hypothesis predicts that a herbivore preferentially feeds on more vigorous plants. We examined these opposing hypotheses by growing spider mites (Tetranychus urticae) on the leaves of stressed and healthy (vigorous) cucumber plants. Host plants were grown under controlled conditions at low, moderate, and high concentrations of NaCl (to induce salinity stress), at low, moderate, and high fertilizer concentrations (to support growth), and without these additions (control). The effects of these treatments were evaluated by measuring fresh and dry plant biomass, carotenoid and chlorophyll content, antioxidant enzyme activity, and concentrations of PO 4 3- , K + , and Na + in plant tissues. The addition of low concentrations of fertilizer increased dry mass, protein, and carotenoid content relative to controls, suggesting a beneficial effect on plants. The highest NaCl treatment (2560 mg L -1 ) resulted in increased Na + and protein content relative to control plants, as well as reduced PO 4 3- , K + , and chlorophyll levels and reduced catalase and ascorbate peroxidase enzyme activity levels. Analysis of life table data of T. urticae mites raised on leaves from the aforementioned plant groups showed the intrinsic rate of increase (r) for mites was 0.167 day -1 in control specimens, 0.125 day -1 for mites reared on plants treated with a moderate concentration of fertilizer (10 mL L -1 ), and was highest (0.241 day -1 ) on plants grown under moderate salinity conditions (1920 mg L -1 NaCl). Reproductive success of T. urticae did not differ on plants watered with a moderate concentration of NaCl or a high concentration of fertilizer. The moderately-stressed plants formed a favorable environment for the development and reproduction of spider mites, supporting the plant stress hypothesis.
International Nuclear Information System (INIS)
Sadras, V.O.; Wilson, L.J.
1997-01-01
Two-spotted spider mites (Tetranychus urticae Koch) are important pests of cotton (Gossypium hirsutum L.). The effects of mites on cotton photosynthesis have been investigated at the leaf and cytological level but not at the canopy level. Our objective was to quantify the effects of timing and intensity of infestation by mites on cotton radiation-use efficiency (RUE). Leaf area, light interception, RUE, canopy temperature, and leaf nitrogen concentration (LNC) were assessed during two growing seasons in crops artificially infested with mites between 59 and 127 d after sowing. Normal and okra-leaf cultivars were compared. A mite index (MI = natural log of the area under the curve of mite number vs thermal time) was used to quantify the cumulative effects of mites on RUE, LNC, and canopy temperature. Crop growth reduction due to mites was greater in early- than in late-infested crops Growth reduction was primarily due to reductions in RUE, but in the more severe treatments accelerated leaf senescence and, hence. reduced light interception also contributed to reductions in crop growth. At a given date, infested okra-leaf crops usually had greater RUE than their normal-leaf counterparts. Both plant types, however. responded similarly to a given level of mite infestation. The ability of the okra-leaf cultivar to maintain greater RUE levels can be attributed. therefore, to its relative inhospitality for the development of mite colonies rather than to an intrinsically greater capacity to maintain photosynthesis under mite damage. Canopy temperature, LNC, and RUE showed a similar, biphasic pattern of response to Ml. In the first phase, response variables were almost unaffected by mites. In the second phase, there was a marked decline in RUE and LNC and a marked increase in canopy temperature with increasing MI. These results suggest (i) some degree of compensatory photosynthesis at low to moderate levels of mite infestation, and (ii) reductions in RUE of mite
Seki, Kousuke
2016-10-01
The development of a cultivar resistant to the two-spotted spider mite has provided both ecological and economic benefits to the production of cut flowers. This study aimed to clarify the mechanism of resistance to mites using an inbred population of carnations. In the resistant and susceptible plants selected from an inbred population, a difference was recognised in the thickness of the abaxial palisade tissue by microscopic examination of the damaged leaf. Therefore, it was assumed that mites displayed feeding preferences within the internal leaf structure of the carnation leaf. The suitability of the host plant for mites was investigated using several cultivars selected using an index of the thickness from the abaxial leaf surface to the spongy tissue. The results suggested that the cultivar associated with a thicker abaxial tissue lowered the intrinsic rate of natural increase of the mites. The cultivars with a thicker abaxial tissue of over 120 µm showed slight damage in the field test. The ability of mites to feed on the spongy tissue during an early life stage from hatching to adult emergence was critical. It was possible to select a cultivar that is resistant to mites under a real cultivation environment by observing the internal structure of the leaf. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
M. E. Santamaria
2018-04-01
Full Text Available Under natural conditions, plants suffer different stresses simultaneously or in a sequential way. At present, the combined effect of biotic and abiotic stressors is one of the most important threats to crop production. Understanding how plants deal with the panoply of potential stresses affecting them is crucial to develop biotechnological tools to protect plants. As well as for drought stress, the economic importance of the spider mite on agriculture is expected to increase due to climate change. Barley is a host of the polyphagous spider mite Tetranychus urticae and drought produces important yield losses. To obtain insights on the combined effect of drought and mite stresses on the defensive response of this cereal, we have analyzed the transcriptomic responses of barley plants subjected to dehydration (water-deficit treatment, spider mite attack, or to the combined dehydration-spider mite stress. The expression patterns of mite-induced responsive genes included many jasmonic acid responsive genes and were quickly induced. In contrast, genes related to dehydration tolerance were later up-regulated. Besides, a higher up-regulation of mite-induced defenses was showed by the combined dehydration and mite treatment than by the individual mite stress. On the other hand, the performance of the mite in dehydration stressed and well-watered plants was tested. Despite the stronger defensive response in plants that suffer dehydration and mite stresses, the spider mite demonstrates a better performance under dehydration condition than in well-watered plants. These results highlight the complexity of the regulatory events leading to the response to a combination of stresses and emphasize the difficulties to predict their consequences on crop production.
Santamaria, M. E.; Diaz, Isabel; Martinez, Manuel
2018-01-01
Under natural conditions, plants suffer different stresses simultaneously or in a sequential way. At present, the combined effect of biotic and abiotic stressors is one of the most important threats to crop production. Understanding how plants deal with the panoply of potential stresses affecting them is crucial to develop biotechnological tools to protect plants. As well as for drought stress, the economic importance of the spider mite on agriculture is expected to increase due to climate change. Barley is a host of the polyphagous spider mite Tetranychus urticae and drought produces important yield losses. To obtain insights on the combined effect of drought and mite stresses on the defensive response of this cereal, we have analyzed the transcriptomic responses of barley plants subjected to dehydration (water-deficit) treatment, spider mite attack, or to the combined dehydration-spider mite stress. The expression patterns of mite-induced responsive genes included many jasmonic acid responsive genes and were quickly induced. In contrast, genes related to dehydration tolerance were later up-regulated. Besides, a higher up-regulation of mite-induced defenses was showed by the combined dehydration and mite treatment than by the individual mite stress. On the other hand, the performance of the mite in dehydration stressed and well-watered plants was tested. Despite the stronger defensive response in plants that suffer dehydration and mite stresses, the spider mite demonstrates a better performance under dehydration condition than in well-watered plants. These results highlight the complexity of the regulatory events leading to the response to a combination of stresses and emphasize the difficulties to predict their consequences on crop production. PMID:29681917
Rijal, Jhalendra P; Wilson, Rob; Godfrey, Larry D
2016-02-01
Twospotted spider mite, Tetranychus urticae Koch, is an important pest of peppermint in California, USA. Spider mite feeding on peppermint leaves causes physiological changes in the plant, which coupling with the favorable environmental condition can lead to increased mite infestations. Significant yield loss can occur in absence of pest monitoring and timely management. Understating the within-field spatial distribution of T. urticae is critical for the development of reliable sampling plan. The study reported here aims to characterize the spatial distribution of mite infestation in four commercial peppermint fields in northern California using spatial techniques, variogram and Spatial Analysis by Distance IndicEs (SADIE). Variogram analysis revealed that there was a strong evidence for spatially dependent (aggregated) mite population in 13 of 17 sampling dates and the physical distance of the aggregation reached maximum to 7 m in peppermint fields. Using SADIE, 11 of 17 sampling dates showed aggregated distribution pattern of mite infestation. Combining results from variogram and SADIE analysis, the spatial aggregation of T. urticae was evident in all four fields for all 17 sampling dates evaluated. Comparing spatial association using SADIE, ca. 62% of the total sampling pairs showed a positive association of mite spatial distribution patterns between two consecutive sampling dates, which indicates a strong spatial and temporal stability of mite infestation in peppermint fields. These results are discussed in relation to behavior of spider mite distribution within field, and its implications for improving sampling guidelines that are essential for effective pest monitoring and management.
Örtücü, Serkan; Algur, Ömer Faruk
2017-04-01
This study was conducted to isolation entomopathogenic fungi for possible use in biocontrol of two-spotted spider mite Tetranychus urticae Koch. and to determine their pathogenicity. For this purpose, plant leaves infected with T. urticae were collected from Erzurum, Kars and Ardahan. At laboratory, the internal and external mycoflora of T.urticae individuals on plant leaves were determined. As a result of isolation, twenty-five different fungi species belonging to the genera Acremonium, Alternaria, Aspergillus, Beauveria, Cladosporium, Gliocladium, Humicola, Penicillium, Trichoderma, Isaria, Ulocladium and Verticillium were obtained. Pathogenicity of this forty-five isolate belonging to twenty-five species were evaluated. As a test organism, T. urticae was used and suspensions (1 × 108conidia ml-1) were prepared in Tween 80. 2ml suspension of a single dose was sprayed onto down side of bean leaf discs using hand sprayer. Mortality was recorded daily for 7 days. A total of twelve isolates belonging to three species were determined to be pathogen against T.urticae. According to scale used: AT020 Isaria farinosa and AT025 Cladosporium cladosporioides were determined as least pathogen, AT037 and AT101 Beauveria bassiana, and AT019 and AT026 C. cladosporioides, and AT035 and AT036 I. farinosa as moderate pathogen, AT007, AT021, AT034 and AT076 B. bassiana as highly pathogen. The other thirty-three isolates found that not pathogenic against T.urticae.
Tachi, Fuyuki; Osakabe, Masahiro
2012-12-01
Ambient ultraviolet-B (UVB) radiation impacts plant-dwelling arthropods including herbivorous and predatory mites. However, the effects of UVB on prey-predator systems, such as that between the herbivorous spider mite and predatory phytoseiid mite, are poorly understood. A comparative study was conducted to determine the vulnerability and behavioral responses of these mites to ultraviolet (UV) radiation. First, we analyzed dose-response (cumulative irradiance-mortality) curves for the eggs of phytoseiid mites ( Neoseiulus californicus, Neoseiulus womersleyi, and Phytoseiulus persimilis) and the spider mite ( Tetranychus urticae) to UVB radiation from a UV lamp. This indicated that the phytoseiid mites were more vulnerable than the spider mite, although P. persimilis was slightly more tolerant than the other two phytoseiid mites. Second, we compared the avoidance behavior of adult female N. californicus and two spider mite species ( T. urticae, a lower leaf surface user; Panonychus citri, an upper leaf surface user) in response to solar UV and visible light. N. californicus actively avoided both types of radiation, whereas P. citri showed only minimal avoidance behavior. T. urticae actively avoided UV as well as N. californicus but exhibited a slow response to visible light as well as P. citri. Such variation in vulnerability and avoidance behavior accounts for differences in the species adaptations to solar UVB radiation. This may be the primary factor determining habitat use among these mites on host plant leaves, subsequently affecting accessibility by predators and also intraguild competition.
Directory of Open Access Journals (Sweden)
Wilson Roberto Maluf
2007-09-01
Full Text Available The objective of this work was to evaluate the feasibility of selection for higher glandular trichome densities, as an indirect criterion of selection for increasing repellence to spider mites Tetranychus urticae, in tomato populations derived from an interspecific cross between Lycopersicon esculentum x L. hirsutum var. glabratum PI 134417. Trichome densities were evaluated in 19 genotypes, including 12 from advanced backcross populations, derived from the original cross L. esculentum x L. hirsutum var. glabratum PI 134417. Counts were made both on the adaxial and abaxial leaf surfaces, and trichomes were classified into glandular types IV and VI, other glandular types (types I+VII, and nonglandular types. Mite repellence was measured by distances walked by mites onto the tomato leaf surface after 20, 40 and 60 min. Spider mite repellence biotests indicated that higher densities of glandular trichomes (especially type VI decreased the distances walked by the mites onto the tomato leaf surface. Selection of plants with higher densities of glandular trichomes can be an efficient criterion to obtain tomato genotypes with higher resistance (repellence to spider mites.O objetivo deste trabalho foi avaliar a eficiência da seleção para maior densidade de tricomas glandulares na resistência (repelência ao ácaro Tetranychus urticae, em populações de tomate derivadas do cruzamento interespecífico Lycopersicon esculentum x L. hirsutum var. glabratum PI 134417. Foram avaliados 19 genótipos quanto à densidade de tricomas, que incluíram 12 derivados de populações avançadas de retrocruzamentos, obtidos a partir do cruzamento original L. esculentum x L. hirsutum var. glabratum PI 134417. Nas faces abaxial e adaxial dos folíolos, realizaram-se as contagens e os tricomas foram classificados em glandulares tipo IV e VI, outros glandulares (tipo I e VII e não glandulares. A repelência aos ácaros foi medida pela distância média, percorrida pelo
Directory of Open Access Journals (Sweden)
Attia, S.
2015-01-01
Full Text Available Description of the subject. Synthetic acaricides have been widely used to manage Tetranychus urticae. Due to the excessive use of biocide and the associated problems of pesticide resistance and environmental pollution, there is an increasing demand for sustainable, environmentally-friendly control methods. Among the current alternative strategies aimed at decreasing the pest populations, the pesticides based on plant extracts are currently one of the most promising methods. Essential oils with acaricidal properties have been categorized as green pesticides because they are biodegradable and predominantly non-toxic to vertebrates. Objectives. With an aim to reduce the use of synthetic pesticides, they represent a promising approach for eco-chemical control of mites. Method. The aim of the present work was to analyze the risk of resistance emergence of T. urticae to repeated treatments with four plant extracts: Deverra scoparia Coss. & Durieu (Araliales: Apiaceae, Hertia cheirifolia (L. Kuntze (Asterales: Ateraceae, Santolina africana Jord. & Fourr. (Asterales: Asteraceae essential oils and garlic distillate Allium sativum L. (Asparagales: Alliaceae after 20 generations. Results. Repeated treatments with S. africana essential oil during 20 generations did not provoke an emergence of resistance while a low development of resistance was observed with H. cheirifolia, A. sativum and D. scoparia extracts. Conclusions. The efficacy of these extracts against the two spotted spider mite and their low development of resistance make them a promising use for pest management.
Directory of Open Access Journals (Sweden)
Chunya Bu
2015-01-01
Full Text Available Tetranychus cinnabarinus (Acari: Tetranychidae is a worldwide polyphagous agricultural pest that has the title of resistance champion among arthropods. We reported previously the identification of the acaricidal compound β-sitosterol from Mentha piperita and Inula japonica. However, the acaricidal mechanism of β-sitosterol is unclear. Due to the limited genetic research carried out, we de novo assembled the transcriptome of T. cinnabarinus using Illumina sequencing and conducted a differential expression analysis of control and β-sitosterol-treated mites. In total, we obtained >5.4 G high-quality bases for each sample with unprecedented sequencing depth and assembled them into 22,941 unigenes. We identified 617 xenobiotic metabolism-related genes involved in detoxification, binding, and transporting of xenobiotics. A highly expanded xenobiotic metabolic system was found in mites. T. cinnabarinus detoxification genes—including carboxyl/cholinesterase and ABC transporter class C—were upregulated after β-sitosterol treatment. Defense-related proteins, such as Toll-like receptor, legumain, and serine proteases, were also activated. Furthermore, other important genes—such as the chloride channel protein, cytochrome b, carboxypeptidase, peritrophic membrane chitin binding protein, and calphostin—may also play important roles in mites’ response to β-sitosterol. Our results demonstrate that high-throughput-omics tool facilitates identification of xenobiotic metabolism-related genes and illustration of the acaricidal mechanisms of β-sitosterol.
Szczepaniec, Adrianna; Creary, Scott F.; Laskowski, Kate L.; Nyrop, Jan P.; Raupp, Michael J.
2011-01-01
Background Attempts to eradicate alien arthropods often require pesticide applications. An effort to remove an alien beetle from Central Park in New York City, USA, resulted in widespread treatments of trees with the neonicotinoid insecticide imidacloprid. Imidacloprid's systemic activity and mode of entry via roots or trunk injections reduce risk of environmental contamination and limit exposure of non-target organisms to pesticide residues. However, unexpected outbreaks of a formerly innocuous herbivore, Tetranychus schoenei (Acari: Tetranychidae), followed imidacloprid applications to elms in Central Park. This undesirable outcome necessitated an assessment of imidacloprid's impact on communities of arthropods, its effects on predators, and enhancement of the performance of T. schoenei. Methodology/Principal Findings By sampling arthropods in elm canopies over three years in two locations, we document changes in the structure of communities following applications of imidacloprid. Differences in community structure were mostly attributable to increases in the abundance of T. schoenei on elms treated with imidacloprid. In laboratory experiments, predators of T. schoenei were poisoned through ingestion of prey exposed to imidacloprid. Imidacloprid's proclivity to elevate fecundity of T. schoenei also contributed to their elevated densities on treated elms. Conclusions/Significance This is the first study to report the effects of pesticide applications on the arthropod communities in urban landscapes and demonstrate that imidacloprid increases spider mite fecundity through a plant-mediated mechanism. Laboratory experiments provide evidence that imidacloprid debilitates insect predators of spider mites suggesting that relaxation of top-down regulation combined with enhanced reproduction promoted a non-target herbivore to pest status. With global commerce accelerating the incidence of arthropod invasions, prophylactic applications of pesticides play a major role in
Environmental Engineering Approaches toward Sustainable Management of Spider Mites.
Suzuki, Takeshi
2012-10-26
Integrated pest management (IPM), which combines physical, biological, and chemical control measures to complementary effect, is one of the most important approaches to environmentally friendly sustainable agriculture. To expand IPM, we need to develop new pest control measures, reinforce existing measures, and investigate interactions between measures. Continued progress in the development of environmental control technologies and consequent price drops have facilitated their integration into plant production and pest control. Here I describe environmental control technologies for the IPM of spider mites through: (1) the disturbance of photoperiod-dependent diapause by artificial light, which may lead to death in seasonal environments; (2) the use of ultraviolet radiation to kill or repel mites; and (3) the use of water vapor control for the long-term cold storage of commercially available natural enemies. Such environmental control technologies have great potential for the efficient control of spider mites through direct physical effects and indirect effects via natural enemies.
International Nuclear Information System (INIS)
Zil'bermints, I.V.; Zhuravleva, L.M.; Dubovoj, V.P.
1988-01-01
It was shown that even a single exposure of spider (tetranychus urticae Koch.) to ionizing radiation changes its reproductive potency, shortens the life span of females, reduces the time of laying and causes unfavourable shifts in sex ratio within at least two generations, whereas its response to pesticides does not change
International Nuclear Information System (INIS)
Leenhouts, H.P.; Chadwick, K.H.
1976-01-01
Unfertilized females of the spider mite (Tetranychus urticae) produce only haploid eggs which develop into a haploid male. Fertilized females produce both haploid eggs (unfertilized), which develop into males, and diploid eggs (fertilized), which develop into females. Radiobiological experiments performed by A.M. Feldmann (Association Euratom-ITAL) made data available on the radiation-induced mortality of haploid and diploid eggs in the F 1 and F 2 generation following irradiation of either males or females with X rays or fast neutrons. The data have been analysed using the molecular theory of cell survival where it is assumed that DNA double strand breaks, induced randomly in the cell, are the critical radiation-induced lesions, which lead to cell death. Theoretical relationships are derived for the dose dependence of hatchability in haploid and diploid eggs in the first and second generations expressed as a function of the radiation damage in the parental genome. These theoretical relationships can be used to derive the inter-relationship between the different hatchabilities, and the results from the spider mite have been analysed using these considerations. It is concluded that the radiation-induced genetic damage arises from one type of initial lesion. The eventual radiobiological implications of this analysis are discussed, expecially with respect to the transmittance of radiation-induced genetic damage after low-level radiation. (author)
Howell, Anna D; Daugovish, Oleg
2013-02-01
The spider mite, Eotetranychus lewisi (McGregor) (Acari: Tetranychidae), is a new emerging pest in California commercial strawberries. The predatory mite Phytoseiulus persimilis (Athias-Henriot) (Acari: Phytoseiidae), typically used for biocontrol of Tetranychus urticae (Koch) (Acari: Tetranychidae), provided growers little to no control of E. lewisi. Four commonly used phytoseiid predatory mites: P. persimilis, Neoseiulus californicus (McGregor), N. fallacis (Garman), and Amblyseius andersoni (Chant), were used in lab studies to investigate which is best at managing E. lewisi populations. We als o investigated t he interactions between T. urticae and E. lewisi and in relation to phytoseiid efficiency given the potential for indirect effects of biocontrol. When E. lewisi and T. urticae are present on the same leaf, T. urticae populations increase and begin displacing E. lewisi. P. persimilis did not feed on E. lewisi, but the other three predatory mites consumed the spider mites and lowered their populations. When both E. lewisi and T. urticae are present on the same leaf, N. fallacis and A. andersoni fed on both types of mites equally and were capable of decreasing both populations. N. californicus fed on E. lewisi first and decreased its population, but allowed T. urticae populations to increase. P. persimilis may be insufficient at controlling E. lewisi and its use may instead enhance E. lewisi populations.
Directory of Open Access Journals (Sweden)
F. J. Toroitich
2014-04-01
Full Text Available Farmers in Kenya continue to raise concerns of difficulty in managing Tetranychus evansi, the most widespread pest species of tomato applying the most commonly used acaricides. This invasive pest species is not only found in Kenya, but in Eastern and Southern Africa, as well as parts of Europe and Asia. In the current study, populations of T. evansi were collected from farms in the four major tomato-growing areas of Kenya (Loitoktok, Kibwezi, Athi-River and Subukia and their susceptibility compared to a laboratory culture (ICIPE that had been maintained for three years without exposure to acaricides. Susceptibility of T. evansi eggs and adults (contact and residual to Brigade (bifenthrin, Dimethoate (dimethoate, Karate (lambdacyhalothrin, Kelthane (dicofol, Omite (propargite and Polytrin (profenofos+ cypermethrin was tested in the laboratory using respective manufacturer’s recommended concentrations. Dimethoate resulted in variable ovicidal mortality while Kelthane, Brigade, Karate, Omite and Polytrin had high mortality across all populations. Similarly, adult contact and residual mortality was lower than that of the other chemicals when exposed to Dimethoate regardless of the location. Furthermore, it also had no residual effect on the mites from ICIPE and Kibwezi. On the other hand, Kelthane was most lethal against the mites from all locations followed by Brigade and Polytrin in that order. Omite caused significantly lower mortality on mites from Subukia while Karate produced variable effects on mites from Kibwezi, Loitoktok and Subukia. The implications of these findings are further discussed.
Genetic diversity analysis of various red spider mite- resistant ...
African Journals Online (AJOL)
User
2011-05-02
May 2, 2011 ... 3Key Laboratory of Plant Breeding and Genetics, Sichuan Agricultural University, Ya'an, 625014, P. R. ... Random amplified polymorphic DNA (RAPD) is a DNA ..... spider mite-resistant, bumper, high-quality and disease-.
Dicke, M.; Baarlen, van P.; Wessels, R.; Dijkman, H.
1993-01-01
It was previously shown that in response to infestation by spider mites (Tetranychus urticae), lima bean plants produce a volatile herbivoreinduced synomone that attracts phytoseiid mites (Phytoseiulus persimilis) that are predators of the spider mites. The production of predator-attracting
The sejugal furrow in camel spiders and acariform mites
Directory of Open Access Journals (Sweden)
Dunlop, Jason A.
2012-07-01
Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.
Van Leeuwen, Thomas; Tirry, Luc; Yamamoto, Atsushi; Nauen, Ralf; Dermauw, Wannes
2015-06-01
Acaricides are one of the cornerstones of an efficient control program for phytophagous mites. An analysis of the global acaricide market reveals that spider mites such as Tetranychus urticae, Panonychus citri and Panonychus ulmi are by far the most economically important species, representing more than 80% of the market. Other relevant mite groups are false spider mites (mainly Brevipalpus), rust and gall mites and tarsonemid mites. Acaricides are most frequently used in vegetables and fruits (74% of the market), including grape vines and citrus. However, their use is increasing in major crops where spider mites are becoming more important, such as soybean, cotton and corn. As revealed by a detailed case study of the Japanese market, major shifts in acaricide use are partially driven by resistance development and the commercial availability of compounds with novel mode of action. The importance of the latter cannot be underestimated, although some compounds are successfully used for more than 30 years. A review of recent developments in mode of action research is presented, as such knowledge is important for devising resistance management programs. This includes spirocyclic keto-enols as inhibitors of acetyl-CoA carboxylase, the carbazate bifenazate as a mitochondrial complex III inhibitor, a novel class of complex II inhibitors, and the mite growth inhibitors hexythiazox, clofentezine and etoxazole that interact with chitin synthase I. Copyright © 2014 Elsevier Inc. All rights reserved.
Krips, O E; Willems, P E; Gols, R; Posthumus, M A; Gort, G; Dicke, M
2001-07-01
We investigated whether volatiles produced by spider mite-damaged plants of four gerbera cultivars differ in attractiveness to Phytoseiulus persimilis, a specialist predator of spider mites, and how the mite-induced odor blends differ in chemical composition. The gerbera cultivars differed in resistance, as expressed in terms of spider mite intrinsic rate of population increase (rm). In order of increasing resistance these were Sirtaki, Rondena, Fame, and Bianca. To correct for differences in damage inflicted on the cultivars, we developed a method to compare the attractiveness of the blends, based on the assumption that a larger amount of spider mite damage leads to higher attraction of P persimilis. Spider mite-induced volatiles of cultivars Rondena and Bianca were preferred over those of cultivar Sirtaki. Spider mite-induced volatiles of cultivars Sirtaki and Fame did not differ in attractiveness to P. persimilis. Sirtaki plants had a lower relative production of terpenes than the other three cultivars. This was attributed to a low production of cis-alpha-bergamotene, trans-alpha-bergamotene, trans-beta-bergamotene, and (E)-beta-farnesene. The emission of (E)-beta-ocimene and linalool was lower in Sirtaki and Fame leaves than in Bianca and Rondena. The importance of these chemical differences in the differential attraction of predatory mites is discussed.
Directory of Open Access Journals (Sweden)
Gemma Albendín
2015-03-01
Full Text Available Biological control techniques are commonly used in many horticultural crops in Spain, however the application of these techniques to Spanish strawberries are relatively recent. In this study the effectiveness of augmentative biological control techniques to control the two main strawberry (Fragaria xananassa Duchesne pest: the two-spotted spider mite (TSSM, Tetranychus urticae Koch (Acari: Tetranychidae, and the western flower thrips (WFT, Frankliniella occidentalis (Pergande (Thysanoptera: Thripidae, through releases of the predatory mites Phytoseiulus persimilis Athias-Henriot, Neoseiulus californicus (McGregor, Amblyseius swirskii Athias-Henriot (Acari: Phytoseiidae, and Orius laevigatus (Fieber (Heteroptera: Anthocoridae were tested. Two-year results on the performance of treatments using combinations of these biocontrol agents are presented. In both years, all treatments resulted in the reduction of TSSM numbers; but no treatment was better than the release of P. persimilis alone (P < 0.05. TSSM suppression varied among crop phases being greater early in the season. None of the treatments reduced significantly WFT numbers (P < 0.05, and the established economic injury level (EIL was surpassed from March to late April in both years. However, EIL was surpassed less times when treatment included O. laevigatus (2009: 20.7%; 2010: 22.7% of samples. No effect of A. swirskii was observed when this mite was released. Results corroborate that biological control techniques for TSSM and WFT are feasible for high-plastic tunnel strawberries. Under the conditions in our study no additive effects were observed, and there was not advantage in the release of multiple natural enemies.
Wang, Jin-Jun; Zhang, Jian-Ping; He, Lin; Zhao, Zhi-Mo
2006-01-01
Development, reproduction and acaricide susceptibility of Tetranychus cinnabarinus (Boisduvals) (Acari: Tetranychidae) were investigated after long-term (about 40 generations) exposure to various levels of acid rain; pH 2.5, 3.0, 4.0, and 5.6. Deionized water (pH 6.8) served as a control. The mites were reared on eggplant leaves at 28°C, 80%RH and a photoperiod of 14:10 (L:D) in the laboratory. The results showed that the duration of the immature stage was significantly affected by acid rain exposure. The shortest duration (8.90 days) was recorded for populations exposed to pH 5.6 acid rain, while the longest duration (9.37 days) occurred after exposure to pH 2.5 acid rain. Compared with the control population, adult longevity was shortened with an increase in acidity. Similarly, the oviposition duration was also shortened by an increase in acidity. Statistically, female fecundity did not differ significantly between pH 5.6, pH 4.0 and control populations, but did differ significantly between the control population and those exposed to pH 2.5 and pH 3.0 acid rain. This suggested that the mite suffered reproductive defects after long-term exposure to acid rain with higher acidity (pH 2.5 and 3.0). The intrinsic rate of increase among different populations was not significantly affected, but the net reproductive rate of populations exposed to pH 2.5 and 3.0 acid rain was significantly less than pH4.0, 5.6, and control populations. Bioassay results showed that after long-term exposure to acid rain, susceptibility of the mites to two acaricides, dichlorvos and fenpropathrin, did not change significantly. PMID:19537978
Ataide, Livia M S; Pappas, Maria L; Schimmel, Bernardus C J; Lopez-Orenes, Antonio; Alba, Juan M; Duarte, Marcus V A; Pallini, Angelo; Schuurink, Robert C; Kant, Merijn R
2016-11-01
Inducible anti-herbivore defenses in plants are predominantly regulated by jasmonic acid (JA). On tomato plants, most genotypes of the herbivorous generalist spider mite Tetranychus urticae induce JA defenses and perform poorly on it, whereas the Solanaceae specialist Tetranychus evansi, who suppresses JA defenses, performs well on it. We asked to which extent these spider mites and the predatory mite Phytoseiulus longipes preying on these spider mites eggs are affected by induced JA-defenses. By artificially inducing the JA-response of the tomato JA-biosynthesis mutant def-1 using exogenous JA and isoleucine (Ile), we first established the relationship between endogenous JA-Ile-levels and the reproductive performance of spider mites. For both mite species we observed that they produced more eggs when levels of JA-Ile were low. Subsequently, we allowed predatory mites to prey on spider mite-eggs derived from wild-type tomato plants, def-1 and JA-Ile-treated def-1 and observed that they preferred, and consumed more, eggs produced on tomato plants with weak JA defenses. However, predatory mite oviposition was similar across treatments. Our results show that induced JA-responses negatively affect spider mite performance, but positively affect the survival of their offspring by constraining egg-predation. Copyright © 2016 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.
Rhodes, Elena M; Liburd, Oscar E; Kelts, Crystal; Rondon, Silvia I; Francis, Roger R
2006-01-01
Greenhouse and field experiments were conducted from 2003 to 2005 to determine the effectiveness of combining releases of two predatory mite species, Phytoseiulus persimilis Athias-Henriot and Neoseiulus californicus (McGregor), and a reduced-risk miticide, Acramite (bifenazate), for control of twospotted spider mite (TSSM) (Tetranychus urticae Koch) in strawberries. In the greenhouse experiment, a combination treatment of P. persimilis and N. californicus was compared with single treatments of each species, Acramite application, and untreated control. All treatments significantly reduced TSSM numbers compared with the control. Field studies employed two approaches: one investigating the same five treatments as the greenhouse experiment and a second, comparing combination treatments of P. persimilis/N. californicus, Acramite/N. californicus, and Acramite/P. persimilis to single treatments of each and to control plots. Among the combination treatments, the P. persimilis/N. californicus treatment significantly reduced TSSM numbers compared with the control, but was not as effective as N. californicus alone during the 2003-2004 field season. Also, combination treatments of Acramite/N. californicus, and Acramite/P. persimilis significantly reduced TSSM populations compared with the control. These findings indicate that all three combination treatments are promising options for TSSM control in strawberries for growers in northern Florida and other strawberry producing areas of the world.
Abad-Moyano, Raquel; Urbaneja, Alberto; Hoffmann, Daniela; Schausberger, Peter
2010-04-01
The two-spotted spider mite, Tetranychus urticae, is one of the most problematic phytophagous pests in Spanish clementine orchards. The most abundant predatory mites in this ecosystem are Euseius stipulatus, Phytoseiulus persimilis and Neoseiulus californicus. Euseius stipulatus is dominant but poorly adapted to utilize T. urticae as prey. It mainly persists on pollen and citrus red mite, Panonychus citri. A recent study suggested that the more efficacious T. urticae predators P. persimilis and N. californicus are negatively affected by lethal and non-lethal intraguild interactions with E. stipulatus. Here, we investigated the potential of N. californicus and P. persimilis to colonize and thrive on young clementine trees infested by T. urticae in presence and absence of E. stipulatus. Presence of E. stipulatus interfered with establishment and abundance of P. persimilis and negatively affected the efficacy of N. californicus in T. urticae suppression. In contrast, the abundance of E. stipulatus was not affected by introduction of a second predator. Trait-mediated effects of E. stipulatus changing P. persimilis and N. californicus behavior and/or life history were the most likely explanations for these outcomes. We conclude that superiority of E. stipulatus in intraguild interactions may indeed contribute to the currently observed predator species composition and abundance, rendering natural control of T. urticae in Spanish clementine orchards unsatisfactory. Nonetheless, stronger reduction of T. urticae and/or plant damage in the predator combination treatments as compared to E. stipulatus alone indicates the possibility to improve T. urticae control via repeated releases of N. californicus and/or P. persimilis.
Mites and spiders act as biological control agent to sand flies
Directory of Open Access Journals (Sweden)
Diwakar Singh Dinesh
2014-02-01
Full Text Available Objective: To find out natural biological control agents of sand flies vector of kala azar in Bihar, India. Methods: Sand flies collected from the field using CDC light trap installing overnight to the collection site scrutitinized for Phlebotomus argentipes, the established vector of visceral leishmaniasis. Blood fed adult females were confined in the insectary for its development of life cycle. During developmental stages 2nd to 4th instars larvae were examined closely by using compound microscope for mite infestation. Adult spider residing along with sand flies collected in trap were kept in cage along with sand flies and their activities were watched closely and recorded by video and picture. Results: Mites were found predating 2nd to 4th instars larvae only under the laboratory conditions and lowering down the population of sand flies up to basal level within 15 d after infestation. One specific spider was found eating blood fed female sand flies kept inside the cage (n=50 attacking on lower part of thoracic region to kill the sand fly and ate desired soft part. Conclusions: Both predators, mites and spiders are acting as biological control agents to larvae and adults of sand flies respectively resulting variable density of vectors due to variable association with these predators and also cause lowering the transmission of the disease as hidden natural controlling agent of sand flies. The extensive study will be of immense help in controlling sand flies without use of environmental pollutant i.e. chemical insecticide.
Ament, K.; Kant, M.R.; Sabelis, M.W.; Haring, M.A.; Schuurink, R.C.
2004-01-01
The tomato (Lycopersicon esculentum) mutant def-1, which is deficient in induced jasmonic acid (JA) accumulation upon wounding or herbivory, was used to study the role of JA in the direct and indirect defense responses to phytophagous mites (Tetranychus urticae). In contrast to earlier reports,
Castro, Thiago; Roggia, Samuel; Wekesa, Vitalis W; de Andrade Moral, Rafael; Gb Demétrio, Clarice; Delalibera, Italo; Klingen, Ingeborg
2016-09-01
The beneficial fungus Neozygites floridana kills the two-spotted spider mite Tetranychus urticae, which is a serious polyphagous plant pest worldwide. Outbreaks of spider mites in strawberry and soybean have been associated with pesticide applications. Pesticides may affect N. floridana and consequently the natural control of T. urticae. N. floridana is a fungus difficult to grow in artificial media, and for this reason, very few studies have been conducted with this fungus, especially regarding the impact of pesticides. The aim of this study was to conduct a laboratory experiment to evaluate the effect of pesticides used in strawberry and soybean crops on N. floridana. Among the pesticides used in strawberry, the fungicides sulfur and cyprodinil + fludioxonil completely inhibited both the sporulation and conidial germination of N. floridana. The fungicide fluazinam affected N. floridana drastically. The application of the fungicide tebuconazole and the insecticides fenpropathrin and abamectin resulted in a less pronounced negative effect on N. floridana. Except for epoxiconazole and cyproconazole, all tested fungicides used in soybean resulted in a complete inhibition of N. floridana. Among the three insecticides used in soybean, lambda-cyhalothrin and deltamethrin resulted in a significant inhibition of N. floridana. The insecticides/ acaricides abamectin and lambda-cyhalothrin at half concentrations and fenpropathrin and permethrin and the fungicide tebuconazole at the recommended concentrations resulted in the lowest impact on N. floridana. The fungicides with the active ingredients sulfur, cyprodinil + fludioxonil, azoxystrobin, azoxystrobin + cyproconazole, trifloxystrobin + tebuconazole and pyraclostrobin + epoxiconazole negatively affected N. floridana. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Lagziri, M.
2015-01-01
Full Text Available Influence of previous pesticide use on Tetranychus urticae and Phytoseiulus persimilis (Acari: Tetranychidae, Phytoseiidae from strawberry crops in the north of Morocco. Description of the subject. Effects of recommended doses of five common pesticides in the strawberries of Loukkos area (Morocco were tested on the two-spotted spider mite Tetranychus urticae and its predatory mite Phytoseiulus persimilis. Laboratory study assessed the contact toxicity of one avermectin miticide (abamectin, two pyrethrinoid insecticide-acaricides (bifenthrin and lambda-cyalothrin, and two fungicides: firstly, mancozeb, which belongs to the dithiocarbamates family of chemicals and secondly, hexaconazole, of the triazole family. Objectives. The aim of the present study was to test in laboratory conditions the effect of five pesticides on the two-spotted spider mite, T. urticae and its predatory mite, P. persimilis. The five pesticides tested were those most frequently applied for at least two years on strawberries at the experimental site. Method. Bioassays were performed with populations of mites originating from different plots with various crop protection backgrounds. The first group of plots had been repeatedly treated with the five tested pesticides during a two-year period, the second group had been moderately treated, and the third had been treated once with the tested pesticides. Results. Our results showed that the tested pesticides provided effective control of T. urticae but that they were not compatible with use on the predatory mite P. persimilis, as these particular mites did not usually come into contact with these products. On the other hand, in plots where pesticides had been used for a long time, the susceptibility of P. persimilis populations to these products was significantly reduced. Conclusions. If the tested pesticides are to be considered for integrated pest control programs in plots where they have been used for a long time and where P
Effect of aqueous plant extracts on tea red spider mite, Oligonychus ...
African Journals Online (AJOL)
Four aqueous plant extracts (APEs) of Acorus calamus (L), Xanthium strumarium (L), Polygonum hydropiper (L) and Clerodendron infortunatum (Gaertn) were evaluated under both laboratory and field conditions at 2.5, 5.0 and 10.0% (w/v) concentrations against tea red spider mite, Oligonychus coffeae (Nietner). Also, the ...
The predatory mite Phytoseiulus persimilis adjusts patch-leaving to own and progeny prey needs.
