WorldWideScience

Sample records for terbium 170

  1. Elastic properties of terbium

    DEFF Research Database (Denmark)

    Spichkin, Y.I.; Bohr, Jakob; Tishin, A.M.

    1996-01-01

    The temperature dependence of the Young modulus along the crystallographic axes b and c (E(b) and E(c)), and the internal friction of a terbium single crystal have been measured. At 4.2 K, E(b) and E(c) are equal to 38 and 84.5 GPa, respectively. The lattice part of the Young modulus and the Debye...... temperature has been calculated. The origin of the Young modulus anomalies arising at the transition to the magnetically ordered state is discussed....

  2. Critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1968-01-01

    The inelasticity of the critical scattering of neutrons in terbium has been measured above the Neél temperature at the (0, 0, 2−Q) satellite position. The results show that dynamic slowing down of the fluctuations does occur in a second‐order phase transition in agreement with the general theory...

  3. Semiconductor composition containing iron, dysprosium, and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.

    2017-09-26

    An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.

  4. Raman spectroscopy study of the doping effect of the encapsulated terbium halogenides on single-walled carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Kharlamova, M.V.; Kramberger, C.; Mittelberger, A. [University of Vienna, Faculty of Physics, Vienna (Austria)

    2017-04-15

    In the present work, the doping effect of terbium chloride, terbium bromide, and terbium iodide on single-walled carbon nanotubes (SWCNTs) was compared by Raman spectroscopy. A precise investigation of the doping-induced alterations of the Raman modes of the filled SWCNTs was conducted. The shifts of the components of the Raman modes and modification of their profiles allowed concluding that the inserted terbium halogenides have acceptor doping effect on the SWCNTs, and the doping efficiency increases in the line with terbium iodide, terbium bromide, and terbium chloride. (orig.)

  5. Magnetocaloric effect of thin Terbium films

    Science.gov (United States)

    Mello, V. D.; Anselmo, D. H. A. L.; Vasconcelos, M. S.; Almeida, N. S.

    2017-12-01

    We report a theoretical study of the magnetocaloric effect of Terbium (Tb) thin films due to finite size and surface effects in the helimagnetic phase, corresponding to a temperature range from TC=219 K to TN=231 K, for external fields of the order of kOe. For a Tb thin film of 6 monolayers submitted to an applied field (ΔH =30 kOe, ΔH =50 kOe and ΔH = 70 kOe) we report a significative change in adiabatic temperature, ΔT / ΔH , near the Néel temperature, of the order ten times higher than that observed for Tb bulk. On the other hand, for small values of the magnetic field, large thickness effects are found. For external field strength around few kOe, we have found that the thermal caloric efficiency increases remarkably for ultrathin films. For an ultrathin film with 6 monolayers, we have found ΔT / ΔH = 43 K/T while for thicker films, with 20 monolayers, ΔT / ΔH = 22 K/T. Our results suggest that thin films of Tb are a promising material for magnetocaloric effect devices for applications at intermediate temperatures.

  6. Femtosecond XUV spectroscopy of gadolinium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Carley, Robert; Frietsch, Bjoern; Doebrich, Kristian; Teichmann, Martin; Gahl, Cornelius; Noack, Frank [Max-Born-Institute, Berlin (Germany); Schwarzkopf, Olaf; Wernet, Philippe [Helmholtz-Zentrum fuer Materialien und Energie (BESSY II), Berlin (Germany); Weinelt, Martin [Max-Born-Institute, Berlin (Germany); Fachbereich Physik, Freie Universitaet, Berlin (Germany)

    2011-07-01

    We present recent results of time-resolved IR-pump-XUV-probe experiments on the ultrafast demagnetization of thin films of Gadolinium(0001) and Terbium(0001) on Tungsten(110). The experiments are the first to be done using a newly developed high-order harmonics (HHG) XUV beamline at the MBI. The beamline delivers monochromated XUV pulses of approximately 150 fs duration with a photon energy resolution of up to 150 meV. Following excitation by intense femtosecond infrared (IR) pulses, photoemission with 35 eV photons allows us to directly probe the 4f electrons and their interaction with the valence band, both in the bulk and at the surface, to follow the ultrafast magnetization dynamics in the Lanthanide metals. As signatures of ultrafast demagnetization of the metal by the IR pulse, we see for the first time, rapid strong reduction of the exchange splitting in the valence band. This is followed by a slower demagnetization due to the spin-lattice interaction.

  7. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    Glasses; terbium ion; oscillator strengths; fluorescence; lifetimes; fibre lasers. 1. Introduction. Today glasses are most favourable engineering materials for abundant applications due to the wide ability of property altering by compositional modifications. The considerable examination of glass science to achieve required ...

  8. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 39; Issue 3. Green fluorescence of terbium ions in lithium fluoroborate glasses for fibre lasers and display devices. G R DILLIP C MADHUKAR REDDY M RAJESH SHIVANAND CHAURASIA B DEVA PRASAD RAJU S W JOO. Volume 39 Issue 3 June 2016 pp 711-717 ...

  9. Terahertz Cherenkov radiation from ultrafast magnetization in terbium gallium garnet

    Science.gov (United States)

    Gorelov, S. D.; Mashkovich, E. A.; Tsarev, M. V.; Bakunov, M. I.

    2013-12-01

    We report an experimental observation of terahertz Cherenkov radiation from a moving magnetic moment produced in terbium gallium garnet by a circularly polarized femtosecond laser pulse via the inverse Faraday effect. Contrary to some existing theoretical predictions, the polarity of the observed radiation unambiguously demonstrates the paramagnetic, rather than diamagnetic, nature of the ultrafast inverse Faraday effect. From measurements of the radiation field, the Verdet constant in the subpicosecond regime is ˜3-10 times smaller than its table quasistatic value.

  10. Terbium luminescence in alumina xerogel fabricated in porous anodic alumina matrix under various excitation conditions

    Energy Technology Data Exchange (ETDEWEB)

    Gaponenko, N. V., E-mail: nik@nano.bsuir.edu.by [Belarusian State University of Informatics and Radioelectronics (Belarus); Kortov, V. S. [Yeltsin Ural Federal University (Russian Federation); Orekhovskaya, T. I.; Nikolaenko, I. A. [Belarusian State University of Informatics and Radioelectronics (Belarus); Pustovarov, V. A.; Zvonarev, S. V.; Slesarev, A. I. [Yeltsin Ural Federal University (Russian Federation); Prislopski, S. Ya. [National Academy of Sciences of Belarus, Stepanov Institute of Physics (Belarus)

    2011-07-15

    Terbium-doped alumina xerogel layers are synthesized by the sol-gel method in pores of a porous anodic alumina film 1 {mu}m thick with a pore diameter of 150-180 nm; the film is grown on a silicon substrate. The fabricated structures exhibit terbium photoluminescence with bands typical of trivalent terbium terms. Terbium X-ray luminescence with the most intense band at 542 nm is observed for the first time for such a structure. Morphological analysis of the structure by scanning electron microscopy shows the presence of xerogel clusters in pore channels, while the main pore volume remains unfilled and pore mouths remain open. The data obtained confirm the promising applications of fabricated structures for developing matrix converters of X-rays and other ionizing radiations into visible light. The possibilities of increasing luminescence intensity in the matrix converter are discussed.

  11. Optical Properties of Lithium Terbium Fluoride and Implications for Performance in High Power Lasers (Postprint)

    Science.gov (United States)

    2016-02-01

    AFRL-RX-WP-JA-2016-0323 OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS... AMERICA (STINFO COPY) AIR FORCE RESEARCH LABORATORY MATERIALS AND MANUFACTURING DIRECTORATE WRIGHT-PATTERSON AIR FORCE BASE, OH 45433-7750 AIR...OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS (POSTPRINT) 5a. CONTRACT NUMBER IN-HOUSE 5b

  12. Detection of biothiols in cells by a terbium chelate-Hg (II) system

    Science.gov (United States)

    Tan, Hongliang; Chen, Yang

    2012-01-01

    Great efforts have been devoted to the development of sensitive and specific analysis methods for biothiols because of their important roles in biological systems. We present a new detection system for biothiols that is based on the reversible quenching and restoration of fluorescence of terbium chelate caused by Hg2+ and thiol species. In the presence of biothiols, a restoration of fluorescence of terbium chelate after quenching by Hg2+ was observed due to the interaction of Hg2+ with thiol groups, and the restored fluorescence increased with the concentration of biothiols. This method was sensitive and selective for biothiols. The detection limit was 80 nM for glutathione, 100 nM for Hcy, and 400 nM for Cysteine, respectively. The terbium chelate-Hg (II) system was successfully applied to determine the levels of biothiols in cancer cells and urine samples. Further, it was also shown to be comparable to Ellman's assay. Compared to other fluorescence methods, the terbium chelate probe is advantageous because interference from short-lived nonspecific fluorescence can be efficiently eliminated due to the long fluorescence lifetime of terbium chelate, which allows for detection by time-resolved fluorescence. The terbium chelate probe can serve as a diagnostic tool for the detection of abnormal levels of biothiols in disease.

  13. Cryogenic temperature characteristics of Verdet constant of terbium sesquioxide ceramics

    Science.gov (United States)

    Snetkov, I. L.; Palashov, O. V.

    2016-12-01

    The dependence of the Verdet constant on temperature in the (80-300 K) range for a promising magneto-active material terbium sesquioxide Tb2O3 at the wavelengths of 405-1064 nm is considered. For each of the studied wavelengths, the Verdet constant of the material cooled down to the liquid nitrogen temperature increased by more than a factor of 3.2 as compared to the room temperature value. Similarly to the other paramagnetics, the increase follows the law ∼1/T. Approximations for the temperature dependence of the Verdet constant have been obtained and the value of 1/V·(dV/dT) has been estimated. This information is needed to determine the angle of rotation as well as the variation of the extinction ratio of a Faraday isolator with temperature and extremely important at creation a cryogenic Faraday devices.

  14. At PS170 (APPLE)

    CERN Multimedia

    CERN PhotoLab

    1983-01-01

    APPLE stands for Antiproton-Proton to Pair of LEptons (an acronym of the ancestor experiment PAPLEP), the PS170 experiment setup at LEAR to study e+e-pair production in antiproton-proton annihilation by Padova-(CEN) Saclay- Torino Collaboration. It consisted of a liquid hydrogen target surrounded by several layers of proportional chambers in the vertical field of a C-magnet (this photo), a gas Cerenkov counter, wire chambers, hodoscopes, and an electromagnetic calorimeter (see photo 8302539X, 8302540X). See also photo 8301539X for the setup assembly at an early stage.

  15. Biogenic terbium oxide nanoparticles as the vanguard against osteosarcoma

    Science.gov (United States)

    Iram, Sana; Khan, Salman; Ansary, Abu Ayoobul; Arshad, Mohd; Siddiqui, Sahabjada; Ahmad, Ejaz; Khan, Rizwan H.; Khan, Mohd Sajid

    2016-11-01

    The synthesis of inner transition metal nanoparticles via an ecofriendly route is quite difficult. This study, for the first time, reports synthesis of terbium oxide nanoparticles using fungus, Fusarium oxysporum. The biocompatible terbium oxide nanoparticles (Tb2O3 NPs) were synthesized by incubating Tb4O7 with the biomass of fungus F. oxysporum. Multiple physical characterization techniques, such as UV-visible and photoluminescence spectroscopy, TEM, SAED, and zeta-potential were used to confirm the synthesis, purity, optical and surface characteristics, crystallinity, size, shape, distribution, and stability of the nanoemulsion of Tb2O3 NPs. The Tb2O3 NPs were found to inhibit the propagation of MG-63 and Saos-2 cell-lines (IC50 value of 0.102 μg/mL) and remained non-toxic up to a concentration of 0.373 μg/mL toward primary osteoblasts. Cell viability decreased in a concentration-dependent manner upon exposure to 10 nm Tb2O3 NPs in the concentration range 0.023-0.373 μg/mL. Cell toxicity was evaluated by observing changes in cell morphology, cell viability, oxidative stress parameters, and FACS analysis. Morphological examinations of cells revealed cell shrinkage, nuclear condensation, and formation of apoptotic bodies. The level of ROS within the cells-an indicator of oxidative stress was significantly increased. The induction of apoptosis at concentrations ≤ IC50 was corroborated by 4‧,6-diamidino-2-phenylindole dihydrochloride (DAPI) staining (DNA damage and nuclear fragmentation). Flow-cytometric studies indicated that the response was dose dependent with a threshold effect.

  16. Autofluorescence-free Live-cell Imaging Using Terbium Nanoparticles.

    Science.gov (United States)

    Cardoso Dos Santos, Marcelina; Goetz, Joan; Bartenlian, Hortense; Wong, Ka-Leung; Charbonniere, Loïc Joanny; Hildebrandt, Niko

    2018-02-20

    Fluorescent nanoparticles (NPs) have become irreplaceable tools for advanced cellular and sub-cellular imaging. While very bright NPs require excitation with UV or visible light, which can create strong autofluorescence of biological components, NIR-excitable NPs without autofluorescence issues exhibit much lower brightness. Here, we show the application of a new type of surface-photosensitized terbium NPs (Tb-NPs) for autofluorescence-free intracellular imaging in live HeLa cells. Combination of exceptionally high brightness, high photostability, and long photoluminecence (PL) lifetimes for highly efficient suppression of the short-lived autofluorescence, allowed for time-gated PL imaging of intracellular vesicles over 72 h without toxicity and at extremely low Tb-NP concentrations down to 12 pM. Detection of highly resolved long-lifetime (ms) PL decay curves from small (~10 µm2) areas within single cells within a few seconds emphasized the unprecedented photophysical properties of Tb-NPs for live-cell imaging that extend well beyond currently available nanometric imaging agents.