Vanas, V; Enigl, M; Walzer, A; Schausberger, P
2006-01-01
Integration of optimal foraging and optimal oviposition theories suggests that predator females should adjust patch leaving to own and progeny prey needs to maximize current and future reproductive success. We tested this hypothesis in the predatory mite Phytoseiulus persimilis and its patchily distributed prey, the two-spotted spider mite Tetranychus urticae. In three separate experiments we assessed (1) the minimum number of prey needed to complete juvenile development, (2) the minimum number of prey needed to produce an egg, and (3) the ratio between eggs laid and spider mites left when a gravid P. persimilis female leaves a patch. Experiments (1) and (2) were the pre-requirements to assess the fitness costs associated with staying or leaving a prey patch. Immature P. persimilis needed at least 7 and on average 14+/-3.6 (SD) T. urticae eggs to reach adulthood. Gravid females needed at least 5 and on average 8.5+/-3.1 (SD) T. urticae eggs to produce an egg. Most females left the initial patch before spider mite extinction, leaving prey for progeny to develop to adulthood. Females placed in a low density patch left 5.6+/-6.1 (SD) eggs per egg laid, whereas those placed in a high density patch left 15.8+/-13.7 (SD) eggs per egg laid. The three experiments in concert suggest that gravid P. persimilis females are able to balance the trade off between optimal foraging and optimal oviposition and adjust patch-leaving to own and progeny prey needs.
Interactions in a tritrophic acarine predator-prey metapopulation system III
DEFF Research Database (Denmark)
Nachman, Gösta; Zemek, R.
2002-01-01
Spider mites are serious pests on many economically important plant species, because they may reduce plant productivity and, at high mite densities, overexploit and even kill the host plants. We have conducted a series of greenhouse experiments to quantify the effects of two-spotted spider mites...... (Tetranychus urticae) on host plants (Phaseolusvulgaris). The average amount of chlorophyll per cm2 leaf area was used as a measure of plant condition. It was shown that chlorophyll concentration decreases with plant age and intensity of spider mite feeding. Damage caused by spider mites was assessed visually...... caused by spider mites (D). D takes values between 0 (no injury) and 1 (all leaves dead). A highly significant positive relationship between the instantaneous spider mite density and D was found, even though D is expected to reflect the cumulated density of mites (mite-days). A model of plant growth...
Directory of Open Access Journals (Sweden)
José Vargas de Oliveira
2013-12-01
Full Text Available The two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae, is one important pest of cotton crop due to reductions in cotton yield and fiber quality. Thus, this work evaluated the toxicity of the synthetic acaricide spiromesifen and natural products on T. urticae and the compatibility with the predatory mite Phytoseiulus macropilis (Banks (Acari: Phytoseiidae. Spiromesifen and the natural products Azadirachtin A/B, Azadirachtin 1%, Jatropha curcas L. and Ricinus communis L. oils were used at different concentrations; the leaf dipping method was employed. The mortality of T. urticae females and eggs was evaluated 48 and 96 h after treatment to calculate the lethal concentrations. The effect on P. macropilis was studied using the LC50s obtained to T. urticae. All acaricides tested were effective in controlling females and eggs of T. urticae. However, according to the LC50s and LC90s calculated, spiromesifen was the most toxic acaricide to females and J. curcas oil presented the higher toxicity to eggs. Spiromesifen, J. curcas oil and Azadiractina 1% caused side effects on P. macropilis. However, only espiromesifeno was classified as harmful to the predator, whereas Azadirachtin A/B and R. communis oil were slightly harmful. R. communis and Azadirachtin A/B were effective in controlling the two-spotted spider mite and promising for the management of this pest in cotton considering their low toxicity to the predator.
Directory of Open Access Journals (Sweden)
Pervin Erdogan
2012-01-01
Full Text Available Two-spotted mite, Tetranychus urticae Koch (Arac.: Tetranychidae, is an economic pest worldwide including Turkey, causing serious damage to vegetables, flowers, and fruit crops. In recent years, broad-spectrum insecticides/miticides have been used to control this pest in Turkey. Control is difficult mainly due to resistance to conventional pesticides. This study was conducted to determine efficacy of pesticides extracted from five different plants [i.e., Allium sativum L. (Amaryllidaceae, Rhododendron luteum S. (Ericaceae, Helichrysum arenarium L. (Asteraceae, Veratrum album L. (Liliaceae, and Tanacetum parthenium L. (Asteraceae] against this mite. Bioassays were tested by two different methods to determine the effects of varying concentrations. Experiments were performed using 3 cm diameter leaf disk from unsprayed bean plants (Phaseolus vulgaris L.. In addition, the effects of the extracts on reproduction and oviposition were investigated. The extract yielded high mortality. In the lowest-concentration bioassays, the adult mites laid lower numbers of eggs compared to the untreated control. No ovicidal effect was observed.
Gamma irradiation as a quarantine treatment against mite (Tetranychidae) on cut flowers
International Nuclear Information System (INIS)
Zainon Othman; Mohd Ridzuan Ismail; Hamidah Sulaiman; Mohd Shamsudin Osman
2000-01-01
Cut flower, an important export commodity of Malaysia in international trade, is often subjected to infestation by various pests such as mites, scales and thrips. The use of low ionising radiation has been suggested as an alternative to methyl bromide fumigation, the current pest disinfestation treatment for cut flower but which is being phased out due to environmental concerns. The criterion for efficacy of radiation as a quarantine treatment will be the inability of treated mites to reproduce at a new location rather than causing immediate mortality. Irradiating red spider mite Tetranychus piercie at a dose of 300 and 400 Gy produced sterile female adults from irradiated protonymph and deutonymph respectively. A lower dose of 200 Gy induced sterility in female adults developed from the less immature stages of irradiated egg and larva. Deteriorating effects caused by irradiation treatment were reflected in immatures by their reduced emergence rate/mortality in subsequent developmental stages. A dose of 240 Gy prevented reproduction in female adult of T piercie by inducing sterility while a much higher dose of 5 kGy is required to produce instant mortality. Based on the results obtained gamma irradiation of dose range 300-400 Gy may be applied as a quarantine treatment against Tetranychus piercie. However, this dose range is only suitable for chrysanthemum (in 4% sucrose solution) but not roses, carnations and orchids which showed phytotoxic symptoms at dose range of 100-300 Gy
Directory of Open Access Journals (Sweden)
Daniele Cristine Hoffmann Schlesener
2013-03-01
Full Text Available O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se mortalidade e fecundidade. A mortalidade máxima observada para o ácaro-rajado foi de 89,7% e 91,5% para Azamax® e Neemseto®, respectivamente, na concentração de 0,5% após a reaplicação do produto no sétimo dia. Também foram observados efeitos adversos sobre a fecundidade e a viabilidade dos ovos quando tratados com os produtos comerciais (p.c.. A persistência biológica dos produtos foi de aproximadamente três dias após a pulverização. As formulações apresentaram seletividade em relação aos fitoseídeos, porém causaram redução da fecundidade dos mesmos.The aim of the present study was to evaluate the efficiency of control and adverse effects of two neem based products: Azamax TM (Azadirachtin A/B 12g/L and Neemseto TM (Azadirachtin A/B, Nimbin and Salanin 2,389 g/L over two-spotted spider mite Tetranychus urticae and the predators Phytoseiulus macropilis and Neoseiulus californicus in laboratory. Effects over the mortality, fecundity, eggs and biological persistence of the two-spotted spider mite when treated with neem based products were evaluated. For the phytoseiids the effects on mortality and fecundity were evaluated. The maximum mortality of two-spotted spider mites rates observed were 89.7% and 91.5% for Azamax TM and Neemseto TM respectively, on the 0.5% concentration after reapplying the product on the seventh day. Adverse effects were also observed over the fecundity and viability of the eggs when treated with
Evolutionary Aspects of Acaricide-Resistance Development in Spider Mites
Directory of Open Access Journals (Sweden)
Masahiro (Mh. Osakabe
2009-01-01
Full Text Available Although the development of acaricide resistance in spider mites is a long-standing issue in agricultural fields, recent problems with acaricide resistance may be characterized by the development of complex- and/or multiresistance to acaricides in distinct classes. Such complexity of resistance is not likely to be a single mechanism. Pesticide resistance involves the microevolution of arthropod pests, and population genetics underlies the evolution. In this review, we address the genetic mechanisms of acaricide resistance evolution. We discuss genetic diversity and linkage of resistance genes, relationships between mite habitat and dispersal, and the effect of dispersal on population genetic structure and the dynamics of resistance genes. Finally, we attempt to present a comprehensive view of acaricide resistance evolution and suggest risks under globalization as well as possible approaches to managing acaricide resistance evolution or emergence.
Directory of Open Access Journals (Sweden)
M. Latifian
2017-12-01
Full Text Available Introduction: The spider mite, Oligonychus afrasiaticus feeds by sucking the sap from the immature fruits tissue. The natural color of fruits changes to pale yellow or gray by mite's feeding. Damaged fruit are cracked and its damage can dry out the fruits. Because of resistance to pesticides, resurgence of date palm spider mite causes to disrupt the natural balance of their population. Tiny black ladybird beetle, Stethorous gilvifrons is the most important and active lady beetle species in Khuzestan province and is very effective on biological control of the spider mite. Determination of the amount and release time of the lady beetles are the most important factors in the implementation of biological control programs of date palm spider mite. So, careful monitoring, time of the release and the ability of deployment of predatory ladybird are essential steps to success in the programs of biological control. Materials and Methods: This research was conducted in Shadegan region of Khuzestan province. The nested design was used to compare the efficiency of different inoculate release methods of the predator, S. gilvifrons. The main niches include three release times which were at the time of emergence, three days and one week after emergence of date palm spider mite in date palm plantation. Sub nesting including three different levels of predator release including minimum, moderate and maximum release with 0.5, 1 and 3 predator /m2 per day and were continued for two weeks. The two or three-days ladybirds were used to release. First, the infected clusters were covered by mesh fabric and ladybirds were released under them. After a week, mantles were opened up to the establishment of ladybird run on the normal condition of date palm plantations. This experiment was repeated three times, and each replication consists of a quarter- hectare plantation with dominant cultivar Sayer.Three date Palm trees from each release and control were randomly selected
Van Tilborg, Merijn; Sabelis, Maurice W; Roessingh, Peter
2004-01-01
Anemotaxis in the predatory mite Phytoseiulus persimilis (both well-fed and starved), has previously been studied on a wire grid under slight turbulent airflow conditions yielding weak, yet distinct, gradients in wind speed and odour concentration (Sabelis and Van der Weel 1993). Such conditions might have critically influenced the outcome of the study. We repeated these experiments, under laminar airflow conditions on a flat surface in a wind tunnel, thereby avoiding variation in wind speed and odour concentration. Treatments for starved and well-fed mites were (1) still-air without herbivore-induced plant volatiles (HIPV) (well-fed mites only), (2) an HIPV-free air stream, and (3) an air stream with HIPV (originating from Lima bean plants infested by two-spotted spider mites, Tetranychus urticae). Well-fed mites oriented in random directions in still-air without HIPV. In an air stream, starved mites always oriented upwind, whether plant odours were present or not. Well-fed mites oriented downwind in an HIPV-free air stream, but in random directions in an air stream with HIPV. Only under the last treatment our results differed from those of Sabelis and Van der Weel (1993).
Kim, Y-K; Chang, Y-S; Lee, M-H; Hong, S-C; Bae, J-M; Jee, Y-K; Chun, B-R; Cho, S-H; Min, K-U; Kim, Y-Y
2002-09-01
Spider mites such as the citrus red mite and the two-spotted spider mite have been demonstrated to be important allergens for fruit cultivating farmers. To evaluate the role of environmental exposure to spider mites in the sensitization and the clinical manifestations of asthma and rhinitis in children and adolescents living in urban and rural areas. A total of 16,624 subjects (aged 7 to 18 years) living in urban (metropolitan and non-metropolitan) and rural areas (apple orchards and citrus orchards) in Korea were evaluated by questionnaire and skin prick test for 11 common aeroallergens, including citrus red mite (CRM) and two-spotted spider mite (TSM). The positive skin response rates to TSM were 4.2% of 1,563 metropolitan subjects, 3.8% of 5,568 non-metropolitan subjects and 6.5% of 1,464 subjects living nearby apple farms, and that to CRM 15.6% of 8,029 living nearby citrus farms. The prevalence of current wheeze and rhinitis as reported on a questionnaire was higher among those with a history of visiting fruit farms once or more per year than among those without it (10% vs. 7.1%, 32.8% vs. 26.7%, for wheezing and rhinitis, respectively). Among those with wheezing or rhinitis, the positive skin responses to TSM or CRM were also higher among those with a history of visiting fruit farms than among those without one (11.2% vs. 6.6%, 13.0% vs. 6.6%, respectively), although the positive skin responses to house dust mites were similar in the both groups. Spider mites are common sensitizing allergens in children and adolescents exposed to them, and environmental exposure to these mites may represent an important risk factor in the sensitization and the clinical manifestations of asthma and rhinitis in children and adolescents living in rural and urban areas.
Directory of Open Access Journals (Sweden)
Juan Alfredo Morales-Ramos
2014-01-01
Full Text Available A new stackable modular system was developed for continuous in vivo production of phytoseiid mites. The system consists of cage units that are filled with lima beans, Phaseolus lunatus, or red beans, P. vulgaris, leaves infested with high levels of the two-spotted spider mites, Tetranychus urticae. The cage units connect with each other through a connection cup, which also serves for monitoring and collection. Predatory mites migrate upwards to new cage units as prey is depleted. The system was evaluated for production of Phytoseiulus persimilis. During a 6-month experimental period, 20,894.9±10,482.5 (mean ± standard deviation predators were produced per week. The production consisted of 4.1±4.6% nymphs and 95.9±4.6% adults. A mean of 554.5±59.8 predatory mites were collected per harvested cage and the mean interval length between harvests was 6.57±6.76 days. The potential for commercial and experimental applications is discussed.
Resistance in Cucumis sativus L. to Tetranychus urticae Koch
Ponti, de O.M.B.
1980-01-01
Chapter 1
The role of plant breeding and particularly of host plant resistance in integrated control is discussed. Host plant resistance to insects and mites, especially to Tetranychus urticae is reviewed. A standard terminology for disease and pest
International Nuclear Information System (INIS)
Feldmann, A.M.
1979-01-01
Radiobiological properties of Tetranychus urticae and other topics of genetic control have been evaluated. The induction by X-rays or fast neutrons of dominant lethals in mature sperm and of dominant lethals and recessive lethals in prophase-1 oocytes and the induction by both radiation types of chromosome mutations, recessive lethals and factors causing F 1 -infertility in sperm and oocytes, have been studied. From the results the optimal dose, radiation type and germ cell type could be chosen for obtaining either fully sterile males or substerile males, producing fully infertile F 1 -females. Also the most favourable conditions were determined for the induction of chromosome mutations with the lowest frequency of linked recessive lethals. The radiobiological properties of holokinetic chromosomes are extensively discussed. The successful displacement of the standard karyotype by a radiation arranged karyotype is presented and discussed in its relevance for practical application. (Auth./C.F.)
Effects of electron beam irradiation on cut flowers and mites
International Nuclear Information System (INIS)
Dohino, Toshiyuki; Tanabe, Kazuo
1994-01-01
Two spotted spider mite, Tetranychus urticae KOCH were irradiated with electron beams (2.5MeV) to develop an alternative quarantine treatment for imported cut flowers. The tolerance of eggs increased with age (1-5-day-old). Immature stages (larva-teleiochrysalis) irradiated at 0.4-0.8kGy increased tolerance with their development. Mated mature females irradiated at 0.4kGy or higher did not produce viable eggs, although temporary recovery was observed at 0.2kGy. Adult males were sterilized at 0.4kGy because non-irradiated virgin females mated with yielded female progeny malformed and sterilized. Various effects of electron beam irradiation were observed when nine species of cut flowers were irradiated in 5MeV Dynamitron accelerator. Chrysanthemum and rose were most sensitive among cut flowers. (author)
Alternative male mating behaviour in the two-spotted spider mite: dependence on age and density
Sato, Y.; Sabelis, M.W.; Egas, M.
2014-01-01
Highlights • We investigated alternative male mating behaviour in the two-spotted spider mite. • We found no differences between genetic lines of fighting and sneaking behaviour. • The proportion of sneaker males changed with male density and with male age. • In competition with old males, young
Nicetic; Watson, D M; Beattie, G A; Meats, A; Zheng, J
2001-01-01
From 1995 to 1999, four experiments were conducted on greenhouse roses to assess the effectiveness of the nC24 petroleum spray oil (PSO), D-C-Tron Plus, against two-spotted mite, Tetranychus urticae Koch (Acarina: Tetranychidae), and to determine how the oil could be most efficiently and effectively used in combination with the predatory mite Phytoseiulus persimilis Athias-Henriot (Acarina: Phytoseiidae) in an integrated pest management program. The results showed that 0.5% PSO applied fortnightly to roses gave excellent protection from T urticae infestation when the mite population was not already established. However, PSO applied after roses were infested with T. urticae above the economic threshold only stabilised populations without reducing them below that threshold. Populations of P. persimilis in the upper and lower canopies were unchanged after two sprays of PSO at 7-day intervals, and application of PSO to the upper canopy was as effective in controlling T. urticae in the presence of P persimilis as spraying the entire plant. Combining PSO with P. persimilis gave better control of T. urticae than using P. persimilis alone. The most cost-effective use of PSO in the presence of P. persimilis is, therefore, to apply spray only to the upper canopy. This will not affect control of powdery mildew with PSO. Comparison of a control program for T urticae based on the monitored use of synthetic miticides with that based on calendar application of PSO revealed that both gave equally effective control. The benefits of combining PSO and P. persimilis in an integrated pest management program for T. urticae on roses over a program based on synthetic fungicides are discussed.
Ozawa, Rika; Nishimura, Osamu; Yazawa, Shigenobu; Muroi, Atsushi; Takabayashi, Junji; Arimura, Gen-ichiro
2012-11-01
Different organisms compensate for, and adapt to, environmental changes in different ways. In this way, environmental changes affect animal-plant interactions. In this study, we assessed the effect of temperature on a tritrophic system of the lima bean, the herbivorous spider mite Tetranychus urticae and the predatory mite Phytoseiulus persimilis. In this system, the plant defends itself against T. urticae by emitting volatiles that attract P. persimilis. Over 20-40 °C, the emission of volatiles by infested plants and the subsequent attraction of P. persimilis peaked at 30 °C, but the number of eggs laid by T. urticae adults and the number of eggs consumed by P. persimilis peaked at 35 °C. This indicates that the spider mites and predatory mites performed best at a higher temperature than that at which most volatile attractants were produced. Our data from transcriptome pyrosequencing of the mites found that P. persimilis up-regulated gene families for heat shock proteins (HSPs) and ubiquitin-associated proteins, whereas T. urticae did not. RNA interference-mediated gene suppression in P. persimilis revealed differences in temperature responses. Predation on T. urticae eggs by P. persimilis that had been fed PpHsp70-1 dsRNA was low at 35 °C but not at 25 °C when PpHsp70-1 expression was very high. Overall, our molecular and behavioural approaches revealed that the mode and tolerance of lima bean, T. urticae and P. persimilis are distinctly affected by temperature variability, thereby making their tritrophic interactions temperature dependent. © 2012 Blackwell Publishing Ltd.
Skirvin, D J; Fenlon, J S
2001-02-01
The functional response of the predatory mite Phytoseiulus persimilis Athias-Henriot to eggs of its prey, the spider mite Tetranychus urticae Koch was examined on three plant species. Experiments were done to determine whether differences in the functional response on the three plant species were due to the morphological features of the crop directly on the predator or through an effect of the plant species on the prey. The results show that crop morphology is the only factor influencing the predatory ability of P. persimilis on the three plant species. Fewer eggs were eaten on Ceanothus thyrsiflorus var. 'Autumnal Blue', the plant species with hairy leaves, and greater numbers of prey consumed on Choisya ternata, a species with smooth leaves. However, similarly few eggs were eaten on the smooth, but waxy leaved Euonymus japonicus as on Ceanothus thyrsiflorus, demonstrating that morphological characters of leaves other than the possession of hairs and trichomes may affect the rates of predation. The implications of these results for the tritrophic interactions between plant, predator and prey, and the development of suitable biological control strategies are discussed.
van Wijk, Michiel; de Bruijn, Paulien J A; Sabelis, Maurice W
2010-11-01
Phytoseiulus persimilis is a predatory mite that in absence of vision relies on the detection of herbivore-induced plant odors to locate its prey, the two-spotted spider-mite Tetranychus urticae. This herbivorous prey is feeding on leaves of a wide variety of plant species in different families. The predatory mites respond to numerous structurally different compounds. However, typical spider-mite induced plant compounds do not attract more predatory mites than plant compounds not associated with prey. Because the mites are sensitive to many compounds, components of odor mixtures may affect each other's perception. Although the response to pure compounds has been well documented, little is known how interactions among compounds affect the response to odor mixtures. We assessed the relation between the mites' responses elicited by simple mixtures of two compounds and by the single components of these mixtures. The preference for the mixture was compared to predictions under three conceptual models, each based on one of the following assumptions: (1) the responses elicited by each of the individual components can be added to each other; (2) they can be averaged; or (3) one response overshadows the other. The observed response differed significantly from the response predicted under the additive response, average response, and overshadowing response model in 52, 36, and 32% of the experimental tests, respectively. Moreover, the behavioral responses elicited by individual compounds and their binary mixtures were determined as a function of the odor concentration. The relative contribution of each component to the behavioral response elicited by the mixture varied with the odor concentration, even though the ratio of both compounds in the mixture was kept constant. Our experiments revealed that compounds that elicited no response had an effect on the response elicited by binary mixtures that they were part of. The results are not consistent with the hypothesis that P
Zach, Gernot J; Peneder, Stefan; Strodl, Markus A; Schausberger, Peter
2012-01-01
In group-living animals, social interactions and their effects on other life activities such as foraging are commonly determined by discrimination among group members. Accordingly, many group-living species evolved sophisticated social recognition abilities such as the ability to recognize familiar individuals, i.e. individuals encountered before. Social familiarity may affect within-group interactions and between-group movements. In environments with patchily distributed prey, group-living predators must repeatedly decide whether to stay with the group in a given prey patch or to leave and search for new prey patches and groups. Based on the assumption that in group-living animals social familiarity allows to optimize the performance in other tasks, as for example predicted by limited attention theory, we assessed the influence of social familiarity on prey patch exploitation, patch-leaving, and inter-patch distribution of the group-living, plant-inhabiting predatory mite Phytoseiulus persimilis. P. persimilis is highly specialized on herbivorous spider mite prey such as the two-spotted spider mite Tetranychus urticae, which is patchily distributed on its host plants. We conducted two experiments with (1) groups of juvenile P. persimilis under limited food on interconnected detached leaflets, and (2) groups of adult P. persimilis females under limited food on whole plants. Familiar individuals of both juvenile and adult predator groups were more exploratory and dispersed earlier from a given spider mite patch, occupied more leaves and depleted prey more quickly than individuals of unfamiliar groups. Moreover, familiar juvenile predators had higher survival chances than unfamiliar juveniles. We argue that patch-exploitation and -leaving, and inter-patch dispersion were more favorably coordinated in groups of familiar than unfamiliar predators, alleviating intraspecific competition and improving prey utilization and suppression.
Directory of Open Access Journals (Sweden)
Gernot J Zach
Full Text Available In group-living animals, social interactions and their effects on other life activities such as foraging are commonly determined by discrimination among group members. Accordingly, many group-living species evolved sophisticated social recognition abilities such as the ability to recognize familiar individuals, i.e. individuals encountered before. Social familiarity may affect within-group interactions and between-group movements. In environments with patchily distributed prey, group-living predators must repeatedly decide whether to stay with the group in a given prey patch or to leave and search for new prey patches and groups.Based on the assumption that in group-living animals social familiarity allows to optimize the performance in other tasks, as for example predicted by limited attention theory, we assessed the influence of social familiarity on prey patch exploitation, patch-leaving, and inter-patch distribution of the group-living, plant-inhabiting predatory mite Phytoseiulus persimilis. P. persimilis is highly specialized on herbivorous spider mite prey such as the two-spotted spider mite Tetranychus urticae, which is patchily distributed on its host plants. We conducted two experiments with (1 groups of juvenile P. persimilis under limited food on interconnected detached leaflets, and (2 groups of adult P. persimilis females under limited food on whole plants. Familiar individuals of both juvenile and adult predator groups were more exploratory and dispersed earlier from a given spider mite patch, occupied more leaves and depleted prey more quickly than individuals of unfamiliar groups. Moreover, familiar juvenile predators had higher survival chances than unfamiliar juveniles.We argue that patch-exploitation and -leaving, and inter-patch dispersion were more favorably coordinated in groups of familiar than unfamiliar predators, alleviating intraspecific competition and improving prey utilization and suppression.
Directory of Open Access Journals (Sweden)
Guilherme Victor Nippes Pereira
2008-06-01
Lycopersicon pennellii (Correll D'Arcy accession LA-716, acylsugars exsudated by type IV glandular trichomes present in all aerial parts of the plant reportedly mediate resistance to arthropod pests. This paper intended to study the levels of resistance to two arthropod pests, the South American tomato pinworm (Tuta absoluta and spider mites (Tetranychus evansi in tomato genotypes selected solely on the basis of their foliar acylsugar contents. Eleven plants with contrasting acylsugar contents were selected from population F3BC2 derived from the interespecific cross Lycopersicon esculentum 'TOM-584'x Lycopersicon pennellii 'LA-716'. These genotypes were used in tests for resistance/ repellence to the arthropod pests, along with parental checks TOM-584 and LA-716. In Tetranychus spp. mite repellence tests, plants selected for high acylsugar contents behaved similarly to the resistant parent LA-716. Negative and significative correlations between acylsugar contents and distances travelled by the mites onto the leaflet surface indicated an association between the allelochemical and the levels of mite repellence. In the assay with the South American pinworm, these genotypes were evaluated for leaflet lesion type and overall plant damage. The high acylsugar genotypes had good levels of insect resistance, similar to those found in LA-716. In all the evaluation date, acylsugars levels were highly and negatively correlated with pinworm damage. The results indicated that selection for high acylsugar contents was effective in increasing the levels of arthropod resistance of tomato genotypes.
Drought-Stressed Tomato Plants Trigger Bottom-Up Effects on the Invasive Tetranychus evansi.
Directory of Open Access Journals (Sweden)
Miguel G Ximénez-Embún
Full Text Available Climate change will bring more drought periods that will have an impact on the irrigation practices of some crops like tomato, from standard water regime to deficit irrigation. This will promote changes in plant metabolism and alter their interactions with biotic stressors. We have tested if mild or moderate drought-stressed tomato plants (simulating deficit irrigation have an effect on the biological traits of the invasive tomato red spider mite, Tetranychus evansi. Our data reveal that T evansi caused more leaf damage to drought-stressed tomato plants (≥1.5 fold for both drought scenarios. Mite performance was also enhanced, as revealed by significant increases of eggs laid (≥2 fold at 4 days post infestation (dpi, and of mobile forms (≥2 fold and 1.5 fold for moderate and mild drought, respectively at 10 dpi. The levels of several essential amino acids (histidine, isoleucine, leucine, tyrosine, valine and free sugars in tomato leaves were significantly induced by drought in combination with mites. The non-essential amino acid proline was also strongly induced, stimulating mite feeding and egg laying when added to tomato leaf disks at levels equivalent to that estimated on drought-infested tomato plants at 10 dpi. Tomato plant defense proteins were also affected by drought and/or mite infestation, but T. evansi was capable of circumventing their potential adverse effects. Altogether, our data indicate that significant increases of available free sugars and essential amino acids, jointly with their phagostimulant effect, created a favorable environment for a better T. evansi performance on drought-stressed tomato leaves. Thus, drought-stressed tomato plants, even at mild levels, may be more prone to T evansi outbreaks in a climate change scenario, which might negatively affect tomato production on area-wide scales.
Walzer, A; Blümel, S; Schausberger, P
2001-01-01
The success of combined release of the predatory mites Phytoseiulus persimilis and Neoseiulus californicus in suppression of spider mites may be related to the effects of the interactions between the two predators on their population dynamics. We studied population growth and persistence of the specialist P persimilis and the generalist N. californicus reared singly versus reared in combination after simultaneous and successive predator introductions on detached bean leaf arenas with abundant prey, Tetranychus urticae. and with diminishing prey. When reared singly with abundant prey, either predator population persisted at high densities to the end of the experiment. In every predator combination system with abundant prey and various initial predator:predator ratios N. californicus displaced P persimilis. When held singly with diminishing prey, the population of P. persimilis grew initially faster than the population of N. californicus but both species reached similar population peaks. Irrespective whether reared singly or in combination. N. californicus persisted three to five times longer after prey depletion than did P. persimilis. Regarding the crucial interactions in the predator combination systems, we conclude that intraguild predation was a stronger force than food competition and finally resulted in the displacement of P. persimilis. Previous studies showed that intraguild predation between the specialist P. persimilis and the generalist N. californicus is strongly asymmetric favoring the generalist. We discuss the implications of potential interactions between P. persimilis and N. californicus to biological control of spider mites.
De Bruijn, Paulien J. A.; Sabelis, Maurice W.
2008-01-01
Predatory mites locate herbivorous mites, their prey, by the aid of herbivore-induced plant volatiles (HIPV). These HIPV differ with plant and/or herbivore species, and it is not well understood how predators cope with this variation. We hypothesized that predators are attracted to specific compounds in HIPV, and that they can identify these compounds in odor mixtures not previously experienced. To test this, we assessed the olfactory response of Phytoseiulus persimilis, a predatory mite that preys on the highly polyphagous herbivore Tetranychus urticae. The responses of the predatory mite to a dilution series of each of 30 structurally different compounds were tested. They mites responded to most of these compounds, but usually in an aversive way. Individual HIPV were no more attractive (or less repellent) than out-group compounds, i.e., volatiles not induced in plants fed upon by spider-mites. Only three samples were significantly attractive to the mites: octan-1-ol, not involved in indirect defense, and cis-3-hexen-1-ol and methyl salicylate, which are both induced by herbivory, but not specific for the herbivore that infests the plant. Attraction to individual compounds was low compared to the full HIPV blend from Lima bean. These results indicate that individual HIPV have no a priori meaning to the mites. Hence, there is no reason why they could profit from an ability to identify individual compounds in odor mixtures. Subsequent experiments confirmed that naive predatory mites do not prefer tomato HIPV, which included the attractive compound methyl salicylate, over the odor of an uninfested bean. However, upon associating each of these odors with food over a period of 15 min, both are preferred. The memory to this association wanes within 24 hr. We conclude that P. persimilis possesses a limited ability to identify individual spider mite-induced plant volatiles in odor mixtures. We suggest that predatory mites instead learn to respond to prey
Abad-Moyano, Raquel; Urbaneja, Alberto; Schausberger, Peter
2010-01-01
Spanish clementine orchards are frequently infested by the two-spotted spider mte Tetranychus urticae. Natural control of T. urticae is insufficient despite the presence of Neoseiulus californicus and Phytoseiulus persimilis. The phytoseiid community is dominated by the generalist Euseius stipulatus which is poorly adapted to exploit T. urticae. Having the intention to promote biological control of T. urticae by augmentative releases we were interested whether P. persimilis and N. californicus are negatively affected by intraguild (IG) interactions with E. stipulatus. Two experiments were conducted. Firstly, we assessed female aggressiveness (quantified as combination of attack probability and latency) in IG predation on larvae. Secondly, we measured mortality, escaping rate and developmental time of immature IG prey in presence and absence of an adult IG predator female. Euseius stipulatus appeared the strongest IG opponent but microhabitat structure modulated the IG interactions and the advantage of E. stipulatus was partially offset when spider mite webbing was present. Implications of these IG interactions for natural and biological control of T. urticae in clementine orchards are discussed.
Skirvin, D J; Stavrinides, M C; Skirvin, D J
2003-08-01
The effect of plant architecture, in terms of leaf hairiness, and prey spatial arrangement, on predation rate of eggs of the spider mite, Tetranychus urticae Koch, by the predatory mite Phytoseiulus persimilis Athias-Henriot was examined on cut stems of chrysanthemums. Three levels of leaf hairiness (trichome density) were obtained using two different chrysanthemum cultivars and two ages within one of the cultivars. The number of prey consumed by P. persimilis was inversely related to trichome density. At low prey densities (less than ten eggs per stem), prey consumption did not differ in a biologically meaningful way between treatments. The effect of prey spatial arrangement on the predation rate of P. persimilis was also examined. Predation rates were higher in prey patches on leaves adjacent to the release point of P. persimilis, but significantly greater numbers of prey were consumed in higher density prey patches compared to low density patches. The predators exhibited non-random searching behaviour, spending more time on leaves closest to the release point. The implications of these findings for biological control and predator-prey dynamics are discussed.
Tollerup, Kris E; Marcum, Daniel; Wilson, Rob; Godfrey, Larry
2013-08-01
The two-spotted spider mite, Tetranychus urticae Koch, is an economic pest on peppermint [Mentha x piperita (L.), 'Black Mitcham'] grown in California. A sampling plan for T. urticae was developed under Pacific Northwest conditions in the early 1980s and has been used by California growers since approximately 1998. This sampling plan, however, is cumbersome and a poor predictor of T. urticae densities in California. Between June and August, the numbers of immature and adult T. urticae were counted on leaves at three commercial peppermint fields (sites) in 2010 and a single field in 2011. In each of seven locations per site, 45 leaves were sampled, that is, 9 leaves per five stems. Leaf samples were stratified by collecting three leaves from the top, middle, and bottom strata per stem. The on-plant distribution of T. urticae did not significantly differ among the stem strata through the growing season. Binomial and enumerative sampling plans were developed using generic Taylor's power law coefficient values. The best fit of our data for binomial sampling occurred using a tally threshold of T = 0. The optimum number of leaves required for T urticae at the critical density of five mites per leaf was 20 for the binomial and 23 for the enumerative sampling plans, respectively. Sampling models were validated using Resampling for Validation of Sampling Plan Software.
Effectiveness of electron irradiation as a quarantine treatment of cut flowers
International Nuclear Information System (INIS)
Hayashi, T.; Todoriki, S.; Nakakita, H.; Dohino, T.; Tanabe, K.
1999-01-01
The effects of electron beams on spider mite (Tetranychus urticae) and flour beetle (Tribolium freemani) were slightly smaller than those of gamma-rays. 'Soft-electrons' (low-energy electrons) at an energy of 170 keV inactivated eggs, larvae, pupae, and adults of the flour beetle. Electron beams at doses up to 400 Gy killed or sterilized all the pests for cut flowers tested; spider mite (Tetranychus urticae), mealybug (Pseudococcus comstocki), leaf miner (Liriomyza trifolii), thrips (Thrips palmi, Thrips tabaci), cutworm (Spodoptera litura), and aphid (Myzus persicae). Carnation, alstromeria, gladiolus, tulip, statice, stock, dendrobium, prairie gentian, oncidium, campanula, gloriosa, fern, gypsophila, freesia, lobelia, triteleia, and gerbera were resistant to radiation, while chrysanthemum, rose, lily, calla, antherium, sweet pea, and iris were sensitive. Radiation-induced deterioration of chrysanthemum could be prevented by post-irradiation treatment with commercial preservative solutions or sugar solutions. (author)
Spatial distribution of phytophagous mites (Aca ri: Tetranychidae) on strawberry plants
International Nuclear Information System (INIS)
Fadini, Marcos A.M.; Venzon, Madelaine; Oliveira, Hamilton G.; Pallini, Angelo; Vilela, Evaldo F.
2007-01-01
Many phytophagous mites can attack strawberry plants, Fragaria x ananassa, among them the southern red mite, Oligonychus ilicis McGregor, and the two-spotted spider mite, Tetranychus urticae Koch. They are found together feeding on the same plant on the upper and underside of the leaves, respectively. Here we studied the choice for feeding sites of O. ilicis and T. urticae on strawberry plants. The first hypothesis tested whether the feeding site choice would be related to the fitness of the species. The second hypothesis dealt whether the feeding site would be determined by the presence of a heterospecific mite. We evaluated the preference, biology and reproductive success of O. ilicis and T. urticae on the under and upper side surface of strawberry leaves infested or not by the heterospecific. O. ilicis preferred to stay on the upper side surface while T. urticae preferred the underside. The preference for the leaf surface correlated with the reproductive success of the species (measured by the intrinsic growth rate). The choice pattern of feeding sites did not alter when the choice test was applied using sites previously infested by heterospecific. Although O. ilicis and T. urticae, apparently, do not interact directly for feeding sites, there is a chance that the first species induces defenses in strawberry plant enabling to reduce the fitness of the second species. The possibility of those species stay together on strawberry plant increases the damage capacity to the culture. (author)
Pathogenecity of Beauveria bassiana and Metarhizium anisopliae ...
African Journals Online (AJOL)
two spotted spider mites, Tetranychus urticae, effect of temperature on virulence, as well as ... It has become a big challenge to maintain quality of products and compete in ... Data were collected on the number of hatched and un-hatched eggs.
Wu, Shengyong; Xing, Zhenlong; Sun, Weinan; Xu, Xuenong; Meng, Ruixia; Lei, Zhongren
2018-03-01
Determination of intraguild interactions between entomopathogens and predators is important when attempting to use a combination of these two natural enemy groups for biological control of their shared arthropod pest species. This study assessed the effects of Beauveria bassiana on the predation and associated behavior of the predatory mite, Phytoseiulus persimilis, against Tetranychus urticae. The functional response tests showed that P. persimilis exhibited a Holling type II response on the spider mite, Tetranychus urticae, when treated with either a B. bassiana or Tween-80 suspension. There were no significant differences between the treatments in the number of T. urticae consumed. The laboratory choice test indicated that P. persimilis displayed a significant avoidance response to B. bassiana on bean leaves immediately following spray application. They also spent significantly longer time in self-grooming behavior on leaf disks sprayed with fungal conidia than on discs treated with Tween-80. There were no significant differences in the predation rates on T. urticae eggs between the different treatments. The potted plant investigations indicated that P. persimilis showed significant aversion behavior to the initial fungal spray, but gradually dispersed over the entire bean plants. Observations using scanning electron microscopy revealed that fungal conidia were attached to the body of P. persimilis after mounting the leaf disk treated with B. bassiana, which would account for its varied behavioral responses. Our study suggests that fungal spray did not affect the predation capability of P. persimilis and poses a negligible risk to their behavior. Copyright © 2018 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Osouli, Sh.; Ziaie, F.; Haddad Irani Nejad, K.; Moghaddam, M.
2013-01-01
Tetranychus urticae Koch (Tetranychidae) is amongst the most serious pests of cut flowers and ornamentals. In this research the effects of gamma irradiation on different biological stages (including quiescent stages) of this pest have been studied. Irradiation at the doses of 250, 250, 200, 250, 200, 350 and 300 Gy causes sterility of females who were able to reach to adult stage from eggs, larva, protochrysalis, protonymph, deutochrysalis, deutonymph and teliochrysalis stages, respectively. The irradiation caused a decrease in percentage of mites entering the adult stage, developed the adult mite‘s longevity, number of laid eggs per adult female emerged from irradiated immature stages, and finally a retardation of embryonic and post-embryonic development. The sex ratio of the adult mites resulted from irradiated immature stages was biased towards females through increase of dose. The adult mites developed from irradiated two-day old eggs, three-day old eggs, larva, protochrysalis and deutochrysalis at 100, 350, 300, 350 and 350 Gy, respectively, were 100% females. In general the females resulted from irradiated quiescent stages have shown a high sensitivity to characteristics like eggs hatchability percentage and the emerged adult's sex ratio. On the other hand with regard to percentage of immature mites developed to adult stages, longevity of adult males and females, number of eggs laid by females and the time needed to complete their development, teliochrysalis has been the most tolerant stage. Also a 300 Gy dose could cause sterility in females irradiated at deutonymph stage and mated with adult males irradiated before mating and prevent their eggs to be hatched. In conclusion the most tolerance stages of this mite for most of characteristics was generally the most developed ones and a dose of around 300 Gy could be a phytosanitary irradiation treatment for Tetranychus urticae Koch. - Highlights: • The effects of γ-radiation on embryonic stages of
International Nuclear Information System (INIS)
Arguelles R, Angelica; Plazas, Natali; Bustos R, Alexander; Cantor R, Fernando; Rodriguez, Daniel; Hilarion, Alejandra
2013-01-01
Tetranychus urticae (Acari: Tetranychidae) is an important pest of ornamental crops. A species of predatory mite used for its control is Neoseiulus californicus and Phytoseiulus persimilis (Acari: Phytoseiidae). This research proposes the use of joint releases of the two cited predators for the control of the pest. Several situations leading to interaction were evaluated: high density of one predator and low density of the other one, being the prey present or absent. The scenario with predators in equal densities and in presence of the prey was also evaluated. When a predator is in higher density and the prey present, the predator with the lower density increases the interference with the consumption of preys by the predator with higher density. On the other hand, when the consumption of T. urticae reduces, intraguild predation increases. P. persimilis shows intraguild predation behavior when t. urticae is absent and N. californicus is present, consuming all developmental stages of its conspecific. Instead, N. californicus only feed on conspecific larvae, when the fitofagous was absent and P. persimilis was present. When the two predators were present in the same assemblage and with the same population density, the quantity of T. urticae consumed by both of them was not higher than the consumed one when each predator was present in separate way.
Directory of Open Access Journals (Sweden)
Edgar Rivero
2009-03-01
Full Text Available Biological aspects and life table of the red spider mite, Tetranychus desertorum Banks, 1900, were studied on leaf discs of kidney bean (Phaseolus vulgaris Linnaeus cultivar "Tacarigua" under laboratory conditions (28 ± 2ºC, 70 ± 10% R.H. and 12:12h. Our results showed that total developmental time was 6.8 days for females, with partial duration of immature stages corresponding to 3.8, 1.4, 1.0 and 0.7 for egg, larva, protonymph and deutonymph, respectively. Preoviposition, oviposition and postoviposition periods were 1.1, 8.4 and 1.3 days, respectively; and the higher mean fecundity (6.93 eggs/female/day was observed on day 4. Female mean longevity was 10 days. The life table parameters recorded were: net reproduction rate (Ro = 41.10 individuals; generation time (T = 11.15 days; intrinsic natural growth (r m = 0.144 individuals/female/day, and finite natural increase rate (λ = 1.155 individuals/female. Our findings could be a basis for further studies devoted to determine damage and control strategies for T. desertorum on kidney bean crops.
DEFF Research Database (Denmark)
Gacheri, Catherine; Kigen, Thomas; Sigsgaard, Lene
2015-01-01
Rose (Rosa hybrida L.) is the most important ornamental crop in Kenya, with huge investments in pest management. We provide the first full-scale, replicated experiment comparing cost and yield of conventional two-spotted spider mite (Tetranychus urticae Koch) control with hot-spot applications of...
Pathogenecity of Beauveria bassiana and Metarhizium anisopliae ...
African Journals Online (AJOL)
emulsifiable formulation on two-spotted spider mite, T. urticae. Weibin and. Mingguang (2004) found that both B. bassiana and Paecilomyces fumosoroseus infections decreased the hatch rates of Tetranychus cinnanarinus eggs and the higher the conidial concentrations resulted in greater reduction in the hatch rates.
Methyl salicylate production in tomato affects biotic interactions
Ament, K.; Krasikov, V.; Allmann, S.; Rep, M.; Takken, F.L.W.; Schuurink, R.C.
2010-01-01
The role of methyl salicylate (MeSA) production was studied in indirect and direct defence responses of tomato (Solanum lycopersicum) to the spider mite Tetranychus urticae and the root-invading fungus Fusarium oxysporum f. sp. lycopersici, respectively. To this end, we silenced the tomato gene
Ahn, Y J; Kim, Y J; Yoo, J K
2001-02-01
The toxicities of the herbicide glufosinate-ammonium to three predatory insect and two predatory mite species of Tetranychus urticae Koch were determined in the laboratory by the direct contact application. At a concentration of 540 ppm (a field application rate for weed control in apple orchards), glufosinate-ammonium was almost nontoxic to eggs of Amblyseius womersleyi Schicha, Phytoseiulus persimilis Athias-Henriot, and T. urticae but highly toxic to nymphs and adults of these three mite species, indicating that a common mode of action between predatory and phytophagous mites might be involved. In tests with predatory insects using 540 ppm, glufosinate-ammonium revealed little or no harm to larvae and pupae of Chrysopa pallens Rambur but was slightly harmful to eggs (71.2% mortality), nymphs (65.0% mortality), and adults (57.7% mortality) of Orius strigicollis Poppius. The herbicide showed no direct effect on eggs and adults of Harmonia axyridis (Pallas) but was harmful, slightly harmful, and harmless to first instars (100% mortality), fourth instars (51.1% mortality), and pupae (24.5% mortality), respectively. The larvae and nymphs of predators died within 12 h after treatment, suggesting that the larvicidal and nymphicidal action may be attributable to a direct effect rather than an inhibitory action of chitin synthesis. On the basis of our data, glufosinate-ammonium caused smaller effects on test predators than on T. urticae with the exception of P. persimilis, although the mechanism or cause of selectivity remains unknown. Glufosinate-ammonium merits further study as a key component of integrated pest management.
Bioactivity of basil ( Ocimum basicilum L.) on control of the spider ...
African Journals Online (AJOL)
Essential plant oils contain biopesticides that could be used to control many crop pests. Tetranychus spp. are mites that cause damage to several crops and are primarily controlled by synthetic pesticides. Literature showed that mites can be controlled with essential oils of plants containing eugenol. In this work, we ...
Effect of pruning and trellising of tomatoes on red spider mite ...
African Journals Online (AJOL)
Key Words: Arthropod pest, Lycopersicon esculentum, Tetranychus evansi. RÉSUMÉ La petite araignée rouge, Tetranychus evansi Baker & Prichard accidentellement introduite en Afrique Australe vers 1980 est une peste relativement nouvelle pour la tomate (Lycopersicon esculentum) de l'Afrique. Depuis lors l'espèce ...
Recognising one's enemies : a functional approach to risk assessment by prey
Grostal, P.; Dicke, M.
2000-01-01
Little has been done to compare the relative importance of various mechanisms through which prey assess the potential risk from natural enemies. We used predator-naive spider mites (Tetranychus urticae, Tetranychidae) to (1) compare the responses of prey to chemical cues from enemy and non-enemy
Ebadollahi, Asgar; Sendi, Jalal Jalali; Aliakbar, Alireza
2017-12-05
Inspite of well-established potentiality of plant essential oils as biopesticides, their environmentally low persistence is considered as a hindering obstacle for its commercialization. In the present study, chemical composition and toxicity of essential oils isolated from leaves of Thymus eriocalyx and Thymus kotschyanus were evaluated against two-spotted spider mite, Tetranychus urticae. The chemicals present in the crude oil were found to be thymol (28.83%), oleic acid (11.51%), palmitic acid (8.60%), borneol (5.72%), ρ-cymene (3.60%), and 1,8-cineole (3.57%) in the essential oil of T. eriocalyx, and camphene (35.59%), linalyl acetate (20.47%), linalool (14.75%), α-terpineol (13.87%), and geranyl acetate (3.07%) in the essential oil of T. kotschyanus. The essential oils had strong fumigant toxicity on the adult females of Te. urticae and their fumigation persistence was prolonged until 6 and 5 d, respectively, for T. eriocalyx and T. kotschyanus. Loading of essential oils in MCM-41 increased their stability and persistence was extended up to 20 and 18 d for T. eriocalyx and T. kotschyanus. Further, mite mortality increased from 80 to 203 mites by T. eriocalyx and from 58 to 186 mites by T. kotschyanus nanoencapsulated essential oils. Based on these results, nanoencapsulation of T. eriocalyx and T. kotschyanus essential oils in MCM-41 may be a useful method for their application in the management of Te. urticae. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Dicke, M.; Beek, van T.A.; Posthumus, M.A.; Dom, Ben N.; Bokhoven, van H.; Groot, de Ae.
1990-01-01
A volatile kairomone emitted from lima bean plants (Phaseolus lunatus) infested with the spider miteTetranychus urticae, was collected on Tenax-TA and analyzed with GC-MS. Two components were identified as the methylene monoterpene (3E)-4,8-dimethyl-1,3,7-nonatriene and the methylene sesquiterpene
Sato, Yukie; Alba, Juan M; Egas, Martijn; Sabelis, Maurice W
2016-11-01
When competing with indigenous species, invasive species face a problem, because they typically start with a few colonizers. Evidently, some species succeeded, begging an answer to the question how they invade. Here, we investigate how the invasive spider mite Tetranychus evansi interacts with the indigenous species T. urticae when sharing the solanaceous host plant tomato: do they choose to live together or to avoid each other's colonies? Both species spin protective, silken webs on the leaf surfaces, under which they live in groups of con- and possibly heterospecifics. In Spain, T. evansi invaded the non-crop field where native Tetranychus species including T. urticae dominated. Moreover, T. evansi outcompetes T. urticae when released together on a tomato plant. However, molecular plant studies suggest that T. urticae benefits from the local down-regulation of tomato plant defences by T. evansi, whereas T. evansi suffers from the induction of these defences by T. urticae. Therefore, we hypothesize that T. evansi avoids leaves infested with T. urticae whereas T. urticae prefers leaves infested by T. evansi. Using wild-type tomato and a mutant lacking jasmonate-mediated anti-herbivore defences, we tested the hypothesis and found that T. evansi avoided sharing webs with T. urticae in favour of a web with conspecifics, whereas T. urticae more frequently chose to share webs with T. evansi than with conspecifics. Also, T. evansi shows higher aggregation on a tomato plant than T. urticae, irrespective of whether the mites occur on the plant together or not.
Jeyaprakash, Ayyamperumal; Hoy, Marjorie A
2009-01-01
Spiders, scorpions, mites and ticks (chelicerates) form one of the most diverse groups of arthropods on land, but their origin and times of diversification are not yet established. We estimated, for the first time, the molecular divergence times for these chelicerates using complete mitochondrial sequences from 25 taxa. All mitochondrial genes were evaluated individually or after concatenation. Sequences belonging to three missing genes (ND3, 6, and tRNA-Asp) from three taxa, as well as the faster-evolving ribosomal RNAs (12S and 16S), tRNAs, and the third base of each codon from 11 protein-coding genes (PCGs) (COI-III, CYTB, ATP8, 6, ND1-2, 4L, and 4-5), were identified and removed. The remaining concatenated sequences from 11 PCGs produced a completely resolved phylogenetic tree and confirmed that all chelicerates are monophyletic. Removing the third base from each codon was essential to resolve the phylogeny, which allowed deep divergence times to be calculated using three nodes calibrated with upper and lower priors. Our estimates indicate that the orders and classes of spiders, scorpions, mites, and ticks diversified in the late Paleozoic, much earlier than previously reported from fossil date estimates. The divergence time estimated for ticks suggests that their first land hosts could have been amphibians rather than reptiles. Using molecular data, we separated the spider-scorpion clades and estimated their divergence times at 397 +/- 23 million years ago. Algae, fungi, plants, and animals, including insects, were well established on land when these chelicerates diversified. Future analyses, involving mitochondrial sequences from additional chelicerate taxa and the inclusion of nuclear genes (or entire genomes) will provide a more complete picture of the evolution of the Chelicerata, the second most abundant group of animals on earth.
Rosado, Jander F; Picanço, Marcelo C; Sarmento, Renato A; da Silva, Ricardo Siqueira; Pedro-Neto, Marçal; Carvalho, Marcos Alberto; Erasmo, Eduardo A L; Silva, Laila Cristina Rezende
2015-07-01
Studies on the seasonal variation of agricultural pest species are important for the establishment of integrated pest control programs. The seasonality of pest attacks on crops is affected by biotic and abiotic factors, for example, climate and natural enemies. Besides that, characteristics of the host plant, crop management, location and the pests' bioecology also affect this seasonality. The mites Polyphagotarsonemus latus (Prostigmata: Tarsonemidae) and Tetranychus bastosi (Prostigmata: Tetranychidae) are the most important pests in the cultivation of physic nut, Jatropha curcas (Euphorbiaceae). All parts of J. curcas can be used for a wide range of purposes. In addition many researchers have studied its potential for use as neat oil, as transesterified oil (biodiesel), or as a blend with diesel. However studies about physic nut pests have been little known. The objective of this study was to assess the seasonal variation of P. latus and T. bastosi in physic nut. This study was conducted at three sites in the state of Tocantins, Brazil. We monitored climatic elements and the densities of the two mite species and of their natural enemies for a period of 2 years. Attack by P. latus occurred during rainy seasons, when the photoperiod was short and the physic nut had new leaves. In contrast, attack by T. bastosi occurred during warmer seasons with longer photoperiods and stronger winds. Populations of both mites and their natural enemies were greater in sites with greater plant diversity adjacent to the plantations. The predators found in association with P. latus and T. bastosi were Euseius concordis (Acari: Phytoseiidae), spiders, Stethorus sp. (Coleoptera: Coccinellidae) and Chrysoperla sp. (Neuroptera: Chrysopidae).
Aratchige, N.S.; Lesna, I.; Sabelis, M.W.
2004-01-01
Although odour-mediated interactions among plants, spider mites and predatory mites have been extensively studied above-ground, belowground studies are in their infancy. In this paper, we investigate whether feeding by rust mites (Aceria tulipae) cause tulip bulbs to produce odours that attract
Nachman, Gösta
2006-01-01
The spatial distributions of two-spotted spider mites Tetranychus urticae and their natural enemy, the phytoseiid predator Phytoseiulus persimilis, were studied on six full-grown cucumber plants. Both mite species were very patchily distributed and P. persimilis tended to aggregate on leaves with abundant prey. The effects of non-homogenous distributions and degree of spatial overlap between prey and predators on the per capita predation rate were studied by means of a stage-specific predation model that averages the predation rates over all the local populations inhabiting the individual leaves. The empirical predation rates were compared with predictions assuming random predator search and/or an even distribution of prey. The analysis clearly shows that the ability of the predators to search non-randomly increases their predation rate. On the other hand, the prey may gain if it adopts a more even distribution when its density is low and a more patchy distribution when density increases. Mutual interference between searching predators reduces the predation rate, but the effect is negligible. The stage-specific functional response model was compared with two simpler models without explicit stage structure. Both unstructured models yielded predictions that were quite similar to those of the stage-structured model.
Phytoseiulus persimilis response to herbivore-induced plant volatiles as a function of mite-days.
Nachappa, Punya; Margolies, David C; Nechols, James R; Loughin, Thomas
2006-01-01
The predatory mite, Phytoseiulus persimilis (Acari: Phytoseiidae), uses plant volatiles (i.e., airborne chemicals) triggered by feeding of their herbivorous prey, Tetranychus urticae (Acari: Tetranychidae), to help locate prey patches. The olfactory response of P. persimilis to prey-infested plants varies in direct relation to the population growth pattern of T. urticae on the plant; P. persimilis responds to plants until the spider mite population feeding on a plant collapses, after which infested plants do not attract predators. It has been suggested that this represents an early enemy-free period for T. urticae before the next generation of females is produced. We hypothesize that the mechanism behind the diminished response of predators is due to extensive leaf damage caused by T. urticae feeding, which reduces the production of volatiles irrespective of the collapse of T. urticae population on the plant. To test this hypothesis we investigated how the response of P. persimilis to prey-infested plants is affected by: 1) initial density of T. urticae, 2) duration of infestation, and 3) corresponding leaf damage due to T. urticae feeding. Specifically, we assessed the response of P. persimilis to plants infested with two T. urticae densities (20 or 40 per plant) after 2, 4, 6, 8, 10, 12 or 14 days. We also measured leaf damage on these plants. We found that predator response to T. urticae-infested plants can be quantified as a function of mite-days, which is a cumulative measure of the standing adult female mite population sampled and summed over time. That is, response to volatiles increased with increasing numbers of T. urticae per plant or with the length of time plant was infested by T. urticae, at least as long at the leaves were green. Predatory mites were significantly attracted to plants that were infested for 2 days with only 20 spider mites. This suggests that the enemy-free period might only provide a limited window of opportunity for T. urticae
Yang, Si-Xia; Guo, Chao; Zhao, Xiu-Ting; Sun, Jing-Tao; Hong, Xiao-Yue
2017-02-19
The two-spotted spider mite, Tetranychus urticae Koch has two forms: green form and red form. Understanding the molecular basis of how these two forms established without divergent genetic background is an intriguing area. As a well-known epigenetic process, DNA methylation has particularly important roles in gene regulation and developmental variation across diverse organisms that do not alter genetic background. Here, to investigate whether DNA methylation could be associated with different phenotypic consequences in the two forms of T. urticae, we surveyed the genome-wide cytosine methylation status and expression level of DNA methyltransferase 3 (Tudnmt3) throughout their entire life cycle. Methylation-sensitive amplification polymorphism (MSAP) analyses of 585 loci revealed variable methylation patterns in the different developmental stages. In particular, principal coordinates analysis (PCoA) indicates a significant epigenetic differentiation between female adults of the two forms. The gene expression of Tudnmt3 was detected in all examined developmental stages, which was significantly different in the adult stage of the two forms. Together, our results reveal the epigenetic distance between the two forms of T. urticae, suggesting that DNA methylation might be implicated in different developmental demands, and contribute to different phenotypes in the adult stage of these two forms. © 2017 Institute of Zoology, Chinese Academy of Sciences.
Vangansbeke, Dominiek; De Schrijver, Lien; Spranghers, Thomas; Audenaert, Joachim; Verhoeven, Ruth; Nguyen, Duc Tung; Gobin, Bruno; Tirry, Luc; De Clercq, Patrick
2013-11-01
Increasing energy costs force glasshouse growers to switch to energy saving strategies. In the temperature integration approach, considerable daily temperature variations are allowed, which not only have an important influence on plant growth but also on the development rate of arthropods in the crop. Therefore, we examined the influence of two constant temperature regimes (15 °C/15 °C and 20 °C/20 °C) and one alternating temperature regime (20 °C/5 °C, with an average of 15 °C) on life table parameters of Phytoseiulus persimilis and Neoseiulus californicus and their target pest, the two-spotted spider mite Tetranychus urticae at a 16:8 (L:D) h photoperiod and 65 ± 5 % RH. For females of both predatory mites the alternating temperature regime resulted in a 25-30 % shorter developmental time as compared to the corresponding mean constant temperature regime of 15 °C/15 °C. The immature development of female spider mites was prolonged for 7 days at 15 °C/15 °C as compared to 20 °C/5 °C. With a daytime temperature of 20 °C, no differences in lifetime fecundity were observed between a nighttime temperature of 20 and 5 °C for P. persimilis and T. urticae. The two latter species did show a higher lifetime fecundity at 20 °C/5 °C than at 15 °C/15 °C, and their daily fecundity at the alternating regime was about 30 % higher than at the corresponding mean constant temperature. P. persimilis and T. urticae showed no differences in sex ratio between the three temperature regimes, whereas the proportion of N. californicus females at 15 °C/15 °C (54.2 %) was significantly lower than that at 20 °C/5 °C (69.4 %) and 20 °C/20 °C (67.2 %). Intrinsic rates of increase were higher at the alternating temperature than at the corresponding mean constant temperature for both pest and predators. Our results indicate that thermal responses of the studied phytoseiid predators to alternating temperature regimes used in energy saving strategies in glasshouse crops may
Directory of Open Access Journals (Sweden)
Dejan Marčić
2009-01-01
Full Text Available Laboratory bioassays were conducted to evaluate the effects of spiromesifen on the fecundity, fertility and population growth of two-spotted spider mite (Tetranychus urticae Koch after treatment of pre-ovipositing females with five acaricide concentrations: 180mg/l (maximum recommended concentration for use in glasshouses against spider mites, 18 mg/l, 1.8 mg/l and 0.18 mg/l (the last one was discriminative for eggs and immatures in preliminary studies, i.e. produced 100% mortality of those stages and 0.018 mg/l. After24h exposure, the percentages of females surviving treatment without visible symptoms of poisoning were 50% (180 mg/l, 45% (18 mg/l, 51% (1.8 mg/l, 74% (0.18 mg/l, 96% (0.018 mg/l and 98% (0 mg/l. Over the first four days after treatment, the females that survived180 mg/l and 18 mg/l laid no eggs. The total number of eggs laid after treatment with these two concentrations was reduced to less than 2% against the control by the end of the trial. The females that survived 1.8 mg/l laid 50% less eggs, compared to the control, while the number of eggs laid by the females treated with 0.18 mg/l and 0.018 mg/l were 19% and 4% lower, respectively. Over the initial four days, egg hatch rates in treatments were 73-87%, and 92-93% in the control. Significant statistical differences between gross fecundity (FCg and gross fertility (FTg values in the control and treatments were detected for females surviving 180 mg/l, 18 mg/l and 1.8 mg/l. On the other hand, only the net fertility (FTn value of females treated with 0.018 mg/l showed no statistically significant difference from the control value. Treatments with 180 mg/l and 18 mg/l significantly reduced the instantaneous rate of increase (ri 6, 8 and 10 days after treatment, compared to the control. The negative ri values in those treatments indicated a declining population. Sublethal effects of spiromesifen and its impact on T. urticae management are discussed.
Energy Technology Data Exchange (ETDEWEB)
Bustos, Alexander; Cantor, Fernando; Cure, Jose R; Rodriguez, Daniel [Universidade Militar Nueva Granada, Bogota (Colombia). Facutad de Ciencias. Programa de Biologia Aplicada], e-mail: fernando.cantor@unimilitar.edu.co
2009-09-15
A rearing technique was standardized to produce Tetranychus urticae Koch on Phaseolus vulgaris (ICA Cerinza variety) as a prey of the predatory mite Phytoseiulus persimilis Athias-Henriot. Two assays were conducted to assess the following variables: the most suitable plant age for mite infestation, and the best time to harvest the mites and re infest the plants. In the first experiment, four, five, six, and seven-week-old plants of P. vulgaris were infested with six T. urticae per foliole. The lower plant stratum exhibited the largest number of mites regardless of plant age. However, four-week old plants had the larger average number of individuals. In the second experiment four-week-old plants were infested with 0.5 female mite/cm{sup 2} of leaf. The number of individuals per instar of T. urticae was recorded weekly. The highest mite production occurred between four and five weeks after infestation, indicating this to be the most suitable for mite harvesting and for plant reinfestation. (author)
Directory of Open Access Journals (Sweden)
Eric W. Riddick
2012-01-01
Full Text Available We investigated mother-offspring relations in a lady beetle Stethorus punctillum Weise that utilizes spider mites as prey. Our objectives were to determine if (1 prey quality affects egg size, (2 maternal size correlates with egg size, and (3 egg size affects hatching success. We fed predators spider mites Tetranychus urticae Koch from lima bean Phaseolus lunatus L. foliage in the laboratory. Mothers of unknown body size offered high rather than low quality spider mites since birth produced larger eggs. Mothers of known body size offered only high quality spider mites, produced eggs of variable size, but mean egg size correlated positively with hind femur length. Mothers laid their eggs singly, rather than in batches, and eggs were large relative to femur size. Egg size did not affect hatch success; mean hatch rate exceeded 95% regardless of egg size. In conclusion, the quality of prey consumed by S. punctillum mothers while in the larval stage can affect their size as adults and, consequently, the size of their eggs. The behavior of laying eggs singly, the positive relationship between maternal size and mean egg size, and the high rate of egg hatch suggest that S. punctillum mothers invest heavily in offspring.
Energy Technology Data Exchange (ETDEWEB)
Nicastro, Roberto L.; Arthur, Valter; Machi, Andre R., E-mail: rnicastro@cena.usp.br, E-mail: arthur@cena.usp.br [Laboratorio de Radiobiologia e Ambiente (CENA/USP), Piracicaba, SP (Brazil); Sato, Mario E., E-mail: mesato@biologico.sp.gov.br [Laboratorio de Acarologia, Instituto Biologico, Campinas, SP (Brazil)
2011-07-01
The spider mite Tetranychus urticae Koch is considered one of the most important phytophagous mites, causing considerable damage in several agricultural crops. The aim of this study was to evaluate the effect of gamma radiation on the toxicity of the acaricides milbemectin and chlorfenapyr in resistant and susceptible strains of T. urticae. The R and S strains for milbemectin and chlorfenapyr were irradiated with gamma radiation at Gamma cell-220 source at doses of 5, 10, 20, 40 e 80 Gy. Five concentrations of milbemectin and chlorfenapyr were evaluated, making applications 24 hours after irradiation. Mites of the controls were sprayed with the same acaricide concentrations used for the R and S strains but they were not exposed to gamma radiation. Experiments on the effects of gamma radiation on the growth rates of mites for acaricide resistant and susceptible strains of T. urticae were also carried out. Tests with the Milbemectin S strain showed an increased susceptibility to the acaricide milbemectin, when the mites were irradiated (20 Gy), in comparison with the control (non irradiated mites). For the Milbemectin R strain, there was no significant influence of gamma irradiation on the toxicity of milbemectin to the mites of this strain. For the Chlorfenapyr S strain, the effect of gamma radiation was similar to that observed for Milbemectin S strain, with increased toxicity of chlorfenapyr to the mites of this susceptible strain. In the case of the Chlorfenapyr R strain, the mites exposed to gamma radiation showed to be more tolerant to chlorfenapyr, considering the LC{sub 10} values. The same trend was observed for the LC{sub 50} values, however, there was no significant difference with the control. The experiments showed that doses of 200 and 300 Gy eliminated the mite populations of acaricide resistant and susceptible strains of T. urticae, in a period of ten days. The dose of 100 Gy did not lead to total elimination of the mite populations, but reduced
International Nuclear Information System (INIS)
Nicastro, Roberto L.; Arthur, Valter; Machi, Andre R.; Sato, Mario E.
2011-01-01
The spider mite Tetranychus urticae Koch is considered one of the most important phytophagous mites, causing considerable damage in several agricultural crops. The aim of this study was to evaluate the effect of gamma radiation on the toxicity of the acaricides milbemectin and chlorfenapyr in resistant and susceptible strains of T. urticae. The R and S strains for milbemectin and chlorfenapyr were irradiated with gamma radiation at Gamma cell-220 source at doses of 5, 10, 20, 40 e 80 Gy. Five concentrations of milbemectin and chlorfenapyr were evaluated, making applications 24 hours after irradiation. Mites of the controls were sprayed with the same acaricide concentrations used for the R and S strains but they were not exposed to gamma radiation. Experiments on the effects of gamma radiation on the growth rates of mites for acaricide resistant and susceptible strains of T. urticae were also carried out. Tests with the Milbemectin S strain showed an increased susceptibility to the acaricide milbemectin, when the mites were irradiated (20 Gy), in comparison with the control (non irradiated mites). For the Milbemectin R strain, there was no significant influence of gamma irradiation on the toxicity of milbemectin to the mites of this strain. For the Chlorfenapyr S strain, the effect of gamma radiation was similar to that observed for Milbemectin S strain, with increased toxicity of chlorfenapyr to the mites of this susceptible strain. In the case of the Chlorfenapyr R strain, the mites exposed to gamma radiation showed to be more tolerant to chlorfenapyr, considering the LC 10 values. The same trend was observed for the LC 50 values, however, there was no significant difference with the control. The experiments showed that doses of 200 and 300 Gy eliminated the mite populations of acaricide resistant and susceptible strains of T. urticae, in a period of ten days. The dose of 100 Gy did not lead to total elimination of the mite populations, but reduced significantly
Directory of Open Access Journals (Sweden)
Denise Tourino Rezende de Cerqueira
Full Text Available ABSTRACT: Improved spray deposition can be attained by electrostatically charging spray droplets, which increases the attraction of droplets to plants and decreases operator exposure to pesticide and losses to the environment. However, this technique alone is not sufficient to achieve desirable penetration of the spray solution into the crop canopy; thus, air assistance can be added to the electrostatic spraying to further improve spray deposition. This study was conducted to compare different spraying technologies on spray deposition and two-spotted spider mite control in cut chrysanthemum. Treatments included in the study were: conventional TJ 8003 double flat fan nozzles, conventional TXVK-3 hollow cone nozzles, semi-stationary motorized jet launched spray with electrostatic spray system (ESS and air assistance (AA, and semi-stationary motorized jet launched spray with AA only (no ESS. To evaluate the effect of these spraying technologies on the control of two-spotted spider mite, a control treatment was included that did not receive an acaricide application. The AA spraying technology, with or without ESS, optimized spray deposition and provided satisfactory two-spotted spider mite control up to 4 days after application.
Morphology of the olfactory system in the predatory mite Phytoseiulus persimilis
van Wijk, M.; Wadman, W.J.; Sabelis, M.W.
2006-01-01
The predatory mite Phytoseiulus persimilis locates its prey, the two-spotted spider mite, by means of herbivore-induced plant volatiles. The olfactory response to this quantitatively and qualitatively variable source of information is particularly well documented. The mites perform this task with a
SIMULTANEOUS PRODUCTIVE GROWTH GROUPS (SPGG: INNOVATION ON PAPAYA MITE MANAGEMENT
Directory of Open Access Journals (Sweden)
Marycruz Abato-Zárate
2011-11-01
Full Text Available Grower’s previous experience and their ability to communicate technical information to other growers, allows greater adoption of technologies. Thus, appropriation of technologies of mite management and sampling was evaluated, based on the “Simultaneous Productive Growth Groups (SPGG†technology transfer model. A preliminary diagnosis was made, evaluating the technology transfer achieved by six leading growers showing up continuously to seven meetings carried out from March to July 2010, and also by 19 growers showing up on a more irregular basis. All growers were from the municipality of Cotaxtla and belonged to the Papaya-Product-System of Veracruz, Mexico. Participation, attitude and efficacy of training were evaluated with a survey. Forty-two percent of growers considered the papaya ring spot virus as the main problem and 48 % revealed spider mites as the second one; 96 % used pesticides on spider mites. Participation of the SPGG basic group was 71 %, who agreed on sampling, recording data in sampling forms and using selective acaricides. Seventy percent were able to recognize spider mites from predatory mites and 83 % recognized selective acaricides. Growers considered that sampling can help reduce control costs. The SPGG model allowed building collective knowledge and better decision making by the working group.
Schimmel, Bernardus C J; Ataide, Livia M S; Chafi, Rachid; Villarroel, Carlos A; Alba, Juan M; Schuurink, Robert C; Kant, Merijn R
2017-06-01
Spider mites are destructive arthropod pests on many crops. The generalist herbivorous mite Tetranychus urticae induces defenses in tomato (Solanum lycopersicum) and this constrains its fitness. By contrast, the Solanaceae-specialist Tetranychus evansi maintains a high reproductive performance by suppressing tomato defenses. Tetranychus evansi outcompetes T. urticae when infesting the same plant, but it is unknown whether this is facilitated by the defenses of the plant. We assessed the extent to which a secondary infestation by a competitor affects local plant defense responses (phytohormones and defense genes), mite gene expression and mite performance. We observed that T. evansi switches to hyper-suppression of defenses after its tomato host is also invaded by its natural competitor T. urticae. Jasmonate (JA) and salicylate (SA) defenses were suppressed more strongly, albeit only locally at the feeding site of T. evansi, upon introduction of T. urticae to the infested leaflet. The hyper-suppression of defenses coincided with increased expression of T. evansi genes coding for salivary defense-suppressing effector proteins and was paralleled by an increased reproductive performance. Together, these observations suggest that T. evansi overcompensates its reproduction through hyper-suppression of plant defenses in response to nearby competitors. We hypothesize that the competitor-induced overcompensation promotes competitive population growth of T. evansi on tomato. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
Food stress causes sex-specific maternal effects in mites.
Walzer, Andreas; Schausberger, Peter
2015-08-01
Life history theory predicts that females should produce few large eggs under food stress and many small eggs when food is abundant. We tested this prediction in three female-biased size-dimorphic predatory mites feeding on herbivorous spider mite prey: Phytoseiulus persimilis, a specialized spider mite predator; Neoseiulus californicus, a generalist preferring spider mites; Amblyseius andersoni, a broad diet generalist. Irrespective of predator species and offspring sex, most females laid only one small egg under severe food stress. Irrespective of predator species, the number of female but not male eggs decreased with increasing maternal food stress. This sex-specific effect was probably due to the higher production costs of large female than small male eggs. The complexity of the response to the varying availability of spider mite prey correlated with the predators' degree of adaptation to this prey. Most A. andersoni females did not oviposit under severe food stress, whereas N. californicus and P. persimilis did oviposit. Under moderate food stress, only P. persimilis increased its investment per offspring, at the expense of egg number, and produced few large female eggs. When prey was abundant, P. persimilis decreased the female egg sizes at the expense of increased egg numbers, resulting in a sex-specific egg size/number trade-off. Maternal effects manifested only in N. californicus and P. persimilis. Small egg size correlated with the body size of daughters but not sons. Overall, our study provides a key example of sex-specific maternal effects, i.e. food stress during egg production more strongly affects the sex of the large than the small offspring. © 2015. Published by The Company of Biologists Ltd.
Suppression of Plant Defenses by Herbivorous Mites Is Not Associated with Adaptation to Host Plants
Directory of Open Access Journals (Sweden)
Jéssica T. Paulo
2018-06-01
Full Text Available Some herbivores suppress plant defenses, which may be viewed as a result of the coevolutionary arms race between plants and herbivores. However, this ability is usually studied in a one-herbivore-one-plant system, which hampers comparative studies that could corroborate this hypothesis. Here, we extend this paradigm and ask whether the herbivorous spider-mite Tetranychus evansi, which suppresses the jasmonic-acid pathway in tomato plants, is also able to suppress defenses in other host plants at different phylogenetic distances from tomatoes. We test this using different plants from the Solanales order, namely tomato, jimsonweed, tobacco, and morning glory (three Solanaceae and one Convolvulaceae, and bean plants (Fabales. First, we compare the performance of T. evansi to that of the other two most-commonly found species of the same genus, T. urticae and T. ludeni, on several plants. We found that the performance of T. evansi is higher than that of the other species only on tomato plants. We then showed, by measuring trypsin inhibitor activity and life history traits of conspecific mites on either clean or pre-infested plants, that T. evansi can suppress plant defenses on all plants except tobacco. This study suggests that the suppression of plant defenses may occur on host plants other than those to which herbivores are adapted.
Antipredator responses in Tetranychus urticae differ with predator specialization
DEFF Research Database (Denmark)
Jacobsen, Stine Kramer; Alexakis, I.; Sigsgaard, Lene
2016-01-01
The behavioural response of Tetranychus urticae to chemical cues from specialist predatory mites, Phytoseiulus persimilis, or generalist predatory bugs, Orius majusculus, on either bean or strawberry was studied in experimental arenas. Predators were placed on the leaf disc for 24 h and removed...... and control treatments. No interaction effect was found between plant species and prey fecundity, while significantly more eggs were laid on bean than on strawberry. Predator cues irrespective of predator specialization resulted in more prey dispersal than in the control. Findings emphasize the importance...
Age-dependent male mating tactics in a spider mite-A life-history perspective.
Sato, Yukie; Rühr, Peter T; Schmitz, Helmut; Egas, Martijn; Blanke, Alexander
2016-10-01
Males often fight with rival males for access to females. However, some males display nonfighting tactics such as sneaking, satellite behavior, or female mimicking. When these mating tactics comprise a conditional strategy, they are often thought to be explained by resource holding potential (RHP), that is, nonfighting tactics are displayed by less competitive males who are more likely to lose a fight. The alternative mating tactics, however, can also be explained by life-history theory, which predicts that young males avoid fighting, regardless of their RHP, if it pays off to wait for future reproduction. Here, we test whether the sneaking tactic displayed by young males of the two-spotted spider mite can be explained by life-history theory. We tested whether young sneaker males survive longer than young fighter males after a bout of mild or strong competition with old fighter males. We also investigated whether old males have a more protective outer skin-a possible proxy for RHP-by measuring cuticle hardness and elasticity using nanoindentation. We found that young sneaker males survived longer than young fighter males after mild male competition. This difference was not found after strong male competition, which suggests that induction of sneaking tactic is affected by male density. Hardness and elasticity of the skin did not vary with male age. Given that earlier work could also not detect morphometric differences between fighter and sneaker males, we conclude that there is no apparent increase in RHP with age in the mite and age-dependent male mating tactics in the mite can be explained only by life-history theory. Because it is likely that fighting incurs a survival cost, age-dependent alternative mating tactics may be explained by life-history theory in many species when reproduction of old males is a significant factor in fitness.
International Nuclear Information System (INIS)
Bustos, Alexander; Cantor, Fernando; Cure, Jose R; Rodriguez, Daniel
2009-01-01
A rearing technique was standardized to produce Tetranychus urticae Koch on Phaseolus vulgaris (ICA Cerinza variety) as a prey of the predatory mite Phytoseiulus persimilis Athias-Henriot. Two assays were conducted to assess the following variables: the most suitable plant age for mite infestation, and the best time to harvest the mites and re infest the plants. In the first experiment, four, five, six, and seven-week-old plants of P. vulgaris were infested with six T. urticae per foliole. The lower plant stratum exhibited the largest number of mites regardless of plant age. However, four-week old plants had the larger average number of individuals. In the second experiment four-week-old plants were infested with 0.5 female mite/cm 2 of leaf. The number of individuals per instar of T. urticae was recorded weekly. The highest mite production occurred between four and five weeks after infestation, indicating this to be the most suitable for mite harvesting and for plant reinfestation. (author)
Meynard, Christine N; Migeon, Alain; Navajas, Maria
2013-01-01
Many species are shifting their distributions due to climate change and to increasing international trade that allows dispersal of individuals across the globe. In the case of agricultural pests, such range shifts may heavily impact agriculture. Species distribution modelling may help to predict potential changes in pest distributions. However, these modelling strategies are subject to large uncertainties coming from different sources. Here we used the case of the tomato red spider mite (Tetranychus evansi), an invasive pest that affects some of the most important agricultural crops worldwide, to show how uncertainty may affect forecasts of the potential range of the species. We explored three aspects of uncertainty: (1) species prevalence; (2) modelling method; and (3) variability in environmental responses between mites belonging to two invasive clades of T. evansi. Consensus techniques were used to forecast the potential range of the species under current and two different climate change scenarios for 2080, and variance between model projections were mapped to identify regions of high uncertainty. We revealed large predictive variations linked to all factors, although prevalence had a greater influence than the statistical model once the best modelling strategies were selected. The major areas threatened under current conditions include tropical countries in South America and Africa, and temperate regions in North America, the Mediterranean basin and Australia. Under future scenarios, the threat shifts towards northern Europe and some other temperate regions in the Americas, whereas tropical regions in Africa present a reduced risk. Analysis of niche overlap suggests that the current differential distribution of mites of the two clades of T. evansi can be partially attributed to environmental niche differentiation. Overall this study shows how consensus strategies and analysis of niche overlap can be used jointly to draw conclusions on invasive threat
Directory of Open Access Journals (Sweden)
Christine N Meynard
Full Text Available Many species are shifting their distributions due to climate change and to increasing international trade that allows dispersal of individuals across the globe. In the case of agricultural pests, such range shifts may heavily impact agriculture. Species distribution modelling may help to predict potential changes in pest distributions. However, these modelling strategies are subject to large uncertainties coming from different sources. Here we used the case of the tomato red spider mite (Tetranychus evansi, an invasive pest that affects some of the most important agricultural crops worldwide, to show how uncertainty may affect forecasts of the potential range of the species. We explored three aspects of uncertainty: (1 species prevalence; (2 modelling method; and (3 variability in environmental responses between mites belonging to two invasive clades of T. evansi. Consensus techniques were used to forecast the potential range of the species under current and two different climate change scenarios for 2080, and variance between model projections were mapped to identify regions of high uncertainty. We revealed large predictive variations linked to all factors, although prevalence had a greater influence than the statistical model once the best modelling strategies were selected. The major areas threatened under current conditions include tropical countries in South America and Africa, and temperate regions in North America, the Mediterranean basin and Australia. Under future scenarios, the threat shifts towards northern Europe and some other temperate regions in the Americas, whereas tropical regions in Africa present a reduced risk. Analysis of niche overlap suggests that the current differential distribution of mites of the two clades of T. evansi can be partially attributed to environmental niche differentiation. Overall this study shows how consensus strategies and analysis of niche overlap can be used jointly to draw conclusions on invasive
Gontijo, Lessando M; Nechols, James R; Margolies, David C; Cloyd, Raymond A
2012-01-01
The arrangement, number, and size of plant parts may influence predator foraging behavior, either directly, by altering the rate or pattern of predator movement, or, indirectly, by affecting the distribution and abundance of prey. We report on the effects of both plant architecture and prey distribution on foraging by the predatory mite, Phytoseiulus persimilis Athias-Henriot (Acari: Phytoseiidae), on cucumber (Cucumis sativus L.). Plants differed in leaf number (2- or 6-leafed), and there were associated differences in leaf size, plant height, and relative proportions of plant parts; but all had the same total surface area. The prey, the twospotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae), were distributed either on the basal leaf or on all leaves. The effect of plant architecture on predator foraging behavior varied depending on prey distribution. The dimensions of individual plant parts affected time allocated to moving and feeding, but they did not appear to influence the frequency with which predators moved among different plant parts. Overall, P. persimilis moved less, and fed upon prey longer, on 6-leafed plants with prey on all leaves than on plants representing other treatment combinations. Our findings suggest that both plant architecture and pattern of prey distribution should be considered, along with other factors such as herbivore-induced plant volatiles, in augmentative biological control programs.