  17. Solar Thermochemical Hydrogen Production via Terbium Oxide Based Redox Reactions

    Directory of Open Access Journals (Sweden)

    Rahul Bhosale

    2016-01-01

    Full Text Available The computational thermodynamic modeling of the terbium oxide based two-step solar thermochemical water splitting (Tb-WS cycle is reported. The 1st step of the Tb-WS cycle involves thermal reduction of TbO2 into Tb and O2, whereas the 2nd step corresponds to the production of H2 through Tb oxidation by water splitting reaction. Equilibrium compositions associated with the thermal reduction and water splitting steps were determined via HSC simulations. Influence of oxygen partial pressure in the inert gas on thermal reduction of TbO2 and effect of water splitting temperature (TL on Gibbs free energy related to the H2 production step were examined in detail. The cycle (ηcycle and solar-to-fuel energy conversion (ηsolar-to-fuel efficiency of the Tb-WS cycle were determined by performing the second-law thermodynamic analysis. Results obtained indicate that ηcycle and ηsolar-to-fuel increase with the decrease in oxygen partial pressure in the inert flushing gas and thermal reduction temperature (TH. It was also realized that the recuperation of the heat released by the water splitting reactor and quench unit further enhances the solar reactor efficiency. At TH=2280 K, by applying 60% heat recuperation, maximum ηcycle of 39.0% and ηsolar-to-fuel of 47.1% for the Tb-WS cycle can be attained.

  18. Folate Receptor Targeted Alpha-Therapy Using Terbium-149

    CERN Document Server

    Müller, Cristina; Haller, Stephanie; Dorrer, Holger; Köster, Ulli; Johnston, Karl; Zhernosekov, Konstantin; Türler, Andreas; Schibli, Roger

    2014-01-01

    Terbium-149 is among the most interesting therapeutic nuclides for medical applications. It decays by emission of short-range α-particles (Eα = 3.967 MeV) with a half-life of 4.12 h. The goal of this study was to investigate the anticancer efficacy of a 149Tb-labeled DOTA-folate conjugate (cm09) using folate receptor (FR)-positive cancer cells in vitro and in tumor-bearing mice. 149Tb was produced at the ISOLDE facility at CERN. Radiolabeling of cm09 with purified 149Tb resulted in a specific activity of ~1.2 MBq/nmol. In vitro assays performed with 149Tb-cm09 revealed a reduced KB cell viability in a FR-specific and activity concentration-dependent manner. Tumor-bearing mice were injected with saline only (group A) or with 149Tb-cm09 (group B: 2.2 MBq; group C: 3.0 MBq). A significant tumor growth delay was found in treated animals resulting in an increased average survival time of mice which received 149Tb-cm09 (B: 30.5 d; C: 43 d) compared to untreated controls (A: 21 d). Analysis of blood parameters rev...

  19. Hardness and dielectric characteristics of flux grown terbium aluminate crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, K.K.; Kotru, P.N. [Jammu Univ. (India). Dept. of Physics; Tandon, R.P. [National Physical Laboratory, New Delhi (India); Wanklyn, B.M. [Clarendon Laboratory, University of Oxford, Oxford (United Kingdom)

    1999-01-29

    Results of indentation induced Vickers hardness testing and dielectric studies conducted on flux-grown terbium aluminate crystals are presented. It is shown that the Vickers hardness value (H{sub v}) is independent of indentation time, but depends on the applied load. Applying the concept of Hays and Kendall, the load independent values are estimated for (110) and (001) planes. Differential behaviour in the crack formation of two different planes (110) and (001) is observed, while (001) plane develops Palmqvist cracks in the whole load range of 10-100 g, (110) plane shows a transition from Palmqvist to median cracks at 70 g. The fracture toughness, brittleness index and yield strength are determined for both the planes. The hardness anisotropy is reported. The dielectric constant, dielectric loss and conductivity are shown to be dependent on temperature and frequency of the applied a.c. field. The dielectric constant versus temperature shows a transition peak at 230 C, which remains independent of the frequency of the applied a.c. field in the range 1 kHz-13 MHz. (orig.) 36 refs.

  20. Thermoluminescence of cerium and terbium -doped calcium pyrophosphate

    Energy Technology Data Exchange (ETDEWEB)

    Roman L, J.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Lozano R, I. B.; Diaz G, J. A. I., E-mail: jesus.roman@nucleares.unam.mx [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, 11500 Mexico D. F. (Mexico)

    2015-10-15

    The aim of this work is to report the thermoluminescence (Tl) response of Calcium Pyrophosphate phosphor doped with Cerium and Terbium impurities (Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+}). The phosphors were synthesized using the co-precipitation method and annealed at 900 degrees C by two hours for obtain the β phase. The intentional doping with Ce and Tb ions was 1 at.% and 0.1 at.%, whereas in the EDS results the concentration of impurities was 0.39 at.% and 0.05 at.%, respectively. The superficial morphology of phosphor is mainly composed by thin wafers of different size. All samples were exposed to gamma rays from {sup 60}Co in the Gammacell-200 irradiator. The Tl response of the phosphor was measured from Rt up to 350 degrees C and under nitrogen atmosphere in a Harshaw TLD 3500 reader. The glow curves of the Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+} powders showed a broad intense Tl peak centered at 165 degrees C and a shoulder at approximate 260 degrees C was observed. A linear Tl response in the range of absorbed dose of 0.2 to 10 Gy was obtained. Tl glow curves were analyzed using the initial rise (IR)and computerized glow curve deconvolution methods to evaluate the kinetics parameters such as activation energy (E), frequency factor (s) and kinetic order (b). (Author)

  1. Solvent polarity and oxygen sensitivity, rather than viscosity, determine lifetimes of biaryl-sensitised terbium luminescence.

    Science.gov (United States)

    Walter, Edward R H; Williams, J A Gareth; Parker, David

    2017-12-14

    In a macrocyclic terbium complex incorporating a biaryl sensitiser, the observed variation of emission lifetime is shown to be determined by the solubility of oxygen in the solvent system and the relative energy of the chromophore excited state, rather than any dependence on solvent viscosity.

  2. Arginine-responsive terbium luminescent hybrid sensors triggered by two crown ether carboxylic acids

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Lasheng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Tang, Ke; Ding, Xiaoping [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Zhou, Zhan; Xiao, Rui [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China)

    2013-12-01

    Crown ether carboxylic acids constitute main building blocks for the synthesis of terbium containing covalent cross-linked luminescent materials. Both the complexes and the hybrid nanomaterials could exhibit remarkable green emissions in pure water. More importantly, they were found to have a profound effect on the luminescence responses to arginine compared with glutamic acid, histidine, tryptophan, threonine, tyrosine and phenylalanine in aqueous environment. The present study provided the possibility of using a host–guest mechanism as a way of signal transduction based on lanthanide supramolecular hybrid materials. - Highlights: • Crown ether carboxylic acids were found to sensitize terbium ions among a group of ethers. • The complexes and silica hybrid materials were both prepared and characterized. • They could exhibit remarkable green emissions in pure water.

  3. Comparative analysis of conjugated alkynyl chromophore-triazacyclononane ligands for sensitized emission of europium and terbium.

    Science.gov (United States)

    Soulié, Marine; Latzko, Frédéric; Bourrier, Emmanuel; Placide, Virginie; Butler, Stephen J; Pal, Robert; Walton, James W; Baldeck, Patrice L; Le Guennic, Boris; Andraud, Chantal; Zwier, Jurriaan M; Lamarque, Laurent; Parker, David; Maury, Olivier

    2014-07-07

    A series of europium and terbium complexes based on a functionalized triazacyclononane carboxylate or phosphinate macrocyclic ligand is described. The influence of the anionic group, that is, carboxylate, methylphosphinate, or phenylphosphinate, on the photophysical properties was studied and rationalized on the basis of DFT calculated structures. The nature, number, and position of electron-donating or electron-withdrawing aryl substituents were varied systematically within the same phenylethynyl scaffold in order to optimize the brightness of the corresponding europium complexes and investigate their two-photon absorption properties. Finally, the europium complexes were examined in cell-imaging applications, and selected terbium complexes were studied as potential oxygen sensors. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe

    OpenAIRE

    Ramezani, Amir M.; Manzoori, Jamshid L.; Amjadi, Mohammad; Jouyban, Abolghasem

    2012-01-01

    A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb3+-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum resp...

  5. 21 CFR 211.170 - Reserve samples.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Reserve samples. 211.170 Section 211.170 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Laboratory Controls § 211.170 Reserve...

  6. 40 CFR 170.250 - Decontamination.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Decontamination. 170.250 Section 170... PROTECTION STANDARD Standard for Pesticide Handlers § 170.250 Decontamination. (a) Requirement. During any..., decontamination supplies for washing off pesticides and pesticide residues. (b) General conditions. (1) The...

  7. 40 CFR 170.150 - Decontamination.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Decontamination. 170.150 Section 170... PROTECTION STANDARD Standard for Workers § 170.150 Decontamination. (a)(1) Requirement. The agricultural employer must provide decontamination supplies for workers in accordance with this section whenever: (i...

  8. 42 CFR 457.170 - Withdrawal process.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Withdrawal process. 457.170 Section 457.170 Public... Plans for Child Health Insurance Programs and Outreach Strategies § 457.170 Withdrawal process. (a... amendment, or any portion of a proposed State plan or plan amendment, at any time during the review process...

  9. 21 CFR 172.170 - Sodium nitrate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium nitrate. 172.170 Section 172.170 Food and... Preservatives § 172.170 Sodium nitrate. The food additive sodium nitrate may be safely used in or on specified... sablefish, smoked, cured salmon, and smoked, cured shad, so that the level of sodium nitrate does not exceed...

  10. Genetically Encoded FRET-Sensor Based on Terbium Chelate and Red Fluorescent Protein for Detection of Caspase-3 Activity

    Directory of Open Access Journals (Sweden)

    Alexander S. Goryashchenko

    2015-07-01

    Full Text Available This article describes the genetically encoded caspase-3 FRET-sensor based on the terbium-binding peptide, cleavable linker with caspase-3 recognition site, and red fluorescent protein TagRFP. The engineered construction performs two induction-resonance energy transfer processes: from tryptophan of the terbium-binding peptide to Tb3+ and from sensitized Tb3+ to acceptor—the chromophore of TagRFP. Long-lived terbium-sensitized emission (microseconds, pulse excitation source, and time-resolved detection were utilized to eliminate directly excited TagRFP fluorescence and background cellular autofluorescence, which lasts a fraction of nanosecond, and thus to improve sensitivity of analyses. Furthermore the technique facilitates selective detection of fluorescence, induced by uncleaved acceptor emission. For the first time it was shown that fluorescence resonance energy transfer between sensitized terbium and TagRFP in the engineered construction can be studied via detection of microsecond TagRFP fluorescence intensities. The lifetime and distance distribution between donor and acceptor were calculated using molecular dynamics simulation. Using this data, quantum yield of terbium ions with binding peptide was estimated.

  11. Nuclear Data Sheets for 170Ta

    Science.gov (United States)

    Balin, Coral M.

    1998-06-01

    Nuclear structure data pertaining to 170Ta have been compiled and evaluated, and incorporated into the ENSDF data file. This evaluation of 170Ta supersedes the previous publications (Zhou Chunmei, Nuclear Data Sheets 50,351 (1987) (cutoff date November 1985), and Coral M. Baglin, Nuclear Data Sheets 77,125 (1996) (cutoff date October 1995)), and includes literature available by 7 April 1998. The newly incorporated references are: 97MeZZ ( 170W ɛ decay); 97Zh17 and 98Zh08 (a new (HI,xnγ) study). One collective band, previously assigned to 170Ta, has now been reassigned to 170Hf.

  12. 10,170 flawless welds

    CERN Multimedia

    Antonella Del Rosso

    2014-01-01

    The welding of tubes containing the principal current-carrying busbars in the LHC magnets was one of the main activities of the SMACC project. After a year of preparation and another of intense activity in the tunnel, the last weld was completed on Wednesday 14 May. Over 10,170 welds have been inspected and not a single fault has been found.    The welder (above) creates the weld using an orbital welding machine (below) specifically designed for CERN. Each of the eight sectors of the LHC contains around 210 interconnects between the superconducting magnets. Consolidating these interconnections was the SMACC project’s primary objective. One of the last jobs before closing the interconnects is the welding of the M lines: each has a 104 mm diameter and a radial clearance of just 45 mm. In total: 10,170 welds carried out in a single year of activities. A true challenge, which was carried out by a team of 30 highly specialised welders, working under the supervision o...

  13. Green light emission in aluminum oxide powders doped with different terbium concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Mariscal B, L; Falcony, C. [IPN, Centro de Investigacion y de Estudios Avanzados, 07360 Ciudad de Mexico (Mexico); Carmona T, S.; Murrieta, H.; Sanchez A, M. A. [UNAM, Instituto de Fisica, 04510 Ciudad de Mexico (Mexico); Vazquez A, R. [IPN, Escuela Superior de Computo, 07738 Ciudad de Mexico (Mexico); Garcia R, C. M., E-mail: mariscal2005@gmail.com [UNAM, Facultad de Ciencias, 04510 Ciudad de Mexico (Mexico)

    2016-11-01

    Different emission intensities presented in aluminum oxide phosphors corresponding to different concentrations of doping performed with terbium are analyzed. The phosphors were synthesized by the evaporation technique and were characterized by photo and cathodoluminescence, X-ray diffraction and EDS techniques for different incorporation percentages of terbium as dopant; they show characteristic transitions in 494, 543, 587 and 622 nm, corresponding to {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4} and {sup 5}D{sub 4} → {sup 7}F{sub 3}, respectively when they are excited with λ{sub exc} = 380 nm wavelength at room temperature. The results of X-ray diffraction show the presence of α-Al{sub 2}O{sub 3} phases with peaks located at 2θ = 25.78, 35.34, 37.96, 43.56, 45.8, 52.74, 57.7, 61.5, 66.74, 68.44, 77.12 and 80.94, and the δ-Al{sub 2}O-3 phase 2θ = 32.82, 45.8, 61.36 and 66.74. These compounds were heat treated for two hours at 1100 degrees Celsius. EDS analyzes indicate that these compounds have close to 60% oxygen around of 40% aluminum in the presence of terbium as dopant which indicates a stoichiometry close to the expected one for alumina. (Author)

  14. Graphene quantum dots-terbium ions as novel sensitive and selective time-resolved luminescent probes.

    Science.gov (United States)

    Llorent-Martínez, Eulogio J; Durán, Gema M; Ríos, Ángel; Ruiz-Medina, Antonio

    2018-01-01

    We propose an alternative approach for the development of analytical methods based on terbium-sensitized luminescence (TSL). TSL is based on the complexation between Tb(III) ions and fluorescent organic compounds that have appropriate functional groups to complex with Tb(III). We report the use of graphene quantum dot (GQDs) nanoparticles to improve the sensitivity and selectivity of TSL detection. GQDs can react with terbium ions through the carboxylic groups present in their structure. These Tb(III)-GQD complexes, formed in situ in aqueous solution, can be used as time-resolved luminescent probes. Ascorbic acid was selected as a target analyte to demonstrate the suitability of the proposed method. The selectivity of the TSL method was highly improved for most of the interferences tested. Under the optimum conditions [Tb(III) concentration 5 × 10-4 mol L-1, GQD concentration 4 mg L-1], a minimum 100% increase in selectivity was observed for several vitamins and common cations that may be present in the samples to be analyzed. In addition, the analytical signal showed a 30% enhancement with the use of GQDs compared with the use of merely Tb(III) ions, with a detection limit of 0.12 μg mL-1. The repeatability and intermediate precision were lower than 3% and 5%, respectively. From the results obtained, the implementation of GQDs in TSL can lead to the development of novel time-resolved luminescent probes with high analytical potential. Graphical abstract Quenching of Tb(III)-graphene quantum dot (GQD) luminescence by ascorbic acid (AA). TBL terbium-sensitized luminescence.

  15. Fluorescence study of some terbium-oligopeptide complexes in methanolic solution.

    Science.gov (United States)

    Rabouan, S; Delage, J; Durand, W; Prognon, P; Barthes, D

    2000-04-03

    This study concerned the use of lanthanide chelates to detect glycyl-leucyl-phenylalanine (GLF) and its homologues. Spectroscopic analysis of peptides without or with terbium complexation revealed the formation of (LF)(3)(Tb)(2), (GF)(3)(Tb)(2), (GLF)(3)(Tb)(2) and (FL)(4)Tb, (FG)(4)Tb complexes with high stability constants in methanolic solutions (pK(d)>13). Lanthanide chelate emission displayed a large Stokes shift (>270 nm), which allowed Tb chelates of GLF and its derivatives to be used for detection purposes. However, this preliminary study indicated some important limitations associated with lanthanide chelation, such as high methanolic content.

  16. Electromagnetic properties of terbium gallium garnet at millikelvin temperatures and low photon energy

    Science.gov (United States)

    Kostylev, Nikita; Goryachev, Maxim; Bushev, Pavel; Tobar, Michael E.

    2017-07-01

    Electromagnetic properties of single crystal terbium gallium garnet are characterised from room down to millikelvin temperatures using the whispering gallery mode method. Microwave spectroscopy is performed at low powers equivalent to a few photons in energy and conducted as functions of the magnetic field and temperature. A phase transition is detected close to the temperature of 3.5 K. This is observed for multiple whispering gallery modes causing an abrupt negative frequency shift and a change in transmission due to extra losses in the new phase caused by a change in complex magnetic susceptibility.

  17. Nuclear excitation functions from 40 to 200 MeV proton irradiation of terbium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W., E-mail: jwengle@lanl.gov; Mashnik, Stepan G.; Parker, Lauren A.; Jackman, Kevin R.; Bitteker, Leo J.; Ullmann, John L.; Gulley, Mark S.; Pillai, Chandra; John, Kevin D.; Birnbaum, Eva R.; Nortier, Francois M.

    2016-01-01

    Nuclear formation cross sections are reported for 26 radionuclides, measured with 40–200 MeV proton irradiations of terbium foils. These data provide the basis for the production of medically relevant radionuclides (e.g., {sup 152}Tb, {sup 155}Tb, {sup 155}Eu, and {sup 156}Eu) and {sup 153}Gd, a potential source used in ongoing efforts to characterize stellar nucleosynthesis routes. Computational predictions from the ALICE2011, CEM03.03, Bertini, and INCL + ABLA codes are compared with newly measured data to contribute to the ongoing process of code development, and yields are calculated for selected radionuclides using measured data.

  18. Micelle-enhanced and terbium-sensitized spectrofluorimetric determination of gatifloxacin and its interaction mechanism

    Science.gov (United States)

    Guo, Changchuan; Wang, Lei; Hou, Zhun; Jiang, Wei; Sang, Lihong

    2009-05-01

    A terbium-sensitized spectrofluorimetric method using an anionic surfactant, sodium dodecyl benzene sulfonate (SDBS), was developed for the determination of gatifloxacin (GFLX). A coordination complex system of GFLX-Tb 3+-SDBS was studied. It was found that SDBS significantly enhanced the fluorescence intensity of the complex (about 11-fold). Optimal experimental conditions were determined as follows: excitation and emission wavelengths of 331 and 547 nm, pH 7.0, 2.0 × 10 -4 mol l -1 terbium (III), and 2.0 × 10 -4 mol l -1 SDBS. The enhanced fluorescence intensity of the system (Δ If) showed a good linear relationship with the concentration of GFLX over the range of 5.0 × 10 -10 to 5.0 × 10 -8 mol l -1 with a correlation coefficient of 0.9996. The detection limit (3 σ) was determined as 6.0 × 10 -11 mol l -1. This method has been successfully applied to the determination of GFLX in pharmaceuticals and human urine/serum samples. Compared with most of other methods reported, the rapid and simple procedure proposed in the text offers higher sensitivity, wider linear range, and better stability. The interaction mechanism of the system is also studied by the research of ultraviolet absorption spectra, surface tension, solution polarity and fluorescence polarization.

  19. Circularly Polarized Luminescence in Enantiopure Europium and Terbium Complexes with Modular, All-Oxygen Donor Ligands

    Science.gov (United States)

    Seitz, Michael; Do, King; Ingram, Andrew J.; Moore, Evan G.; Muller, Gilles; Raymond, Kenneth N.

    2009-01-01

    Abstract: Circulaly polarized luminescence from terbium(III) complexed and excited by chiral antenna ligands gives strong emission The modular synthesis of three new octadentate, enantiopure ligands are reported - one with the bidentate chelating unit 2-hydroxyisophthalamide (IAM) and two with 1-hydroxy-2-pyridinone (1,2-HOPO) units. A new design principle is introduced for the chiral, non-racemic hexamines which constitute the central backbones for the presented class of ligands. The terbium(III) complex of the IAM ligand, as well as the europium(III) complexes of the 1,2-HOPO ligands are synthesized and characterized by various techniques (NMR, UV, CD, luminescence spectroscopy). All species exhibit excellent stability and moderate to high luminescence efficiency (quantum yields ΦEu = 0.05–0.08 and ΦTb = 0.30–0.57) in aqueous solution at physiological pH. Special focus is put onto the properties of the complexes in regard to circularly polarized luminescence (CPL). The maximum luminescence dissymmetry factors (glum) in aqueous solution are high with |glum|max = 0.08 – 0.40. Together with the very favorable general properties (good stability, high quantum yields, long lifetimes), the presented lanthanide complexes can be considered as good candidates for analytical probes based on CPL in biologically relevant environments. PMID:19639983

  20. Nuclear Data Sheets for 170Lu

    Science.gov (United States)

    Baglin, Coral M.

    1998-11-01

    Nuclear structure data pertaining to 170Lu have been compiled and evaluated, and incorporated into the ENSDF data file. This evaluation of 170Lu supersedes the previous publication (C. Baglin, Nuclear Data Sheets 77,125 (1996) (literature cutoff date October 1995)), and includes literature available by 8 Otober 1998.

  1. 27 CFR 20.170 - Physical inventory.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Physical inventory. 20.170... Users of Specially Denatured Spirits Inventory and Records § 20.170 Physical inventory. Once in each... physical inventory of each formula of new and recovered specially denatured spirits. (Approved by the...

  2. 48 CFR 229.170-3 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reports. 229.170-3 Section... DEFENSE GENERAL CONTRACTING REQUIREMENTS TAXES General 229.170-3 Reports. The contracting officer shall submit a report to the designated Security Assistance Office when a foreign government or entity imposes...

  3. 38 CFR 59.170 - Forms.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Forms. 59.170 Section 59.170 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) GRANTS TO... Forms, or at the Veterans Health Administration, Room 789, 810 Vermont Ave., NW., Washington, DC 20420...

  4. 10 CFR 170.11 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Exemptions. 170.11 Section 170.11 Energy NUCLEAR... licensing or safety issues, even though the NRC may realize some benefits from its review and approval of... educational institution for a production or utilization facility, other than a power reactor, or for the...

  5. 13 CFR 120.170 - Flood insurance.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Flood insurance. 120.170 Section... to All Business Loans Requirements Imposed Under Other Laws and Orders § 120.170 Flood insurance.... 4000 et seq.)), a loan recipient must obtain flood insurance if any building (including mobile homes...

  6. 21 CFR 145.170 - Canned peaches.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned peaches. 145.170 Section 145.170 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... ingredients: (i) Natural and artificial flavors. (ii) Spice. (iii) Vinegar, lemon juice, or organic acids. (iv...

  7. 21 CFR 155.170 - Canned peas.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned peas. 155.170 Section 155.170 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... drained weight of the finished food. (b) Lemon juice or concentrated lemon juice. (c) Mint leaves. (d...

  8. Luminescent method of determination of composition of europium and terbium complexes in solution by change of intensity ratio of luminescence bands

    Energy Technology Data Exchange (ETDEWEB)

    Bel' tyukova, S.V.; Nazarenko, N.A.; Poluehktov, N.S.

    1982-03-01

    The complexes of europium and terbium with phenanthroline, ethylenediaminetetraacetate, nitrilotriacetate, some acids-phenol derivatives and ..beta..-diketones series have been used as an example to demonstrate that the value of the ratio of intensities on the two bands of europium(terbium) luminescence spectra - the one corresponding to the hypersensitive'' transition and the other, to the magnetic dipole one - can be used for determination of the complexes composition in solutions.

  9. Dicty_cDB: VHB170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB170 (Link to dictyBase) - - - Contig-U16315-1 VHB170P (Link to Original site) VHB...170F 549 VHB170Z 780 VHB170P 1309 - - Show VHB170 Library VH (Link to library) Clone ID VHB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-C/VHB170Q.Seq.d/ Representative seq. ID VHB...170P (Link to Original site) Representative DNA sequence >VHB170 (VHB170Q) /CSM/VH/VHB1-C/VHB...CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHB170 (VHB170Q) /CSM/VH/VHB1-C/VHB

  10. 48 CFR 1402.170 - Acronyms.

    Science.gov (United States)

    2010-10-01

    ... Solicitor TFMTreasury Financial Manual U.S.C.United States Code VECPValue Engineering Change Proposal ... AND TERMS Definitions 1402.170 Acronyms. A&EArchitect & Engineering ACMISAcquisition Career Management...

  11. 45 CFR 170.402 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... TECHNOLOGY STANDARDS, IMPLEMENTATION SPECIFICATIONS, AND CERTIFICATION CRITERIA AND CERTIFICATION PROGRAMS FOR HEALTH INFORMATION TECHNOLOGY Temporary Certification Program for HIT § 170.402 Definitions. For the purposes of this subpart: Applicant means a single organization or a consortium of organizations...