Sato, Y; Alba, J M; Sabelis, M W
2014-01-01
When phylogenetically close, two competing species may reproductively interfere, and thereby affect their population dynamics. We tested for reproductive interference (RI) between two congeneric haplo-diploid spider mites, Tetranychus evansi and Tetranychus urticae, by investigating their interspecific mating and their population dynamics when they competed on the same plants. They are both pests of tomato, but differ in the host plant defences that they suppress or induce. To reduce the effect of plant-mediated interaction, we used a mutant tomato plant lacking jasmonate-mediated anti-herbivore defences in the competition experiment. In addition, to manipulate the effect of RI, we introduced founder females already mated with conspecific males in mild RI treatments or founder, virgin females in strong RI treatments (in either case together with heterospecific and conspecific males). As females show first-male sperm precedence, RI should occur especially in the founder generation under strong RI treatments. We found that T. urticae outcompeted T. evansi in mild, but not in strong RI treatments. Thus, T. evansi interfered reproductively with T. urticae. This result was supported by crossing experiments showing frequent interspecific copulations, strong postmating reproductive isolation and a preference of T. evansi males to mate with T. urticae (instead of conspecific) females, whereas T. urticae males preferred conspecific females. We conclude that interspecific mating comes at a cost due to asymmetric mate preferences of males. Because RI by T. evansi can improve its competitiveness to T. urticae, we propose that RI partly explains why T. evansi became invasive in Europe where T. urticae is endemic. PMID:24865602
Opit, George P; Perret, Jamis; Holt, Kiffnie; Nechols, James R; Margolies, David C; Williams, Kimberly A
2009-02-01
Efficacy, costs, and impact on crop salability of various biological and chemical control strategies for Tetranychus urticae Koch (Acari: Tetranychidae) were evaluated on mixed plantings of impatiens, Impatiens wallerana Hook.f (Ericales: Balsaminaceae), and ivy geranium, Pelargonium peltatum (1.) L'Hér. Ex Aiton (Geraniales: Geraniaceae), cultivars in commercial greenhouses. Chemical control consisting of the miticide bifenazate (Floramite) was compared with two biological control strategies using the predatory mite Phytoseiulus persimilis Athias-Henriot (Acari: Phytoseiidae). Treatments were 1) a single, early application of bifenazate; 2) a single, early release of predatory mites at a 1:4 predator:pest ratio based on leaf samples to estimate pest density; 3) a weekly release of predatory mites at numbers based on the area covered by the crop; and 4) an untreated control. T. urticae populations were monitored for 3 wk after the earliest treatment. When plants were ready for market, their salability was estimated. Bifenazate and density-based P. persimilis treatments effectively reduced T. urticae numbers starting 1 wk after plants had been treated, whereas the scheduled, area-based P. persimilis treatment had little or no effect. The percentage of flats that could be sold at the highest market wholesale price ranged from 15 to 33%, 44 to 86%, 84 to 95%, and 92 to 100%, in the control, weekly area-based P. persimilis, bifenazate, and single density-based P. persimilis treatments, respectively. We have shown that in commercial greenhouse production of herbaceous ornamental bedding plants, estimating pest density to determine the appropriate number of predators to release is as effective and offers nearly the same economic benefit as prophylactic use of pesticides.
Computer-assisted estimation of leaf damage caused by spider mites
Czech Academy of Sciences Publication Activity Database
Škaloudová, B.; Křivan, Vlastimil; Zemek, Rostislav
2006-01-01
Roč. 53, č. 2, (2006), s. 81-91 ISSN 0168-1699 R&D Projects: GA AV ČR(CZ) IAA6007303 Institutional research plan: CEZ:AV0Z50070508 Keywords : Tetranychus urticae * Acari * Tetranychidae Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.851, year: 2006
``Sleeping with the enemy''—predator-induced diapause in a mite
Kroon, Annemarie; Veenendaal, René L.; Bruin, Jan; Egas, Martijn; Sabelis, Maurice W.
2008-12-01
Diapause in arthropods is a physiological state of dormancy that is generally thought to promote survival during harsh seasons and dispersal, but it may also serve to avoid predation in space and time. Here, we show that predation-related odours induce diapause in female adult spider mites. We argue that this response allows them to move into an area where they are free of enemies, yet forced to survive without food. Spider mites are specialised leaf feeders, but—in late summer—they experience severe predation on leaves. Hence, they face a dilemma: to stay on the leaf and risk being eaten or to move away from the leaf and risk death from starvation and thirst. Female two-spotted spider mites solve this dilemma by dramatically changing their physiology when exposed to predation-associated cues. This allows them to disperse away from leaves and to survive in winter refuges in the bark of trees or in the soil. We conclude that the mere presence of predation-associated cues causes some herbivorous mites to seek refuge, thereby retarding the growth rate of the population as a whole: a trait-mediated indirect effect that may have consequences for the stability of predator prey systems and for ecosystem structure.
Directory of Open Access Journals (Sweden)
M.A. Watanabe
1994-04-01
Full Text Available O ácaro rajado, Tetranychus urticae Koch, é considerado uma das principais pragas de hortaliças e várias outras culturas no Brasil, em áreas onde um considerável volume de acaricidas é anualmente empregado no seu controle. O objetivo deste trabalho foi testar a viabilidade técnica do emprego dos fitoseídeos Amblyseius idaeus (Denmark & Muma e Phytoseudus macropilis (Banks, comum ente encontrados no Brasil, no controle de T. urticae em pepino e morangueiro em Jaguaríúna,SP. Utilizou-se o delineamento experimental em blocos casualizados, com 4 repetições e 4 tratamentos (T1-T4 para o pepino e 5 tratamentos para o morangueiro (T1-T5: T1, testemunha; T2, pulverizações semanais de Malation para a exclusão de predadores nativos; T3, liberações periódicas de A.idaeus; T4, liberações periódicas de P.macropilis; T5, pulverizações semanais de avermectina para a exclusão de ácaros fitófagos e predadores nativos. Apenas A.idaeus se estabeleceu na cultura de pepino, reduzindo significativamente a população de T. urticae. Ambas espécies de predadores se estabeleceram na cultura do morango e reduziram significativamente a população de T.urticae.The two-spotted spider mite, Tetranychus urticae Koch, is considered one of the main pests of horticultural and other crops in Brazil, in areas where a considerable volume of acaricides is annually used for its control. The objective of this work was to test the technical viability of using phytoseiids Amblyseius idaeus (Denmark & Muma and Phytoseudus macropilis (Banks, commonly found in Brazil, to control T .urticae in cucumber and strawberry crops in Jaguaríúna,SP. A randomized complete block design was used, with 4 replicates and 4 treatments for cucumber (T1-T4 and 5 treatments for strawberry crops (T1-T5: T1, control; T2, weekly sprays of malathion for exclusion of native predators; T3, periodical releases of A.idaeus; T4, periodical releases of P. macropilis; T5, weekly sprays of
Integration of multiple intraguild predator cues for oviposition decisions by a predatory mite
Walzer, Andreas; Schausberger, Peter
2012-01-01
In mutual intraguild predation (IGP), the role of individual guild members is strongly context dependent and, during ontogeny, can shift from an intraguild (IG) prey to a food competitor or to an IG predator. Consequently, recognition of an offspring's predator is more complex for IG than classic prey females. Thus, IG prey females should be able to modulate their oviposition decisions by integrating multiple IG predator cues and by experience. Using a guild of plant-inhabiting predatory mites sharing the spider mite Tetranychus urticae as prey and passing through ontogenetic role shifts in mutual IGP, we assessed the effects of single and combined direct cues of the IG predator Amblyseius andersoni (eggs and traces left by a female on the substrate) on prey patch selection and oviposition behaviour of naïve and IG predator-experienced IG prey females of Phytoseiulus persimilis. The IG prey females preferentially resided in patches without predator cues when the alternative patch contained traces of predator females or the cue combination. Preferential egg placement in patches without predator cues was only apparent in the choice situation with the cue combination. Experience increased the responsiveness of females exposed to the IG predator cue combination, indicated by immediate selection of the prey patch without predator cues and almost perfect oviposition avoidance in patches with the cue combination. We argue that the evolution of the ability of IG prey females to evaluate offspring's IGP risk accurately is driven by the irreversibility of oviposition and the functionally complex relationships between predator guild members. PMID:23264692
Directory of Open Access Journals (Sweden)
G. C. Souza-Pimentel
Full Text Available Abstract Predatory mites that belong to the Phytoseiidae family are one of the main natural enemies of phytophagous mites, thus allowing for their use as a biological control. Phytoseiulus macropilis (Banks, 1904 (Acari: Phytoseiidae is among the main species of predatory mites used for this purpose. Tetranychus urticae Koch, 1836 (Acari: Tetranychidae is considered to be one of the most important species of mite pests and has been described as attacking over 1,100 species of plants in 140 families with economic value. The objective of the present study was to investigate, in the laboratory, the reproductive parameters of the predatory mite P. macropilis when fed T. urticae. Experiments were conducted under laboratory conditions at 25 ± 2 °C of temperature, 70 ± 10% RH and 14 hours of photophase. In addition, biological aspects were evaluated and a fertility life table was established. The results of these experiments demonstrated that the longevity of adult female was 27.5 days and adult male was 29.0 days. The population was estimated to increase approximately 27 times (Ro in mean generation time (T, which was 17.7 days. Lastly, the mite population grew 1.2 times/day (λ and doubled every 3.7 days (TD.
Health effects of predatory beneficial mites and wasps in greenhouses
DEFF Research Database (Denmark)
Bælum, Jesper; Enkegaard, Annie; Doekes, Gert
A three-year study of 579 greenhouse workers in 31 firms investigated the effect of four different beneficial arthropods. It was shown that the thrips mite Amblyseeius cucumeris and the spider mite predator Phytoseiulus persimilis may cause allergy measured by blood tests as well as eye and nose...... symptoms. No effect was seen by the predator wasp Aphidius colemani nor the predator mite Hypoaspis miles and no effect on lung diseases were seen....
Xue, Yingen; Meats, Alan; Beattie, G Andrew C; Spooner-Hart, Robert; Herron, Grant A
2009-08-01
Occasional pesticide application in integrated pest management to at least part of a crop requires that any biological control agents must re-invade previously sprayed areas in order that resurgent pests can be constrained. The ability of the phytoseiid predatory mite Phytoseiulus persimilis to feed on adult two-spotted spider mite (TSSM) Tetranychus urticae on excised leaf discs in both control conditions and in a treatment with a sub lethal residue of agricultural mineral oil (AMO) was assessed. The predator exhibited a Type II functional response with the asymptote significantly higher in the AMO conditions due to the fact that the prey grew slower and reached a smaller size in this treatment. In terms of prey volume eaten, the satiation level of the predator was unchanged by the AMO deposits. The numbers of eggs produced by adult P. persimilis females at densities of 4, 8 and 16 TSSM adult females/disc in the control were significantly higher than those in the AMO treatment, but were similar for the higher density levels, 32 and 64 prey per disc. Thus the functional response in terms of volume of prey eaten explained the numerical response in terms of predator eggs produced. The presence of AMO deposits when the prey were at high density had no effect on predator efficiency (volume eaten) but resulted in a lower intake than that in control conditions when there was a greater distance between prey.
Gorman, Kevin; Hewitt, Fiona; Denholm, Ian; Devine, Gregor J
2002-02-01
A recent survey of insecticide resistance in two of the most problematic pests in UK glasshouses revealed some new developments. At least some individuals in all UK samples of Trialeurodes vaporariorum that were tested resisted the insect growth regulator (IGR) buprofezin. The most strongly resistant strains were unaffected by the field application rate of this compound, and even samples from populations that had never been exposed to buprofezin contained individuals that survived the highest concentration applied (10,000 mg litre-1). The field rate of buprofezin was shown to select for resistance through vapour action alone. The benzophenylurea teflubenzuron, an unrelated IGR, was cross-resisted by buprofezin-resistant individuals. There was no evidence of resistance to imidacloprid, but all T vaporariorum strains tested, regardless of origin, exhibited a high innate tolerance to nicotine, when compared with another whitefly species, Bemisia tabaci. Marked resistance to fenbutatin oxide and tebufenpyrad was found in single glasshouse populations of Tetranychus urticae, but these compounds and abamectin appeared to remain highly effective against all other strains collected.
Zhu, Yu-xi; Yang, Qun-fang; Huang, Yu-bi; Li, Qing
2015-09-01
In the present study, we investigated the systematically induced production of defense-related compounds, including DIMBOA, total phenol, trypsin inhibitors (TI) and chymotrypsin inhibitor (CI), by Tetranychus cinnabarinus infestation in Zea mays. The first leaves of two corn in-bred line seedlings, the mite-tolerant line ' H1014168' and the mite-sensitive line 'H1014591', were sucked by T. cinnabarinus adult female for seven days, and then the contents of DIMBOA, total phenol, TI and CI were measured in the second leaf and in the roots, respectively. Results showed that as compared to the unsucked control, all contents of DIMBOA, total phenol, TI and CI induced by T. cinnabarinus sucking were significantly higher in the second leaf of both inbred lines as well as in the roots of the mite-tolerant 'H1014168'. However, in the roots of 'H1014591', these defense compounds had different trends, where there was a higher induction of TI and a lower level of total phenol than that of the healthy control, while had almost no difference in DIMBOA and CI. These findings suggested that the infestation of T. cinnabarinus could systematically induce accumulation of defense-related compounds, and this effect was stronger in the mite-tolerant inbred line than in the mite-sensitive inbred line.
Bjørnson, S; Keddie, B A
2001-02-01
Isolated colonies of the predatory mite, Phytoseiulus persimilis, were used to gain information regarding prevalence and transmission of Microsporidium phytoseiuli. Two colonies of P. persimilis were reared on spider mite (Tetranychus urticae)-infested bean plants in isolated cages. Disease prevalence of predators from Colony 1 remained relatively low (between 0 and 15%) over 57 weeks of observation whereas disease prevalence of predators from Colony 2 increased over 3 months (from 12 to 100%). Disease prevalence among predators from Colony 1 had increased to 100% 2 months after weekly sampling had ceased for this colony and periodic sampling confirmed that disease prevalence among individuals of both colonies remained at 100%. Microsporidian spores were not detected in randomly chosen samples of T. urticae prey mites that were removed and examined biweekly during this period. Although numerous microsporidian spores were observed in smear preparations of fecal pellets examined by light microscopy, spores were not observed on leaf surfaces or predator feces when examined by SEM. The latter appeared as intact aggregates composed of numerous dumbbell-shaped crystals and it is unlikely that spores are liberated from intact fecal pellets onto leaf surfaces. Vertical transmission of M. phytoseiuli was 100%; horizontal transmission was low (14.3%) and occurred only when immature P. persimilis were permitted to develop in contact with infected immature and adult predators. The mean number of eggs produced per mated pair was highest when uninfected females were mated with uninfected males (63.2 eggs per mated pair). Although mean egg production decreased when one or both parents were infected, not all differences were significant. Male predatory mites did not contribute to infection of their progeny. Results suggest that routine examination of P. persimilis for microsporidian spores is essential for the management of M. phytoseiuli within P. persimilis colonies. Low disease
Coombs, Megan R; Bale, Jeffrey S
2013-04-01
The lower and upper thermal activity thresholds of the predatory mite Phytoseiulus macropilis Banks (Acari: Phytoseiidae) were compared with those of its prey Tetranychus urticae Koch (Acari: Tetranychidae) and one of the alternative commercially available control agents for T. urticae, Phytoseiulus persimilis Athias-Henriot. Adult female P. macropilis retained ambulatory function (CTmin) and movement of appendages (chill coma) at significantly lower temperatures (8.2 and 0.4 °C, respectively) than that of P. persimilis (11.1 and 3.3 °C) and T. urticae (10.6 and 10.3 °C). As the temperature was raised, P. macropilis ceased walking (CTmax) and entered heat coma (42.7 and 43.6 °C), beyond the upper locomotory limits of P. persimilis (40.0 and 41.1 °C), but before T. urticae (47.3 and 48.7 °C). Walking speeds were investigated and P. persimilis was found to have significantly faster ambulation than P. macropilis and T. urticae across a range of temperatures. The lower thermal activity threshold data indicate that P. macropilis will make an effective biological control agent in temperate climates.
Geostatistics as a tool to study mite dispersion in physic nut plantations.
Rosado, J F; Picanço, M C; Sarmento, R A; Pereira, R M; Pedro-Neto, M; Galdino, T V S; de Sousa Saraiva, A; Erasmo, E A L
2015-08-01
Spatial distribution studies in pest management identify the locations where pest attacks on crops are most severe, enabling us to understand and predict the movement of such pests. Studies on the spatial distribution of two mite species, however, are rather scarce. The mites Polyphagotarsonemus latus and Tetranychus bastosi are the major pests affecting physic nut plantations (Jatropha curcas). Therefore, the objective of this study was to measure the spatial distributions of P. latus and T. bastosi in the physic nut plantations. Mite densities were monitored over 2 years in two different plantations. Sample locations were georeferenced. The experimental data were analyzed using geostatistical analyses. The total mite density was found to be higher when only one species was present (T. bastosi). When both the mite species were found in the same plantation, their peak densities occurred at different times. These mites, however, exhibited uniform spatial distribution when found at extreme densities (low or high). However, the mites showed an aggregated distribution in intermediate densities. Mite spatial distribution models were isotropic. Mite colonization commenced at the periphery of the areas under study, whereas the high-density patches extended until they reached 30 m in diameter. This has not been reported for J. curcas plants before.
Directory of Open Access Journals (Sweden)
Audrey Errard
2016-08-01
Full Text Available The spider mite Tetranychus urticae Koch and the aphid Myzus persicae (Sulzer both infest a number of economically significant crops, including tomato (Solanum lycopersicum. Although used for decades to control pests, the impact of green lacewing larvae Chrysoperla carnea (Stephens on plant biochemistry was not investigated. Here we used profiling methods and targeted analyses to explore the impact of the predator and herbivore(s-predator interactions on tomato biochemistry. Each pest and pest-predator combination induced a characteristic metabolite signature in the leaf and the fruit thus, the plant exhibited a systemic response. The treatments had a stronger impact on non-volatile metabolites including abscisic acid and amino acids in the leaves in comparison with the fruits. In contrast, the various biotic factors had a greater impact on the carotenoids in the fruits. We identified volatiles such as myrcene and α-terpinene which were induced by pest-predator interactions but not by single species, and we demonstrated the involvement of the phytohormone abscisic acid in tritrophic interactions for the first time. More importantly, C. carnea larvae alone impacted the plant metabolome, but the predator did not appear to elicit particular defense pathways on its own. Since the presence of both C. carnea larvae and pest individuals elicited volatiles which were shown to contribute to plant defense, C. carnea larvae could therefore contribute to the reduction of pest infestation, not only by its preying activity, but also by priming responses to generalist herbivores such as T. urticae and M. persicae. On the other hand, the use of C. carnea larvae alone did not impact carotenoids thus, was not prejudicial to the fruit quality. The present piece of research highlights the specific impact of predator and tritrophic interactions with green lacewing larvae, spider mites and aphids on different components of the tomato primary and secondary metabolism
Prado, Julia; Quesada, Carlos; Gosney, Michael; Mickelbart, Michael V; Sadof, Clifford
2015-06-01
Although leaf nitrogen (N) has been shown to increase the suitability of hosts to herbivorous arthropods, the responses of these pests to N fertilization on susceptible and resistant host plants are not well characterized. This study determined how different rates of N fertilization affected injury caused by the potato leafhopper (Empoasca fabae Harris) and the abundance of maple spider mite (Oligonychus aceris (Shimer)) on 'Red Sunset' red maple (Acer rubrum) and 'Autumn Blaze' Freeman maple (Acer×freemanii) during two years in Indiana. N fertilization increased leaf N concentration in both maple cultivars, albeit to a lesser extent during the second year of the study. Overall, Red Sunset maples were more susceptible to E. fabae injury than Autumn Blaze, whereas Autumn Blaze maples supported higher populations of O. aceris. Differences in populations of O. aceris were attributed to differences between communities of stigmaeid and phytoseiid mites on each cultivar. Injury caused by E. fabae increased with N fertilization in a dose-dependent manner in both cultivars. Although N fertilization increased the abundance of O. aceris on both maple cultivars, there was no difference between the 20 and 40 g rates. We suggest the capacity of N fertilization to increase O. aceris on maples could be limited at higher trophic levels by the community of predatory mites. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Ozana M. de A. Maia
2006-09-01
Full Text Available A ocorrência de três espécies acarinas fitófagas é relatada pela primeira vez sobre folhas de Ipomoea cairica. As espécies Brevipalpus phoenicis (Geijskes, Tetranychus urticae (Koch e Polyphagotarsonemus latus (Banks, foram coletadas sobre folhas de I. cairica nas imediações da Universidade Federal do Paraná, Curitiba, Paraná, Brasil, em 20 de janeiro de 2005.The first occurrence of three phytophagus mites on Ipomoea cairica, is reported. The species Brevipalpus phoenicis (Geijskes, Tetranychus urticae (Koch and Polyphagotarsonemus latus (Banks were caught on leaves of I. cairica, around Universidade Federal do Paraná, Curitiba, Paraná, Brazil, in January 20th, 2005.
Sudo, M; Osakabe, M
2015-12-01
Seasonal population dynamics of an herbivorous mite has been documented in terms of the relationship between thermoresponses and temporal biological factors such as resource availability or predation risk. Although recent studies emphasize the deleterious effects of solar ultraviolet-B (UVB; 280-320 nm wavelengths) radiation on plant-dwelling mites, how UVB affects mite population remains largely unknown. On a wild shrub Viburnum erosum var. punctatum in Kyoto, an herbivorous false spider mite, Brevipalpus obovatus Donnadieu, occurs only in autumn. Females of this species lay one-third of their eggs on upper leaf surfaces. Oviposition on upper surfaces is beneficial for avoiding predation by phytoseiids, but exposes eggs to solar UVB and heat stress. To test the hypothesis that the seasonal occurrence of this mite is determined by interactions between solar UVB radiation and temperature, we examined variation in egg hatching success under near-ambient and UV-attenuated sunlight conditions from spring to autumn. The UV-attenuation significantly improved hatching success. However, most eggs died under heat stress regardless of UV treatments in July and August. We established a deterministic heat stress-cumulative UVB dose-egg hatching success response model, which we applied to meteorological data. The model analyses illustrated lower and higher survivability peaks in late May and October, respectively, which partly corresponded to data for annual field occurrence, indicating the importance of solar UVB radiation and heat stress as determinants of the seasonal occurrence of this mite. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Hernández, M M; Martínez-Villar, E; Peace, C; Pérez-Moreno, I; Marco, V
2012-12-01
Laboratory studies were developed to evaluate the compatibility of flufenoxuron and azadirachtin with Beauveria bassiana against Tetranychus urticae larvae along with the required Probit analysis of the involved chemicals on all of the life stages of this mite. Flufenoxuron displayed parallel regression lines for the mortality of eggs, deutonymphs and adults. Larvae and protonymphs were the most susceptible life stages. Protonymphs were 35 times more sensitive than eggs and adults. Azadirachtin gave equal mortality on proto- and deutonymphs. The response of eggs and adults was equivalent when treated with azadirachtin. The regression lines for proto- and deutonymphs were parallel to those of adults and eggs yet three times more sensitive. The effects of separate combinations of the entomopathogenic fungus Beauveria bassiana at its LC(20) with flufenoxuron and azadirachtin at their corresponding LC(40) were evaluated on mite larvae. The application of flufenoxuron with B. bassiana revealed a clear synergy. While the combination of azadirachtin and B. bassiana had an additive effect. These combinations with B. bassiana could improve mite control by contributing to a decline in the likelihood of resistance so often described in the literature.
He, Jiangtao; Zhou, Lijuan; Yao, Qiang; Liu, Bo; Xu, Hanhong; Huang, Jiguang
2018-01-01
The two-spotted spider mite, Tetranychus urticae Koch is an important pest of cotton. We investigated the efficacy of dimethoate in controlling T. urticae by drip irrigation. Greenhouse and field experiments were carried out to determine the efficacy of dimethoate to T. urticae and the absorption and distribution of dimethoate in cotton. Greenhouse results showed that cotton leaves received higher amounts of dimethoate compared with cotton roots and stems, with higher amounts in young leaves compared with old leaves and cotyledon having the lowest amounts among leaves. Field results showed the efficacy of dimethoate to T. urticae by drip irrigation varied by volume of dripping water, soil pH and dimethoate dosage. Dimethoate applied at 3.00 kg ha -1 with 200 m 3 ha -1 water at weak acidic soil pH (5.70-6.70) through drip irrigation can obtain satisfactory control efficacy (81.49%, 7 days) to T. urticae, without negatively impacting on its natural enemy Neoseiulus cucumeris. The residue of dimethoate in all cotton seed samples were not detectable. These results demonstrate the effectiveness of applying dimethoate by drip irrigation for control of T. urticae on cotton. This knowledge could aid in the applicability of dimethoate by drip irrigation for field management of T. urticae populations. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Sampling plans for pest mites on physic nut.
Rosado, Jander F; Sarmento, Renato A; Pedro-Neto, Marçal; Galdino, Tarcísio V S; Marques, Renata V; Erasmo, Eduardo A L; Picanço, Marcelo C
2014-08-01
The starting point for generating a pest control decision-making system is a conventional sampling plan. Because the mites Polyphagotarsonemus latus and Tetranychus bastosi are among the most important pests of the physic nut (Jatropha curcas), in the present study, we aimed to establish sampling plans for these mite species on physic nut. Mite densities were monitored in 12 physic nut crops. Based on the obtained results, sampling of P. latus and T. bastosi should be performed by assessing the number of mites per cm(2) in 160 samples using a handheld 20× magnifying glass. The optimal sampling region for T. bastosi is the abaxial surface of the 4th most apical leaf on the branch of the middle third of the canopy. On the abaxial surface, T. bastosi should then be observed on the side parts of the middle portion of the leaf, near its edge. As for P. latus, the optimal sampling region is the abaxial surface of the 4th most apical leaf on the branch of the apical third of the canopy on the abaxial surface. Polyphagotarsonemus latus should then be assessed on the side parts of the leaf's petiole insertion. Each sampling procedure requires 4 h and costs US$ 7.31.
Directory of Open Access Journals (Sweden)
Radmila Petanović
2010-01-01
Full Text Available In the middle of the last century, mites moved into the focus of attention as pests relevantto agriculture, forestry and landscape horticulture, presumably in direct reactionto the “green revolution” that involved plant cultivation in large-plot monocropping systems,improved methods of cultivation, selection of high-yielding cultivars and intensifieduse of pesticides and mineral fertilizers. Agroecosystems in which phytophagous miteshave become harmful organisms are primarily orchards, vineyards, greenhouses, urbangreeneries, plant nurseries and stored plant products, as well as annual field crops to asomewhat lesser degree. Phytophagous mite species belong to a variety of spider mites(Tetranychidae, false spider mites (Tenuipalpidae, gall and rust mites (Eriophyoidae, tarsonemidmites (Tarsonemidae and acarid mites (Acaridae. Most of these harmful speciesare widespread, some of them having more economic impact than others and being moredetrimental as depending on various specificities of each outdoor agroecosystem in anyparticular climatic region.The first segment of this overview focuses on the most significant mite pests ofagroecosystemsand urban horticultural areas in European countries, our own region andin Serbia today, primarily on species that have caused problems in recent years regardingplant production, and it also discusses various molecular methods available for investigatingdifferent aspects of the biology of phytophagous mites. Also, acaricides are discussedas a method of controlling mite pests in the light of the current situation and trends on pesticidemarkets in Serbia and the European Union member-countries
Mites fluctuation population on peach tree (Prunus persica (L. Batsch and in associated plants
Directory of Open Access Journals (Sweden)
Carla Rosana Eichelberger
2011-09-01
Full Text Available Despite the importance of peach (Prunus persica (L. Batsch in Rio Grande do Sul, little is known about mites fluctuation population considered important to this crop. The objective of this study was to know the population diversity and fluctuation of mite species associated with Premier and Eldorado varieties in Roca Sales and Venâncio Aires counties, Rio Grande do Sul. The study was conducted from July 2008 to June 2009 when 15 plants were randomly chosen in each area. The plants were divided in quadrants and from each one a branch was chosen from which three leaves were removed: one collected in the apical region, another in the medium and the other in the basal region, totalizing 180 leaves/area. Five of the most abundant associated plants were collected monthly in enough amounts for the screening under the stereoscopic microscope during an hour. A total of 1,124 mites were found belonging to 14 families and 28 species. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 and Mononychellus planki (McGregor, 1950 were the most abundant phytophagous mites, whereas Typhlodromalus aripo Deleon, 1967 and Phytoseiulus macropilis (Banks, 1904 the most common predatory mites. The period of one hour under stereoscopic microscope was enough to get a representative sample. In both places evaluated the ecologic indices were low, but little higherin Premier (H' 0.56; EqJ: 0.43 when compared to Eldorado (H' 0.53; EqJ 0.40. In Premier constant species were not observed and accessory only Brevipalpus phoenicis (Geijskes, 1939, T. ludeni and T. aripo. Higher abundance was observed in December and January and bigger amount in April. Already in Eldorado, T. ludeni and P. ulmi were constants. Greater abundance was observed in November and December, whereas grater richness in December and January. In both orchards were not found mites in buds. Tetranychus ludeni is the most abundant phytophagous mites with outbreak population in November, December and
Methyl salicylate production in tomato affects biotic interactions.
Ament, Kai; Krasikov, Vladimir; Allmann, Silke; Rep, Martijn; Takken, Frank L W; Schuurink, Robert C
2010-04-01
The role of methyl salicylate (MeSA) production was studied in indirect and direct defence responses of tomato (Solanum lycopersicum) to the spider mite Tetranychus urticae and the root-invading fungus Fusarium oxysporum f. sp. lycopersici, respectively. To this end, we silenced the tomato gene encoding salicylic acid methyl transferase (SAMT). Silencing of SAMT led to a major reduction in SAMT expression and MeSA emission upon herbivory by spider mites, without affecting the induced emission of other volatiles (terpenoids). The predatory mite Phytoseiulus persimilis, which preys on T. urticae, could not discriminate between infested and non-infested SAMT-silenced lines, as it could for wild-type tomato plants. Moreover, when given the choice between infested SAMT-silenced and infested wild-type plants, they preferred the latter. These findings are supportive of a major role for MeSA in this indirect defence response of tomato. SAMT-silenced tomato plants were less susceptible to a virulent strain of F. oxysporum f. sp. lycopersici, indicating that the direct defense responses in the roots are also affected in these plants. Our studies show that the conversion of SA to MeSA can affect both direct and indirect plant defence responses.
Walzer, Andreas; Schausberger, Peter
2011-03-01
We studied developmental plasticity under food stress in three female-biased size dimorphic predatory mite species, Phytoseiulus persimilis, Neoseiulus californicus, and Amblyseius andersoni. All three species prey on two-spotted spider mites but differ in the degree of adaptation to this prey. Phytoseiulus persimilis is a specialized spider mite predator, N. californicus is a generalist with a preference for spider mites, and A. andersoni is a broad generalist. Immature predators were offered prey patches of varying density and their survival chances, dispersal tendencies, age and size at maturity measured. Amblyseius andersoni dispersed earlier from and had lower survival chances in low density prey patches than N. californicus and P. persimilis. Age at maturity was not affected by prey density in the generalist A. andersoni, whereas both the specialist P. persimilis and the generalist N. californicus accelerated development at low prey densities. Species-specific plasticity in age at maturity reflects opposite survival strategies when confronted with limited prey: to prematurely leave and search for other food (A. andersoni) or to stay and accelerate development (P. persimilis, N. californicus). In all species, size at maturity was more plastic in females than males, indicating that males incur higher fitness costs from deviations from optimal body size.
Biological control of fruit-tree red spider mite
Rabbinge, R.
1976-01-01
During the last decade, integrated pest control systems have been developed for several crops. One of the main fields of research in integrated control has been the control of orchard pests. Experience with modified spraying programmes in apple orchards, the increasing resistance of spiderMuleta, Muluken G; Schausberger, Peter
2013-09-01
Group-living animals frequently have to trade off the costs and benefits of leaving an established group and joining another group. Owing to their high fitness relevance, group-joining decisions are commonly nonrandom and may be based on traits of both individual members and the group such as life stage, body size, social status and group density or size, respectively. Many group-living animals are able to recognize and to associate preferentially with familiar individuals, i.e. those encountered before. Hence, after dispersing from established groups, animals commonly have to decide whether to join a new familiar or unfamiliar group. Using binary choice situations we assessed the effects of social familiarity on group-joining behaviour of the plant-inhabiting predatory mite Phytoseiulus persimilis . Group living in P. persimilis is brought about by the patchy distribution of its spider mite prey and mutual conspecific attraction. In the first experiment, gravid predator females given a choice between spider mite patches occupied by unfamiliar and familiar groups of females strongly preferred to join familiar groups and to deposit their eggs in these patches. Preference for socially familiar groups was robust across biases of spider mite prey densities between choice options. The second experiment revealed that the predatory mite females can smell social familiarity from a distance. Females subjected to odour choice situations in artificial cages were more strongly attracted to the odour of familiar than unfamiliar groups. We argue that P. persimilis females preferentially join socially familiar groups because a familiar social environment relaxes competition and optimizes foraging and reproduction.
Muleta, Muluken G.; Schausberger, Peter
2013-01-01
Group-living animals frequently have to trade off the costs and benefits of leaving an established group and joining another group. Owing to their high fitness relevance, group-joining decisions are commonly nonrandom and may be based on traits of both individual members and the group such as life stage, body size, social status and group density or size, respectively. Many group-living animals are able to recognize and to associate preferentially with familiar individuals, i.e. those encountered before. Hence, after dispersing from established groups, animals commonly have to decide whether to join a new familiar or unfamiliar group. Using binary choice situations we assessed the effects of social familiarity on group-joining behaviour of the plant-inhabiting predatory mite Phytoseiulus persimilis. Group living in P. persimilis is brought about by the patchy distribution of its spider mite prey and mutual conspecific attraction. In the first experiment, gravid predator females given a choice between spider mite patches occupied by unfamiliar and familiar groups of females strongly preferred to join familiar groups and to deposit their eggs in these patches. Preference for socially familiar groups was robust across biases of spider mite prey densities between choice options. The second experiment revealed that the predatory mite females can smell social familiarity from a distance. Females subjected to odour choice situations in artificial cages were more strongly attracted to the odour of familiar than unfamiliar groups. We argue that P. persimilis females preferentially join socially familiar groups because a familiar social environment relaxes competition and optimizes foraging and reproduction. PMID:24027341
Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.
Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris
2015-08-01
An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.
International Nuclear Information System (INIS)
Doan Thi The; Nguyen Thi Ly; Vo Thi Kim Lang; Cao Van Chung
2016-01-01
Utilization of phytosanitary irradiation as a potential treatment to disinfest agricultural commodities in trade has expanded rapidly in the recent years. In this study, red mites (Tetranychus sp) isolated from cut Chrysanthemums were treated by electron beam irradiation at doses of 100, 200, 300 and 400 Gy. After irradiation, they were kept at room temperature to determine the effects of electron beam irradiation on red mite at different developmental stages (eggs, nymphs and adults) and the reproduction of female adults. The results showed that the pattern of tolerance to irradiation in red mite was eggs < 2nd instars < adults, in which the adults were the most tolerance stage. The number of eggs laid by the irradiated female mites and the hatching rate significantly decreased when the irradiation dose increased. The hatching rate of eggs at 300 Gy was 4.25% and no larvae F_1 survived during observation time. It could be concluded that 300 Gy is the effective quarantine dose for red mite infesting on cut chrysanthemums. (author)
Disentangling mite predator-prey relationships by multiplex PCR.
Pérez-Sayas, Consuelo; Pina, Tatiana; Gómez-Martínez, María A; Camañes, Gemma; Ibáñez-Gual, María V; Jaques, Josep A; Hurtado, Mónica A
2015-11-01
Gut content analysis using molecular techniques can help elucidate predator-prey relationships in situations in which other methodologies are not feasible, such as in the case of trophic interactions between minute species such as mites. We designed species-specific primers for a mite community occurring in Spanish citrus orchards comprising two herbivores, the Tetranychidae Tetranychus urticae and Panonychus citri, and six predatory mites belonging to the Phytoseiidae family; these predatory mites are considered to be these herbivores' main biological control agents. These primers were successfully multiplexed in a single PCR to test the range of predators feeding on each of the two prey species. We estimated prey DNA detectability success over time (DS50), which depended on the predator-prey combination and ranged from 0.2 to 18 h. These values were further used to weight prey detection in field samples to disentangle the predatory role played by the most abundant predators (i.e. Euseius stipulatus and Phytoseiulus persimilis). The corrected predation value for E. stipulatus was significantly higher than for P. persimilis. However, because this 1.5-fold difference was less than that observed regarding their sevenfold difference in abundance, we conclude that P. persimilis is the most effective predator in the system; it preyed on tetranychids almost five times more frequently than E. stipulatus did. The present results demonstrate that molecular tools are appropriate to unravel predator-prey interactions in tiny species such as mites, which include important agricultural pests and their predators. © 2015 John Wiley & Sons Ltd.