  12. Thermo-transferred thermoluminescence (TTTl) in potassium-yttrium double fluoride doped with terbium

    Energy Technology Data Exchange (ETDEWEB)

    Gallegos, A.; Rivera, T.; Diaz G, J. A. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Legaria 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Azorin, J. [Universidad Autonoma Metropolitana, Unidad Iztapalapa, San Rafael Atlixco No. 186, Col. Vicentina, 09340 Mexico D. F. (Mexico); Azorin, J. C. [Universidad de Guanajuato, Division de Ciencias e Ingenierias-Campus Leon, Lomas del Bosque No. 103, Col. Lomas del Campestre, 37000 Leon, Guanajuato (Mexico); Licona, R.; Rivas, F.; Hernandez C, G. [Benemerita Universidad Autonoma de Puebla, Facultad de Ciencias Quimicas, 14 Sur y San Claudio, Ciudad Universitaria, Puebla de Zaragoza, Puebla (Mexico); Khaidukov, N. [Institute of General and Inorganic Chemistry, Lenin SK 11 Prospect 31, Moscow 117907 (Russian Federation)

    2011-02-15

    This paper presents results of studying the thermo-transferred thermoluminescence (TTTl) phenomenon in potassium-yttrium double fluoride doped with terbium (K{sub 2}YF{sub 5:}Tb) at different impurity concentrations (0.8%, 0.95% and 0.99%). Previously to study the TTTl phenomenon, structural characterization and chemical composition of the materials were determined. The structural studies were conducted using a scanning electron microscope; meanwhile, chemical composition was analyzed using energy dispersive X-ray spectroscopy. Thermoluminescence kinetics was studied irradiating the samples with {sup 137}Cs gamma rays as well as with {sup 90}Sr/{sup 90}Y beta rays, analyzing the glow curves by the deconvolution method for obtaining the kinetic parameters. (Author)

  13. The influence of pressure on the photoluminescence properties of a terbium-adipate framework

    Science.gov (United States)

    Spencer, Elinor C.; Zhao, Jing; Ross, Nancy L.; Andrews, Michael B.; Surbella, Robert G.; Cahill, Christopher L.

    2013-06-01

    The influence of pressure (over the 0-4.7 GPa range) on the photoluminescence emissions and crystal structure of the known 3D terbium-adipate metal-organic framework material Tb-GWMOF6 has been evaluated by high-pressure single-crystal X-ray diffraction and spectroscopic techniques. The results from this study show that this complex lanthanide framework structure undergoes three phase transitions within the 0-4 GPa pressure range that involve alterations in the number of symmetry independent Tb3+ ion sites within the crystal lattice. These pressure induced modifications to the structure of Tb-GWMOF6 lead to pronounced changes in the profiles of the 5D4→7F5 emission spectra of this complex.

  14. Terbium Radionuclides for Theranostics Applications: A Focus On MEDICIS-PROMED

    Science.gov (United States)

    Cavaier, R. Formento; Haddad, F.; Sounalet, T.; Stora, T.; Zahi, I.

    A new facility, named CERN-MEDICIS, is under construction at CERN to produce radionuclides for medical applications. In parallel, the MEDICIS-PROMED, a Marie Sklodowska-Curie innovative training network of the Horizon 2020 European Commission's program, is being coordinated by CERN to train young scientists on the production and use of innovative radionuclides and develop a network of experts within Europe. One program within MEDICIS-PROMED is to determine the feasibility of producing innovative radioisotopes for theranostics using a commercial middle-sized high-current cyclotron and the mass separation technology developed at CERN-MEDICIS. This will allow the production of high specific activity radioisotopes not achievable with the common post-processing by chemical separation. Radioisotopes of scandium, copper, arsenic and terbium have been identified. Preliminary studies of activation yield and irradiation parameters optimization for the production of Tb-149 will be described.

  15. Dielectric and conducting behavior of gadolinium-terbium fumarate heptahydrate crystals

    Science.gov (United States)

    Shah, M. D.; Want, B.

    2015-07-01

    Gadolinium-terbium fumarate heptahydrate crystals were grown in silica gel by using single gel diffusion technique. The crystals were characterized by different physico-chemical techniques of characterization. Powder X-ray diffraction results showed that the grown material is purely crystalline in nature. Elemental analyses suggested the chemical formula of the compound to be Gd Tb (C4H2O4)3ṡ7H2O. Energy dispersive X-ray analysis confirmed the presence of Gd and Tb in the title compound. The dielectric and conductivity studies of the grown compound were carried as function of frequency of applied field and the temperature. The grown material showed a dielectric anomaly which was correlated with its thermal behavior. The ac conductivity of the material showed Jonscher's power law behavior: σ(ω)=σo+Aωs, with a temperature-dependent power exponent s(<1). The conductivity was found to be a function of temperature and frequency.

  16. Highly sensitive detection of dipicolinic acid with a water-dispersible terbium-metal organic framework.

    Science.gov (United States)

    Bhardwaj, Neha; Bhardwaj, Sanjeev; Mehta, Jyotsana; Kim, Ki-Hyun; Deep, Akash

    2016-12-15

    The sensitive detection of dipicolinic acid (DPA) is strongly associated with the sensing of bacterial organisms in food and many types of environmental samples. To date, the demand for a sensitive detection method for bacterial toxicity has increased remarkably. Herein, we investigated the DPA detection potential of a water-dispersible terbium-metal organic framework (Tb-MOF) based on the fluorescence quenching mechanism. The Tb-MOF showed a highly sensitive ability to detect DPA at a limit of detection of 0.04nM (linear range of detection: 1nM to 5µM) and also offered enhanced selectivity from other commonly associated organic molecules. The present study provides a basis for the application of Tb-MOF for direct, convenient, highly sensitive, and specific detection of DPA in the actual samples. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. A New Bis(phthalocyaninato) Terbium Single-Ion Magnet with an Overall Excellent Magnetic Performance.

    Science.gov (United States)

    Chen, Yuxiang; Ma, Fang; Chen, Xiaoxiang; Dong, Bowei; Wang, Kang; Jiang, Shangda; Wang, Chiming; Chen, Xin; Qi, Dongdong; Sun, Haoling; Wang, Bingwu; Gao, Song; Jiang, Jianzhuang

    2017-11-20

    Bulky and strong electron-donating dibutylamino groups were incorporated onto the peripheral positions of one of the two phthalocyanine ligands in the bis(phthalocyaninato) terbium complex, resulting in the isolation of heteroleptic double-decker (Pc)Tb{Pc[N(C4H9)2]8} {Pc = phthalocyaninate; Pc[N(C4H9)2]8 = 2,3,9,10,16,17,23,24-octakis(dibutylamino)phthalocyaninate} with the nature of an unsymmetrical molecular structure, a square-antiprismatic coordination geometry, an intensified coordination field strength, and the presence of organic radical-f interaction. As a total result of all these factors, this sandwich-type tetrapyrrole lanthanide single-ion magnet (SIM) exhibits an overall enhanced magnetic performance including a high blocking temperature (TB) of 30 K and large effective spin-reversal energy barrier of Ueff = 939 K, rendering it the best sandwich-type tetrapyrrole lanthanide SIM reported thus far.

  18. Ultralarge magneto-optic rotations and rotary dispersion in terbium gallium garnet single crystal.

    Science.gov (United States)

    Shaheen, Amrozia; Majeed, Hassaan; Anwar, Muhammad Sabieh

    2015-06-10

    We report systematically acquired data on the Verdet constant of terbium gallium garnet for wavelengths ranging from visible to near-infrared (405-830 nm) regime. Our experimental method of Stokes polarimetry is based on the Fourier decomposition of the received light intensity and allows unambiguous determination of both the Faraday rotation and the ellipticity of the emergent light. Temperature-dependent investigations in the range of 8-300 K extend earlier reports and verify the Verdet's constant direct dependence on the magnetization, whose first-order approximation is simply a manifestation of the Curie's law. Further, a least-squares fitting of the experimental data correlates well with theoretical predictions. At a wavelength of 405 nm and temperature of 8 K, the rotation is approximately 500°.

  19. Terbium fluorescence as a sensitive, inexpensive probe for UV-induced damage in nucleic acids

    Energy Technology Data Exchange (ETDEWEB)

    El-Yazbi, Amira F.; Loppnow, Glen R., E-mail: glen.loppnow@ualberta.ca

    2013-07-05

    Graphical abstract: -- Highlights: •Simple, inexpensive, mix-and-read assay for positive detection of DNA damage. •Recognition of undamaged DNA via hybridization to a hairpin probe. •Terbium(III) fluorescence reports the amount of damage by binding to ssDNA. •Tb/hairpin is a highly selective and sensitive fluorescent probe for DNA damage. -- Abstract: Much effort has been focused on developing methods for detecting damaged nucleic acids. However, almost all of the proposed methods consist of multi-step procedures, are limited, require expensive instruments, or suffer from a high level of interferences. In this paper, we present a novel simple, inexpensive, mix-and-read assay that is generally applicable to nucleic acid damage and uses the enhanced luminescence due to energy transfer from nucleic acids to terbium(III) (Tb{sup 3+}). Single-stranded oligonucleotides greatly enhance the Tb{sup 3+} emission, but duplex DNA does not. With the use of a DNA hairpin probe complementary to the oligonucleotide of interest, the Tb{sup 3+}/hairpin probe is applied to detect ultraviolet (UV)-induced DNA damage. The hairpin probe hybridizes only with the undamaged DNA. However, the damaged DNA remains single-stranded and enhances the intrinsic fluorescence of Tb{sup 3+}, producing a detectable signal directly proportional to the amount of DNA damage. This allows the Tb{sup 3+}/hairpin probe to be used for sensitive quantification of UV-induced DNA damage. The Tb{sup 3+}/hairpin probe showed superior selectivity to DNA damage compared to conventional molecular beacons probes (MBs) and its sensitivity is more than 2.5 times higher than MBs with a limit of detection of 4.36 ± 1.2 nM. In addition, this probe is easier to synthesize and more than eight times cheaper than MBs, which makes its use recommended for high-throughput, quantitative analysis of DNA damage.

  20. Fine- and hyperfine structure investigations of even configuration system of atomic terbium

    Science.gov (United States)

    Stefanska, D.; Elantkowska, M.; Ruczkowski, J.; Furmann, B.

    2017-03-01

    In this work a parametric study of the fine structure (fs) and the hyperfine structure (hfs) for the even-parity configurations of atomic terbium (Tb I) is presented, based in considerable part on the new experimental results. Measurements on 134 spectral lines were performed by laser induced fluorescence (LIF) in a hollow cathode discharge lamp; on this basis, the hyperfine structure constants A and B were determined for 52 even-parity levels belonging to the configurations 4f85d6s2, 4f85d26s or 4f96s6p; in all the cases those levels were involved in the transitions investigated as the lower levels. For 40 levels the hfs was examined for the first time, and for the remaining 12 levels the new measurements supplement our earlier results. As a by-product, also preliminary values of the hfs constants for 84 odd-parity levels were determined (the investigations of the odd-parity levels system in the terbium atom are still in progress). This huge amount of new experimental data, supplemented by our earlier published results, were considered for the fine and hyperfine structure analysis. A multi-configuration fit of 7 configurations was performed, taking into account second-order of perturbation theory, including the effects of closed shell-open shell excitations. Predicted values of the level energies, as well as of magnetic dipole and electric quadrupole hyperfine structure constants A and B, are quoted in cases when no experimental values are available. By combining our experimental data with our own semi-empirical procedure it was possible to identify correctly the lower and upper level of the line 544.1440 nm measured by Childs with the use of the atomic-beam laser-rf double-resonance technique (Childs, J Opt Soc Am B 9;1992:191-6).

  1. Structural and optical characterization of terbium doped ZnGa2O4 thin films deposited by RF magnetron sputtering

    Science.gov (United States)

    Somasundaram, K.; Girija, K. G.; Sudarsan, V.; Selvin, P. Christopher; Vatsa, R. K.

    2016-05-01

    Tb3+ doped ZnGa2O4 nanophosphor (21 nm) has been synthesized via low temperature polyol route and subsequently thin films of the same were deposited on glass and ITO substrates by RF magnetron sputtering. The films were characterized by X-ray Diffraction and luminescence measurements. The XRD pattern showed that Tb3+ doped ZnGa2O4 nanophosphor has a cubic spinel phase. Luminescence behavior of the nanophosphor and as deposited sputtered film was investigated. The PL emission spectra of nanophosphor gave a broad ZnGa2O4 host emission band along with a strong terbium emission and the thin films showed only broad host emission band and there was no terbium ion emission.

  2. Determination of fluoxetine in pharmaceutical and biological samples based on the silver nanoparticle enhanced fluorescence of fluoxetine-terbium complex.

    Science.gov (United States)

    Lotfi, Ali; Manzoori, Jamshid L

    2016-11-01

    In this study, a simple and sensitive spectrofluorimetric method is presented for the determination of fluoxetine based on the enhancing effect of silver nanoparticles (AgNPs) on the terbium-fluoxetine fluorescence emission. The AgNPs were prepared by a simple reduction method and characterized by UV-Vis spectroscopy and transmission electron microscopy. It was indicated that these AgNPs have a remarkable amplifying effect on the terbium-sensitized fluorescence of fluoxetine. The effects of various parameters such as AgNP and Tb(3+) concentration and the pH of the media were investigated. Under obtained optimal conditions, the fluorescence intensity of the terbium-fluoxetine-AgNP system was enhanced linearly by increasing the concentration of fluoxetine in the range of 0.008 to 19 mg/L. The limit of detection (b + 3s) was 8.3 × 10(-4) mg/L. The interference effects of common species found in real samples were also studied. The method had good linearity, recovery, reproducibility and sensitivity, and was satisfactorily applied for the determination of fluoxetine in tablet formulations, human urine and plasma samples. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  3. Neutron Diffraction and Electrical Transport Studies on Magnetic Transition in Terbium at High Pressures and Low Temperatures

    Science.gov (United States)

    Thomas, Sarah; Montgomery, Jeffrey; Tsoi, Georgiy; Vohra, Yogesh; Weir, Samuel; Tulk, Christopher; Moreira Dos Santos, Antonio

    2013-06-01

    Neutron diffraction and electrical transport measurements have been carried out on the heavy rare earth metal terbium at high pressures and low temperatures in order to elucidate its transition from a helical antiferromagnetic to a ferromagnetic ordered phase as a function of pressure. The electrical resistance measurements using designer diamonds show a change in slope as the temperature is lowered through the ferromagnetic Curie temperature. The temperature of the ferromagnetic transition decreases at a rate of -16.7 K/GPa till 3.6 GPa, where terbium undergoes a structural transition from hexagonal close packed (hcp) to an α-Sm phase. Above this pressure, the electrical resistance measurements no longer exhibit a change in slope. In order to confirm the change in magnetic phase suggested by the electrical resistance measurements, neutron diffraction measurements were conducted at the SNAP beamline at the Oak Ridge National Laboratory. Measurements were made at pressures to 5.3 GPa and temperatures as low as 90 K. An abrupt increase in peak intensity in the neutron diffraction spectra signaled the onset of magnetic order below the Curie temperature. A magnetic phase diagram of rare earth metal terbium will be presented to 5.3 GPa and 90 K based on these studies.

  4. Study of Silver Nanoparticles Sensitized Fluorescence and Second-Order Scattering of Terbium(III-Pefloxacin Mesylate Complex and Determination of Pefloxacin Mesylate

    Directory of Open Access Journals (Sweden)

    Aiyun Li

    2014-01-01

    Full Text Available α-Keto acid of pefloxacin mesylate (PFLX can form the complex with Terbium(III. The intramolecular energy from PFLX to Terbium(III ion takes place when excited, and thus Terbium(III excited state is formed and then emits the characteristic fluorescence of Terbium(III, locating at 490, 545, 580, and 620 nm. The second-order scattering (SOS peak at 545 nm also appears for the complex with the exciting wavelength of 273 nm. When the silver nanoparticles are added to the system, the luminescence intensity at 545 nm greatly increased. So, with the adding of nanoparticles to the Terbium(III-PFLX complex, not only is the intramolecular energy promoted but also the SOS intensity is enhanced. The experimental results show that it is the silver nanoparticles with certain size and certain concentration which can greatly enhance the fluorescence-SOS intensity, and the relative intensity at 545 nm is proportional to the amount of PFLX. Based on this phenomenon, a novel method for the determination of PFLX has been developed and applied to the determination of PFLX in capsule and serum samples.

  5. Nuclear Data Sheets for 170Pt

    Science.gov (United States)

    Baglin, Coral M.

    1999-02-01

    Nuclear structure data pertaining to170Pt have been compiled and evaluated, and incorporated into the ENSDF data file. This evaluation of170Pt supersedes the previous publication (Coral M. Baglin,Nuclear Data Sheets 77,125 (1996) (literature cutoff date October 1995)), and includes literature available by 17 February 1999. The newly incorporated references are: 98Se20, 98Ki20, 97Ju04, 96Bi07 and 95Au04. Three new data sets have been added, as follows:174Hg α decay,171Au p decay (1.02 ms), (HI,xnγ).

  6. Influence of crystalline structure on the luminescence properties of terbium orthotantalates

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Kisla P.F. [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil); Carmo, Alexandre P. [Instituto Federal Fluminense, Campus Cabo Frio, RJ 28909-971 (Brazil); Bell, Maria J.V. [Departamento de Física, Universidade Federal de Juiz de Fora, Juiz de Fora 36036-330, MG (Brazil); Dias, Anderson, E-mail: anderson_dias@iceb.ufop.br [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil)

    2013-06-15

    Terbium orthotantalate powders were produced with M-fergusonite type (I2/a) and M′-fergusonite type (P2/a) structures. The samples were studied by X-ray diffraction, Raman scattering, and photoluminescence measurements (emission and decay curves). The results showed that crystalline materials were obtained with all the 18 Raman-active modes predicted by group theory calculations. Also, it was observed through photoluminescence decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. Photoluminescence emission curves exhibited some variation in spectral shape, peak position, and relative intensity as a consequence of their different crystalline arrangements. The dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549.2 nm (M-type) and 543.0 nm (M′-type). Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively. M′-type materials seems to be the most suitable for luminescent devices and could be a potential green luminescent material due to the strongest emission if compared with the M-fergusonite type. -- Highlights: ► Terbium orthotantalates were prepared in two different crystalline structures: I2/a and P2/a. ► XRD and Raman scattering showed that the different space groups obtained were exhibited all the 18 Raman-active modes. ► PL decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. ► Dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549 nm (M-type) and 543 nm (M′-type). ► Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively.

  7. 1 CFR 457.170 - Compliance procedures.

    Science.gov (United States)

    2010-01-01

    ... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.170 Compliance... Employment Opportunity Director, National Capital Planning Commission, 1325 G Street NW., Washington, DC... the permission of the Assistant Attorney General. (l) The agency may delegate its authority for...

  8. 48 CFR 1837.170 - Pension portability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Pension portability. 1837... ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Service Contracts-General 1837.170 Pension portability. (a) It is NASA's policy not to require pension portability in service contracts. However, pension...

  9. 22 CFR 1510.170 - Compliance procedures.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AFRICAN DEVELOPMENT FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE AFRICAN DEVELOPMENT FOUNDATION § 1510.170 Compliance..., Office of Administration and Finance, shall be responsible for coordinating implementation of this...

  10. 45 CFR 2490.170 - Compliance procedures.

    Science.gov (United States)

    2010-10-01

    ... FOUNDATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.170 Compliance procedures. (a) Except as... Rehabilitation Act of 1973 (29 U.S.C. 791). (c) The Director of Administration and Finance shall be responsible...

  11. Reference: 170 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 170 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15705949i Salom辿 Pat...he Arabidopsis circadian clock. 3 791-803 15705949 2005 Mar The Plant cell McClung C Robertson|Salom辿 Patrice A

  12. 21 CFR 1311.170 - Transmission requirements.

    Science.gov (United States)

    2010-04-01

    ... dispensing.” Data on the prescription may be electronically transferred to medical records, and a list of... ORDERS AND PRESCRIPTIONS (Eff. 6-1-10) Electronic Prescriptions § 1311.170 Transmission requirements. (a) The electronic prescription application must transmit the electronic prescription as soon as possible...

  13. 48 CFR 1509.170-3 - Applicability.

    Science.gov (United States)

    2010-10-01

    .... (c) EPA Form 1900-26, Contracting Officer's Evaluation of Contractor Performance, and EPA Form 1900-27, Project Officer's Evaluation of Contractor Performance, applies to all performance evaluations... PLANNING CONTRACTOR QUALIFICATIONS Contractor Performance Evaluations 1509.170-3 Applicability. (a) This...

  14. 45 CFR 1181.170 - Compliance procedures.

    Science.gov (United States)

    2010-10-01

    ... HUMANITIES INSTITUTE OF MUSEUM AND LIBRARY SERVICES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE INSTITUTE OF MUSEUM AND LIBRARY SERVICES § 1181.170... Museum and Library Services, 1100 Pennsylvania Ave., NW., room 510, Washington, DC 20506. (d) The agency...

  15. 27 CFR 9.170 - Long Island.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Long Island. 9.170 Section... Island. (a) Name. The name of the viticultural area described in this section is “Long Island.” (b) Approved maps. The appropriate maps for determining the boundary of the Long Island viticultural area are...

  16. Laser control and temperature switching of luminescence intensity in photostable transparent film based on terbium(III) β-diketonate complex

    Science.gov (United States)

    Lapaev, Dmitry V.; Nikiforov, Victor G.; Safiullin, Georgy M.; Lobkov, Vladimir S.; Salikhov, Kev M.; Knyazev, Andrey A.; Galyametdinov, Yury G.

    2014-11-01

    The study of the terbium(III) and gadolinium(III) β-diketonate complexes by photoluminescence spectroscopy reveals considerable changes of the photophysical properties of the complexes under the UV laser irradiation. The measurements show the enhancement of the luminescence intensities in the vitrified transparent film of the terbium(III) complex as well as the gadolinium(III) complex under the 337 nm laser irradiation at room temperature. The irradiated film of the terbium(III) complex restores the initial photophysical properties after heating close to the melting temperature (∼353 K) and cooling. We observe no change of the luminescent properties of the irradiated film for months. These features can be used for the design of new lanthanide-based photostable systems with laser control of the luminescence intensity.

  17. Development of functionalized terbium fluorescent nanoparticles for antibody labeling and time-resolved fluoroimmunoassay application.

    Science.gov (United States)

    Ye, Zhiqiang; Tan, Mingqian; Wang, Guilan; Yuan, Jingli

    2005-01-15

    Silica-based functionalized terbium fluorescent nanoparticles were prepared, characterized and developed as a fluorescence probe for antibody labeling and time-resolved fluoroimmunoassay. The nanoparticles were prepared in a water-in-oil (W/O) microemulsion containing a strongly fluorescent Tb(3+) chelate, N,N,N(1),N(1)-[2,6-bis(3'-aminomethyl-1'-pyrazolyl)phenylpyridine] tetrakis(acetate)-Tb(3+) (BPTA-Tb(3+)), Triton X-100, octanol, and cyclohexane by controlling copolymerization of tetraethyl orthosilicate (TEOS) and 3-[2-(2-aminoethylamino)ethylamino]propyl-trimethoxysilane (AEPS) with ammonia water. The characterizations by transmission electron microscopy and fluorometric methods show that the nanoparticles are spherical and uniform in size, 45 +/- 3nm in diameter, strongly fluorescent with fluorescence quantum yield of 10% and a long fluorescence lifetime of 2.0ms. The amino groups directly introduced to the nanoparticle's surface by using AEPS in the preparation made the surface modification and bioconjugation of the nanoparticles easier. The nanoparticle-labeled anti-human alpha-fetoprotein antibody was prepared and used for time-resolved fluoroimmunoassay of alpha-fetoprotein (AFP) in human serum samples. The assay response is linear from 0.10ngml(-1) to about 100ngml(-1) with the detection limit of 0.10ngml(-1). The coefficient variations (CVs) of the method are less than 9.0%, and the recoveries are in the range of 84-98% for human serum sample measurements.

  18. Highly efficient precipitation of phosphoproteins using trivalent europium, terbium, and erbium ions

    Energy Technology Data Exchange (ETDEWEB)

    Guezel, Yueksel; Rainer, Matthias; Mirza, Munazza Raza; Bonn, Guenther K. [Leopold-Franzens University, Institute of Analytical Chemistry and Radiochemistry, Innsbruck (Austria)

    2012-05-15

    This study describes a highly efficient method for the selective precipitation of phosphoproteins by trivalent europium, terbium, and erbium metal ions. These metal cations belong to the group of lanthanides and are known to be hard acceptors with an overwhelming preference for oxygen-containing anions such as phosphates to which they form very tight ionic bonds. The method could be successfully applied to specifically precipitate phosphoproteins from complex samples including milk and egg white by forming solid metal-protein complexes. Owing to the low solubility product of the investigated lanthanide salts, the produced metal-protein complexes showed high stability. The protein pellets were extensively washed to remove nonphosphorylated proteins and contaminants. For the analysis of proteins the pellets were first dissolved in 30 % formic acid and subjected to matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) MS. For peptide mass-fingerprint analysis the precipitated phosphoproteins were enzymatically digested using microwave-assisted digestion. The method was found to be highly specific for the isolation and purification of phosphoproteins. Protein quantification was performed by colorimetric detection of total precipitated phosphoproteins and revealed more than 95 % protein recovery for each lanthanide salt. (orig.)