Hordijk, Cornelis A.; Posthumus, Maarten A.; Dicke, Marcel
2008-01-01
It is well established that plants infested with a single herbivore species can attract specific natural enemies through the emission of herbivore-induced volatiles. However, it is less clear what happens when plants are simultaneously attacked by more than one species. We analyzed volatile emissions of lima bean and cucumber plants upon multi-species herbivory by spider mites (Tetranychus urticae) and caterpillars (Spodoptera exigua) in comparison to single-species herbivory. Upon herbivory by single or multiple species, lima bean and cucumber plants emitted volatile blends that comprised mostly the same compounds. To detect additive, synergistic, or antagonistic effects, we compared the multi-species herbivory volatile blend with the sum of the volatile blends induced by each of the herbivore species feeding alone. In lima bean, the majority of compounds were more strongly induced by multi-species herbivory than expected based on the sum of volatile emissions by each of the herbivores separately, potentially caused by synergistic effects. In contrast, in cucumber, two compounds were suppressed by multi-species herbivory, suggesting the potential for antagonistic effects. We also studied the behavioral responses of the predatory mite Phytoseiulus persimilis, a specialized natural enemy of spider mites. Olfactometer experiments showed that P. persimilis preferred volatiles induced by multi-species herbivory to volatiles induced by S. exigua alone or by prey mites alone. We conclude that both lima bean and cucumber plants effectively attract predatory mites upon multi-species herbivory, but the underlying mechanisms appear different between these species. PMID:18185960
Zhang, Xiaona; Jin, Daochao; Zou, Xiao; Guo, Jianjun
2016-05-01
The two-spotted mite, Tetranychus urticae Koch, is one of the most serious mite pests of crops throughout the world. Biocontrol of the mite with fungal agents has long been paid much attention because of the development of insecticide resistance and the severe restriction of chemical pesticides. In this study, the efficacy of submerged conidia of the entomopathogenic fungus Isaria cateniannulata strain 08XS-1 against T. urticae eggs, larvae and female adults was evaluated at different temperatures and humidity in the laboratory and under field conditions. The results showed that a suspension of 2 × 10(7) submerged conidia mL(-1) caused the highest mortalities of mite eggs, larvae and females (100, 100 and 70% respectively) at 100% relative humidity and 25 °C in the laboratory. In the field experiments against the mites, a suspension of 2 × 10(8) submerged conidia mL(-1) achieved significant efficiency - the relative control effects were 88.6, 83.8 and 83%, respectively, in cucumber, eggplant and bean fields after 10 days of treatment. The results suggest that the I. cateniannulata strain 08XS-1 is a potential fungal agent, with acceptable production cost of conidia, against T. urticae in the field in an area such as southwestern China with higher air humidity. © 2016 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry.
Selenium hyperaccumulation offers protection from cell disruptor herbivores
Directory of Open Access Journals (Sweden)
Quinn Colin F
2010-08-01
Full Text Available Abstract Background Hyperaccumulation, the rare capacity of certain plant species to accumulate toxic trace elements to levels several orders of magnitude higher than other species growing on the same site, is thought to be an elemental defense mechanism against herbivores and pathogens. Previous research has shown that selenium (Se hyperaccumulation protects plants from a variety of herbivores and pathogens. Selenium hyperaccumulating plants sequester Se in discrete locations in the leaf periphery, making them potentially more susceptible to some herbivore feeding modes than others. In this study we investigate the protective function of Se in the Se hyperaccumulators Stanleya pinnata and Astragalus bisulcatus against two cell disrupting herbivores, the western flower thrips (Frankliniella occidentalis and the two-spotted spider mite (Tetranychus urticae. Results Astragalus bisulcatus and S. pinnata with high Se concentrations (greater than 650 mg Se kg-1 were less subject to thrips herbivory than plants with low Se levels (less than 150 mg Se kg-1. Furthermore, in plants containing elevated Se levels, leaves with higher concentrations of Se suffered less herbivory than leaves with less Se. Spider mites also preferred to feed on low-Se A. bisulcatus and S. pinnata plants rather than high-Se plants. Spider mite populations on A. bisulcatus decreased after plants were given a higher concentration of Se. Interestingly, spider mites could colonize A. bisulcatus plants containing up to 200 mg Se kg-1 dry weight, concentrations which are toxic to many other herbivores. Selenium distribution and speciation studies using micro-focused X-ray fluorescence (μXRF mapping and Se K-edge X-ray absorption spectroscopy revealed that the spider mites accumulated primarily methylselenocysteine, the relatively non-toxic form of Se that is also the predominant form of Se in hyperaccumulators. Conclusions This is the first reported study investigating the
Shimoda, Takeshi; Nishihara, Masahiro; Ozawa, Rika; Takabayashi, Junji; Arimura, Gen-ichiro
2012-03-01
Plants under herbivore attack emit mixtures of volatiles (herbivore-induced plant volatiles, HIPVs) that can attract predators of the herbivores. Although the composition of HIPVs should be critical for the attraction, most studies of transgenic plant-emitted volatiles have simply addressed the effect of trans-volatiles without embedding in other endogenous plant volatiles. We investigated the abilities of transgenic wishbone flower plants (Torenia hybrida and Torenia fournieri) infested with spider mites, emitting a trans-volatile ((E)-β-ocimene) in the presence or absence of endogenous volatiles (natural HIPVs and/or floral volatiles), to attract predatory mites (Phytoseiulus persimilis). In both olfactory- and glasshouse-based assays, P. persimilis females were attracted to natural HIPVs from infested wildtype (wt) plants of T. hybrida but not to those of T. fournieri. The trans-volatile enhanced the ability to attract P. persimilis only when added to an active HIPV blend from the infested transgenic T. hybrida plants, in comparison with the attraction by infested wt plants. Intriguingly, floral volatiles abolished the enhanced attractive ability of T. hybrida transformants, although floral volatiles themselves did not elicit any attraction or avoidance behavior. Predator responses to trans-volatiles were found to depend on various background volatiles (e.g. natural HIPVs and floral volatiles) endogenously emitted by the transgenic plants. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.
Schausberger, Peter; Davaasambuu, Undarmaa; Saussure, Stéphanie; Christiansen, Inga C
2018-04-01
Behavioural plasticity can be categorized into activational (also termed contextual) and developmental plasticity. Activational plasticity allows immediate contextual behavioural changes, whereas developmental plasticity is characterized by time-lagged changes based on memory of previous experiences (learning). Behavioural plasticity tends to decline with age but whether this holds true for both plasticity categories and the effects of first-in-life experiences is poorly understood. We tackled this issue by assessing the foraging plasticity of plant-inhabiting predatory mites, Amblyseius swirskii , on thrips and spider mites following age-dependent prey experience, i.e. after hatching or after reaching maturity. Juvenile and young adult predator females were alternately presented thrips and spider mites, for establishing 1st and 2nd prey-in-life experiences, and tested, as gravid females, for their foraging plasticity when offered both prey species. Prey experience by juvenile predators resulted in clear learning effects, which were evident in likelier and earlier attacks on familiar prey, and higher proportional inclusion of familiar prey in total diet. First prey-in-life experience by juvenile but not adult predators resulted in primacy effects regarding attack latency. Prey experience by adult predators resulted mainly in prey-unspecific physiological changes, with easy-to-grasp spider mites providing higher net energy gains than difficult-to-grasp thrips. Prey experience by juvenile, but not adult, predators was adaptive, which was evident in a negative correlation between attack latencies and egg production. Overall, our study provides key evidence that similar experiences by juvenile and adult predators, including first-in-life experiences, may be associated with different types of behavioural plasticity, i.e. developmental and activational plasticity.
Davaasambuu, Undarmaa; Saussure, Stéphanie; Christiansen, Inga C.
2018-01-01
Behavioural plasticity can be categorized into activational (also termed contextual) and developmental plasticity. Activational plasticity allows immediate contextual behavioural changes, whereas developmental plasticity is characterized by time-lagged changes based on memory of previous experiences (learning). Behavioural plasticity tends to decline with age but whether this holds true for both plasticity categories and the effects of first-in-life experiences is poorly understood. We tackled this issue by assessing the foraging plasticity of plant-inhabiting predatory mites, Amblyseius swirskii, on thrips and spider mites following age-dependent prey experience, i.e. after hatching or after reaching maturity. Juvenile and young adult predator females were alternately presented thrips and spider mites, for establishing 1st and 2nd prey-in-life experiences, and tested, as gravid females, for their foraging plasticity when offered both prey species. Prey experience by juvenile predators resulted in clear learning effects, which were evident in likelier and earlier attacks on familiar prey, and higher proportional inclusion of familiar prey in total diet. First prey-in-life experience by juvenile but not adult predators resulted in primacy effects regarding attack latency. Prey experience by adult predators resulted mainly in prey-unspecific physiological changes, with easy-to-grasp spider mites providing higher net energy gains than difficult-to-grasp thrips. Prey experience by juvenile, but not adult, predators was adaptive, which was evident in a negative correlation between attack latencies and egg production. Overall, our study provides key evidence that similar experiences by juvenile and adult predators, including first-in-life experiences, may be associated with different types of behavioural plasticity, i.e. developmental and activational plasticity. PMID:29765663
Variation in nesting behavior of eight species of spider mites, Stigmaeopsis having sociality
Saito, Yutaka; Zhang, Yan-Xuan; Mori, Kotaro; Ito, Katsura; Sato, Yukie; Chittenden, Anthony R.; Lin, Jian-Zhen; Chae, Younghae; Sakagami, Takane; Sahara, Ken
2016-10-01
Nesting behavior is considered to be an important element of social living in animals. The spider mites belonging to the genus Stigmaeopsis spend their lives within nests produced from silk threads. Several of these species show cooperative sociality, while the others are subsocial. In order to identify the origins of this social behavior, comparisons of nest sizes, nesting behaviors (making nests continuously or separately), and their associated traits (fecal deposition patterns) were made for eight cogeneric Stigmaeopsis species showing various levels of social development. All of these species inhabit bamboo plants (Poaceae). We initially addressed the proximate factor of nest size variation. The variation in nest size of the eight species corresponded well with the variation in dorsal seta sc1 length, suggesting that nest size variation among species may have a genetic basis. The time spent within a nest (nest duration) increased with nest size on the respective host plants. Nest arrangement patterns varied among species showing different sized nests: Large nest builders continuously extended their nests, while middle and small nest-building species built new separate nests, which resulted in different social interaction times among species, and is thought to be closely related to social development. Fecal deposition behaviors also varied among Stigmaeopsis species, suggesting diversity in anti-predatory adaptations. Finally, we discuss how the variation in sociality observed within this genus is likely the result of nest size variation that initially evolved as anti-predator strategies.
Aratchige, N S; Lesna, I; Sabelis, M W
2004-01-01
Although odour-mediated interactions among plants, spider mites and predatory mites have been extensively studied above-ground, belowground studies are in their infancy. In this paper, we investigate whether feeding by rust mites (Aceria tulipae) cause tulip bulbs to produce odours that attract predatory mites (Neoseiulus cucumeris). Since our aim was to demonstrate such odours and not their relevance under soil conditions, the experiments were carried out using a classic Y-tube olfactometer in which the predators moved on a Y-shaped wire in open air. We found that food-deprived female predators can discriminate between odours from infested bulbs and odours from uninfested bulbs or artificially wounded bulbs. No significant difference in attractiveness to predators was found between clean bulbs and bulbs either wounded 30 min or 3 h before the experiment. These results indicate that it may not be simply the wounding of the bulbs, but rather the feeding by rust mites, which causes the bulb to release odours that attract N. cucumeris. Since bulbs are belowground plant structures, the olfactometer results demonstrate the potential for odour-mediated interactions in the soil. However, their importance in the actual soil medium remains to be demonstrated.
Directory of Open Access Journals (Sweden)
M. Estrella Santamaria
2018-03-01
Full Text Available Cystatins have been largely used for pest control against phytophagous species. However, cystatins have not been commonly overexpressed in its cognate plant species to test their pesticide capacity. Since the inhibitory role of barley HvCPI-6 cystatin against the phytophagous mite Tetranychus urticae has been previously demonstrated, the purpose of our study was to determine if barley transgenic lines overexpressing its own HvIcy6 gene were more resistant against this phytophagous infestation. Besides, a transcriptomic analysis was done to find differential expressed genes among wild-type and transformed barley plants. Barley plants overexpressing HvIcy6 cystatin gene remained less susceptible to T. urticae attack when compared to wild-type plants, with a significant lesser foliar damaged area and a lower presence of the mite. Transcriptomic analysis revealed a certain reprogramming of cellular metabolism and a lower expression of several genes related to photosynthetic activity. Therefore, although caution should be taken to discard potential deleterious pleiotropic effects, cystatins may be used as transgenes with impact on agricultural crops by conferring enhanced levels of resistance to phytophagous pests.
Alzate, A; Bisschop, K; Etienne, R S; Bonte, D
2017-11-01
Dispersal and competition have both been suggested to drive variation in adaptability to a new environment, either positively or negatively. A simultaneous experimental test of both mechanisms is however lacking. Here, we experimentally investigate how population dynamics and local adaptation to a new host plant in a model species, the two-spotted spider mite (Tetranychus urticae), are affected by dispersal from a stock population (no-adapted) and competition with an already adapted spider mite species (Tetranychus evansi). For the population dynamics, we find that competition generally reduces population size and increases the risk of population extinction. However, these negative effects are counteracted by dispersal. For local adaptation, the roles of competition and dispersal are reversed. Without competition, dispersal exerts a negative effect on adaptation (measured as fecundity) to a novel host and females receiving the highest number of immigrants performed similarly to the stock population females. By contrast, with competition, adding more immigrants did not result in a lower fecundity. Females from populations with competition receiving the highest number of immigrants had a significantly higher fecundity than females from populations without competition (same dispersal treatment) and than the stock population females. We suggest that by exerting a stronger selection on the adapting populations, competition can counteract the migration load effect of dispersal. Interestingly, adaptation to the new host does not significantly reduce performance on the ancestral host, regardless of dispersal rate or competition. Our results highlight that assessments of how species can adapt to changing conditions need to jointly consider connectivity and the community context. © 2017 The Authors. Journal of Evolutionary Biology Published by John Wiley & Sons ltd on Behalf of European Society for Evolutionary Biology.
Directory of Open Access Journals (Sweden)
Tomoko Matsuda
Full Text Available The spider mite sub-family Tetranychinae includes many agricultural pests. The internal transcribed spacer (ITS region of nuclear ribosomal RNA genes and the cytochrome c oxidase subunit I (COI gene of mitochondrial DNA have been used for species identification and phylogenetic reconstruction within the sub-family Tetranychinae, although they have not always been successful. The 18S and 28S rRNA genes should be more suitable for resolving higher levels of phylogeny, such as tribes or genera of Tetranychinae because these genes evolve more slowly and are made up of conserved regions and divergent domains. Therefore, we used both the 18S (1,825-1,901 bp and 28S (the 5' end of 646-743 bp rRNA genes to infer phylogenetic relationships within the sub-family Tetranychinae with a focus on the tribe Tetranychini. Then, we compared the phylogenetic tree of the 18S and 28S genes with that of the mitochondrial COI gene (618 bp. As observed in previous studies, our phylogeny based on the COI gene was not resolved because of the low bootstrap values for most nodes of the tree. On the other hand, our phylogenetic tree of the 18S and 28S genes revealed several well-supported clades within the sub-family Tetranychinae. The 18S and 28S phylogenetic trees suggest that the tribes Bryobiini, Petrobiini and Eurytetranychini are monophyletic and that the tribe Tetranychini is polyphyletic. At the genus level, six genera for which more than two species were sampled appear to be monophyletic, while four genera (Oligonychus, Tetranychus, Schizotetranychus and Eotetranychus appear to be polyphyletic. The topology presented here does not fully agree with the current morphology-based taxonomy, so that the diagnostic morphological characters of Tetranychinae need to be reconsidered.
Directory of Open Access Journals (Sweden)
Lino Bittencourt Monteiro
2006-12-01
Full Text Available O ácaro-vermelho da macieira, Panonychus ulmi (Acari: Tetranychidae, é uma importante praga na cultura da macieira em Fraiburgo - SC, e o controle biológico aplicado foi implantado em meados dos anos 90. O objetivo deste trabalho foi demonstrar os benefícios econômicos da utilização do controle biológico no manejo do ácaro-vermelho. A avaliação foi realizada em dois pomares comerciais de macieiras. Em um deles, foi implantado o controle biológico aplicado de ácaros, baseado na liberação do ácaro predador Neoseiulus californicus (Acari: Phytoseiidae, seleção de inseticidas e manejo de ervas invasoras, e o outro pomar seguiu o manejo convencional de artrópodes, baseado na aplicação de produtos químicos para o controle de insetos, ácaros fitófagos e ervas invasoras. A análise econômica mostrou que os custos com mão-de-obra e máquinas foram semelhantes em ambos os pomares, entretanto os custos com acaricidas foram significativamente inferiores no pomar onde o manejo foi o controle biológico, demonstrando que, apesar da necessidade de investimentos em instalações para a criação do ácaro predador e custos de manutenção das mesmas, a estratégia biológica foi economicamente viável.Red spider mite, Panonychus ulmi (Acari: Tetranychidae is a significant pest in apple tree in Fraiburgo, Santa Catarina (SC and applied biological control was implemented in the mid-nineties. The objective of this study was to demonstrate the economic benefits of biological control in the management of red spider mite. The assessment was carried out in two commercial orchards, one of which was subjected to biological control of spider mite by releasing the predator Neoseiulus californicus, insecticide selection and weed management, and the other to conventional arthropod management, based on the application of chemicals to control insects, phytofagous mites and weed. Economic analysis showed that the costs for labor and machines were
Cakmak, Ibrahim; Janssen, Arne; Sabelis, Maurice W
2006-01-01
Species at the same trophic level may interact through competition for food, but can also interact through intraguild predation. Intraguild predation is widespread at the second and third trophic level and the effects may cascade down to the plant level. The effects of intraguild predation can be modified by antipredator behaviour in the intraguild prey. We studied intraguild predation and antipredator behaviour in two species of predatory mite, Neoseiulus californicus and Phytoseiulus persimilis, which are both used for control of the two-spotted spider mite in greenhouse and outdoor crops. Using a Y-tube olfactometer, we assessed in particular whether each of the two predators avoids odours emanating from prey patches occupied by the heterospecific predator. Furthermore, we measured the occurrence and rate of intraguild predation of different developmental stages of P. persimilis and N. californicus on bean leaves in absence or in presence of the shared prey. Neither of the two predator species avoided prey patches with the heterospecific competitor, both when inexperienced with the other predator and when experienced with prey patches occupied by the heterospecific predator. Intraguild experiments showed that N. californicus is a potential intraguild predator of P. persimilis. However, P. persimilis did not suffer much from intraguild predation as long as the shared prey was present. This is probably because N. californicus prefers to feed on two-spotted spider mites rather than on its intraguild prey.
Morphology of the olfactory system in the predatory mite Phytoseiulus persimilis.
van Wijk, Michiel; Wadman, Wytse J; Sabelis, Maurice W
2006-01-01
The predatory mite Phytoseiulus persimilis locates its prey, the two-spotted spider mite, by means of herbivore-induced plant volatiles. The olfactory response to this quantitatively and qualitatively variable source of information is particularly well documented. The mites perform this task with a peripheral olfactory system that consists of just five putative olfactory sensilla that reside in a dorsal field at the tip of their first pair of legs. The receptor cells innervate a glomerular olfactory lobe just ventral of the first pedal ganglion. We have made a 3D reconstruction of the caudal half of the olfactory lobe in adult females. The glomerular organization as well as the glomerular innervation appears conserved across different individuals. The adult females have, by approximation, a 1:1 ratio of olfactory receptor cells to olfactory glomeruli.
De Boer, Jetske G; Dicke, Marcel
2004-02-01
Many carnivorous arthropods use herbivore-induced plant volatiles to locate their prey. These plant volatiles are blends of up to hundreds of compounds. It is often unknown which compounds in such a complex volatile blend represent the signal to the foraging carnivore. We studied the role of methyl salicylate (MeSA) as part of the volatile blend in the foraging behavior of the predatory mite Phytoseiulus persimilis by using a Y-tube olfactometer. MeSA is one of the compounds released by lima bean, infested with Tetranychus urticae--a prey species of the predatory mite. MeSA attracted satiated predatory mites in a dose-dependent way with optimum attraction at a dose of 0.2 microg. Predatory mites did not discriminate between a prey-induced lima bean volatile blend (that contains MeSA) and a prey-induced volatile blend to which an extra amount of synthetic MeSA had been added. However, they preferred a MeSA-containing volatile blend (induced by T. urticae) to an otherwise similar but MeSA-free blend (induced by jasmonic acid). Adding synthetic MeSA to the MeSA-free blend significantly increased the mites' choice for this odor, suggesting an important role for MeSA. This study is a new step toward unraveling the role of herbivore-induced plant volatiles in the foraging behavior of predatory arthropods.
Gamma irradiation a potential quarantine treatment against mites on cut flowers
International Nuclear Information System (INIS)
Hamidah Sulaiman; Mohd Shamsudin Osman; Zainon Othman; Mohd Ridzuan Ismail
2002-01-01
Cut flower, an important export commodity of Malaysia in international trade, is often subjected to infestation by various pests such as mites, scales and thrips. The use of low ionizing radiation has been suggested as an alternative to methyl bromide fumigation, the current pest disinfestations treatment for cut flower but which is being phased out due to environmental concerns. The criterion for efficacy of radiation as a quarantine treatment will be inability of treated mites to reproduce at a new location rather than causing immediate mortality. A dose of 200 Gy prevented reproduction in female adult of Tetranychus piercie by inducing sterility while a much higher dose of 5 kGy is required to produce instant mortality. Based on the results obtained gamma irradiation of dose range 300-500 Gy may be applied as a quarantine treatment for Tetranycus piercie. However, this dose range is only suitable for chrysanthemum (in 4% sucrose solution) but not roses, carnations and orchids which showed phytotoxic symptoms at dose range of 100-400 Gy. (Author)
Directory of Open Access Journals (Sweden)
Vasanthakumar Duraikkannu
2012-01-01
Full Text Available Green lacewing Mallada boninensis is an important predator of various soft-bodied arthropods, including red spider mites in tea. Efforts were made to develop mass rearing technology for this predator in a cost effective manner. Three combinations of artificial diets (Protinex (AD1, egg yolk (AD2 and royal jelly (AD3 based were evaluated in comparison with standard diet (Protinex + Honey. All the tested diets influenced the egg-laying capacity of M. boninensis. The egg yolk-based diet resulted in more egg production than the other two diets. Survival of all life stages of M. boninensis was also observed on each diet and no significant difference was noticed. Results revealed that the egg yolk-based diet is the best of the three diet combinations tested in view of high fecundity and survival rate of M. boninensis.
Sato, Yukie; Sakamoto, Hironori; Gotoh, Tetsuo; Saito, Yutaka; Chao, Jung-Tai; Egas, Martijn; Mochizuki, Atsushi
2018-03-22
In speciation research, much attention is paid to the evolution of reproductive barriers, preventing diverging groups from hybridizing back into one gene pool. The prevalent view is that reproductive barriers evolve gradually as a by-product of genetic changes accumulated by natural selection and genetic drift in groups that are segregated spatially and/or temporally. Reproductive barriers, however, can also be reinforced by natural selection against maladaptive hybridization. These mutually compatible theories are both empirically supported by studies, analysing relationships between intensity of reproductive isolation and genetic distance in sympatric taxa and allopatric taxa. Here, we present the - to our knowledge - first comparative study in a haplodiploid organism, the social spider mite Stigmaeopsis miscanthi, by measuring premating and post-mating, pre- and post-zygotic components of reproductive isolation, using three recently diverged forms of the mite that partly overlap in home range. We carried out cross-experiments and measured genetic distances (mitochondrial DNA and nuclear DNA) among parapatric and allopatric populations of the three forms. Our results show that the three forms are reproductively isolated, despite the absence of premating barriers, and that the post-mating, prezygotic component contributes most to reproductive isolation. As expected, the strength of post-mating reproductive barriers positively correlated with genetic distance. We did not find a clear pattern of prezygotic barriers evolving faster in parapatry than in allopatry, although one form did show a trend in line with the ecological and behavioural relationships between the forms. Our study advocates the versatility of haplodiploid animals for investigating the evolution of reproductive barriers. © 2018 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology.
Functional response of predatory thrips to two-spotted spider mite - influence of pesticides
DEFF Research Database (Denmark)
Pakyari, Hajar; Enkegaard, Annie
2013-01-01
A leaf disc bioassay was used to investigate the effects of abamectin and fenpropathrin on the functional response of an acarophagous thrips, Scolothrips longicornis Priesner, to eggs of Tetranychus urticae Koch at 25 ± 1°C, 60 ± 10% RH, 16:8 h (L:D). The type of the functional response differed....... The theoretical maximum number of prey attacked by the thrips was 49.67 and 23.67 eggs per day for females and males, respectively; both maxima were attained in the control treatment. These values were reduced for males exposed to full doses of either pesticide and for females exposed to both half and full doses...
International Nuclear Information System (INIS)
Richter, S.; Dedek, W.
1983-01-01
Uptake, mobility and translocation of 14 C-dimethoate and 32 P-methamidophos in Vicia faba L. and Oryza sativa L. were studied by means of pea aphid (Acyrthosiphon pisum Harris), red spider mite (Tetranychus urticae Koch) and rice cicada (Sogatodes orizicola Muir). A relationship was found to exist between the uptake of active ingredients and the individual developmental stages. Both ingredients are rapidly taken up through the roots and translocated throughout the plant, the rate of incorporation being higher with mites - due to the higher share of active ingredients in their cells - than with aphids. Tests without allowing time for exposition are possible and provide direct information on the rate of uptake. Both dimethoate and methamidophos penetrate into the leaf tissue. The phloem is loaded somewhat more slowly, the rate of load being more favourable with dimethoate. Acropetal and basipetal translocation proceed accordingly. However, the two active ingredients under review are not transported in insecticidal or acaricidal concentrations. Unlike dimethoate, the insecticidal action of methamidophos in field bean persists for 20 days or more. Studies on the mobility of dimethoate in rice plants point to a high apoplastic translocation in the treated leaf and to a somewhat retarded acropetal translocation in insecticidal concentrations. These results show that bioassays may be carried out not only with aphids but also with spider mites and cicades to demonstrate the mobility of chemical agents in plants. (author)
Directory of Open Access Journals (Sweden)
Deok Ho Kwon
Full Text Available Rapid resistance detection is necessary for the adaptive management of acaricide-resistant populations of Tetranychus urticae. Detection of phenotypic and genotypic resistance was conducted by employing residual contact vial bioassay (RCV and quantitative sequencing (QS methods, respectively. RCV was useful for detecting the acaricide resistance levels of T. urticae, particularly for on-site resistance detection; however, it was only applicable for rapid-acting acaricides (12 out of 19 tested acaricides. QS was effective for determining the frequencies of resistance alleles on a population basis, which corresponded to 12 nonsynonymous point mutations associated with target-site resistance to five types of acaricides [organophosphates (monocrotophos, pirimiphos-methyl, dimethoate and chlorpyrifos, pyrethroids (fenpropathrin and bifenthrin, abamectin, bifenazate and etoxazole]. Most field-collected mites exhibited high levels of multiple resistance, as determined by RCV and QS data, suggesting the seriousness of their current acaricide resistance status in rose cultivation areas in Korea. The correlation analyses revealed moderate to high levels of positive relationships between the resistance allele frequencies and the actual resistance levels in only five of the acaricides evaluated, which limits the general application of allele frequency as a direct indicator for estimating actual resistance levels. Nevertheless, the resistance allele frequency data alone allowed for the evaluation of the genetic resistance potential and background of test mite populations. The combined use of RCV and QS provides basic information on resistance levels, which is essential for choosing appropriate acaricides for the management of resistant T. urticae.
Directory of Open Access Journals (Sweden)
Badegana, AM.
2000-01-01
Full Text Available A New Rearing Technique of Phytophagous Mite Tetranychus urticae Koch (Acari : Tetranychida and its Application in the Study of the Efficacy of some Acaricides on Potato [Solanum tuberosum L.. A 5 cm diameter leaf disc of potato or another host plant (or four on 2.5 cm diameter was used in a Petri dish of 9 cm diameter for the rearing technique. This leaf disc, pierced in its centre, slides along a rustproof pin and floats on a 1 mm thick lamina of demineralized fresh water. Water is a "strong barrier" which confines the tetranychid mites on the leaf disc, even if this one does not corne from a host plant (tetranychid mites deprived of food. This rearing technique was used as a bioassay to test the effectiveness of acaricides (pyrimiphos-methyl, bromopropylate, fenpropathrin, dienochlor on the developmental stages of Tetranychus urticae. The ovicidal activity against the eggs of one, three, seven days old (the eggs incubation duration being 8.1 ±0.15 days was also studied. The results obtained show that bromopropylate, fenpropathrin and dienochlor have an ovicidal activity against the eggs of the different ages, but dienochlor has the highest efficiency (90 % mortality. Pyrimiphos-methyl is only active against the seven-day old eggs and bromopropylate has a high efficiency only on the one-day old eggs. Concerning the other developmental stages such as chrysalis (protochrysalis, deu-tochrysalis, teleiochrysalis and mobile stages (larva, protonymph, deutonymph and adult female, pyrimiphos-methyl has de highest efficiency (90 % mortality ; dienochlor also, except mobile stages. Bromopropylate has no activity against the chrysalis and mobile stages and fenpropathrin has a remarkable repulsive effect.
Directory of Open Access Journals (Sweden)
Luna Segura Diego Marino
1987-12-01
Full Text Available Some important ecological topics about Tetranychus cinnabarinus (Boisduval. (Acari: Tetranychidae pest management was studied in a comercial crop of carnation Dianthus caryophyllus L. in greenhouse in Suba - Cundinamarca. Population of mites was evaluated on 3 thirds and 9 ages of plants during rainy and dry season. 34.83
34.61% were found on the up third and 27.84% were found on the lower third of plants. Mite population reached equilibrium state, de life cycle was 37.19C% for egg;
20.50% for larva; 24.37% ninfal stages and 17.54% for adults. Trifolium repens L.; Stellaris media (L. Cyrill; Pos annua L.; Veronica persica Poir; Holcus lanatus L. and
Oxslis corniculata L. were found as secondary hosts for T. cinneberinus during this studv, In laboratory conditions, 300C and 85 ± 5% R.H., the life cycle of Tetrsnychuscinnabarinus
(Boisduval. on Triototium repens L. Was shorter than the life cycle on carnation (Disnthus csryopbvtlu. L..El trabajo se desarrolló bajo condiciones de cultivo comercial (Municipio de Suba, Cundinamarca, abordó interrogantes
de interés específico para el manejo de ácaros en clavel, como son principalmente: dinámica de población y efecto
del ciclo de vida. Bajo invernadero, se evaluó la distribución vertical de poblaciones teniendo en cuenta: tres estratos, nueve edades de planta y dos épocas (lluviosa y seca; además se buscaron hospedantes secundarios del ácaro. Las mayores poblaciones de arañita se presentaron en plantas de 19, 20 y 21 meses de edad, con un 34.83% del total. Al tener en cuenta distribución vertical se observó que el estrato medio contiene la mayor población, el 37.55% y la menor, el
estrato inferior con el 27.84%. Al comparar los diferentes estados del ciclo de vida del ácaro se pudo ver la condición de equilibrio estable de su poblaci
Montserrat, M; de la Peña, F; Hormaza, J I; González-Fernández, J J
2008-02-01
The persea mite Oligonychus perseae is a pest of avocado trees that builds extremely dense webbed nests that protect them against natural enemies, including phytoseiid mites. Nests have one or two marginal entrances that are small and flattened. The predatory mite Neoseiulus californicus co-occurs with O. perseae in the avocado orchards of the south-east of Spain. Penetration inside nests through the entrances by this predator is thought to be hindered by its size and its globular-shaped body. However, in the field it has repeatedly been found inside nests that were clearly ripped. Perhaps penetration of the nests has been facilitated by nest wall ripping caused by some other species or by unfavourable abiotic factors. However, to assess whether N. californicus is also able to enter the nest of O. perseae by itself, we carried out laboratory experiments and made a short film. They show how this predator manages to overcome the webbed wall, and that it can penetrate and forage inside nests of O. perseae.
Effect of aqueous plant extracts on tea red spider mite, Oligonychus ...
African Journals Online (AJOL)
STORAGESEVER
2009-02-04
Feb 4, 2009 ... integrated mite management. Key words: Tea ... Scientific name. Family. Parts used .... C.V.%. 8.64. Mean of five observations (30 eggs/observation). 100 numbers of ..... This work is part of a Tea Research Association in-house project ... innovation in tea science and sustainable development in tea. Industry ...
DEFF Research Database (Denmark)
Ullah, Mohammad Shaef; Haque, Md. Ahsanul; Nachman, Gösta
2012-01-01
Development and reproductive traits of Tetranychus macfarlanei Baker & Pritchard (Acari: Tetranychidae) were investigated on kidney bean, Phaseolus vulgaris L., at eleven constant temperatures. Tetranychus macfarlanei was able to develop and complete its life cycle at temperatures ranging from 17...
Abad-Moyano, Raquel; Pina, Tatiana; Pérez-Panadés, Jordi; Carbonell, Emilio A; Urbaneja, Alberto
2010-04-01
Tetranychus urticae is one of the most damaging tetranychid mites affecting clementine orchards in Spain, where natural control is insufficient. Furthermore, in clementine nurseries, tender foliage is highly susceptible to attack and natural enemies are almost always absent. Therefore, acaricides are often used indiscriminately. Alternative control measures are necessary, both in commercial orchards and clementine nurseries. In order to assess the efficacy of inoculative releases of N. californicus and P. persimilis to reduce T. urticae populations in young Spanish clementine plants, a semi-field experiment was conducted and repeated in three seasons (spring, summer and autumn). Phytoseiulus persimilis was highly effective in reducing both T. urticae infestations and the damage level inflicted on plants at both release rates evaluated (40 and 80 phytoseiids/plant) and all three periods considered. By contrast, N. californicus demonstrated low performance under certain conditions. The results of this study could be adapted and transferred to nurseries and young citrus plantations.
Directory of Open Access Journals (Sweden)
PP Marafeli
Full Text Available The predatory mite, Neoseiulus californicus(McGregor, 1954 (Acari: Phytoseiidae is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticaeKoch, 1836 (Acari: Tetranychidae, is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm was 0.2 and the mean generation time (T was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.
Pérez-Sayas, Consuelo; Aguilar-Fenollosa, Ernestina; Hurtado, Mónica A; Jaques, Josep A; Pina, Tatiana
2017-06-16
Predatory mites of the Phytoseiidae family are considered one of the most important groups of natural enemies used in biological control. The behavioral patterns of arthropods can differ greatly daily and seasonally; however, there is a lack of literature related to Phytoseiidae diel and seasonal predation patterns. The predatory activity of three phytoseiid species (two Tetranychidae-specialists, Phytoseiulus persimilis and Neoseiulus californicus, and one omnivore, Euseius stipulatus) that occur naturally in Spanish citrus orchards was observed under laboratory conditions in winter and summer. The temperature and photoperiod of the climatic chamber where the mites were reared did not change during the experiment. Our study demonstrates that phytoseiids can exhibit diel and seasonal predatory patterns when feeding on Tetranychus urticae (Acari: Tetranychidae). Neoseiulus californicus was revealed to be a nocturnal predator in summer but diurnal in winter. In contrast, P. persimilis activity was maximal during the daytime, and E. stipulatus showed no clear daily predation patterns. The predatory patterns described in this study should be taken into account when designing laboratory studies and also in field samplings, especially when applying molecular techniques to unveil trophic relationships. © 2017 Institute of Zoology, Chinese Academy of Sciences.
Ethanol extract of Cymbopogon winterianus on mortality and number of eggs of Tetranychus urticae
Directory of Open Access Journals (Sweden)
Victor Bernardo Vicentini
2015-07-01
Full Text Available Plant extracts have been studied as a promising source of natural insecticides. This study assessed the effect of the ethanol extract of Cymbopogon winterianus Jowitt (citronella grass in comparison with an insecticide containing azadirachtin (ICA on mortality and number of eggs of Tetranychus urticae Koch (Acari: Tetranychidae in laboratory conditions. For the tests, the mites were sprayed with the aid of a Potter spray tower. To assess the mortality of females, LC50 value for extract of citronella grass and ICA was, respectively, 2.63 and 2.83%. With respect to the number of eggs, the greatest reduction was observed at a concentration of 5% for the evaluation period of 120h, both for the extract of citronella grass (86% and for ICA (81%. These results suggest the potential of the ethanol extract of citronella grass to control of T. urticae. However, experiments, under field conditions, involving other populations of T. urticae should be performed to verify the efficacy of this extract as an alternative to be used in pest management programs
Directory of Open Access Journals (Sweden)
Paula E. Cushing
2012-01-01
Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.
Attending to detail by communal spider-eating spiders.
Jackson, Robert R; Nelson, Ximena J
2012-07-01
Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.
Complex Odor from Plants under Attack: Herbivore's Enemies React to the Whole, Not Its Parts
van Wijk, Michiel; de Bruijn, Paulien J. A.; Sabelis, Maurice W.
2011-01-01
Background Insect herbivory induces plant odors that attract herbivores' natural enemies. Assuming this attraction emerges from individual compounds, genetic control over odor emission of crops may provide a rationale for manipulating the distribution of predators used for pest control. However, studies on odor perception in vertebrates and invertebrates suggest that olfactory information processing of mixtures results in odor percepts that are a synthetic whole and not a set of components that could function as recognizable individual attractants. Here, we ask if predators respond to herbivore-induced attractants in odor mixtures or to odor mixture as a whole. Methodology/Principal Findings We studied a system consisting of Lima bean, the herbivorous mite Tetranychus urticae and the predatory mite Phytoseiulus persimilis. We found that four herbivore-induced bean volatiles are not attractive in pure form while a fifth, methyl salicylate (MeSA), is. Several reduced mixtures deficient in one component compared to the full spider-mite induced blend were not attractive despite the presence of MeSA indicating that the predators cannot detect this component in these odor mixtures. A mixture of all five HIPV is most attractive, when offered together with the non-induced odor of Lima bean. Odors that elicit no response in their pure form were essential components of the attractive mixture. Conclusions/Significance We conclude that the predatory mites perceive odors as a synthetic whole and that the hypothesis that predatory mites recognize attractive HIPV in odor mixtures is unsupported. PMID:21765908
Complex odor from plants under attack: herbivore's enemies react to the whole, not its parts.
Directory of Open Access Journals (Sweden)
Michiel van Wijk
Full Text Available Insect herbivory induces plant odors that attract herbivores' natural enemies. Assuming this attraction emerges from individual compounds, genetic control over odor emission of crops may provide a rationale for manipulating the distribution of predators used for pest control. However, studies on odor perception in vertebrates and invertebrates suggest that olfactory information processing of mixtures results in odor percepts that are a synthetic whole and not a set of components that could function as recognizable individual attractants. Here, we ask if predators respond to herbivore-induced attractants in odor mixtures or to odor mixture as a whole.We studied a system consisting of Lima bean, the herbivorous mite Tetranychus urticae and the predatory mite Phytoseiulus persimilis. We found that four herbivore-induced bean volatiles are not attractive in pure form while a fifth, methyl salicylate (MeSA, is. Several reduced mixtures deficient in one component compared to the full spider-mite induced blend were not attractive despite the presence of MeSA indicating that the predators cannot detect this component in these odor mixtures. A mixture of all five HIPV is most attractive, when offered together with the non-induced odor of Lima bean. Odors that elicit no response in their pure form were essential components of the attractive mixture.We conclude that the predatory mites perceive odors as a synthetic whole and that the hypothesis that predatory mites recognize attractive HIPV in odor mixtures is unsupported.