  19. A Terbium Sensitized Luminescence Method for the Assay of Flubiprofen in Pharmaceutical Formulations

    Directory of Open Access Journals (Sweden)

    Salma M.Z. Al-Kindy

    2014-12-01

    Full Text Available A sensitive time-resolved luminescence method for the determination of flubiprofen (FLP in methanol and in aqueous solution is described. The method is based on the luminescence sensitization of terbium (Tb3+ by the formation of a ternary complex with FLP in the presence of 4,7 diphenyl 1,10 phenanthroline (DPP as co-ligand, and Tween-20 as surfactant. The signal for Tb-FLP-DPP was monitored at λex  = 285 nm and λem  = 552 nm. Optimum conditions for the formation of the complex in an aqueous system were TRIS buffer, pH 8.0, DPP (2.5Å~10−7  M, Tween-20 (0.30% and 4Å~10-5  mol L-1  of Tb3+  which allowed the determination of 20–1000 ng mL-1  of FLP with a limit of detection (LOD of 10 ng mL-1 . The relative standard deviations of the method ranged between 0.6 and 1.4% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assays of FLP in pharmaceutical formulations and spiked tap water samples with average recoveries of 87% – 95%.

  20. Sensitization effects of supramolecular assemblies on the luminescence of terbium-ion prulifloxacin complexes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Hong; Yi Chongyue; Li Xue; Fang Fang [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Yang Yajiang, E-mail: yjyang@mail.hust.edu.c [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2011-04-15

    Luminescence enhancement of terbium-ion prulifloxacin complexes (Tb(III)-PUFX) in supramolecular hydrogels formed by assembly of 1,3:2,4-di-O-benzylidene-D-sorbitol (DBS) was investigated by steady-state fluorescence, varying temperature fluorescence and time-resolved fluorescence. The luminescence images show that Tb(III)-PUFX were dispersed in the DBS gels. The luminescence intensity of Tb(III)-PUFX in the DBS gels was significantly increased in comparison with that in corresponding aqueous solutions. The varying temperature fluorescent spectra show that the luminescence intensity of Tb(III)-PUFX decreased with an increase in the temperature. This implies that the luminescence enhancement of Tb(III)-PUFX is related to the dissociation and the formation of the DBS assemblies. Time-resolved fluorescence measurements show slower rotational motion in DBS gels in comparison with that in the corresponding aqueous solutions. This may be ascribed to a unique microstructure of three-dimensional network formed by DBC aggregates, resulting in deactivation of the nonradiative relaxation. The images of field emission scanning electron microscopy and polarized optical microscopy indicate that the morphology of the DBS assemblies was not influenced upon addition of Tb(III)-PUFX to the DBS gels.

  1. A Nanoscale Multiresponsive Luminescent Sensor Based on a Terbium(III) Metal-Organic Framework.

    Science.gov (United States)

    Dang, Song; Wang, Ting; Yi, Feiyan; Liu, Qinghui; Yang, Weiting; Sun, Zhong-Ming

    2015-08-01

    A nanoscale terbium-containing metal-organic framework (nTbL), with a layer-like structure and [H2 NMe2 ](+) cations located in the framework channels, was synthesized under hydrothermal conditions. The structure of the as-prepared sample was systematically confirmed by powder XRD and elemental analysis; the morphology was characterized by field-emission SEM and TEM. The photoluminescence studies revealed that rod-like nTbL exhibited bright-green emission, corresponding to (5)D4 →(7)FJ (J=6-3) transitions of the Tb(3+) ion under excitation. Further sensing measurements revealed that as-prepared nTbL could be utilized as a multiresponsive luminescent sensor, which showed significant and exclusive detection ability for Fe(3+) ions and phenylmethanol. These results highlight the practical applications of lanthanide-containing metal-organic frameworks as fluorescent probes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Terbium-Doped VO2 Thin Films: Reduced Phase Transition Temperature and Largely Enhanced Luminous Transmittance.

    Science.gov (United States)

    Wang, Ning; Duchamp, Martial; Dunin-Borkowski, Rafal E; Liu, Shiyu; Zeng, XianTing; Cao, Xun; Long, Yi

    2016-01-26

    Vanadium dioxide (VO2) is a well-known thermochromic material with large IR modulating ability, promising for energy-saving smart windows. The main drawbacks of VO2 are its high phase transition temperature (τ(c) = 68°C), low luminous transmission (T(lum)), and weak solar modulating ability (ΔT(sol)). In this paper, the terbium cation (Tb(3+)) doping was first reported to reduce τ(c) and increase T(lum) of VO2 thin films. Compared with pristine VO2, 2 at. % doping level gives both enhanced T(lum) and ΔT(sol) from 45.8% to 54.0% and 7.7% to 8.3%, respectively. The T(lum) increases with continuous Tb(3+) doping and reaches 79.4% at 6 at. % doping level, representing ∼73.4% relative increment compared with pure VO2. This has surpassed the best reported doped VO2 thin films. The enhanced thermochromic properties is meaningful for smart window applications of VO2 materials.

  3. Luminescent investigations of terbium(III) biosorption as a surrogate for heavy metals and radionuclides.

    Science.gov (United States)

    Achyuthan, Komandoor E; Arango, Dulce C; Carles, Elizabeth L; Cutler, Christopher E; Meyer, Lauren A; Brozik, Susan M

    2009-07-01

    We describe a metal transport system for investigating the interfacial interactions between the anionic surface charge of a gram-negative bacterium (Escherichia coli) and a trivalent cationic metal, Tb3+. We believe this is the first description of the uptake kinetics, sub- and intracellular distribution, and temporal fate of Tb3+ ion in E. coli. We used the luminescence of the terbium-dipicolinic acid chelate to study metal ion transport. The bacteria had a high tolerance for the metal (IC(50) = 4 mM Tb3+). Metal ion transport was passive and metabolism independent. The uptake kinetics rapidly reached a maximum within 15 min, followed by a stasis for 60 min, and declining thereafter between 120 and 240 min, resulting in a biphasic curve. During this period, greater than one-third of the metal ion was sequestered within the cell. Our choice of a safe Biosafety Level I E. coli bacteria and the relatively non-toxic Tb3+ metal represents a model system for luminescent investigations of biosorption, for studying bacterial-water interfacial chemistry and for the bioremediation of heavy metals and radionuclides.

  4. Construction of the energy matrix for complex atoms. Part VIII: Hyperfine structure HPC calculations for terbium atom

    Science.gov (United States)

    Elantkowska, Magdalena; Ruczkowski, Jarosław; Sikorski, Andrzej; Dembczyński, Jerzy

    2017-11-01

    A parametric analysis of the hyperfine structure (hfs) for the even parity configurations of atomic terbium (Tb I) is presented in this work. We introduce the complete set of 4fN-core states in our high-performance computing (HPC) calculations. For calculations of the huge hyperfine structure matrix, requiring approximately 5000 hours when run on a single CPU, we propose the methods utilizing a personal computer cluster or, alternatively a cluster of Microsoft Azure virtual machines (VM). These methods give a factor 12 performance boost, enabling the calculations to complete in an acceptable time.

  5. 45 CFR 170.420 - Application.

    Science.gov (United States)

    2010-10-01

    ...-audit against all sections of ISO/IEC 17025:2005 (incorporated by reference in § 170.499), and the following: (i) A copy of the applicant's quality system document according to section 4.2.2 of ISO/IEC 17025... according to section 4.9.1 of ISO/IEC 17025:2005; and (iii) The qualifications of each of the applicant's...

  6. Nuclear Data Sheets for A = 170

    Science.gov (United States)

    Baglin, Coral M.

    2002-08-01

    Nuclear structure data pertaining to all nuclei with mass number A=170 have been compiled and evaluated, and incorporated into the ENSDF data file. This evaluation supersedes the previous evaluation (Coral M. Baglin, Nuclear Data Sheets 77, 125 (1996), cutoff date October 1995) and subsequent updates of the ENSDF file for Yb (cutoff 17 February 1999), Lu (cutoff 8 October 1998), Pt (cutoff 17 February 1999) and Ta (cutoff 7 April 1998). It includes all literature available by 15 August 2002.

  7. 48 CFR 1644.170 - Policy for FEHB Program subcontracting.

    Science.gov (United States)

    2010-10-01

    ... subcontracting. 1644.170 Section 1644.170 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CONTRACT MANAGEMENT SUBCONTRACTING POLICIES AND PROCEDURES General 1644.170 Policy for FEHB Program subcontracting. (a) General policy. Carriers must follow...

  8. 40 CFR 68.170 - Prevention program/Program 2.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Prevention program/Program 2. 68.170 Section 68.170 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.170 Prevention program/Program...

  9. 46 CFR 126.170 - Carriage of offshore workers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Carriage of offshore workers. 126.170 Section 126.170... CERTIFICATION General § 126.170 Carriage of offshore workers. (a) Offshore workers may be carried aboard an OSV in compliance with this subchapter. The maximum number of offshore workers authorized for carriage...

  10. 40 CFR 159.170 - Human epidemiological and exposure studies.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Human epidemiological and exposure studies. 159.170 Section 159.170 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS STATEMENTS OF POLICIES AND INTERPRETATIONS Reporting Requirements for Risk/Benefit Information § 159.170 Human epidemiological and...

  11. 27 CFR 17.170 - Retention of records.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Retention of records. 17.170 Section 17.170 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... PRODUCTS Records § 17.170 Retention of records. Each manufacturer shall retain for a period of not less...

  12. Spectrofluorimetric determination of human serum albumin using terbium-danofloxacin probe.

    Science.gov (United States)

    Ramezani, Amir M; Manzoori, Jamshid L; Amjadi, Mohammad; Jouyban, Abolghasem

    2012-01-01

    A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb(3+)-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb(3+)-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb(3+)-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH = 7.8, [Tb(3+)] = 8.5 × 10(-5) mol L(-1), [Dano] = 1.5 × 10(-4) mol L(-1). The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2 × 10(-6) - 1.3 × 10(-6) mol L(-1), 0.2 × 10(-6) - 1.4 × 10(-6) mol L(-1), and 0.2 × 10(-6) - 1 × 10(-6) mol L(-1), respectively. The detection limits (S/N = 3) for BSA, HSA, and plasma sample of HSA were 8.7 × 10(-8) mol L(-1), 6.2 × 10(-8) mol L(-1), and 8.1 × 10(-8) mol L(-1), respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.

  13. Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe

    Directory of Open Access Journals (Sweden)

    Amir M. Ramezani

    2012-01-01

    Full Text Available A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA and bovine serum albumin (BSA using terbium-danofloxacin (Tb3+-Dano as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA. Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH=7.8, [Tb3+] =8.5×10−5 mol L−1, [Dano] =1.5×10−4 mol L−1. The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2×10−6−1.3×10−6 mol L−1, 0.2×10−6−1.4×10−6 mol L−1, and 0.2×10−6−1×10−6 mol L−1, respectively. The detection limits (S/N = 3 for BSA, HSA, and plasma sample of HSA were 8.7×10−8 mol L−1, 6.2×10−8 mol L−1, and 8.1×10−8 mol L−1, respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.

  14. Determination of flavonoids in pharmaceutical preparations using Terbium sensitized fluorescence method

    Directory of Open Access Journals (Sweden)

    M Shaghaghi

    2009-12-01

    Full Text Available "nBackground and the Purpose of the Study: The aim of this study was development and validation of a simple, rapid and sensitive spectrofluorimetric method for determination of total flavonoids in two topical formulations of Calendula officinalis, Ziziphus Spina-christi and an oral drop of Hypiran perforatum L. The proposed method is based on the formation of terbium (Tb3+ "n-flavonoids (quercetin as a reference standard complex at pH 7.0, which has fluorescence intensely with maximum emission at 545 nm when excited at 310 nm. "nMethod "n: For ointments masses of topical formulations were weighed and added to ethanol-aqueous buffer (pH 10.0 and the resulting mixtures were shaken and then two phases were separated by centrifugation. Aqueous phases were filtered and then diluted with water. For Hypiran drops an appropriate portion was diluted with ethanol and then aliquots of sample or standard solutions were determined according to the experimental procedure. "nResults "n: Under the optimum conditions, total concentrations of flavonoids (as quercetin equivalent in three tested formulations were found to be 0.204 mg/g (for Dermatin cream, 0.476 mg/g (for Calendula ointment and 13.50 μg/ml (for Hypiran drops. Analytical recoveries from samples spiked with different amounts of quercetin were 96.1-104.0 % with RSD % of less than 3.5. Conclusion : The proposed method which requires a simple dissolution step without any matrix interferences provided high sensitivity and selectivity and was easily applied to determine total flavonoids in real samples of three investigated formulations with excellent reproducibility.

  15. TOF SIMS analysis and generation of white photoluminescence from strontium silicate codoped with europium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Tshabalala, Modiehi A.; Swart, Hendrik C.; Ntwaeaborwa, Odireleng M., E-mail: ntwaeab@ufs.ac.za [Department of Physics, University of the Free State, P.O Box 339, Bloemfontein 9300 South Africa (South Africa)

    2014-03-15

    White light emitting terbium (Tb{sup 3+}) and europium (Eu{sup 3+}) codoped strontium silicate (Sr{sub 2}SiO{sub 4}) phosphors were prepared by a solid state reaction process. The structure, particle morphology, chemical composition, ion distribution, photoluminescence (PL), and decay characteristics of the phosphors were analyzed by x-ray diffraction (XRD), scanning electron microscopy (SEM), time-of-flight secondary ion mass spectrometry (TOF-SIMS), and PL spectroscopy, respectively. The XRD data showed that our Sr{sub 2}SiO{sub 4} composed of two phases, namely, β-Sr{sub 2}SiO{sub 4} and α′-Sr{sub 2}SiO{sub 4}, and the α′-Sr{sub 2}SiO{sub 4} phase was more prominent than the β-Sr{sub 2}SiO{sub 4} phase. The SEM micrographs showed that the particles were agglomerated together and they did not have definite shapes. All ions (i.e., negative and positive) present in our materials were identified by TOF-SIMS. In addition, the chemical imaging performed with the TOF-SIMS demonstrated how the individual ions including the dopants (Eu{sup 3+} and Tb{sup 3+}) were distributed in the host lattice. White photoluminescence was observed when the Sr{sub 2}SiO{sub 4}:Tb{sup 3+}, Eu{sup 3+} phosphor was excited at 239 nm using a monochromatized xenon lamp as the excitation source. The phosphor exhibited fast decay lifetimes implying that it is not a good candidate for long afterglow applications.

  16. Synthesis, crystal structure and photophysical properties of europium(III) and terbium(III) complexes with pyridine-2,6-dicarboxamide

    NARCIS (Netherlands)

    Tanase, S.; Gallego, P.M.; Gelder, R. de; Fu, W.T.

    2007-01-01

    The reactions of pyridine-2,6-dicarboxamide with europium(III) and terbium(III) triflates led to the formation of mononuclear complexes of formula [Ln(pcam)(3)](CF3SO3)(3) (Ln = Eu 1, Tb 2; pcam stands for pyridine-2,6-dicarboxamide). From single-crystal X-ray diffraction analysis, the complexes

  17. Zinc sulfide and terbium-doped zinc sulfide films grown by traveling wave reactor atomic layer epitaxy

    CERN Document Server

    Yun, S J; Nam, K S

    1998-01-01

    Zinc sulfide (ZnS) and terbium-doped ZnS (ZnS:Tb) thin films were grown by traveling wave reactor atomic layer epitaxy (ALE). In the present work, ZnCl sub 2 , H sub 2 S, and tris (2,2,6,6-tetramethyl-3,5-heptandionato) terbium (Tb(tmhd) sub 3) were used as the precursors. The dependence of crystallinity and Cl content of ZnS films was investigated on the growth temperature. ZnS and ZnS:Tb films grown at temperatures ranging from 400 to 500 .deg. C showed a hexagonal-2H crystalline structure. The crystallinity of ZnS film was greatly enhanced as the temperature increased. At growth temperatures higher than 450.deg.C, the films showed preferred orientation with mainly (002) diffraction peak. The Cl content decreased from approximately 9 to 1 at.% with the increase in growth temperature from 400 to 500 .deg. C. The segregation of Cl near the surface region and the incorporation of O from Tb(tmhd) sub 3 during ALE process were also observed using Auger electron spectroscopy. The ALE-grown ZnS and ZnS:Tb films re...

  18. Commercializing potassium terbium fluoride, KTF (KTb3F10) faraday crystals for high laser power optical isolator applications

    Science.gov (United States)

    Schlichting, Wolfgang; Stevens, Kevin; Foundos, Greg; Payne, Alexis

    2017-10-01

    Many scientific lasers and increasingly industrial laser systems operate in power regime, require high-performance optical isolators to prevent disruptive light feedback into the laser cavity. The optically active Faraday material is the key optical element inside the isolator. SYNOPTICS has been supplying the laser market with Terbium Gallium Garnet (TGG - Tb3Ga5O12) for many years. It is the most commonly used material for the 650-1100nm range and the key advantages for TGG include its cubic crystal structure for alignment free processing, little to no intrinsic birefringence, and ease of manufacture. However, for high-power laser applications TGG is limited by its absorption at 1064nm and its thermo-optic coefficient, dn/dT. Specifically, thermal lensing and depolarization effects become a limiting factor at high laser powers. While TGG absorption has improved significantly over the past few years, there is an intrinsic limit. Now, SYNOPTICS is commercializing the enhanced new crystal Potassium Terbium Fluoride KTF (KTb3F10) that exhibits much smaller nonlinear refractive index and thermo-optic coefficients, and still exhibits a Verdet constant near that of TGG. This cubic crystal has relatively low absorption and thermo-optic coefficients. It is now fully characterized and available for select production orders. At OPTIFAB in October 2017 we present recent results comparing the performance of KTF to TGG in optical isolators and show SYNOPTICS advances in large volume crystal growth and the production ramp up.

  19. Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

    Directory of Open Access Journals (Sweden)

    Devender Singh

    2016-12-01

    Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

  20. 26 CFR 1.170A-9 - Definition of section 170(b)(1)(A) organization.

    Science.gov (United States)

    2010-04-01

    ... curriculum and normally has a regularly enrolled body of pupils or students in attendance at the place where... for scholarships, libraries and student loans. (ii) To qualify under section 170(b)(1)(A)(iv), the... calendar year in which the contribution is made such organization must be committed to spend such...

  1. Synthesis and luminescent study of Ce{sup 3+}-doped terbium-yttrium aluminum garnet

    Energy Technology Data Exchange (ETDEWEB)

    Dotsenko, V.P., E-mail: ssclab@ukr.net [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Berezovskaya, I.V.; Zubar, E.V.; Efryushina, N.P. [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Poletaev, N.I.; Doroshenko, Yu.A. [Institute of Combustion and Advanced Technologies, Mechnikov Odessa National University, Dvoryanskaya 2, 65082 Odessa (Ukraine); Stryganyuk, G.B. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine); HASYLAB at DESY, Notkestrasse 85, 22607 Hamburg (Germany); Voloshinovskii, A.S. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine)

    2013-02-15

    Highlights: Black-Right-Pointing-Pointer Ce{sup 3+}-doped garnets (TYAG) were prepared using nanostructured reagents. Black-Right-Pointing-Pointer The Ce{sup 3+} ions cause a very efficient yellow emission of the samples. Black-Right-Pointing-Pointer The reasons for the long wavelength position of this emission are discussed. Black-Right-Pointing-Pointer Contribution from Al atoms to the conduction band of TYAG is quite essential. - Abstract: Terbium-yttrium aluminum garnets (TYAG) doped with Ce{sup 3+} ions have been prepared by solid state reactions between nanostructured oxides of aluminum and rare earths. The luminescent properties of Ce{sup 3+} ions in (Tb{sub 0.8}Y{sub 0.2}){sub 3(1-x)}Ce{sub 3x}Al{sub 5}O{sub 12} (x = 0.03) have been studied upon excitation in the 2-20 eV region. The substitution of Tb{sup 3+} for Y{sup 3+} in the garnet structure results in broadening the emission band and shifting its maximum towards the longer wavelengths. It was found that in addition to the 4f{sup n} {yields} 4f{sup n-1}5d excitation bands of Ce{sup 3+} and Tb{sup 3+} ions, the excitation spectra for the Ce{sup 3+} emission contain broad bands at 6.73 and {approx}9.5 eV. These bands are attributed to the Ce{sup 3+}-bound exciton formation and O 2p {yields} Al 3s, 3p transitions, respectively. In contrast to the predictions based on the results of electronic structure calculations on Y{sub 3}Al{sub 5}O{sub 12} and Tb{sub 4}Al{sub 2}O{sub 9}, the threshold of interband transitions in TYAG is at high energies ( Greater-Than-Or-Slanted-Equal-To 7.3 eV), and contributions from Al{sub tetr} and Al{sub oct} atoms to the conduction-band density of states are evaluated as quite essential.

  2. Structural variations in terbium(III) complexes with 1,3-adamantanedicarboxylate and diverse co-ligands

    Energy Technology Data Exchange (ETDEWEB)

    Thuéry, Pierre, E-mail: pierre.thuery@cea.fr

    2015-07-15

    Terbium nitrate was reacted with 1,3-adamantanedicarboxylic acid (LH{sub 2}) under solvo-hydrothermal conditions with either N,N-dimethylformamide (DMF) or N,N-dimethylacetamide (DMA) as organic solvents. Hydrolysation of the latter co-solvents resulted in the formation of formate or acetate ions, which are present as co-ligands in the 1D coordination polymer [Tb(L)(HCOO)(H{sub 2}O){sub 2}] (1) and the 2D assembly [Tb(L)(CH{sub 3}COO)(H{sub 2}O)] (2). The increase in dimensionality in the latter arises from the higher connectivity provided by acetate versus formate, the L{sup 2−} ligand being bis-chelating in both cases. The complex [Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 5}][Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 4}]·3H{sub 2}O (3), another 1D species, crystallizes alongside crystals of 2. Further addition of cucurbit[6]uril (CB6), with DMF as co-solvent, gave the two complexes [Tb{sub 2}(L){sub 2}(CB6)(H{sub 2}O){sub 6}](NO{sub 3}){sub 2}·6H{sub 2}O (4) and [H{sub 2}NMe{sub 2}]{sub 2}[Tb(L)(HCOO){sub 2}]{sub 2}·CB6·3H{sub 2}O (5). Complex 4 crystallizes as a 3D framework in which Tb(L){sup +} chains are connected by tetradentate CB6 molecules, while 5 unites a carboxylate-bridged anionic 2D planar assembly and layers of CB6 molecules with counter-cations held at both portals. - Graphical abstract: One- to three-dimensional assemblies are formed in terbium(III) complexes with 1,3-adamantanedicarboxylate obtained under solvo-hydrothermal conditions, these species including formate or acetate co-ligands formed in situ, or additional cucurbit[6]uril molecules. - Highlights: • We report structures of terbium(III) complexes with 1,3-adamantanedicarboxylate. • Solvents able to generate co-ligands or counter-ions in situ have been used. • A 3D species including additional cucurbituril molecules is decribed. • One species displays an alternation of metal–organic and organic sheets.

  3. Investigating the features of the M170 in congenital prosopagnosia

    Directory of Open Access Journals (Sweden)

    Davide eRivolta

    2012-03-01

    Full Text Available Face perception generates specific neural activity as early as 170 ms post-stimulus onset, termed the M170 when measured with Magnetoencephalography (MEG. We examined the M170 in six people with congenital prosopagnosia (CP and 11 typical controls. Previous research indicates that there are two neural generators for the M170 (one within the right lateral occipital area -rLO- and one within the right fusiform gyrus -rFG-, and in the current study we explored whether these sources reflect the processing of different types of information. Individuals with CP showed face-selective M170 responses within the rLO and right rFG, which did not differ in magnitude to those of the controls. To examine possible links between neural activity and behaviour we correlated the CPs’ MEG activity generated within rLO and rFG with their face perception skills. The rLO-M170 correlated with holistic/configural face processing, whereas the rFG-M170 correlated with featural processing. Hence, the results of our study demonstrate that individuals with CP can show an M170 that is within the normal range, and that the M170 in the rLO and rFG are involved in different aspects of face processing.

  4. Complete Stokes polarimetry of magneto-optical Faraday effect in a terbium gallium garnet crystal at cryogenic temperatures.

    Science.gov (United States)

    Majeed, Hassaan; Shaheen, Amrozia; Anwar, Muhammad Sabieh

    2013-10-21

    We report the complete determination of the polarization changes caused in linearly polarized incident light due to propagation in a magneto-optically active terbium gallium garnet (TGG) single crystal, at temperatures ranging from 6.3 to 300 K. A 28-fold increase in the Verdet constant of the TGG crystal is seen as its temperature decreases to 6.3 K. In contrast with polarimetry of light emerging from a Faraday material at room temperature, polarimetry at cryogenic temperatures cannot be carried out using the conventional fixed polarizer-analyzer technique because the assumption that ellipticity is negligible becomes increasingly invalid as temperature is lowered. It is shown that complete determination of light polarization in such a case requires the determination of its Stokes parameters, otherwise inaccurate measurements will result with negative implications for practical devices.

  5. Development of Optical Isolators for Visible Light Using Terbium Aluminum Garnet (Tb3Al5O12) Single Crystals

    Science.gov (United States)

    Geho, Mikio; Takagi, Takashi; Chiku, Shinichiro; Fujii, Takashi

    2005-07-01

    We have recently reported the successful growth of incongruently melting terbium aluminum garnet (Tb3Al5O12; TAG) single crystals by the hybrid laser FZ (floating zone) method. Optical property evaluations confirmed a high transmittance and a larger Verdet constant than conventional Tb3Ga5O12 (TGG) crystals and/or Faraday glasses. In this study, we attempted to design, fabricate, and evaluate optical isolators in visible light through near-infrared (NIR) regions using TAG crystals. A finite element method (FEM) simulation of possible models led us to the preferable one based on a radially magnetized magnet. To realize this, we employed a pseudo-radially magnetized magnet. The target wavelengths of the prototype device were 408, 808, and 1064 nm. The typical extinction ratio was more than 30 dB and the insertion loss was less than 0.3 dB for AR-coated devices.

  6. 40 CFR 170.234 - Safe operation of equipment.

    Science.gov (United States)

    2010-07-01

    ... pesticides. (2) Of the potentially harmful effects of exposure to pesticides. (3) Of the correct way to... Section 170.234 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.234 Safe operation of equipment. (a) The...