Directory of Open Access Journals (Sweden)
Wendel José Teles Pontes
2007-01-01
Full Text Available Essential oils from leaves and fruits of Protiumheptaphyllum collected in Tamandaré beach Pernambuco/Brazil were analysed by GC/MS and tested for toxicity and repellent effect against the two spotted spider mite (Tetranychus urticae. The major constituent identified in the fruits was alpha-terpinene (47.6 % whereas oil from leaf contained mainly sesquiterpenes such as 9-epi-caryophyllene (21.4 %, trans-isolongifolanone (10.7 % and 14-hydroxi-9-epi-caryophyllene (16.7 %. The fruit oil was found to be more effective against the mite when compared to the leaf oil. Both showed mortality properties and oviposition deterrence in higher concentration (10 µl.l-1 air, but only the essential oil from fruits induced repellence on T. urticae.O óleo essencial das folhas e frutos de Protiumheptaphyllum coletada em Tamandaré-Pernambuco foi analisado por CG/EM e testado sua toxicidade e efeito repelente contra ácaro rajado (Tetranychus urticae. O constituinte majoritário identificado nos frutos foi alfa-terpineno (47,6 % enquanto que nas folhas foram os sesquiterpenos 9-epi-cariofileno (21,4 %, trans-isolongifolanona (10,7 % and 14-hidroxi-9-epi-cariofileno (16,7 %. O óleo dos frutos foi mais eficiente contra o ácaro, comparado com o óleo das folhas. Ambos os óleos revelaram propriedades de mortalidade e deterrência de oviposição na maior concentração (10 µl.l-1 air e apenas o óleo essencial dos frutos induziu repelência no T. urticae.
Gamma irradiation used on adult Tetranychus urticae Koch as a quarantine treatment
Directory of Open Access Journals (Sweden)
Osouli Shiva
2014-07-01
Full Text Available The effect of gamma radiation with 0, 200, 250, 300, 350, 400, and 450 Gy intensities on the longevity, total number of eggs, and the percent of hatched eggs laid by irradiated females of Tetranychus urticae Koch (Tetranychidae was evaluated. Two different groups (0–24 h old and 48–72 h old of adult females were irradiated. The results showed that 350 and 300 Gy doses significantly reduced the longevity of the 0–24 h old females and the 48–72 h old females. The younger females were more tolerant at lower dose rates than the older females. There was a quadratic relationship between dose rates and young females, while it was linear in older females. The total number of eggs laid by females of both ages was significantly reduced with a linear trend by 250 Gy irradiation. The eggs laid by females of both the 0–24 h olds and the 48–72 h olds lost their hatchability when the dose rate was 350 Gy. It was concluded, that applying a dose rate of 320 Gy on one of the mates (male or female before mating, or a 300 Gy on both of them, would be sufficient to cause sterility in adult mites.
DEFF Research Database (Denmark)
Tomkiewicz, Jonna; Skovgård, Henrik; Nachman, Gösta
1993-01-01
. The difference in photosynthetically active area that arises between uninjured and injured plants over a period of time provides a measure of spider mite injury that can be related to growth and yield. The method integrates the injury inflicted over a period of time, allows successive observations of the same...
Llandres, Ana L.; Rodríguez-Gironés, Miguel A.
2011-01-01
According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183
Llandres, Ana L; Rodríguez-Gironés, Miguel A
2011-02-16
According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.
Attentional bias to moving spiders in spider fearful individuals.
Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike
2009-05-01
We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.
Effect of acaricidal activity of Solanum nigrum on Tetranychus ...
African Journals Online (AJOL)
Effect of acaricidal activity of Solanum nigrum on Tetranychus urticae Koch under laboratory conditions. Stephanie Johana Numa Vergel, Lorena Rodríguez Coy, Daniel Rodríguez Caicedo, Ericsson Coy-Barrera ...
Negative evidence of Wolbachia in the predaceous mite Phytoseiulus persimilis.
Enigl, M; Zchori-Fein, E; Schausberger, P
2005-01-01
The cytoplasmically inherited bacterium Wolbachia is widespread in arthropod species and has been repeatedly detected in the predaceous mite Phytoseiulus persimilis. Our original goal was to assess the prevalence of Wolbachia infection in P. persimilis and the potential fitness consequences for this host. To accomplish that goal, seven P. persimilis strains were obtained from Europe, Africa and the USA and reared on the phytophagous mite Tetranychus urticae as prey. After preliminary results showed that the T. urticae used was infected with Wolbachia, the minimum starvation time of the predators to prevent false positive results from undigested prey was determined. We tested DNA samples by PCR (polymerase chain reaction) after starving the predators or feeding them Wolbachia-free T. urticae for various periods. Those experiments showed that Wolbachia could not be detected after 16 h at 25 degrees C and 48 h at 20 degrees C. To verify the results of the PCR analyses, we furthermore conducted crossing experiments with antibiotic-treated and untreated individuals. No indications of Wolbachia effects were recorded. Additionally, we screened live eggs of four of the seven strains reared in our laboratory and alcohol samples of 10 other P. persimilis strains for the occurrence of Wolbachia by PCR, none of which tested positive. Synthesis of our study and previous reports suggests that infection of P. persimilis with Wolbachia is extremely rare and of minor importance. We discuss the significance of our findings for future studies on the presence of Wolbachia in predaceous arthropods.
DEFF Research Database (Denmark)
Castro, Thiago Rodriguesde
The growing demand for strawberries has imposed challenges, especially regarding the control of pests. Many farmers report problems with reduced chemical control efficiency, probably due to selection of resistant populations of insects and mites. An alternative is the use of biological control...... agent were performed, but this bulk of knowledge is in remarkable contrast to the lack of research on the fundamental ecology of Metarhizium in agroecosystems. This thesis aimed to evaluate the establishment, persistence and dispersal of these entomopathogenic fungi in strawberry crop soil...... in Inconfidentes, Minas Gerais, Brazil; and to study the diversity and abundance of species of Metarhizium isolated from organic and conventional strawberry crop soils, and from the field margins in Brazil and Denmark. The effectiveness of new species of Metarhizium recently found in Brazil, was evaluated against...
Predation-related odours reduce oviposition in a herbivorous mite.
Choh, Yasuyuki; Uefune, Masayoshi; Takabayashi, Junji
2010-01-01
When adult females of the herbivorous mite, Tetranychus urticae, were exposed to the predatory mite, Phytoseiulus persimilis, they laid fewer eggs than females that had not been exposed to P. persimilis when transferred onto a new leaf patch. However, when T. urticae females were exposed to either products of P. persimilis or artificially damaged conspecific eggs on a leaf patch, the number of T. urticae eggs on a new leaf patch did not differ significantly from the control. The reduced oviposition was neither due to the feeding activity on the leaf patch with P. persimilis nor to that on the new leaf patch. There was also no significant difference between the number of T. urticae eggs produced on a new leaf patch following exposure to the odours of a neighbouring leaf patch where there had previously been either P. persimilis or T. urticae adults. However, female T. urticae that had been exposed to odours from neighbouring leaf patches on which both T. urticae and P. persimilis had been placed produced significantly fewer eggs on a new leaf patch than those that had not been exposed to such odours. Neither odours from neighbouring intact leaf patches on which T. urticae eggs were preyed on by P. persimilis, nor odours from a neighbouring Parafilm patch on which T. urticae was preyed on by P. persimilis affected the oviposition of T. urticae. These data suggest that the presence of T. urticae, P. persimilis and a leaf patch are needed for the emission of odours to reduce oviposition in T. urticae.
Onzo, A.; Sabelis, M.W.; Hanna, R.
2014-01-01
To determine whether to use single or multiple predator species for biological pest control requires manipulative field experiments. We performed such tests in Benin (West Africa) in cassava fields infested by the cassava green mite Mononychellus tanajoa, and the cotton red mite Oligonychus
Directory of Open Access Journals (Sweden)
Angelica María Argüelles
2013-01-01
Full Text Available Tetranychus urticae (Acari: Tetranychidae is one of the most important pests in ornamental cultures. Between the species most used for its control are Neoseilus sp. and Phytoseiulus persimilis (Acari: Phytoseiidae. Knowing the effectivity and ages of the prefers prey of each species of predator. In this search purposed the management of the plague through the use of combined releases, is necessary to evaluate that could occur between them with the prey when they act together. With this aim, we evaluated any situations. For one side was evaluated when a predator with a second predator with more density for the first predator. This situation was analyzed in presence and with absence of its prey. For other side, was evaluated the interactions of both predators are presents at the same density and with the prey. In the fist situation in presence of the prey was observe that increase the age of predator in minor density also increase the interference over the consumption of the high population’s predator over the prey. Moreover when decreased the T. urticae’s consumption increased the intraguild consumption. P. persimilis in absence of T. urticae and in presence of N. californicus approve a behavior of intraguild predation over all the ages of its cospecifics, while that N. californicus only consumed coespecific’s larvae in the phytofagous absence and in presence of P. persimilis. When both predators were in the same test at the same population’s density, was not observe a higher consumption of T. urticae that when each predator act for its way.
International Nuclear Information System (INIS)
Bhuiya, A.D.; Majumder, M.Z.R.; Hahar, G.; Shahjahan, R.M.; Khan, M.
1999-01-01
Effect of radiation on different developmental stages of mites, thrips, and nematodes were observed to determine their sterility doses and to develop a method for detection of irradiated and unirradiated specimens. A brief survey on cut-flower and tuber associated pests, and their biological study along with the tolerance level of host products were conducted. Mites Oligonychus biharensis (Hirst) and Tetranychus sp., as well as four species of thrips viz. Retithrips syriacus (Mayet), Haplothrips gowdeyi Franklin, Frankliniella intonsa Tribom, and Microcephalothrips abdominalis Crowford were recognized as common pests damaging plants and cut-flowers. Common species of nematodes infesting ginger and turmeric were Meloidogyne spp. and Ditylenchus spp. Results indicated that a dose 0.2 kGy and above caused complete sterility of male and female mites and insects. Various pre-adult developmental stages required less irradiation dose (0.05-0.1 kGy) for sterilization. Variation of melanization in treated and untreated life stages of mites and thrips could not be observed even at 0.2 kGy with the 2-methyl DOPA spot test. Inhibition of melanization in irradiated pupal stages of thrips were observed at doses above 0.4 kGy. Both irradiated and unirradiated thrips were identical in their protein banding pattern. Virtually no protein bands were observed in irradiated and unirradiated nematodes when samples were run on 5% PAGE in TBE. Tube rose and marigold treated with higher dose (0.3 to 0.5 kGy) caused no remarkable morphological degradation for 7-8 days after irradiation. Nematodes were resistant to radiation. Complete elimination and abnormalities of J 2 stages of Meloidogyne spp. and Ditylenchus spp. were not observed even at 4.0 kGy although significant weight loss and spoilage of tubers were recorded after 14 days of radiation exposure. (author)
Directory of Open Access Journals (Sweden)
Noeli Juarez Ferla
2008-09-01
Full Text Available Neste artigo é descrita ocorrência e o dano causado pelo ácaro vermelho europeu Panonychus ulmi (Koch associado à cultura da videira. As coletas foram realizadas na safra 2005-2006 em Vitis vinifera L. da cultivar Merlot, nos municípios de Bento Gonçalves e Candiota, no Estado do Rio Grande do Sul, Brasil. As folhas infestadas apresentaram bronzeamento, com manchas avermelhadas na face adaxial, resultando na queda prematura das mesmas. Esse é o primeiro registro do ácaro vermelho europeu danificando a cultura da videira no Rio Grande do Sul.The occurrence and the damage caused for the European red spider mite Panonychus ulmi (Koch associated to the culture of the grapevine are described. The collections had been carried through in 2005-2006 seasons in Vitis vinifera L. of cultivating Merlot in Bento Gonçalves and Candiota counties, in the state of Rio Grande do Sul, Brazil. The infested leaves had presented bronzing, with spots redly in the adaxial face resulting in the premature fall. This is the first register of the European red mite damaging the culture of the grapevine in Rio Grande do Sul.
Araújo, Mário J C; Câmara, Cláudio A G; Born, Flávia S; Moraes, Marcílio M; Badji, César A
2012-06-01
The chemical composition of essential oil of leaves of Piper aduncum L., growing wild in a fragment of the Atlantic Rainforest biome in northeastern Brazil, was determined through gas chromatography-mass spectrometry. The acaricidal activity and repellency of the essential oil and its components [dillapiole (0.28 g/ml), α-humulene (0.016 g/ml), (E)-nerolidol (0.0007 g/ml) and β-caryophyllene (0.0021 g/ml)] were evaluated in the laboratory against adults of Tetranychus urticae Koch. The mites were more susceptible to the oil in fumigation tests (LC(50) = 0.01 μl/l of air) than in contact test with closed Petri dish (LC(50) = 7.17 μl/ml); mortality was reduced by approximately 50 % in the latter test. The repellent action of the oil and toxicity by fumigation and contact did not differ significantly from the positive control (eugenol). The repellent activity was attributed to the components (E)-nerolidol, α-humulene and β-caryophyllene, whereas toxicity by fumigation and contact was attributed to β-caryophyllene. The effect of Piper oil and the role of its components regarding host plant preference with a two-choice leaf disk test are also discussed.
Bjørnson; Steiner; Keddie
1996-11-01
Ultrastructure and pathology of Microsporidium phytoseiuli n. sp. infecting the predatory mite Phytoseiulus persimilis Athias-Henriot is described using light and transmission electron microscopy. Infected mites showed no gross, external symptoms. All observed stages of the parasite had unpaired nuclei. Schizonts were commonly observed within nuclei of digestive cells of the ventriculus and within the cytoplasm of cells lining the cecal wall and in muscle tissue underlying it. Sporoblasts and spores occurred in the nuclei and cytoplasm of digestive cells within the ventriculus, in cortical regions of the sub- and supraesophageal ganglia, within the cecal wall and muscle tissue, and in parenchyma cells underlying the cuticle. Mature spores were also observed in developing eggs within gravid females. These were broad- to elongate-ovoid, measured 4.33 ± 0.35 x 1.27 ± 0.15 &mgr;m (electron micrographs), 5.37 ± 0.46 x 2.22 ± 0.17 &mgr;m (fixed and stained), and 5.88 ± 0.34 x 2.22 ± 0.19 &mgr;m (fresh) and had an isolfilar polar filament coiled 12 to 15 times within the posterior two-thirds. Within cells, individual spores appeared to be in direct contact with host cytoplasm, while groups of spores were infrequently observed within interfacial envelopes. Groups of 4, 8, to more than 16 spores were observed by light microscopy, while 8 was the maximum observed by electron microscopy. No spores were observed in Tetranychus urticae, a mite used as food during this study.
Ullah, Mohammad Shaef; Lim, Un Taek
2017-09-01
Tetranychus urticae Koch (Acari: Tetranychidae), a major pest of many agricultural crops, is mainly controlled with chemical acaricides. However, predatory mites and entomopathogens have been proposed as alternative control agents. In this study, the effect of the BotaniGard ® GHA strain of Beauveria bassiana on the survival, longevity, fecundity, and egg hatch rate of the predatory mite Phytoseiulus persimilis Athias-Henriot (Acari: Phytoseiidae) were studied under laboratory conditions. When B. bassiana was applied directly to P. persimilis eggs at a concentration of 1×10 8 conidia/ml, corrected hatchability was less than 5%, and the corrected mortality of nymphs and adults was not significantly different from control 10days after treatment. Phytoseiulus persimilis nymphs that hatched from treated eggs showed no significant change in their development time, adult female longevity, hatch rate, survival rates over time, or offspring sex ratio. However, significant negative effects on fecundity and life table parameters (net reproductive rate, intrinsic rate of natural increase, mean generation time, finite rate of increase, and doubling time) were found when B. bassiana was applied to the adult stage. Spraying B. bassiana at 1×10 8 conidia/ml on newly emerged adults of P. persimilis caused 44% reduction in the oviposition period, 26% in adult longevity, and 63% in fecundity. Due to these negative effects, B. bassiana should be used with careful adjustment of application timing (first spray B. bassiana and then release P. persimilis) to supplement biological mite control systems using P. persimilis. Copyright © 2017 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Uraisakul, Kanok [Rajamangala University of Technology Suvarnabhumi Phranakhonsiayathaya, Hantra Campus, Phranakhonsiayathaya (Thailand); Piadang, Nattaya [Office of Atoms for Peace, Bangkok (Thailand)
2006-09-15
A usages of herb extracts by stream integrated rith micro-organism to control insect pests and phytophagus mites by biological control was compared with insecticide to investigate the responses of chili tree and kieffer lime tree. Moreover, herb extracts were tested in controlling insect pests. Herb extracts were selected from many effective kinds such as: Azadirachta indica, Hyptis suaveolens, Citronella grass, Eucalyptus, Stemona, Galangal, Zingiber, cassumunar Roxb. Chronmolaena oderatum, Derris elyptica, Ginger, Annona seed, Malueraca sp., Andrographis paniculata, Veronia aquarrosa, Garlic, Thevetia peruviana, and Tobacco. The experiment was set at Herb Laboratory Ayutthaya Campus, Rajamangala University of Technology, Suvarnabhumi during August 2004 to June 2006. From testing herb extracts at 100 ppm. On Chili germination, the result was that the Chromolaena extracts made highest germination of 69.50%, Citronella grass at 500 ppm., made highest germination of chili seed at 86.00% within 12 days. Garlic extracts could kill 75.90% of aphids in 24 hrs., maximized in this experiments. Malueraca extracts at 500 ppm. Could kill 92.65% of chili aphids similar to the activity of insecticides action in 24 hrs. However at 5,000 ppm. It found that chemical treatment gave difference results from herbal treatments. Annona extracts could kill 64.58% of chili aphids better that others treatments. There are 18 treatment of time at 6 hrs. , 15 hrs., and 24 hrs., respectively. The results found that at 6 hrs., Kelthane could kill 93.75% of red spider mite. At 15 hrs. Stemona could kill 95.50% of red spider mite. At 24 hrs. Stemona or Chromolaena could kill 100% of red spider mite equally, Chrolaena could kill more than 83% of chili thrips at 24 hrs. Annona extracts could harvest the maximum of fruit fresh weight and numbers of fruits. After cutting leaves for producing new leaves, spraying herbal extracts was not different in statistic; however, Eucalyptus extracts, Neem plus
International Nuclear Information System (INIS)
Uraisakul, Kanok; Piadang, Nattaya
2006-09-01
A usages of herb extracts by stream integrated rith micro-organism to control insect pests and phytophagus mites by biological control was compared with insecticide to investigate the responses of chili tree and kieffer lime tree. Moreover, herb extracts were tested in controlling insect pests. Herb extracts were selected from many effective kinds such as: Azadirachta indica, Hyptis suaveolens, Citronella grass, Eucalyptus, Stemona, Galangal, Zingiber, cassumunar Roxb. Chronmolaena oderatum, Derris elyptica, Ginger, Annona seed, Malueraca sp., Andrographis paniculata, Veronia aquarrosa, Garlic, Thevetia peruviana, and Tobacco. The experiment was set at Herb Laboratory Ayutthaya Campus, Rajamangala University of Technology, Suvarnabhumi during August 2004 to June 2006. From testing herb extracts at 100 ppm. On Chili germination, the result was that the Chromolaena extracts made highest germination of 69.50%, Citronella grass at 500 ppm., made highest germination of chili seed at 86.00% within 12 days. Garlic extracts could kill 75.90% of aphids in 24 hrs., maximized in this experiments. Malueraca extracts at 500 ppm. Could kill 92.65% of chili aphids similar to the activity of insecticides action in 24 hrs. However at 5,000 ppm. It found that chemical treatment gave difference results from herbal treatments. Annona extracts could kill 64.58% of chili aphids better that others treatments. There are 18 treatment of time at 6 hrs. , 15 hrs., and 24 hrs., respectively. The results found that at 6 hrs., Kelthane could kill 93.75% of red spider mite. At 15 hrs. Stemona could kill 95.50% of red spider mite. At 24 hrs. Stemona or Chromolaena could kill 100% of red spider mite equally, Chrolaena could kill more than 83% of chili thrips at 24 hrs. Annona extracts could harvest the maximum of fruit fresh weight and numbers of fruits. After cutting leaves for producing new leaves, spraying herbal extracts was not different in statistic; however, Eucalyptus extracts, Neem plus
Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A
2014-09-01
Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.
Specialised use of working memory by Portia africana, a spider-eating salticid.
Cross, Fiona R; Jackson, Robert R
2014-03-01
Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.
Seiedy, Marjan; Saboori, Alireza; Zahedi-Golpayegani, Azadeh
2013-06-01
Determination of attraction and avoidance behavior of predators is important in concomitant use of multiple natural enemies to control a pest. The olfactory response of the predatory mite Phytoseiulus persimilis was studied to odors related to Tetranychus urticae adults infected by Beauveria bassiana DEBI008 in 0, 24, 48 and 72 h intervals, both in absence and in presence of plants. In plant-present experiments, P. persimilis attraction was neither towards adults of T. urticae infected by 0.02 % Tween 80 (as control), nor to the ones infected by B. bassiana for 0 or 24 h, whereas significant attraction towards the control was observed when tested against T. urticae infected by B. bassiana for 48 or 72 h. In absence of plants, P. persimilis displayed significant avoidance of T. urticae infected by B. bassiana for 48 or 72 h, when their alternative option was 0.02 % Tween 80-infected T. urticae adults. These results indicate that P. persimilis can recognize the presence of B. bassiana and that the predator avoids the fungus. This suggests that the two natural enemy species can be used together in biological control programmes.
Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi
2014-11-01
The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.
Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web
Directory of Open Access Journals (Sweden)
Jiang Min
2016-01-01
Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.
Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web
Jiang Min
2016-01-01
Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.
Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...
A burst of ABC genes in the genome of the polyphagous spider mite Tetranychus urticae
Dermauw, W.; Osborne, E.J.; Clark, R.M.; Grbić, M.; Tirry, L.; Van Leeuwen, T.
2013-01-01
Background: The ABC (ATP-binding cassette) gene superfamily is widespread across all living species. The majority of ABC genes encode ABC transporters, which are membrane-spanning proteins capable of transferring substrates across biological membranes by hydrolyzing ATP. Although ABC transporters
A minute fossil phoretic mite recovered by phase-contrast X-ray computed tomography.
Dunlop, Jason A; Wirth, Stefan; Penney, David; McNeil, Andrew; Bradley, Robert S; Withers, Philip J; Preziosi, Richard F
2012-06-23
High-resolution phase-contrast X-ray computed tomography (CT) reveals the phoretic deutonymph of a fossil astigmatid mite (Acariformes: Astigmata) attached to a spider's carapace (Araneae: Dysderidae) in Eocene (44-49 Myr ago) Baltic amber. Details of appendages and a sucker plate were resolved, and the resulting three-dimensional model demonstrates the potential of tomography to recover morphological characters of systematic significance from even the tiniest amber inclusions without the need for a synchrotron. Astigmatids have an extremely sparse palaeontological record. We confirm one of the few convincing fossils, potentially the oldest record of Histiostomatidae. At 176 µm long, we believe this to be the smallest arthropod in amber to be CT-scanned as a complete body fossil, extending the boundaries for what can be recovered using this technique. We also demonstrate a minimum age for the evolution of phoretic behaviour among their deutonymphs, an ecological trait used by extant species to disperse into favourable environments. The occurrence of the fossil on a spider is noteworthy, as modern histiostomatids tend to favour other arthropods as carriers.
A minute fossil phoretic mite recovered by phase-contrast X-ray computed tomography
Dunlop, Jason A.; Wirth, Stefan; Penney, David; McNeil, Andrew; Bradley, Robert S.; Withers, Philip J.; Preziosi, Richard F.
2012-01-01
High-resolution phase-contrast X-ray computed tomography (CT) reveals the phoretic deutonymph of a fossil astigmatid mite (Acariformes: Astigmata) attached to a spider's carapace (Araneae: Dysderidae) in Eocene (44–49 Myr ago) Baltic amber. Details of appendages and a sucker plate were resolved, and the resulting three-dimensional model demonstrates the potential of tomography to recover morphological characters of systematic significance from even the tiniest amber inclusions without the need for a synchrotron. Astigmatids have an extremely sparse palaeontological record. We confirm one of the few convincing fossils, potentially the oldest record of Histiostomatidae. At 176 µm long, we believe this to be the smallest arthropod in amber to be CT-scanned as a complete body fossil, extending the boundaries for what can be recovered using this technique. We also demonstrate a minimum age for the evolution of phoretic behaviour among their deutonymphs, an ecological trait used by extant species to disperse into favourable environments. The occurrence of the fossil on a spider is noteworthy, as modern histiostomatids tend to favour other arthropods as carriers. PMID:22072283
Energy Technology Data Exchange (ETDEWEB)
Vuorinen, Terhi; Nerg, Anne-Marja; Holopainen, Jarmo K
2004-09-01
We evaluated the similarities between ozone-induced and mite-induced emission of volatile organic compounds (VOCs) from lima beans, and tested the response of the natural enemies of herbivores to these emissions using trophic system of two-spotted spider mites and predatory mites. The acute ozone-exposure and spider mite-infestation induced the emission of two homoterpenes, (E)-4,8-dimethyl-1,3,7-nonatriene and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene, and (Z)-3-hexenyl acetate. Only plants with spider mite-infestation emitted the monoterpene (E)-{beta}-ocimene. Predatory mites were equally attracted to ozone-exposed and unexposed plants, but discriminated between spider mite-infested and uninfested plants, when both were exposed to ozone. The similarities between ozone and herbivore-induced VOCs suggest that plant defence against phytotoxic ozone and the production of VOCs for attraction of the natural enemies of herbivores may have adaptive coevolution. However, the expected elevated ozone concentrations in future may not disturb tritrophic signalling, unless herbivore-induced VOCs are lost in the process of aerosol formation.
International Nuclear Information System (INIS)
Vuorinen, Terhi; Nerg, Anne-Marja; Holopainen, Jarmo K.
2004-01-01
We evaluated the similarities between ozone-induced and mite-induced emission of volatile organic compounds (VOCs) from lima beans, and tested the response of the natural enemies of herbivores to these emissions using trophic system of two-spotted spider mites and predatory mites. The acute ozone-exposure and spider mite-infestation induced the emission of two homoterpenes, (E)-4,8-dimethyl-1,3,7-nonatriene and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene, and (Z)-3-hexenyl acetate. Only plants with spider mite-infestation emitted the monoterpene (E)-β-ocimene. Predatory mites were equally attracted to ozone-exposed and unexposed plants, but discriminated between spider mite-infested and uninfested plants, when both were exposed to ozone. The similarities between ozone and herbivore-induced VOCs suggest that plant defence against phytotoxic ozone and the production of VOCs for attraction of the natural enemies of herbivores may have adaptive coevolution. However, the expected elevated ozone concentrations in future may not disturb tritrophic signalling, unless herbivore-induced VOCs are lost in the process of aerosol formation
Davies, Jamie T; Ireson, John E; Allen, Geoff R
2009-02-01
Predation by the phytoseiid mite, Phytoseiulus persimilis, is considered a major threat to the effectiveness of biological control of gorse, Ulex europaeus, using Tetranychus lintearius. To assess this threat and to determine if the impact of P. persimilis on T. lintearius populations is comparable to its impact on T. urticae populations, its development and predator : prey generation time ratios were assessed. The pre-adult mortality and development time of two populations of P. persimilis fed on two diets, T. urticae and T. lintearius, were determined at two temperatures, 14 and 24 degrees C. There were no significant differences in either mortality or development time between the two populations of P. persimilis at these temperatures. There is therefore no evidence that the two tested populations of P. persimilis are behaving as different strains. Similarly, diet had no significant effect on either mortality or development time at these temperatures. At 14 degrees C the mortality of P. persimilis was significantly higher and development was significantly longer than at 24 degrees C. Using pre-adult development as a surrogate for generation times, predator : prey generation time ratios were calculated between P. persimilis and both T. urticae and T. lintearius using data from this and other studies. The predator : prey generation time ratios between P. persimilis and T. lintearius were lower than those between P. persimilis and T. urticae. These results indicate that the impact of P. persimilis on T. lintearius populations is likely to be comparable to its impact on T. urticae populations. This provides further evidence that predation by P. persimilis is having a deleterious effect on T. lintearius populations and therefore reducing its effectiveness as a biological control agent for gorse.
... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...
Mammola, Stefano; Isaia, Marco
2017-04-26
World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).
Spider phylogenomics: untangling the Spider Tree of Life
Directory of Open Access Journals (Sweden)
Nicole L. Garrison
2016-02-01
Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results
Spider phylogenomics: untangling the Spider Tree of Life
Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.
2016-01-01
Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the
Respiration in spiders (Araneae).
Schmitz, Anke
2016-05-01
Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.
Directory of Open Access Journals (Sweden)
Carla Rosana Eichelberger
2011-09-01
Full Text Available Despite the importance of peach (Prunus persica (L. Batsch in Rio Grande do Sul, little is known about mites fluctuation population considered important to this crop. The objective of this study was to know the population diversity and fluctuation of mite species associated with Premier and Eldorado varieties in Roca Sales and Venâncio Aires counties, Rio Grande do Sul. The study was conducted from July 2008 to June 2009 when 15 plants were randomly chosen in each area. The plants were divided in quadrants and from each one a branch was chosen from which three leaves were removed: one collected in the apical region, another in the medium and the other in the basal region, totalizing 180 leaves/area. Five of the most abundant associated plants were collected monthly in enough amounts for the screening under the stereoscopic microscope during an hour. A total of 1,124 mites were found belonging to 14 families and 28 species. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 and Mononychellus planki (McGregor, 1950 were the most abundant phytophagous mites, whereas Typhlodromalus aripo Deleon, 1967 and Phytoseiulus macropilis (Banks, 1904 the most common predatory mites. The period of one hour under stereoscopic microscope was enough to get a representative sample. In both places evaluated the ecologic indices were low, but little higherin Premier (H' 0.56; EqJ: 0.43 when compared to Eldorado (H' 0.53; EqJ 0.40. In Premier constant species were not observed and accessory only Brevipalpus phoenicis (Geijskes, 1939, T. ludeni and T. aripo. Higher abundance was observed in December and January and bigger amount in April. Already in Eldorado, T. ludeni and P. ulmi were constants. Greater abundance was observed in November and December, whereas grater richness in December and January. In both orchards were not found mites in buds. Tetranychus ludeni is the most abundant phytophagous mites with outbreak population in November, December and
... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...
Almost a spider: a 305-million-year-old fossil arachnid and spider origins.
Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael
2016-03-30
Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.
Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.
McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G
2014-06-01
This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.
... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...
Ros, V.I.D.; Breeuwer, J.A.J.
2007-01-01
The past 15 years have witnessed a number of molecular studies that aimed to resolve issues of species delineation and phylogeny of mites in the family Tetranychidae. The central part of the mitochondrial COI region has frequently been used for investigating intra- and interspecific variation. All
... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...
Uma, Divya B; Weiss, Martha R
2012-12-01
An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.
Inactivation of dust mites, dust mite allergen, and mold from carpet.
Ong, Kee-Hean; Lewis, Roger D; Dixit, Anupma; MacDonald, Maureen; Yang, Mingan; Qian, Zhengmin
2014-01-01
Carpet is known to be a reservoir for biological contaminants, such as dust mites, dust mite allergen, and mold, if it is not kept clean. The accumulation of these contaminants in carpet might trigger allergies or asthma symptoms in both children and adults. The purpose of this study is to compare methods for removal of dust mites, dust mite allergens, and mold from carpet. Carpets were artificially worn to simulate 1 to 2 years of wear in a four-person household. The worn carpets were inoculated together with a common indoor mold (Cladosporium species) and house dust mites and incubated for 6 weeks to allow time for dust mite growth on the carpet. The carpets were randomly assigned to one of the four treatment groups. Available treatment regimens for controlling carpet contaminants were evaluated through a literature review and experimentation. Four moderately low-hazard, nondestructive methods were selected as treatments: vacuuming, steam-vapor, Neem oil (a natural tree extract), and benzalkonium chloride (a quaternary ammonium compound). Steam vapor treatment demonstrated the greatest dust mite population reduction (p 0.05) for both physical and chemical methods. The steam-vapor treatment effectively killed dust mites and denatured dust mite allergen in the laboratory environment.
Directory of Open Access Journals (Sweden)
PORAV Viorica
2014-05-01
Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.
Nyffeler, Martin; Knörnschild, Mirjam
2013-01-01
In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436
Nyffeler, Martin; Knörnschild, Mirjam
2013-01-01
In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.
Campbell, Alene
This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…
Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.
Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B
2011-10-01
Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.
... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...
Life cycle and reproduction of house-dust mites: environmental factors influencing mite populations.
Hart, B J
1998-01-01
An understanding of the life cycle of house-dust mites, as well as environmental factors influencing mite populations, can be exploited in mite control. The most important limiting factor for house-dust-mite populations is air humidity. House-dust mites osmoregulate through the cuticle and therefore require a high ambient air humidity to prevent excessive water loss. In addition, the supracoxal glands actively take up ambient water vapour, and the protonynph stage of the life cycle is resistant to desiccation. Larger house-dust-mite populations are found when the absolute indoor air humidity is above 7 g/kg (45% relative humidity at 20 degrees C). Consequently, ventilation by air-conditioning systems is being developed as a means of control. A number of other aspects of the domestic environment are also being manipulated in an integrated approach to render the habitat less suitable for mites. The potential exists for developing models for house-dust mite populations, environmental characteristics, and the effects of various approaches to control.
What you fear will appear: detection of schematic spiders in spider fear.
Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan
2010-01-01
Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.
... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...
Vacacela Ajila, Henry E; Ferreira, João A M; Colares, Felipe; Oliveira, Cleber M; Bernardo, Ana Maria G; Venzon, Madelaine; Pallini, Angelo
2018-01-01
Ricoseius loxocheles (De Leon) (Acari: Phytoseiidae) is often found in coffee crops and is known to feed on coffee leaf rust, Hemileia vastatrix Berkeley and Broome (Uredinales). As the occurrence of coffee leaf rust is limited primarily to the rainy season, the mite may use other food sources to survive during the periods of low pathogen prevalence. It is well known that phytoseiid mites can survive on a variety of food sources, such as herbivorous mites, fungi and pollen. We evaluated the ability of R. loxocheles to survive and reproduce on a diet of Brevipalpus phoenicis Geijskes (Acari: Tenuipalpidae), cattail pollen (Typha spp.), clover rust (Puccinia oxalidis), bee pollen (Santa Bárbara ® dehydrated pollen, Santa Bárbara, MG, Brazil) and coffee leaf rust. Ricoseius loxocheles did not survive or reproduce on any B. phoenicis stages tested (egg, larva, adult). The survival and oviposition of R. loxocheles were directly affected by the presence of coffee rust urediniospores, but not by the presence of the prey. Survival and oviposition of the phytoseiid were similar when fed cattail pollen, clover rust and coffee leaf rust but was lower when fed bee pollen. Our results show that R. loxocheles is not a predator of B. phoenicis but it is able to utilize other resources besides coffee leaf rust.
Choi, Won-Il; Lee, Sang-Geui; Park, Hyung-Man; Ahn, Young-Joon
2004-04-01
Fifty-three plant essential oils were tested for their toxicity against eggs and adults of Tetranychus urticae Koch as well as adults of Phytoseiulus persimilis Athias-Henriot, by using a filter paper diffusion bioassay without allowing direct contact. Responses varied according to oil type and dose, and mite species. In a plastic container (4.5 by 9.5 cm) bioassay at 14 x 10(-3) microl/ml air, caraway seed, citronella java, lemon eucalyptus, pennyroyal, and peppermint oils gave > 90% mortality against adult T. urticae, whereas 82 and 81% mortality was observed with sage and spearmint oils, respectively. With the exception of sage oil, the other six essential oils were highly effective against T. urticae eggs at 9.3 x 10(-3) microl/ml air. Against adult P. persimilis, these six test oils caused > 90% mortality at 7.1 x 10(-3) microl/ml air. Particularly peppermint oil at 4.7 x 10(-3) microl/ml air was highly toxic. In an acrylic cage (30 by 30 by 40 cm ) test, lemon eucalyptus, pennyroyal, peppermint, and spearmint oils were highly effective against adult T. urticae at 1.4 x 10(-3) microl/ml air. These results indicate that the mode of delivery of these essential oils was largely a result of action in the vapor phase via the respiratory system. The essential oils described herein merit further study as potential fumigants for T. urticae control.
Primeiro registro de Tetranychus urticae (Acari: Tetranychidae em mudas de teca no Brasil
Directory of Open Access Journals (Sweden)
Alexandre dos Santos
2014-07-01
Full Text Available O ácaro fitófago Tetranychus urticae (Kock, 1836 (Acari: Tetranychidae foi relatado e suas injúrias caracterizadas pela primeira vez em viveiro de produção mudas de teca (Tectona grandis no Brasil.
Ebadollahi, Asgar; Sendi, Jalal Jalali; Maroufpoor, Mostafa; Rahimi-Nasrabadi, Mehdi
2017-03-01
There is a rapid growth in the screening of plant materials for finding new bio-pesticides. In the present study, the essential oils of E. oleosa and E. torquata leaves were extracted using a Clevenger apparatus and their chemical profiles were investigated by Gas Chromatography-Mass Spectrometry (GC-MS). Among identified compounds, the terpenes had highest amount for both essential oils; 93.59% for E. oleosa and 97.69% for E. torquata. 1,8-Cineole (31.96%), α-pinene (15.25%) and trans-anethole (7.32%) in the essential oil of E. oleosa and 1,8-cineole (28.57%), α-pinene (15.74%) and globulol (13.11%) in the E. torquata essential oil were identified as the main components. The acaricidal activity of the essential oils of E. oleosa and E. torquata were examined using fumigation methods against the adult females of Tetranychus urticae Koch. The essential oils have potential acaricidal effects on T. urticae. The essential oil of E. oleosa with LC 50 value of 2.42 µL/L air was stronger than E. torquata. A correlation between log concentration and mite mortality has been observed. Based on the results of present study, it can be stated that the essential oils of E. oleosa and E. torquata have a worthy potential in the management of T. urticae.
Held, D W; Potter, D A; Gates, R S; Anderson, R G
2001-04-01
Incidental transport of arthropods on plant material can be a significant mode of pest entry into greenhouses. We evaluated the use of controlled atmosphere treatments as a potential way to eliminate arthropod pests on plant propagules (i.e., cuttings or small rooted plants). Lethal exposures to CO2 or N2 were determined for common greenhouse pests including fungus gnat larvae, Bradysia sp.; green peach aphid, Myzus persicae (Sulzer); sweetpotato whitefly, Bemisia sp.; twospotted spider mite, Tetranychus urticae Koch; and western flower thrips, Frankliniella occidentalis (Pergande). We also studied the effect of pest species, life stage, and presence or absence of plants on efficacy of modified atmosphere treatments. Finally, effects of modified atmospheres on plant quality were evaluated for several bedding plant species including begonia, Begonia semperflorens-cultorum Hort. 'Cocktail Series', chrysanthemum, Dendranthema grandiflora Tzvelev., geranium, Pelargonium X hortorum L.H. Bailey, and impatiens, Impatiens wallerana Hook f., and among cultivars of geranium and chrysanthemum. Exposure for 12-18 h to >99% N2 or CO2 caused complete mortality of aphids, mites, thrips, and whiteflies. Fungus gnat larvae were more tolerant of hypoxic conditions. Adult mites and eggs were equally susceptible. For most pests, there was no difference in response to atmospheres modified by CO2 or N2. However, there was variation in response among plant species and cultivars, with effects ranging from delayed flowering to mortality. Despite the possibility of adverse effects on some plants, this work indicates that use of modified atmospheres has potential to eliminate arthropod pests on plant propagules before they are introduced into greenhouses.
THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS
Cross, Fiona R.; Jackson, Robert R.
2016-01-01
Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057
Tsolakis, H; Ragusa, S
2008-06-01
Laboratory trials were carried out to evaluate the toxicity and the influence of a commercial mixture of vegetal, essential oils, and potassium salts of fatty acids (Acaridoil 13SL) on the population growth rate (r(i)--instantaneous rate of increase) of two mite species, the phytophagous Tetranychus urticae Koch and the predator Phytoseiulus persimilis Athias-Henriot. A residue of 1.3 mg/cm(2) of pesticide solution was harmless for Ph. persimilis eggs, while a moderate mortality of eggs and of larvae from treated eggs of T. urticae, was observed (53.8%). The pesticide also caused a delay in the postembryonic development of the tetranychid. Moreover, 83.4% mortality was reported for treated females tetranychids and only 24.0% for Ph. persimilis females. The pesticide influenced negatively the population growth of T. urticae which showed a very low rate of increase (r(i)=0.07), compared to that obtained in the control (r(i)=0.68). The pesticide did not affect negatively the reproductive potential of Ph. persimilis (r(i)=0.54 and r(i)=0.57 for test and control, respectively). These results suggest a considerable acaricidal activity of potassium salts of fatty acids and caraway oil on T. urticae and a good selectivity on Ph. persimilis.
Directory of Open Access Journals (Sweden)
Silvana D Del V. Figueroa
2011-12-01
Full Text Available Solanum chenopodioides Lam., conocida como "hierba mora", es una hierba o subarbusto ampliamente distribuido en Argentina y otras zonas de Sudamérica y es una maleza sumamente tóxica para el ganado. Sus hojas tienen propiedades medicinales y son utilizadas como sedante y en oftalmología. Es frecuente el ataque de sus hojas por ácaros fitófagos y por insectos minadores. El objetivo del presente trabajo fue analizar la morfología y la anatomía de las hojas en plantas sanas e infestadas por ácaros (Tetranychidae, Tetranychus sp. y dípteros minadores de la hoja (Agromyzidae. Los resultados muestran que el ataque de ambos agentes reduce significativamente el volumen del tejido fotosintético por excelencia. Así, se compromete el crecimiento, y por lo tanto la supervivencia de la especie. Aún más, en caso de ser utilizada como especie medicinal se afecta la calidad del principio activo.Solanum chenopodioides Lam., known as "nightshade", is a herb or subshrub widely distributed in Argentina and another zones of South America, and is a weed highly toxic to livestock. Its leaves have medicinal properties and are used as a sedative and in ophthalmology. The attack of its leaves by phytophagous mites and leafminer insects is frequent. The aim of this study was to analyze the morphology and the anatomy of the leaves of both healthy and infested plants by Tetranychidae, Tetranychus sp. mites and Agromyzidae leafminer diptera. The results show that the attack of both agents significantly reduces the amount of photosynthetic tissue par excellence. Thus, growth is compromised, and therefore the survival of the species. Moreover, when used as medicinal species, the quality the active principle is affected.
Mulaik, Stanley B.
1990-01-01
Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)
International Nuclear Information System (INIS)
Ignatowicz, S.
1997-01-01
Viable eggs of the European red mite, Panonychus ulmi (Koch), on apples have been the concern of several importing countries and exports require preshipment, phytosanitary treatment to reduce or eliminate live eggs. Because fumigation is often detrimental to the commodity appearance and shelf-life, resulting in a loss of commercial value, there is a need for alternatives for chemical pest control as a quarantine treatment, and irradiation could be a new strategy method. The data obtained indicate that a dose of gamma radiation equal to or higher than 0.15 kGy seems to be adequate to prevent post-diapause hatching of wintering eggs of the European red mite. Thus, this dose is suggested for quarantine treatment of apples infested with wintering eggs of the European red mite. (author)
The evolution of sociality in spiders
DEFF Research Database (Denmark)
Lubin, Yael; Bilde, T.
2007-01-01
. Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...
Costello, Michael J
2007-01-01
: Tydeidae) was 2.7 times higher in 'sulfur pre-bloom' compared to 'sulfur,' and higher by 2.7 times in 'DMI' compared to 'sulfur post-bloom,' suggesting a negative effect of sulfur on this tydeid. These results do not support the hypotheses that the cause of the increase in T. pacificus density is due to negative effects of sulfur on phytoseiids or tydeids. Rather, it appears that a plant-based explanation is likely, first, because of the differences in pre-bloom versus post-bloom sulfuring, and second, because of the long lag time between the end of the sulfur applications and the corresponding increase in spider mite density.
Non-webbuilding spiders: prey specialists or generalists?
Nentwig, Wolfgang
1986-07-01
Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.
Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O
2014-01-01
In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.
Science Education Resources on the Web--Spiders.
Thirunarayanan, M. O.
1997-01-01
Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…
Aquatic subsidies transport anthropogenic nitrogen to riparian spiders
Energy Technology Data Exchange (ETDEWEB)
Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)
2011-05-15
Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.
Aquatic subsidies transport anthropogenic nitrogen to riparian spiders
International Nuclear Information System (INIS)
Akamatsu, Fumikazu; Toda, Hideshige
2011-01-01
Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.
Radiation effect onto biodiversity of spiders
International Nuclear Information System (INIS)
Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.
2010-01-01
At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.
Energetics, scaling and sexual size dimorphism of spiders.
Grossi, B; Canals, M
2015-03-01
The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.
Spiders do have melanin after all.
Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D
2015-11-01
Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.
Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg
2009-03-04
The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.
Directory of Open Access Journals (Sweden)
Carlos Augusto Hincapié Ll
2008-12-01
Full Text Available Tetranychus urticae Koch is a pest that causes great economic losses because it attacks a wide range of host plants. Also, some populations have developed resistance against commercial acaricides. This work compares different extracts from garlic (Allium sativum L. bulbs measuring their toxicity and repellency effects on T. urticae. Extracts were obtained using as solvents CO2 in supercritical conditions (CSC, ethanol and petroleum ether using soxhlet and soaking methods and soaking in water. The supercritical fluid extraction technique allows for obtaining extracts at low temperature using high pressures, avoiding compound degradation and making possible solvent separation by exposing the extract at room temperature. Mites were bred on bean plants (Phaseolus vulgaris L. in a laboratory environment in Laureles Campus, Universidad Pontificia Bolivariana, Medellín, Colombia. Mortality was evaluated putting 10 mites in P. vulgaris 3 cm diameter leaf discs previously submersed in the extract. The lowest mean lethal concentrations (LC50 were obtained with the CSC method (8.1188, 5.4105, 2.8206 mg g-1 at 24, 48 and 72 h, respectively. Extracts were characterized using gas chromatography/mass spectrometry (GC/MS, finding vinyl dithiins (63.11%, diallyl disulfide (10.88% and diallyl trisulfide (10.4% as the main compounds in the CSC extract. The main conclusion is that, in comparison with other techniques of extraction from garlic bulbs used in this study, supercritical fluids allow for obtaining extracts with a higher concentration of biologically active compounds against T. urticae.Tetranychus urticae Koch es una plaga que causa grandes pérdidas económicas porque ataca un numeroso grupo de cultivos. Además, algunas poblaciones han desarrollado resistencia a acaricidas comerciales. Este trabajo compara diferentes extractos a partir de bulbos de ajo (Allium sativum L. a través de su toxicidad y repelencia sobre T. urticae. Los extractos se
Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.
Vetter, Richard S
2011-06-01
Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.
Homma, R; Ando, T; Miyahara, A; Kimura, H; Ito, G; Uesato, N; Ino, Y; Iwaki, M
1994-12-01
We have examined the antigenic relationship between the house dust mite Dermatophagoides farinae and the predacious mite Phytoseiulus persimilis. Immunoblotting analysis demonstrated that there was a very weak antigenic cross-reactivity between these different suborder of mites but that this cross-reactivity was not attributed to D. farinaes major allergen's, Der fI and Der fII. These results suggest that P. persimilis might scarcely provoke allergic symptoms in patients sensitized to house dust mites.
Guzman-Novoa, Ernesto; Emsen, Berna; Unger, Peter; Espinosa-Montaño, Laura G; Petukhova, Tatiana
2012-07-01
The objective of this study was to demonstrate genotypic variability and analyze the relationships between the infestation levels of the parasitic mite Varroa destructor in honey bee (Apis mellifera) colonies, the rate of damage of fallen mites, and the intensity with which bees of different genotypes groom themselves to remove mites from their bodies. Sets of paired genotypes that are presumably susceptible and resistant to the varroa mite were compared at the colony level for number of mites falling on sticky papers and for proportion of damaged mites. They were also compared at the individual level for intensity of grooming and mite removal success. Bees from the "resistant" colonies had lower mite population rates (up to 15 fold) and higher percentages of damaged mites (up to 9 fold) than bees from the "susceptible" genotypes. At the individual level, bees from the "resistant" genotypes performed significantly more instances of intense grooming (up to 4 fold), and a significantly higher number of mites were dislodged from the bees' bodies by intense grooming than by light grooming (up to 7 fold) in all genotypes. The odds of mite removal were high and significant for all "resistant" genotypes when compared with the "susceptible" genotypes. The results of this study strongly suggest that grooming behavior and the intensity with which bees perform it, is an important component in the resistance of some honey bee genotypes to the growth of varroa mite populations. The implications of these results are discussed. Copyright © 2012 Elsevier Inc. All rights reserved.
Spider and burnable poison rod combinations
International Nuclear Information System (INIS)
Edwards, G.T.; Schluderberg, D.C.
1980-01-01
An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)
Are temperate canopy spiders tree-species specific?
Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas
2014-01-01
Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.
Fish predation by semi-aquatic spiders: a global pattern.
Directory of Open Access Journals (Sweden)
Martin Nyffeler
Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.
Fish predation by semi-aquatic spiders: a global pattern.
Nyffeler, Martin; Pusey, Bradley J
2014-01-01
More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.
Horiuchi, J.I.; Arimura, G.I.; Ozawa, R.; Shimoda, T.; Dicke, M.; Takabayashi, J.; Nishioka, T.
2003-01-01
We tested the response of the herbivorous mite Tetranychus urticae to uninfested lima bean leaves exposed to herbivore-induced conspecific plant volatiles by using a Y-tube olfactometer. First, we confirmed that exposed uninfested leaves next to infested leaves were more attractive to carnivorous
Evidence for competition between carnivorous plants and spiders.
Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R
2010-10-07
Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.
Heuts, B.; Brunt, T.
2009-01-01
We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species
Approach and avoidance in fear of spiders
Rinck, M.; Becker, E.S.
2007-01-01
We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or
Learning to avoid spiders: fear predicts performance, not competence.
Luo, Xijia; Becker, Eni S; Rinck, Mike
2018-01-05
We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.
Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.
Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf
2009-06-01
Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.
Kim, Ok-Kyung; Ishikawa, Tadashi; Yamada, Yoshihiro; Sato, Takuma; Shinohara, Hirosuke; Takahata, Ken
2017-01-01
The solanaceous fruit crop pepino ( Solanum muricatum Ait.), originating in the Andes, is grown commercially in South American countries and New Zealand. In these areas, pests and diseases of pepino have been identified well; however, to date, these have seldom been investigated in detail in Japan. Herein, we attempt to reconstruct an agricultural production system for commercial pepino crops in Japan, and evaluate the incidence of pests and viral diseases on pepino. The findings of this study will facilitate in developing a better crop system for the commercial cultivation of healthy pepino fruits. A total of 11 species, comprising nine insects and two mites, were recognized as pests of pepino plants in our experimental fields in Kanagawa Prefecture, central Honshu, Japan. Of these pest species, the two-spotted spider mite Tetranychus urticae Koch, 1836 and the cotton aphid Aphis gossypii Glover, 1877, were remarkably abundant than the other pest species. Eventually, 13 species, including two previously recorded, are currently recognized as the pests of pepino in Japan. With regard to viruses, we tested two species Alfalfa mosaic virus (AMV) and Cucumber mosaic virus (CMV), as well as three genera Carlavirus , Potexvirus , and Potyvirus . No virus was detected in symptomatic pepino leaves collected in our experimental fields. This is a first report on the identification of pests on pepino plants in Kanagawa Prefecture, Japan and elucidates the relationship between currently occurring pests of pepino plants and potential viral pathogens that they can transmit.
Diurnal temperature variations affect development of a herbivorous arthropod pest and its predators.
Directory of Open Access Journals (Sweden)
Dominiek Vangansbeke
Full Text Available The impact of daily temperature variations on arthropod life history remains woefully understudied compared to the large body of research that has been carried out on the effects of constant temperatures. However, diurnal varying temperature regimes more commonly represent the environment in which most organisms thrive. Such varying temperature regimes have been demonstrated to substantially affect development and reproduction of ectothermic organisms, generally in accordance with Jensen's inequality. In the present study we evaluated the impact of temperature alternations at 4 amplitudes (DTR0, +5, +10 and +15°C on the developmental rate of the predatory mites Phytoseiulus persimilis Athias-Henriot and Neoseiulus californicus McGregor (Acari: Phytoseiidae and their natural prey, the two-spotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae. We have modelled their developmental rates as a function of temperature using both linear and nonlinear models. Diurnally alternating temperatures resulted in a faster development in the lower temperature range as compared to their corresponding mean constant temperatures, whereas the opposite was observed in the higher temperature range. Our results indicate that Jensen's inequality does not suffice to fully explain the differences in developmental rates at constant and alternating temperatures, suggesting additional physiological responses play a role. It is concluded that diurnal temperature range should not be ignored and should be incorporated in predictive models on the phenology of arthropod pests and their natural enemies and their performance in biological control programmes.
Diurnal Temperature Variations Affect Development of a Herbivorous Arthropod Pest and its Predators
Vangansbeke, Dominiek; Audenaert, Joachim; Nguyen, Duc Tung; Verhoeven, Ruth; Gobin, Bruno; Tirry, Luc; De Clercq, Patrick
2015-01-01
The impact of daily temperature variations on arthropod life history remains woefully understudied compared to the large body of research that has been carried out on the effects of constant temperatures. However, diurnal varying temperature regimes more commonly represent the environment in which most organisms thrive. Such varying temperature regimes have been demonstrated to substantially affect development and reproduction of ectothermic organisms, generally in accordance with Jensen’s inequality. In the present study we evaluated the impact of temperature alternations at 4 amplitudes (DTR0, +5, +10 and +15°C) on the developmental rate of the predatory mites Phytoseiulus persimilis Athias-Henriot and Neoseiulus californicus McGregor (Acari: Phytoseiidae) and their natural prey, the two-spotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae). We have modelled their developmental rates as a function of temperature using both linear and nonlinear models. Diurnally alternating temperatures resulted in a faster development in the lower temperature range as compared to their corresponding mean constant temperatures, whereas the opposite was observed in the higher temperature range. Our results indicate that Jensen’s inequality does not suffice to fully explain the differences in developmental rates at constant and alternating temperatures, suggesting additional physiological responses play a role. It is concluded that diurnal temperature range should not be ignored and should be incorporated in predictive models on the phenology of arthropod pests and their natural enemies and their performance in biological control programmes. PMID:25874697
Directory of Open Access Journals (Sweden)
Wendel José Teles Pontes
2007-08-01
Full Text Available The essential oils of the leaves and fruits obtained by hydrodistillation of Xylopia sericea, collected in the restinga area of Pernambuco, were analyzed by GC (HP 5890 SERIES II and GC/MS (HP 5890B SERIES II/ MSD 5971. A major part of the volatile components identified in the oils of fruits and leaves were monoterpenes and sesquiterpenes. Cubenol (57.43% and alpha-epi-muurolol (26.09% were the main compounds found in the leaves, whereas beta-pinene (45.59% and alpha-pinene (17.18% were the fruits major components. The acaricidal activity of the essential oils was evaluated for Tetranychus urticae. The oil of the leaves was more active than that of the fruits showing an LC50 value of 4.08 µL/L of air for a 72 h period.
Balancing in- and out-breeding by the predatory mite Phytoseiulus persimilis.
Atalay, Demet; Schausberger, Peter
2018-02-01
In- and out-breeding depressions are commonly observed phenomena in sexually reproducing organisms with a patchy distribution pattern, and spatial segmentation and/or isolation of groups. At the genetic level, inbreeding depression is due to increased homozygosity, whereas outbreeding depression is due to inferior genetic compatibility of mates. Optimal outbreeding theory suggests that intermediate levels of mate relatedness should provide for the highest fitness gains. Here, we assessed the fitness consequences of genetic relatedness between mates in plant-inhabiting predatory mites Phytoseiulus persimilis, which are obligatory sexually reproducing but haplo-diploid. Both females and males arise from fertilized eggs but males lose the paternal chromosome set during embryogenesis, dubbed pseudo-arrhenotoky. Phytoseiulus persimilis are highly efficacious in reducing crop-damaging spider mite populations and widely used in biological control. Using iso-female lines of two populations, from Sicily and Greece, we assessed the fecundity of females, and sex ratio of their offspring, that mated with either a sibling, a male from the same population or a male from the other population. Additionally, we recorded mating latency and duration. Females mating with a male from the same population produced more eggs, with a lower female bias, over a longer time than females mating with a sibling or with a male from the other population. Mating latency was unaffected by mate relatedness; mating duration was disproportionally long in sibling couples, likely indicating female reluctance to mate and sub-optimal spermatophore transfer. Our study provides a rare example of in- and out-breeding depression in a haplo-diploid arthropod, supporting the optimal outbreeding theory.
Uncovering the structure-function relationship in spider silk
Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan
2018-03-01
All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.
Animal coloration: sexy spider scales.
Taylor, Lisa A; McGraw, Kevin J
2007-08-07
Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.
Time-dependent motor properties of multipedal molecular spiders.
Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R
2011-09-01
Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.
Azandémè Hounmalon, Ginette Y; Maniania, Nguya K; Niassy, Saliou; Fellous, Simon; Kreiter, Serge; Delétré, Emilie; Fiaboe, Komi K; Martin, Thibaud
2018-05-13
Tetranychus evansi (Te) is an exotic pest of solanaceous crops in Africa. The predatory mite Phytoseiulus longipes (Pl) and the fungus Metarhizium anisopliae (Ma), are potential biocontrol agents of Te. The present study investigated efficacy of fungus-treated foam placed above or below the third Te-infested tomato leaf. The persistence of fungus-treated foam and the performance of Pl with or without fungus-treated foam were evaluated. The fungus-treated foam was effective when Te infestation was below the third tomato leaf as no damage was recorded on all upper tomato leaves up to 30 days post-treatment. However, in the control treatments, the infestation increased considerably from 9±0.3% to 100±0% at 15 days post-treatment. The reuse of the fungus-treated foam at 15, 30 and 45 days post-treatment resulted in 19±1.4%, 25±1.2% and 54±2.1% respective infestation by Te. The fungus-treated foam and Pl alone are efficient, but there is no benefit to combinting both against Te. The fungus-treated foam is an effective method to optimize the use of Ma in screenhouse conditions. These two control agents could be integrated in an IPM strategy for crops protection. However, these results need to be confirmed in large field trials. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.
Kindt, M.; Brosschot, J.F.
1999-01-01
Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28
Pepato, A R; Klimov, P B
2015-09-02
Acariformes is the most species-rich and morphologically diverse radiation of chelicerate arthropods, known from the oldest terrestrial ecosystems. It is also a key lineage in understanding the evolution of this group, with the most vexing question whether mites, or Acari (Parasitiformes and Acariformes) is monophyletic. Previous molecular studies recovered Acari either as monophyletic or non-monophyletic, albeit with a limited taxon sampling. Similarly, relationships between basal acariform groups (include little-known, deep-soil 'endeostigmatan' mites) and major lineages of Acariformes (Sarcoptiformes, Prostigmata) are virtually unknown. We infer phylogeny of chelicerate arthropods, using a large and representative dataset, comprising all main in- and outgroups (228 taxa). Basal diversity of Acariformes is particularly well sampled. With this dataset, we conduct a series of phylogenetically explicit tests of chelicerate and acariform relationships and present a phylogenetic framework for internal relationships of acariform mites. Our molecular data strongly support a diphyletic Acari, with Acariformes as the sister group to Solifugae (PP =1.0; BP = 100), the so called Poecilophysidea. Among Acariformes, some representatives of the basal group Endeostigmata (mainly deep-soil mites) were recovered as sister-groups to the remaining Acariformes (i. e., Trombidiformes + and most of Sarcoptiformes). Desmonomatan oribatid mites (soil and litter mites) were recovered as the monophyletic sister group of Astigmata (e. g., stored product mites, house dust mites, mange mites, feather and fur mites). Trombidiformes (Sphaerolichida + Prostigmata) is strongly supported (PP =1.0; BP = 98-100). Labidostommatina was inferred as the basal lineage of Prostigmata. Eleutherengona (e. g., spider mites) and Parasitengona (e. g., chiggers, fresh water mites) were recovered as monophyletic. By contrast, Eupodina (e. g., snout mites and relatives) was not. Marine mites (Halacaridae) were
Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches
2014-06-01
The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.
Walzer, A; Paulus, H F; Schausberger, P
2004-12-01
In greenhouse agroecosystems, a guild of spider mite predators may consist of the oligophagous predatory mite Phytoseiulus persimilis Athias-Henriot, the polyphagous predatory mite Neoseiulus californicus McGregor (both Acari: Phytoseiidae) and the primarily herbivorous but facultatively predatory western flower thrips Frankliniella occidentalis Pergande (Thysanoptera: Thripidae). Diet-specialization and the predator body size relative to prey are crucial factors in predation on F. occidentalis by P. persimilis and N. californicus. Here, it was tested whether the relevance of these factors changes during predator ontogeny. First, the predator (protonymphs and adult females of P. persimilis and N. californicus): prey (F. occidentalis first instars) body size ratios were measured. Second, the aggressiveness of P. persimilis and N. californicus towards F. occidentalis was assessed. Third, survival, development and oviposition of P. persimilis and N. californicus with F. occidentalis prey was determined. The body size ranking was P. persimilis females > N. californicus females > P. persimilis protonymphs > N. californicus protonymphs. Neoseiulus californicus females were the most aggressive predators, followed by highly aggressive N. californicus protonymphs and moderately aggressive P. persimilis protonymphs. Phytoseiulus persimilis females did not attack thrips. Frankliniella occidentalis larvae are an alternative prey for juvenile N. californicus and P. persimilis, enabling them to reach adulthood. Females of N. californicus but not P. persimilis sustained egg production with thrips prey. Within the guild studied here, N. californicus females are the most harmful predators for F. occidentalis larvae, followed by N. californicus and P. persimilis juveniles. Phytoseiulus persimilis females are harmless to F. occidentalis.
Intra-seasonal Strategies Based on Energy Budgets in a Dynamic Predator-Prey Game
Staňková, K.; Abate, A.; Sabelis, M.W.; Křivan, V.; Zaccour, G.
2013-01-01
We propose a game-theoretical model to describe intra-seasonal predator-prey interactions between predatory mites (Acari: Phytoseiidae) and prey mites (also called fruit-tree red spider mites) (Acari: Tetranychidae) that feed on leaves of apple trees. Its parameters have been instantiated based on
DEFF Research Database (Denmark)
Pakyari, Hajar; Enkegaard, Annie
2015-01-01
consumption rates of exposed females of Scolothrips longicornis Priesner and their offspring when fed on Tetranychus urticae Koch eggs. Prey consumption of female thrips was significantly affected by treatment with all concentrations of the two pesticides with the effect of fenpropathrin being more severe...
Wu, Ke; Hoy, Marjorie A.
2014-01-01
Clathrin heavy chain has been shown to be important for viability, embryogenesis, and RNA interference (RNAi) in arthropods such as Drosophila melanogaster. However, the functional roles of clathrin heavy chain in chelicerate arthropods, such as the predatory mite Metaseiulus occidentalis, remain unknown. We previously showed that dsRNA ingestion, followed by feeding on spider mites, induced systemic and robust RNAi in M. occidentalis females. In the current study, we performed a loss-of-function analysis of the clathrin heavy chain gene in M. occidentalis using RNAi. We showed that ingestion of clathrin heavy chain dsRNA by M. occidentalis females resulted in gene knockdown and reduced longevity. In addition, clathrin heavy chain dsRNA treatment almost completely abolished oviposition by M. occidentalis females and the few eggs produced did not hatch. Finally, we demonstrated that clathrin heavy chain gene knockdown in M. occidentalis females significantly reduced a subsequent RNAi response induced by ingestion of cathepsin L dsRNA. The last finding suggests that clathrin heavy chain may be involved in systemic RNAi responses mediated by orally delivered dsRNAs in M. occidentalis. PMID:25329675
Maternal care and subsocial behaviour in spiders.
Yip, Eric C; Rayor, Linda S
2014-05-01
While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.
Checklist of spider fauna of FR Peshawar, FATA, Pakistan
Directory of Open Access Journals (Sweden)
F. Perveen
2012-03-01
Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.
DEFF Research Database (Denmark)
Bilde, T.; Maklakov, A.A.; Schilling, Nadia
2007-01-01
avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...
Understanding Spider-Man: Your Everyday Superhero
Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm
2014-01-01
This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...
Directory of Open Access Journals (Sweden)
Emilia Siwak
2014-04-01
Full Text Available Mite allergens belong to the group of inhalant allergens and represent antigenic substances which are particutlarly important in the pathogenesis of respiratory system diseases and skin diseases. The most common diseases associated with chronic exposure to these aeroallergens include: allergic rhinitis, bronchial asthma and atopic dermatitis. Mite allergens are simple proteins or glycoproteins with different molecular structures and various biochemical functions. The sensitizing capacity of these proteins is connected from their physicochemical properties. Individual allergens perform, among others, the functions of structural proteins, act as enzymes, transport lipids, bind metal ions, and are capable of glycosylation. In addition, mite allergenic proteases degrade proteins of the skin epithelium-resulting in a weakening of its natural protective barrier-and induce the immune response. The proteases also induce the release of pro-inflammatory cytokines: interleukin-4 (IL-4, interleukin 6 (IL-6, interleukin 8 (IL-8, eotaxin, and granulocyte-macrophage colony-stimulating factor-GM-CSF. The article presents the tertiary structure of major and mid-range mite allergens and their classification. Based on literature reports concerning the chemical structure of allergenic proteins, it was emphasized that the structural differences between homologous proteins with allergenic pozoproperties relate to the distribution of amino acid residues on the surface of the molecule. IgE binding affinity and the similarities and differences in the amino acid sequence of the allergens were also the basis for determining cross-reactivity of allergenic proteins. The paper shows an example of this phenomenon, describing the existence of common allergens for various mite species.
Possibility in application of electron beam irradiation to plant quarantine of cut flowers
International Nuclear Information System (INIS)
Tanabe, Kazuo
1994-01-01
For the purpose of developing new quarantine procedure alternative to fumigation, electron beam irradiation was examined in the disinfestation of arthroped pests that infest cut flowers. Immature and adult two-spotted spider mites, Tetranychus urticae, which is a typical pest in horticulture due to high fertility, parthenogenesis and chemical resistance, were irradiated at a Van de graaf electron accelerator (2.5 MeV) at 0.2 - 1.4 kGy. They decreased radiosensitivity with aging. Female was much more tolerant than male throughout their life. Irradiation controlled the fertility of both sexes, and also feeding and behavioral activities. Cut flowers irradiated with the Dynamitron accelerator (5 MeV) showed various responses according to species, cultivars and tissues of plants. Carnations, tulips and gladioluses were tolerant in disinfesting or sterilizing, but some cultivars of chrysanthemum and rose showed the symptom of injury, in which flowering was delayed at low dose, and the failure of flowering and the chlorosis of leaves occurred at high dose. Floral organs were much more sensitive to radiation than others. Sensitive plants also showed the reduced production of ethylene. (K.I.)
House dust mite control measures for asthma
DEFF Research Database (Denmark)
Gøtzsche, Peter C.; Johansen, Helle Krogh
2008-01-01
BACKGROUND: The major allergen in house dust comes from mites. Chemical, physical and combined methods of reducing mite allergen levels are intended to reduce asthma symptoms in people who are sensitive to house dust mites. OBJECTIVES: To assess the effects of reducing exposure to house dust mite...... antigens in the homes of people with mite-sensitive asthma. SEARCH STRATEGY: PubMed and The Cochrane Library (last searches Nov 2007), reference lists. SELECTION CRITERIA: Randomised trials of mite control measures vs placebo or no treatment in people with asthma known to be sensitive to house dust mites......), the standardised mean difference was 0.00 (95% confidence interval (CI) -0.10 to 0.10). There were no statistically significant differences either in number of patients improved (relative risk 1.01, 95% CI 0.80 to 1.27), asthma symptom scores (standardised mean difference -0.04, 95% CI -0.15 to 0...
Anti-mite measurements in mite-sensitive adult asthma. A controlled trial.
Burr, M L; St Leger, A S; Neale, E
1976-02-14
A cross-over controlled trial has been conducted among 32 adult patients with mite-sensitive asthma. The bedclothes and pillows of each subject were laundered and vacuum-cleaned and a plastic cover applied to the mattress for six weeks in an attempt to reduce exposure to mites. No improvement in daily peak-flow reading or drug usage was found in comparison with a control period.
Directory of Open Access Journals (Sweden)
Sidney G. Azevedo
2018-05-01
Full Text Available The present study was carried out to evaluate an alternative controlling agent for greenhouse pests and the yellow fever mosquito larvae. The potential bioactivity of Licaria puchury-major (Mart. Kosterm. (“puxuri” was evaluated here against three most common pests in tropical and subtropical countries: Aedes aegypti Linn. Larvae, Tetranychus urticae Koch. mites and Cerataphis lataniae Boisd. aphids. The essential oil from seeds was analyzed by GC-FID and GC-MS. The major compounds were safrole (38.8% and eucalyptol (21.7%. Phenylpropanes (51.7% was the main group of compounds and oxygenated monoterpenes represented 28.8% of the total oil. The essential oil has shown no inhibition of acetylcholinesterase (AChE in the tested concentrations. However, potential antioxidant activities were evaluated by different methods [DPPH: LD 50 = (27.8 ± 1.0 µg/.mL; ABTS: (977.3 ± 25.2 µM TEs/g (Trolox Equivalents; FRAP: (548.2 ± 29.0 µM Fe(II/g]. A significant larvicidal potential for 24 h of exposure was observed with LD 50 = 98.9 µg/mL, being an indicative that the larval mortality may occur by ingestion or contact due to the no inhibition against AChE. Volatile phase effects were evaluated against T. urticae Koch. and C. lataniae Boisd. and LD 50 were found about 30.8 and 13.5 µg/mL , respectively. These results are consistent with an octopaminergic effect , since some phenylpropanoids (such as Safrole, identified as the major compound in this work can block octopamine, a multi-functional, naturally occurring biogenic amine. Then, this study clearly illustrated the efficacy of the investigated seeds, which encourages the development of a new potential natural controlling agent against these common pests due to the abundance of these seeds in the Amazon region and to the high essential oil yield .
Walzer, Andreas; Schausberger, Peter
2013-01-01
Intraguild (IG) prey is commonly confronted with multiple IG predator species. However, the IG predation (IGP) risk for prey is not only dependent on the predator species, but also on inherent (intraspecific) characteristics of a given IG predator such as its life-stage, sex or gravidity and the associated prey needs. Thus, IG prey should have evolved the ability to integrate multiple IG predator cues, which should allow both inter- and intraspecific threat-sensitive anti-predator responses. Using a guild of plant-inhabiting predatory mites sharing spider mites as prey, we evaluated the effects of single and combined cues (eggs and/or chemical traces left by a predator female on the substrate) of the low risk IG predator Neoseiulus californicus and the high risk IG predator Amblyseius andersoni on time, distance and path shape parameters of the larval IG prey Phytoseiulus persimilis. IG prey discriminated between traces of the low and high risk IG predator, with and without additional presence of their eggs, indicating interspecific threat-sensitivity. The behavioural changes were manifest in distance moved, activity and path shape of IG prey. The cue combination of traces and eggs of the IG predators conveyed other information than each cue alone, allowing intraspecific threat-sensitive responses by IG prey apparent in changed velocities and distances moved. We argue that graded responses to single and combined IG predator cues are adaptive due to minimization of acceptance errors in IG prey decision making. PMID:23750040
Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang
2015-09-24
A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.
Directory of Open Access Journals (Sweden)
Wenjin Gan
2015-10-01
Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.
Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H
2017-06-30
This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.
Weber, Marjorie G; Porturas, Laura D; Taylor, Scott A
2016-09-01
Mite domatia are small structures on the underside of plant leaves that provide homes for predacious or fungivorous mites. In turn, mites inhabiting domatia defend the plant by consuming leaf herbivores and pathogens, which can result in a domatia-mediated, plant-mite defence mutualism. Several recent studies have suggested that plants receive enhanced benefits when they provide a foliar food source, such as sugars secreted from extrafloral nectaries, to mite mutualists alongside mite domatia. However, the effect of foliar sugar on reducing leaf pathogen load via domatia-inhabiting mites has not been directly investigated. To fill this gap, the links between foliar sugar addition, domatia-inhabiting mite abundance, and pathogen load were experimentally evaluated in wild grape. Furthermore, because the proposed combined benefits of providing food and housing have been hypothesized to select for the evolutionary correlation of extrafloral nectaries and domatia across plant lineages, a literature survey aimed at determining the overlap of mite domatia and extrafloral nectaries across plant groups was also conducted. It was found that leaves with artificial addition of foliar sugar had 58-80 % more mites than leaves without foliar sugar addition, and that higher mite abundances translated to reduced powdery mildew (Erysiphe necator) loads on leaves. It was found that mite domatia and extrafloral nectaries occur non-randomly in the same clades across Eudicots. Genera with both traits are reported to highlight candidate lineages for future studies. Together, the results demonstrate that foliar sugar can indeed enhance the efficacy of domatia-mediated plant-mite mutualisms, and suggest that this synergism has the potential to influence the co-distribution of foliar nectar and mite domatia across plants. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
2006-03-02
water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England
Sex-specific kleptoparasitic foraging in ant-eating spiders
DEFF Research Database (Denmark)
Martisová, Martina; Bilde, T.; Pekar, Stano
2009-01-01
. To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...
Huijdlng, J; de Jong, PJ; Huijding, J.
This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and
Audenaert, J; Vangansbeke, D; Verhoeven, R; De Clercq, P; Tirry, L; Gobin, B
2014-01-01
Predatory mites like Phytoseiulus persimilis Athias-Henriot, Neoseiulus californicus McGregor and N. fallacis (Garman) (Acari: Phytoseiidae) are essential in sustainable control strategies of the two-spotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae) in warm greenhouse cultures to complement imited available pesticides and to tackle emerging resistance. However, in response to high energy prices, greenhouse plant breeders have recently changed their greenhouse steering strategies, allowing more variation in temperature and humidity. The impact of these variations on biological control agents is poorly understood. Therefore, we constructed functional response models to demonstrate the impact of realistic climate variations on predation efficiency. First, two temperature regimes were compared at constant humidity (70%) and photoperiod (16L:8D): DIF0 (constant temperature) and DIF15 (variable temperature with day-night difference of 15°C). At mean temperatures of 25°C, DIF15 had a negative influence on the predation efficiency of P. persimilis and N. californicus, as compared to DIF0. At low mean temperatures of 15°C, however, DIF15 showed a higher predation efficiency for P. persimilis and N. californicus. For N. fallacis no difference was observed at both 15°C and 25°C. Secondly, two humidity regimes were compared, at a mean temperature of 25°C (DIFO) and constant photoperiod (16L:8D): RHCTE (constant 70% humidity) and RHALT (alternating 40% L:70%D humidity). For P. persimilis and N. fallacis RHCTE resulted in a higher predation efficiency than RHALT, for N. californicus this effect was opposite. This shows that N. californicus is more adapted to dry climates as compared to the other predatory mites. We conclude that variable greenhouse climates clearly affect predation efficiency of P. persimilis, N. californicus and N. fallacis. To obtain optimal control efficiency, the choice of predatory mites (including dose and application frequency
Mites as selective fungal carriers in stored grain habitats.
Hubert, Jan; Stejskal, Václav; Kubátová, Alena; Munzbergová, Zuzana; Vánová, Marie; Zd'árková, Eva
2003-01-01
Mites are well documented as vectors of micromycetes in stored products. Since their vectoring capacity is low due to their small size, they can be serious vectors only where there is selective transfer of a high load of specific fungal species. Therefore the aim of our work was to find out whether the transfer of fungi is selective. Four kinds of stored seeds (wheat, poppy, lettuce, mustard) infested by storage mites were subjected to mycological analysis. We compared the spectrum of micromycete species isolated from different species of mites (Acarus siro, Lepidoglyphus destructor, Tyrophagus putrescentiae, Caloglyphus rhizoglyphoides and Cheyletus malaccensis) and various kinds of stored seeds. Fungi were separately isolated from (a) the surface of mites, (b) the mites' digestive tract (= faeces), and (c) stored seeds and were then cultivated and determined. The fungal transport via mites is selective. This conclusion is supported by (i) lower numbers of isolated fungal species from mites than from seeds; (ii) lower Shannon-Weaver diversity index in the fungal communities isolated from mites than from seeds; (iii) significant effect of mites/seeds as environmental variables on fungal presence in a redundancy analysis (RDA); (iv) differences in composition of isolated fungi between mite species shown by RDA. The results of our work support the hypothesis that mite-fungal interactions are dependent on mite species. The fungi attractive to mites seem to be dispersed more than others. The selectivity of fungal transport via mites enhances their pest importance.
Disentangling the phylogenetic and ecological components of spider phenotypic variation.
Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo
2014-01-01
An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.
Takahashi, Kentaro; Taniguchi, Masami; Fukutomi, Yuma; Sekiya, Kiyoshi; Watai, Kentaro; Mitsui, Chihiro; Tanimoto, Hidenori; Oshikata, Chiyako; Tsuburai, Takahiro; Tsurikisawa, Naomi; Minoguchi, Kenji; Nakajima, Hiroshi; Akiyama, Kazuo
2014-03-01
Anaphylaxis after the ingestion of foods contaminated with mites has recently been recognized. Case series and case reports thus far have shown that mite-contaminated wheat flour is the major cause of oral mite anaphylaxis. However, we have found 8 cases of oral mite anaphylaxis which were caused by mite-contaminated okonomiyaki-mix, a savory Japanese style pancake mix, in our hospital. In addition to our 8 cases, the databases of MEDLINE and ICHUSHI were systematically searched for patients with oral mite anaphylaxis in Japan. Thirty-six patients including our 8 cases with oral mite anaphylaxis were identified. Thirty-four out of 36 cases (94%) ingested okonomiyaki or takoyaki, prepared at home using okonomiyaki-mix or takoyaki-mix which was previously opened and stored for months at ambient temperature. Microscopic examination of culprit mixes of 16 cases including our 1 case revealed contamination of mites such as Dermatophagoides farina (Der f) (5 cases), Tyrophagus putrescentiae (Tyr p) (4 cases), and Dermatophagoides pteronyssinus (Der p) (3 cases). The specific IgE to each mite is generally upregulated in these patients. Especially, the titers of specific IgE to Der p and Der f were more than class 2 in all cases. Mite-contaminated flavored flour is the major cause of oral mite anaphylaxis in Japan.
Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M
1992-07-25
We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.
Second-order nonlinear optical microscopy of spider silk
Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.
2017-06-01
Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.
Tangled in a sparse spider web
DEFF Research Database (Denmark)
Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo
2012-01-01
In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...
Sclerotherapy of Varicose Veins and Spider Veins
... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...
Assassin bug uses aggressive mimicry to lure spider prey.
Wignall, Anne E; Taylor, Phillip W
2011-05-07
Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.
SPIDER: CMB Polarimetry from the Edge of Space
Energy Technology Data Exchange (ETDEWEB)
Gualtieri, R.; et al.
2017-11-28
SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.
DEFF Research Database (Denmark)
Kilpinen, Ole; Steenberg, Tove
2008-01-01
The poultry red mite (PRM), Dermanyssus gallinae, is the most important ectoparasite in European egg production. The mites hide in cracks and crevices in the near vicinity of the resting places of the birds, coming out to feed mainly during the night. Under favourable conditions the population can...... grow rapidly, leading to serious problems. Large mite populations may cause anaemia or even death to the poultry, but also in lower numbers mites may be a nuisance to the birds causing decreased egg production and egg quality. Furthermore, they may have the potential of acting as reservoir......-pathogenic fungi and desiccant dust. The dust is diatomaceous earth (of natural origin), synthetic silica products or combinations of the two. The progress of the work with desiccant dusts will be reported. So far, 7 different products have been tested in the laboratory with regard to their efficacy, speed...
Cuticular antifungals in spiders: density- and condition dependence.
Directory of Open Access Journals (Sweden)
Daniel González-Tokman
Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.
Cuticular antifungals in spiders: density- and condition dependence.
González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur
2014-01-01
Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.
[Investigation of Acaroid mites breeding in stored dry fruits].
Tao, Ning; Zhan, Xiao-dong; Sun, En-tao; Li, Chao-pin
2015-12-01
To study the species and density of Acaroid mites breeding in stored dry fruits. The samples from the dried fruit stores and warehouses were collected, and the mites breeding in them were separated, then the slides with mites were prepared and observed by a light microscope for species identification and counting. The indexes such as the breeding density, species richness index, diversity index and evenness index were calculated. Totally 12 species of Acaroid mites belonging to 6 families and 10 genera were obtained from the total 49 samples. The dominant mite species were Carpoglyphus lactis, Tyrophagus putrescentiae, Acarus siro, and Caloglyphus berlesei. The breeding densities of mites in longans, filberts and plum candies were 79.78, 48.91, 35.73 mites/g, respectively, which were higher than those in other dry fruits. The seasonal variation experiment of mites found that the average breeding density of acaroid mites was higher in July and October, the richness index and diversity index reached the highest value in July, and the evenness index was higher in January and April. The observation of the growth and decline of Acaroid mites under the artificial condition found the number of Caloglyphus berlesei declined sharply and Tyrophagus putrescentiae first increased and then decreased. The pollution of Acaroid mites is serious in the stored dried fruits, for which the positive prevention and control measures to the mite breeding should be taken to reduce the harm.
National Research Council Canada - National Science Library
Kellogg, James; Bovais, Christopher; Dahlburg, Jill; Foch, Richard; Gardner, John; Gordon, Diana; Hartley, Ralph; Kamgar-Parsi, Behrooz; McFarlane, Hugh; Pipitone, Frank; Ramamurti, Ravi; Sciambi, Adam; Spears, William; Srull, Donald; Sullivan, Carol
2001-01-01
.... The NRL Micro Tactical Expendable "MITE" air vehicle is a result of this research. The operational MITE is a hand-launched, dual-propeller, fixed-wing air vehicle, with a 9-inch chord and a wingspan of 8 to 18 inches, depending on payload weight...
Clinical evaluation of a double-blind dust mite avoidance trial with mite-allergic rhinitic patients
Kniest, F.M.; Young, E.; Praag, van M.C.G.; Vos, H.; Kort, H.S.M.; Koers, W.J.; Maat-Bleeker, de F.; Bronswijk, van J.E.M.H.
1991-01-01
Inheritance and allergen exposure are key factors in the development and the course of atopic allergy, expressed as conjunctivitis, rhinitis, asthma or dermatitis. This study concerns the clinical significance of mite and mite-allergen avoidance measures based on intensive cleaning with acaricide
Brain systems underlying encounter expectancy bias in spider phobia.
Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik
2015-06-01
Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.
The aerodynamic signature of running spiders.
Directory of Open Access Journals (Sweden)
Jérôme Casas
Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.
Biotechnological Trends in Spider and Scorpion Antivenom Development
DEFF Research Database (Denmark)
Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine
2016-01-01
in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....
Biased interpretation and memory in children with varying levels of spider fear.
Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike
2014-01-01
This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.
Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.
2010-01-01
There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.
The taxonomy of two economically important eriophyoid species, Aceria tosichella (wheat curl mite, WCM) and A. tulipae (dry bulb mite, DBM), was confounded in the world literature until the late 20th century due to their morphological similarity and ambiguous data from plant-transfer and virus-trans...
Spider foraging strategy affects trophic cascades under natural and drought conditions.
Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong
2015-07-23
Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.
Demoly, P; Kleine-Tebbe, J; Rehm, D
2017-10-01
Treatment with SQ (standardised quality) house dust mite sublingual tablet for 1 year resulted in a decreased probability of having an allergic rhinitis (AR) exacerbation day (from 11% [placebo] to 5% [SQ house dust mite sublingual tablet]) and an increased probability of having a mild AR day (from 16% [placebo] to 34% [SQ house dust mite sublingual tablet]). © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.
Peculiar torsion dynamical response of spider dragline silk
Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.
2017-07-01
The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.
A supplementary description of Brevipalpus californicus (Acari: Trombidiformes: Tenuipalpidae
Directory of Open Access Journals (Sweden)
Mohammad Raissi Ardali
2015-10-01
Full Text Available The false spider mite Brevipalpus californicus from the family Tenuipalpidae was collected from Caucasian alnus, White willow, Persian raspberry and a wild Chrysanthemum bush in Mazandaran province. This species is reported as a new record to the false spider mites-fauna of Iran here. Reviewing literatures revealed that it was briefly described in the original paper without any measures. So, a completed description is presented based on the Iranian specimens and different body segments are drawn for B. californicus. In addition, the above plants are new host records for B. californicus.
Plastic material investment in load-bearing silk attachments in spiders.
Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E
2018-05-17
The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.
Hygienic Activity Toward Varroa Mites in Capped Brood is not Dependent on Mite Reproductive Status
- The varroa resistance of bees selectively bred for high levels of varroa sensitive hygiene (VSH) is characterized by a reduction of (1) the mite infestation rate (Harris 2007 J. Apic. Res. / Bee World 46: 134-139) and (2) the percentage of fertile mites (Harris and Harbo 1999 J. Econ. Entomol. 92:...
Vetter, Richard S; Rust, Michael K
2010-06-01
In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.
Photoluminescent properties of spider silk coated with Eu-doped nanoceria
Energy Technology Data Exchange (ETDEWEB)
Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)
2017-02-15
Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.
High School Students' Attitudes Towards Spiders: A cross-cultural comparison
Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera
2010-08-01
Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.
Photoluminescent properties of spider silk coated with Eu-doped nanoceria
International Nuclear Information System (INIS)
Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko
2017-01-01
Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.
Kniest, F.M.; Wolfs, B.G.; Vos, H.; Ducheine, B.O.I.; Schayk-Bakker, M.J.; de Lange, P.J.P.; Vos, E.M.P.; Bronswijk, van J.E.M.H.
1992-01-01
We report on the mechanisms, the environmental changes and patient compliance with regard to conventional and new dust and mite avoidance measures to prevent allergic symptoms caused by mite allergens, taking into account both allergen contamination and the developmental success of pyroglyphid
Science 101: Why Don't Spiders Stick to Their Own Webs?
Robertson, Bill
2011-01-01
This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…
Salticid predation as one potential driving force of ant mimicry in jumping spiders
Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min
2011-01-01
Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898
Research on Artificial Spider Web Model for Farmland Wireless Sensor Network
Directory of Open Access Journals (Sweden)
Jun Wang
2018-01-01
Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.
Gols, R.; Schütte, C.; Stouthamer, R.; Dicke, M.
2007-01-01
The predatory mite, Phytoseiulus persimilis is an important biological control agent of herbivorous spider mites. This species is also intensively used in the study of tritrophic effects of plant volatiles in interactions involving plants, herbivores, and their natural enemies. Recently, a novel
Large-bodied Demodex mite infestation in 4 dogs.
Hillier, Andrew; Desch, Clifford E
2002-03-01
Large-bodied Demodex mites were detected in 4 dogs. The mites were readily detected in material obtained via deep skin scrapings and were most commonly found on the trunk. The mites were distinguishable from D. canis, because adult males were approximately 100% longer and adult females were approximately 50% longer than adult male and female D. canis mites, respectively. The large-bodied mites were found in the hair follicles, sebaceous ducts, and sebaceous glands in histologic sections of skin from 2 dogs. All dogs had adult-onset generalized demodicosis. Two dogs had coexistent iatrogenic hypercortisolism, 1 dog had hypothyroidism, and 1 dog did not have coexistent disease. Infestations responded to miticidal therapy, control of the coexistent disease, or both.
Silk Spinning in Silkworms and Spiders.
Andersson, Marlene; Johansson, Jan; Rising, Anna
2016-08-09
Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.
A novel neurotoxin from venom of the spider, Brachypelma albopilosum.
Directory of Open Access Journals (Sweden)
Yunhua Zhong
Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.
PARASITIC MITES IN BACKYARD TURKEYS
Directory of Open Access Journals (Sweden)
Marco Antonio Camacho-Escobar
2010-02-01
Full Text Available To describe the parasitic mites in backyard turkeys, was did this work. The mites were obtain by hand for 30 backyard turkeys in Oaxaca’s Coast region, Mexico; the mites were mount in adhesive paper and wash with the 200X lent in a computer optical microscopy, the parasites size were determinate in the pictures obtained by the microscopy software, the images were sized using a specialist software for it, which relate the number of pixels in the picture with the size of the observation field. Were indentified the species Dermanyssus gallinae, Megninia ginglymura and Ornithonyssus sylviarum, the last two described for first time in backyard turkeys in Mexico. Â
Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India
Directory of Open Access Journals (Sweden)
C. K. Adarsh
2015-12-01
Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India. This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India. The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera. Out of 252 endemic spiders of India, 16 have been reported from KAU campus. Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus. Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%.
Pyroglyphid mites as a source of work-related allergens.
Macan, Jelena; Kanceljak-Macan, Božica; Milković-Kraus, Sanja
2012-01-01
Pyroglyphid mites are primarily associated with allergen exposure at home; hence the name house dust mites. However, we have found numerous studies reporting pyroglyhid mite levels in public and occupational settings. This review presents the findings of house dust mite allergens (family Pyroglyphidae, species Dermatophagoides) as potential work-related risk factors and proposes occupations at risk of house dust mite-related diseases. Pyroglyphid mites or their allergens are found in various workplaces, but clinically relevant exposures have been observed in hotels, cinemas, schools, day-care centres, libraries, public transportation (buses, trains, taxies, and airplanes), fishing-boats, submarines, poultry farms, and churches. Here we propose a classification of occupational risk as low (occasional exposure to mite allergen levels up to 2 μg g(-1)), moderate (exposure between 2 μg g(-1) and 10 μg g(-1)), and high (exposure >10 μg g(-1)). The classification of risk should include factors relevant for indoor mite population (climate, building characteristics, and cleaning schedule). To avoid development or aggravation of allergies associated with exposure to house dust mites at work, occupational physicians should assess exposure risk at work, propose proper protection, provide vocational guidance to persons at risk and conduct pre-employment and periodic examinations to diagnose new allergy cases. Protection at work should aim to control dust mite levels at work. Measures may include proper interior design and regular cleaning and building maintenance.
Research on Artificial Spider Web Model for Farmland Wireless Sensor Network
Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie
2018-01-01
Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...
Spider diffraction: a comparison of curved and straight legs
International Nuclear Information System (INIS)
Richter, J.L.
1984-01-01
It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders
Haematophagus Mites in Poultry Farms of Iran
Directory of Open Access Journals (Sweden)
S Rahbari
2009-12-01
Full Text Available Background: Blood sucking mites are important avian ectoparasites which being found on bird species worldwide. Their presence are problematic for the producers either through potential direct effects on weight gain, egg production, sperm production in roosters or as nuisance pests on worker handle hens and eggs. The aim of this study was pointing out of the status of haematophagus mites.Methods: Eight caged layer and four breeder flocks were visited, monitoring for the presence of chicken mites performed by removing and examining debris from poultry house, infested nesting material collected into zip lock plastic bags and at least 20 birds were also randomly selected to examine the presence of chicken mites. Mites obtained from each population were mounted in Hoyer,s medium on microscope slides and identified. All eight caged layer and four breeder flocks were inspected, which were infested with chicken blood feeding mites.Results: Massive infestations of Dermanyssus gallinae were common with huge numbers of parasites on birds, cages and the conveyor belts for egg. Only one farm from Mazandaran Province was infested to Ornithonyssus bursa.Conclusion: Dermanyssus gallinae was the most prevalent blood feeder mite in the breeder and caged layer flocks in Iran, while O. bursa was reported as a first record, which found only in a breeder flock in Mazanderan Province. It seems that its presence is limited into the area which affected by both warm and humid environmental conditions.
High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison
Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera
2010-01-01
Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…
Walzer, Andreas; Schausberger, Peter
2011-01-01
Predation is a major selective force for the evolution of behavioural characteristics of prey. Predation among consumers competing for food is termed intraguild predation (IGP). From the perspective of individual prey, IGP differs from classical predation in the likelihood of occurrence because IG prey is usually more rarely encountered and less profitable because it is more difficult to handle than classical prey. It is not known whether IGP is a sufficiently strong force to evolve interspecific threat sensitivity in antipredation behaviours, as is known from classical predation, and if so whether such behaviours are innate or learned. We examined interspecific threat sensitivity in antipredation in a guild of predatory mite species differing in adaptation to the shared spider mite prey (i.e. Phytoseiulus persimilis, Neoseiulus californicus and Amblyseius andersoni). We first ranked the players in this guild according to the IGP risk posed to each other: A. andersoni was the strongest IG predator; P. persimilis was the weakest. Then, we assessed the influence of relative IGP risk and experience on maternal strategies to reduce offspring IGP risk: A. andersoni was insensitive to IGP risk. Threat sensitivity in oviposition site selection was induced by experience in P. persimilis but occurred independently of experience in N. californicus. Irrespective of experience, P. persimilis laid fewer eggs in choice situations with the high- rather than low-risk IG predator. Our study suggests that, similar to classical predation, IGP may select for sophisticated innate and learned interspecific threat-sensitive antipredation responses. We argue that such responses may promote the coexistence of IG predators and prey.
Optically probing torsional superelasticity in spider silks
Energy Technology Data Exchange (ETDEWEB)
Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)
2013-11-11
We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.
Optically probing torsional superelasticity in spider silks
International Nuclear Information System (INIS)
Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.
2013-01-01
We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices
LoBue, Vanessa
2010-01-01
Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…
Early events in the evolution of spider silk genes.
Directory of Open Access Journals (Sweden)
James Starrett
Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid
Silk elasticity as a potential constraint on spider body size.
Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi
2010-10-07
Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.
Skirvin, David J; Fenlon, John S
2003-01-01
Environmental variables, such as temperature, are important in determining the efficiency of biological control in ornamental crops. This paper examines the effect of temperature on the functional response of adult female Phytoseiulus persimilis to eggs of the spider mite, Tetranychus urticae. The functional response was determined using a new functional response assay technique with plant stems as an arena, rather than leaf discs. The use of plant stems allows the influence that plant structure has on predation to be incorporated into the assay. Control assays were also used (without predators) to estimate natural losses of prey. The data were analysed using a binomial model, with the use of Abbot's formula to correct for the losses in the controls. A combined equation to describe the effect of temperature and prey density on the predation rate of Phytoseiulus persimilis was derived. The results showed that more prey are eaten as the temperature increases from 15 degrees C to 25 degrees C, but the number of prey eaten then declines at 30 degrees C, although not to the levels seen at 20 degrees C. The implication of these results for biological control in ornamental crops, where the temperature can often exceed 30 degrees C, is discussed.
Haematophagus Mites in Poultry Farms of Iran
Directory of Open Access Journals (Sweden)
S Rahbari
2009-12-01
Full Text Available Background: Blood sucking mites are important avian ectoparasites which being found on bird species worldwide. Their presence are problematic for the producers either through potential direct effects on weight gain, egg production, sperm production in roosters or as nuisance pests on worker handle hens and eggs. The aim of this study was pointing out of the status of haematophagus mites."nMethods: Eight caged layer and four breeder flocks were visited, monitoring for the presence of chicken mites performed by removing and examining debris from poultry house, infested nesting material collected into zip lock plastic bags and at least 20 birds were also randomly selected to examine the presence of chicken mites. Mites obtained from each population were mounted in Hoyer,s medium on microscope slides and identified. All eight caged layer and four breeder flocks were inspected, which were infested with chicken blood feeding mites."nResults: Massive infestations of Dermanyssus gallinae were common with huge numbers of parasites on birds, cages and the conveyor belts for egg. Only one farm from Mazandaran Province was infested to Ornithonyssus bursa."nConclusion: Dermanyssus gallinae was the most prevalent blood feeder mite in the breeder and caged layer flocks in Iran, while O. bursa was reported as a first record, which found only in a breeder flock in Mazanderan Province. It seems that its presence is limited into the area which affected by both warm and humid environmental conditions. Keywords: Dermanyssus gallinae, Ornithonyssus bursa, Poultry, Iran
Herbivory in spiders: the importance of pollen for orb-weavers.
Eggs, Benjamin; Sanders, Dirk
2013-01-01
Orb-weaving spiders (Araneidae) are commonly regarded as generalist insect predators but resources provided by plants such as pollen may be an important dietary supplementation. Their webs snare insect prey, but can also trap aerial plankton like pollen and fungal spores. When recycling their orb webs, the spiders may therefore also feed on adhering pollen grains or fungal spores via extraoral digestion. In this study we measured stable isotope ratios in the bodies of two araneid species (Aculepeira ceropegia and Araneus diadematus), their potential prey and pollen to determine the relative contribution of pollen to their diet. We found that about 25% of juvenile orb-weaving spiders' diet consisted of pollen, the other 75% of flying insects, mainly small dipterans and hymenopterans. The pollen grains in our study were too large to be taken up accidentally by the spiders and had first to be digested extraorally by enzymes in an active act of consumption. Therefore, pollen can be seen as a substantial component of the spiders' diet. This finding suggests that these spiders need to be classified as omnivores rather than pure carnivores.
Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.
Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L
2017-08-01
Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.
Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite
Directory of Open Access Journals (Sweden)
Michael Makris
2009-01-01
Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.
Coagulopathy after spider bites in a six-year-old boy
Directory of Open Access Journals (Sweden)
Ansari SH.
2008-06-01
Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl. Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.
House dust mites in the city of Lima, Peru.
Croce, M; Costa-Manso, E; Baggio, D; Croce, J
2000-01-01
Since mites are the most common house dust allergens, knowledge about the species most prevalent in a region is important for diagnostic and specific immunotherapy purposes. In order to establish the prevalence of house dust mites in different city districts, 100 house dust samples were collected from different parts of Lima. Lima is a city of tropical climate located along the coast of the Pacific Ocean. The relative air humidity is 80-90% and the various districts studied are located at altitudes ranging from 37-355 meters. The mite Blomia tropicalis was the organism most frequently detected, being present in 59% of the house dust samples. Dermatophagoides pteronyssinus occupied second place (15.9%), followed by Chortoglyphus arcuatus and Tyrophagus putrescentiae. These four mites, taken together, represented more than 90% of the mites detected. No specimen of the species Dermatophagoides farinae was detected. We conclude that B. tropicalis and D. pteronyssinus are the most common house dust mites in Lima. Considering the high prevalence of B. tropicalis in Lima and the fact that its cross-reactivity with antigens of the mites of the family Pyroglyphidae is minimal, we conclude that sensitization to this mite should be investigated separately in allergic patients living in Lima.
Camel spider (Solifugae) use of prairie dog colonies
Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...
Nutrient regulation in a predator, the wolf spider Pardosa prativaga
DEFF Research Database (Denmark)
Jensen, Kim; Mayntz, David; Toft, Søren
2011-01-01
Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...
Hamby, Kelly A; Alifano, Jesse A; Zalom, Frank G
2013-10-01
Pyrethroid insecticides are generally regarded as acutely toxic to predatory phytoseiid mites; however, persistence of hull split spray pyrethroid residues on almond trees and their effects on phytoseiids have not been quantified over time. Hull split, the separation of the almond hull along the suture, exposes the new crop nuts to infestation by Amyelois transitella (Walker) larvae, and is the preferred timing for insecticides applied for their control. Galendromus occidentalis (Nesbitt) is the most important phytoseiid biocontrol agent for web-spinning spider mites in California (USA) almond orchards, and the impact of bifenthrin and λ-cyhalothrin pyrethroid residue on their survival, fertility, and fecundity was determined. The total effects of direct contact with esfenvalerate, permethrin, bifenthrin and λ-cyhalothrin were also evaluated for comparison. The total effects (E) of direct contact treatments of the four pyrethroids ranged from 77.8 % for esfenvalerate to 98.8 % for bifenthrin. Both bifenthrin and λ-cyhalothrin twig residue would be considered harmful (IOBC class 4) following field application at hull split timing. Bifenthrin twig residue would be considered slightly harmful (IOBC class 2) for up to 3.5 months and harmless (IOBC class 1) after 6 months. λ-cyhalothrin residue would be considered moderately harmful (IOBC class 3) for up to 3.5 months following application and harmless (IOBC class 1) after 6 months. Bifenthrin and λ-cyhalothrin twig residue on treated trees significantly reduced G. occidentalis female survival for up to 6 months post-treatment, however total effects (E) classify these residues as harmless (IOBC class 1) after 6 months. Harmful effects of direct and residual exposure following application have implications for the use of these pyrethroids in an integrated mite management program for perennial crops.
Arachnid aloft: directed aerial descent in neotropical canopy spiders.
Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert
2015-09-06
The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).
Spider silk reinforced by graphene or carbon nanotubes
Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria
2017-09-01
Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.
Cognitive reappraisal of snake and spider pictures: An event-related potentials study.
Langeslag, Sandra J E; van Strien, Jan W
2018-05-30
Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.
Early Cretaceous greenhouse pumped higher taxa diversification in spiders.
Shao, Lili; Li, Shuqiang
2018-05-24
The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.
Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi
2014-08-04
Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.
Invited review current progress and limitations of spider silk for biomedical applications.
Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna
2012-06-01
Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.
Determination of PCDDs in spider webs: preliminary studies
Rybak, Justyna; Rutkowski, Radosław
2018-01-01
The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.
Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C
2013-02-01
Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.
Global associations between birds and vane-dwelling feather mites.
Doña, Jorge; Proctor, Heather; Mironov, Sergey; Serrano, David; Jovani, Roger
2016-11-01
Understanding host-symbiont networks is a major question in evolutionary ecology. Birds host a great diversity of endo- and ectosymbiotic organisms, with feather mites (Arachnida: Acariformes: Analgoidea, Pterolichoidea) being among the most diverse of avian symbionts. A global approach to the ecology and evolution of bird-feather-mite associations has been hampered because of the absence of a centralized data repository. Here we present the most extensive data set of associations between feather mites and birds. Data include 12 036 records of 1887 feather mite species located on the flight feathers of 2234 bird species from 147 countries. Feather mites typically located inside quills, on the skin, or on downy body feathers are not included. Data were extracted from 493 published sources dating from 1882 to 2015. Data exploration shows that although most continents and bird families are represented, most bird species remain unexplored for feather mites. Nevertheless, this is the most comprehensive data set available for enabling global macroecological analyses of feather mites and their hosts, such as ecological network analyses. This metadata file outlines the structure of these data and provides primary references for all records used. © 2016 by the Ecological Society of America.
Japyassú, Hilton F; Laland, Kevin N
2017-05-01
There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.
Evolutionary genomics of miniature inverted-repeat transposable elements (MITEs) in Brassica.
Nouroz, Faisal; Noreen, Shumaila; Heslop-Harrison, J S
2015-12-01
Miniature inverted-repeat transposable elements (MITEs) are truncated derivatives of autonomous DNA transposons, and are dispersed abundantly in most eukaryotic genomes. We aimed to characterize various MITEs families in Brassica in terms of their presence, sequence characteristics and evolutionary activity. Dot plot analyses involving comparison of homoeologous bacterial artificial chromosome (BAC) sequences allowed identification of 15 novel families of mobile MITEs. Of which, 5 were Stowaway-like with TA Target Site Duplications (TSDs), 4 Tourist-like with TAA/TTA TSDs, 5 Mutator-like with 9-10 bp TSDs and 1 novel MITE (BoXMITE1) flanked by 3 bp TSDs. Our data suggested that there are about 30,000 MITE-related sequences in Brassica rapa and B. oleracea genomes. In situ hybridization showed one abundant family was dispersed in the A-genome, while another was located near 45S rDNA sites. PCR analysis using primers flanking sequences of MITE elements detected MITE insertion polymorphisms between and within the three Brassica (AA, BB, CC) genomes, with many insertions being specific to single genomes and others showing evidence of more recent evolutionary insertions. Our BAC sequence comparison strategy enables identification of evolutionarily active MITEs with no prior knowledge of MITE sequences. The details of MITE families reported in Brassica enable their identification, characterization and annotation. Insertion polymorphisms of MITEs and their transposition activity indicated important mechanism of genome evolution and diversification. MITE families derived from known Mariner, Harbinger and Mutator DNA transposons were discovered, as well as some novel structures. The identification of Brassica MITEs will have broad applications in Brassica genomics, breeding, hybridization and phylogeny through their use as DNA markers.
Air-conditioner filters enriching dust mites allergen.
Zhan, Xiaodong; Li, Chaopin; Xu, Haifeng; Xu, Pengfei; Zhu, Haibin; Diao, Jidong; Li, Na; Zhao, Beibei
2015-01-01
We detected the concentration of dust mites allergen (Der f1 & Der p1) in the air of different places before and after the starting of air-conditioners in Wuhu City, Anhui, China, and to discuss the relation between the dust mites allergen in air-conditioner filters and the asthma attack. The dust samples were collected from the air-conditioner filters in dining rooms, shopping malls, hotels and households respectively. Concentrations of dust mites major group allergen 1 (Der f 1, Der p1) were detected with enzyme linked immunosorbent assay (ELISA), and the dust mite immune activities were determined by dot-ELISA. The concentration of Der f1 in dining rooms, shopping malls, hotels and households was 1.52 μg/g, 1.24 μg/g, 1.31 μg/g and 1.46 μg/g respectively, and the concentration of Der p1 in above-mentioned places was 1.23 μg/g, 1.12 μg/g, 1.16 μg/g and 1.18 μg/g respectively. The concentration of Der f1 & Der p1 in air was higher after the air-conditioners starting one hours later, and the difference was significant (Pair-conditioner filters can enrich dust mites major group allergen, and the allergens can induce asthma. The air-conditioner filters shall be cleaned or replaced regularly to prevent or reduce accumulation of the dust mites and its allergens.
A comparison of spider communities in Bt and non-Bt rice fields.
Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho
2014-06-01
To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.
Edge effect on weevils and spiders
Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.
2002-01-01
The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...
Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure
Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.
2016-01-01
Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926
Cleaner mites: sanitary mutualism in the miniature ecosystem of neotropical bee nests.
Biani, Natalia B; Mueller, Ulrich G; Wcislo, William T
2009-06-01
Cleaning symbioses represent classic models of mutualism, and some bee mites are thought to perform cleaning services for their hosts in exchange for suitable environments for reproduction and dispersal. These mutual benefits, however, have not been rigorously demonstrated. We tested the sanitary role of bee mites by correlating mite loads with fungal contamination in natural nests of Megalopta genalis and Megalopta ecuadoria and by experimentally manipulating mite loads in artificial cells with developing brood. Field observations revealed significant correlations between the presence of mites and the absence of fungi inside the brood cells, as well as between the absence of mites and increased bee mortality. Likewise, experimental brood cells with mites have fewer fungal colonies than do cells without mites. Field observations and experimental manipulations, therefore, provide clear evidence of the sanitary effect of mites in nests of Megalopta bees. This bee-mite association constitutes one of the few examples of terrestrial cleaning mutualisms.
Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders
DEFF Research Database (Denmark)
Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine
2012-01-01
Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...
The time course of location-avoidance learning in fear of spiders.
Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S
2016-01-01
Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.
Edge effect on weevils and spiders
Directory of Open Access Journals (Sweden)
R. Horváth
2002-05-01
Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.
Three Species of Ectoparasite Mites (Acari: Pterygosomatidae Infested Geckos in Indonesia
Directory of Open Access Journals (Sweden)
TARUNI SRI PRAWASTI
2013-06-01
Full Text Available Limited data is hitherto available on the diversity and dispersal of parasitic mites of geckos in Indonesia. Here, we collected three species of geckos, namely Cosymbotus platyurus, Hemidactylus frenatus, and H. garnotii throughout Indonesia to study the distribution and diversity of its parasitic mites. We conducted detail morphological analysis of the mites using whole mount polyvinyl lactophenol and scanning electron microscope preparation. Three species of ectoparasite mites from genus Geckobia were identified in a total of 221 individuals out of 448 geckos collected from 25 sites in Indonesia. Two species were G. glebosum and G. bataviensis, and the other one was designated as Geckobia sp 1. Based on our result, the three mites species were spread randomly and live sympatrically. The G. bataviensis mite showed the widest distribution, because it was found in almost all gecko collection sites, hence the most cosmopolitan mites. We also found that C. platyurus gecko had the lowest mite prevalence which might due to the fact that it has the least number of skin folds, an important site for mite protection. This result implies that further research on the relationship of anatomy of gecko skin with chelicera and claw structure of mites is necessary in the future.
Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae
Directory of Open Access Journals (Sweden)
Komposch, Christian
2011-01-01
Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.
SPIDER: A Framework for Understanding Driver Distraction.
Strayer, David L; Fisher, Donald L
2016-02-01
The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.
Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F
2008-06-01
The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.
Marín, Linda; Perfecto, Ivette
2013-04-01
Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.
Ecological Factors Determining Abundance of Parasitic Mites on Aedes spp. Larvae
Directory of Open Access Journals (Sweden)
Nurhadi Eko Firmansyah
2017-12-01
Full Text Available Ability to infestation and abundance of parasitic mites in Aedes spp. larvae cannot be separated from the influence of various factors. Ecological factors have been suggested to play a role determine the presence of parasitic mites that under certain conditions become a key factor in determining the abundance of parasitic mites on Aedes spp. larvae. The aim of this study to determine the ecological factors affect the abundance of parasitic mites on Aedes spp. larvae in Bogor Regency. Capturing of Aedes spp. larvae was performed directly on the habitats found in indoor and outdoor. Capturing mites in the body of Aedes spp. larvae was performed using insect forceps. Ecological factors measured were dissolved oxygen (DO, pH, temperature, and total dissolved solid (TDS. The influence of ecological factors was analyzed using regression and correlation analysis. The result of mite identification has been obtained three species of mites that are Halacarus sp., Histiostoma sp., and Hydrozetes sp. The result indicated that total dissolved solid (TDS and temperature was the factors that determined the abundance of mites. The factors of pH, and dissolved oxygen (DO did not determine the abundance of parasitic mites of Aedes spp. larvae. The research result can be further developed as a new alternative to Dengue Hemorraghic Fever control and provide information on parasitic mites that infest Aedes spp. larvae. In addition, this results become an early step in controlling of Aedes spp. strategy platform by the parasitic mites.
Brauneis, Maria D; Zoller, Hartmut; Williams, Heike; Zschiesche, Eva; Heckeroth, Anja R
2017-12-02
Dermanyssus gallinae, the poultry red mite, is a growing threat to chickens in poultry farms. This nocturnal hematophagous ectoparasite has a rapid rate of proliferation with a negative impact on the birds' health, welfare and productivity resulting in severe economic consequences for poultry farmers. A study was performed with fluralaner, a novel systemic ectoparasiticide, to evaluate its effect on mite vitality and reproduction after oral administration to laying hens. Sixteen healthy hens were randomly allocated to two study groups (n = 8). One group was orally treated with fluralaner by gavage at a dose of 0.5 mg/kg bodyweight twice 7 days apart. The negative control group received no treatment. Hens in each group were repeatedly infested with approximately 200 unfed adult D. gallinae at 1, 5, 8, 12, 15, 19, 22 and 26 days after the initial administration. After infestation and feeding for 2.5 h, 25 engorged mites per hen were collected and incubated in tubes. Mites were assessed for vitality (dead/live) at 4, 8, 12, and 24 h after each infestation. Tubes containing eggs and/or living mites were incubated another 8 days for assessment of mite reproductive capacity. Fluralaner demonstrated a fast speed of kill in mites within 4 h post-infestation for 12 days after treatment initiation. An efficacy (mite mortality) of 98.7-100% was achieved. At 15 days after treatment initiation, 100% efficacy was achieved within 24 h post-infestation, and no mite oviposition occurred during this period. Nineteen days after treatment initiation, the mites' ability to generate nymphs was reduced by 90.8%, which decreased to < 24.1% at later infestations. Fluralaner administered orally to hens twice, 7 days apart, provides efficacy against experimental poultry red mite infestation for at least 2 weeks. The demonstrated rapid speed of kill results in substantial depletion of the mites' oviposition and suggests that fluralaner can be an effective tool in the control
Reconstitutable control rod spider assembly
International Nuclear Information System (INIS)
Shallenberger, J.M.; Ferian, S.J.
1990-01-01
A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)
Directory of Open Access Journals (Sweden)
Julia J Mlynarek
Full Text Available Related host species often demonstrate differences in prevalence and/or intensity of infection by particular parasite species, as well as different levels of resistance to those parasites. The mechanisms underlying this interspecific variation in parasitism and resistance expression are not well understood. Surprisingly, few researchers have assessed relations between actual levels of parasitism and resistance to parasites seen in nature across multiple host species. The main goal of this study was to determine whether interspecific variation in resistance against ectoparasitic larval water mites either was predictive of interspecific variation in parasitism for ten closely related species of damselflies (grouped into five "species pairs", or was predicted by interspecific variation in a commonly used measure of innate immunity (total Phenoloxidase or potential PO activity. Two of five species pairs had interspecific differences in proportions of individuals resisting larval Arrenurus water mites, only one of five species pairs had species differences in prevalence of larval Arrenurus water mites, and another two of five species pairs showed species differences in mean PO activity. Within the two species pairs where species differed in proportion of individuals resisting mites the species with the higher proportion did not have correspondingly higher PO activity levels. Furthermore, the proportion of individuals resisting mites mirrored prevalence of parasitism in only one species pair. There was no interspecific variation in median intensity of mite infestation within any species pair. We conclude that a species' relative ability to resist particular parasites does not explain interspecific variation in parasitism within species pairs and that neither resistance nor parasitism is reflected by interspecific variation in total PO or potential PO activity.
Does the removal of mite-infested brood facilitate grooming?
The relationship between the removal of mite-infested brood and mite drop was compared using Russian (RHB, n = 9) and Italian (IHB, n = 9) honey bee colonies. A cloake board was used to isolate test brood frame on the top hive body and the metal sheet served as a varroa trap. Inoculum mites were col...
Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo
2018-05-07
Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.
Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J
2014-11-01
Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.
Pheromonal Communication in the European House Dust Mite, Dermatophagoides pteronyssinus
Directory of Open Access Journals (Sweden)
Johannes L.M. Steidle
2014-08-01
Full Text Available Despite the sanitary importance of the European house dust mite Dermatophagoides pteronyssinus (Trouessart, 1897, the pheromonal communication in this species has not been sufficiently studied. Headspace analysis using solid phase micro extraction (SPME revealed that nerol, neryl formate, pentadecane, (6Z,9Z-6,9-heptadecadiene, and (Z-8-heptadecene are released by both sexes whereas neryl propionate was released by males only. Tritonymphs did not produce any detectable volatiles. In olfactometer experiments, pentadecane and neryl propionate were attractive to both sexes as well as to tritonymphs. (Z-8-heptadecene was only attractive to male mites. Therefore it is discussed that pentadecane and neryl propionate are aggregation pheromones and (Z-8-heptadecene is a sexual pheromone of the European house dust mite D. pteronyssinus. To study the potential use of pheromones in dust mite control, long-range olfactometer experiments were conducted showing that mites can be attracted to neryl propionate over distances of at least 50 cm. This indicates that mite pheromones might be useable to monitor the presence or absence of mites in the context of control strategies.
Remote monitoring of vibrational information in spider webs
Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.
2018-06-01
Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.
A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.
Directory of Open Access Journals (Sweden)
Yann Hénaut
Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.
A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.
Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain
2014-01-01
Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.
Environmental and hormonal factors controlling reversible colour change in crab spiders.
Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme
2013-10-15
Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.
A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest
Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain
2014-01-01
Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055
Directory of Open Access Journals (Sweden)
Fabrício Fagundes Pereira
2005-08-01
Full Text Available Relata-se a infestação de um ácaro-vermelho em mudas clonais de Eucalyptus grandis Hill ex Maiden, mantidas em casa de vegetação no município de Martinho Campos, Minas Gerais. O ácaro foi observado na parte superior das folhas que exibiam sinais de sucção de seiva e bronzeamento. Essas injúrias causaram desenvolvimento anormal e morte de plantas. O ácaro foi identificado como Oligonychus yothersi (McGregor (Acari: Tetranychidae, e isso representa o primeiro registro dessa espécie em mudas clonais de E. grandis no Brasil.An infestation of the red spider mite was reported in clone seedlings of Eucalyptus grandis Hill ex Maiden under greenhouse conditions, in the municipality of Martinho Campos, Minas Gerais State. The spider mite was found on the leaf upper faces with signs of sap suction and bronzing. Such injuries caused abnormal development and plant death. The spider mite was identified as Oligonychus yothersi (McGregor (Acari: Tetranychidae. This is the first record of O. yothersi on E. grandis seedlings in Brazil.
Domatia reduce larval cannibalism in predatory mites
Ferreira, J.A.M.; Eshuis, B.; Janssen, A.; Sabelis, M.W.
2008-01-01
1. Acarodomatia are small structures on the underside of leaves of many plant species, which are mainly inhabited by carnivorous and fungivorous mites. 2. Domatia are thought to protect these mites against adverse environmental conditions and against predation. They are considered as an indirect
Respiratory allergy caused by house dust mites
DEFF Research Database (Denmark)
Calderón, Moisés A; Linneberg, Allan; Kleine-Tebbe, Jörg
2015-01-01
consequences in patients with respiratory allergic diseases. We investigate the epidemiology of HDM allergy to explore the interaction between mites and human subjects at the population, individual, and molecular levels. Core and recent publications were identified by using "house dust mite" as a key search...
Small Molecules from Spiders Used as Chemical Probes
DEFF Research Database (Denmark)
Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian
2011-01-01
Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....
Directory of Open Access Journals (Sweden)
Farzana Perveen
2015-09-01
Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.
Optical surface profiling of orb-web spider capture silks
Energy Technology Data Exchange (ETDEWEB)
Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)
2010-09-15
Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).
Optical surface profiling of orb-web spider capture silks
International Nuclear Information System (INIS)
Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E
2010-01-01
Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).
Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.
He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki
2014-09-10
It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.
Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.
2017-06-01
This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.
How informative are case studies of spider bites in the medical literature?