  7. Dicty_cDB: VSI170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSI170 (VSI170Q) /...10 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU268263 ) Dictyostelium...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AJ292531_14( AJ292531

  8. 21 CFR 606.170 - Adverse reaction file.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Adverse reaction file. 606.170 Section 606.170... Adverse reaction file. (a) Records shall be maintained of any reports of complaints of adverse reactions... thorough investigation of each reported adverse reaction shall be made. A written report of the...

  9. 20 CFR 220.170 - The trial work period.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false The trial work period. 220.170 Section 220... DETERMINING DISABILITY Trial Work Period and Reentitlement Period for Annuitants Disabled for Any Regular Employment § 220.170 The trial work period. (a) Definition of the trial work period. The trial work period is...

  10. CLIP-170 facilitates the formation of kinetochore-microtubule attachments

    NARCIS (Netherlands)

    Tanenbaum, M.E.; Galjart, N.; Vugt, M.A.T.M. van; Medema, R.H.

    2006-01-01

    CLIP-170 is a microtubule 'plus end tracking' protein involved in several microtubule-dependent processes in interphase. At the onset of mitosis, CLIP-170 localizes to kinetochores, but at metaphase, it is no longer detectable at kinetochores. Although RNA interference (RNAi) experiments have

  11. 10 CFR 72.170 - Nonconforming materials, parts, or components.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Nonconforming materials, parts, or components. 72.170... WASTE Quality Assurance § 72.170 Nonconforming materials, parts, or components. The licensee, applicant..., documentation, segregation, disposition, and notification to affected organizations. Nonconforming items must be...

  12. 48 CFR 1602.170 - Definition of terms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Definition of terms. 1602.170 Section 1602.170 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION GENERAL DEFINITIONS OF WORDS AND TERMS Definitions of FEHBP...

  13. 45 CFR 170.499 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    ... and § 170.423. (2) ISO/IEC GUIDE 65 General Requirements for Bodies Operating Product Certification... INFORMATION TECHNOLOGY STANDARDS, IMPLEMENTATION SPECIFICATIONS, AND CERTIFICATION CRITERIA AND CERTIFICATION PROGRAMS FOR HEALTH INFORMATION TECHNOLOGY Temporary Certification Program for HIT § 170.499 Incorporation...

  14. 21 CFR 73.170 - Grape skin extract (enocianina).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Grape skin extract (enocianina). 73.170 Section 73... LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.170 Grape skin extract (enocianina). (a) Identity. (1) The color additive grape skin extract (enocianina) is a purplish-red liquid prepared by the...

  15. 48 CFR 1602.170-2 - Community rate.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Community rate. 1602.170-2... 1602.170-2 Community rate. (a) Community rate means a rate of payment based on a per member per month... using community rates. (b) Adjusted community rate means a community rate which has been adjusted for...

  16. 45 CFR 170.410 - Types of testing and certification.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Types of testing and certification. 170.410... CERTIFICATION PROGRAMS FOR HEALTH INFORMATION TECHNOLOGY Temporary Certification Program for HIT § 170.410 Types... perform the following types of testing and certification: (a) Complete EHR testing and certification; and...

  17. 170 haematological and sperm count changes following exposure to ...

    African Journals Online (AJOL)

    GBENGA MICHEAL

    Nigerian Veterinary Journal 2010 31(2):170-176. 170 ... Department of Veterinary Physiology, Biochemistry and Pharmacology, University of Ibadan,. Ibadan ..... irritant and sensitizing plant found in India New Delhi. Indian J. Agric. Sci. BRADFORD P. S. (1996): Large animal internal medicine 2 nd edition. Mosby pp. 241.

  18. A hydrometallurgical process for the recovery of terbium from fluorescent lamps: Experimental design, optimization of acid leaching process and process analysis.

    Science.gov (United States)

    Innocenzi, Valentina; Ippolito, Nicolò Maria; De Michelis, Ida; Medici, Franco; Vegliò, Francesco

    2016-12-15

    Terbium and rare earths recovery from fluorescent powders of exhausted lamps by acid leaching with hydrochloric acid was the objective of this study. In order to investigate the factors affecting leaching a series of experiments was performed in according to a full factorial plan with four variables and two levels (4 2 ). The factors studied were temperature, concentration of acid, pulp density and leaching time. Experimental conditions of terbium dissolution were optimized by statistical analysis. The results showed that temperature and pulp density were significant with a positive and negative effect, respectively. The empirical mathematical model deducted by experimental data demonstrated that terbium content was completely dissolved under the following conditions: 90 °C, 2 M hydrochloric acid and 5% of pulp density; while when the pulp density was 15% an extraction of 83% could be obtained at 90 °C and 5 M hydrochloric acid. Finally a flow sheet for the recovery of rare earth elements was proposed. The process was tested and simulated by commercial software for the chemical processes. The mass balance of the process was calculated: from 1 ton of initial powder it was possible to obtain around 160 kg of a concentrate of rare earths having a purity of 99%. The main rare earths elements in the final product was yttrium oxide (86.43%) following by cerium oxide (4.11%), lanthanum oxide (3.18%), europium oxide (3.08%) and terbium oxide (2.20%). The estimated total recovery of the rare earths elements was around 70% for yttrium and europium and 80% for the other rare earths. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Investigation of the luminescent properties of terbium-anthranilate complexes and application to the determination of anthranilic acid derivatives in aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Arnaud, N.; Georges, J

    2003-01-10

    The luminescent properties of terbium complexes with furosemide (FR), flufenamic (FF) acid, tolfenamic (TF) acid and mefenamic (MF) acid have been investigated in aqueous solutions. For all four compounds, complexation occurs when the carboxylic acid of the aminobenzoic group is dissociated and is greatly favoured in the presence of trioctylphosphine oxide as co-ligand and Triton X-100 as surfactant. Under optimum conditions, luminescence of the lanthanide ion is efficiently sensitised and the lifetime of the {sup 5}D{sub 4} resonance level of terbium in the complex is ranging between 1 and 1.9 ms, against 0.4 ms for the aqua ion. The sensitivity of the method for the determination of anthranilic acid derivatives is improved by one to two orders of magnitude with respect to that achieved using native fluorescence or terbium-sensitised luminescence in methanol. The limits of detection are 2x10{sup -10}, 5x10{sup -10} and 2x10{sup -9} mol l{sup -1} for flufenamic acid, furosemide and tolfenamic acid, and mefenamic acid, respectively, with within-run RSD values of less than 1%. The method has been applied to the determination of flufenamic acid in spiked calf sera with and without sample pretreatment. Depending on the method and the analyte concentration, the recovery was ranging between 83 and 113% and the lowest concentration attainable in serum samples was close to 1x10{sup -7} mol l{sup -1}.

  20. 49 CFR 173.170 - Black powder for small arms.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Black powder for small arms. 173.170 Section 173... Class 7 § 173.170 Black powder for small arms. Black powder for small arms that has been classed in... § 173.56; (d) Each completed package must be marked “BLACK POWDER FOR SMALL ARMS” and “NA 0027”; and (e...

  1. Structural investigation and photoluminescent properties of gadolinium(III), europium(III) and terbium(III) 3-mercaptopropionate complexes.

    Science.gov (United States)

    Souza, E R; Mazali, I O; Sigoli, F A

    2014-01-01

    This work reports on the synthesis, crystallographic determination and spectroscopic characterization of gadolinium(III), terbium(III) and europium(III) 3-mercaptopropionate complexes, aqua-tris(3-mercaptopropionate)lanthanide(III)--[Ln(mpa)3(H2O)]. The Judd-Ofelt intensity parameters were experimentally determined from emission spectrum of the [Eu(mpa)3(H2O)]complex and they were also calculated from crystallographic data. The complexes are coordination polymers, where the units of each complex are linked together by carboxylate groups leading to an unidimensional and parallel chains that by chemical interactions form a tridimensional framework. The emission spectrum profile of the [Eu(mpa)3(H2O)] complex is discussed based on point symmetry of the europium(III) ion, that explains the bands splitting observed in its emission spectrum. Photoluminescent analysis of the [Gd(mpa)3(H2O)] complex show no efficient ligand excitation but an intense charge transfer band. The excitation spectra of the [Eu(mpa)3(H2O)] and [Tb(mpa)3(H2O)] complexes do not show evidence of energy transfer from the ligand to the excited levels of these trivalent ions. Therefore the emission bands are originated only by direct f-f intraconfigurational excitation of the lantanide(III) ions.

  2. Fluorometric determination of proteins using the terbium (III)-2-thenoyltrifluoroacetone-sodium dodecyl benzene sulfonate-protein system

    Energy Technology Data Exchange (ETDEWEB)

    Jia Zhen [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Department of Chemistry, Dezhou University, Dezhou 253023 (China); Yang Jinghe [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)]. E-mail: yjh@sdu.edu.cn; Wu Xia [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Wang Fei [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Guo Changying [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Liu Shufang [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)

    2006-12-15

    It is found that in hexamethylene tetramine (HMTA)-HCl buffer of pH=8.00, proteins can enhance the fluorescence of terbium (III) (Tb{sup 3+})-2-thenoyltrifluoroacetone (TTA)-sodium dodecyl benzene sulfonate (SDBS) system. Based on this, a sensitive method for the determination of proteins is proposed. The experiments indicate that under the optimum conditions, the enhanced fluorescence intensity is in proportion to the concentration of proteins in the range of 4.0x10{sup -9}-7.5x10{sup -6}g/mL for bovine serum albumin (BSA), 5.0x10{sup -9}-1.5x10{sup -5}g/mL for human serum albumin (HSA), 1.0x10{sup -8}-7.5x10{sup -6}g/mL for egg albumin (EA). Their detection limits (S/N=3) are 0.5, 0.8 and 2.0ng/mL, respectively. The interaction mechanism is also studied.

  3. Terbium to Quantum Dot FRET Bioconjugates for Clinical Diagnostics: Influence of Human Plasma on Optical and Assembly Properties

    Directory of Open Access Journals (Sweden)

    Niko Hildebrandt

    2011-10-01

    Full Text Available Förster resonance energy transfer (FRET from luminescent terbium complexes (LTC as donors to semiconductor quantum dots (QDs as acceptors allows extraordinary large FRET efficiencies due to the long Förster distances afforded. Moreover, time-gated detection permits an efficient suppression of autofluorescent background leading to sub-picomolar detection limits even within multiplexed detection formats. These characteristics make FRET-systems with LTC and QDs excellent candidates for clinical diagnostics. So far, such proofs of principle for highly sensitive multiplexed biosensing have only been performed under optimized buffer conditions and interactions between real-life clinical media such as human serum or plasma and LTC-QD-FRET-systems have not yet been taken into account. Here we present an extensive spectroscopic analysis of absorption, excitation and emission spectra along with the luminescence decay times of both the single components as well as the assembled FRET-systems in TRIS-buffer, TRIS-buffer with 2% bovine serum albumin, and fresh human plasma. Moreover, we evaluated homogeneous LTC-QD FRET assays in QD conjugates assembled with either the well-known, specific biotin-streptavidin biological interaction or, alternatively, the metal-affinity coordination of histidine to zinc. In the case of conjugates assembled with biotin-streptavidin no significant interference with the optical and binding properties occurs whereas the histidine-zinc system appears to be affected by human plasma.

  4. Evidence of mass exchange between inside and outside of sonoluminescing bubble in aqueous solution of terbium chloride

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Jinfu, E-mail: liang.shi2007@163.com [School of Physics and Electronic Science, Guizhou Normal University, Guiyang 550001 (China); Chen, Weizhong, E-mail: wzchen@nju.edu.cn [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China); Wang, Xun; Yang, Jing; Chen, Zhan [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China)

    2016-12-16

    Highlights: • Time-resolved spectra of SBSL were obtained for Tb{sup 3+} ions emission lines. • Mass exchange between inside and outside of SL bubble was probed via Tb{sup 3+} ions lines. • The argon rectification hypothesis was tested by time-resolved spectra of SBSL. • The rate of mass exchange inside an SBSL bubble increases with increasing sound pressure. - Abstract: Spectra of single-bubble sonoluminescence (SBSL) were obtained for Tb{sup 3+} ions emission lines from bubbles in an aqueous solution of terbium chloride (TbCl{sub 3}). The spectra provide experimental evidence to prove that an air bubble driven by strong ultrasound will not eventually become a rectified pure argon bubble, which is not as predicted by the argon rectification hypothesis. The time-resolved spectra of SBSL show a mass exchange of material such as Tb{sup 3+} ions between the inside and outside of the bubble. With increasing sound pressure, the rate of mass exchange and the SBSL intensity increases.

  5. Optical properties and electrical transport of thin films of terbium(III bis(phthalocyanine on cobalt

    Directory of Open Access Journals (Sweden)

    Peter Robaschik

    2014-11-01

    Full Text Available The optical and electrical properties of terbium(III bis(phthalocyanine (TbPc2 films on cobalt substrates were studied using variable angle spectroscopic ellipsometry (VASE and current sensing atomic force microscopy (cs-AFM. Thin films of TbPc2 with a thickness between 18 nm and 87 nm were prepared by organic molecular beam deposition onto a cobalt layer grown by electron beam evaporation. The molecular orientation of the molecules on the metallic film was estimated from the analysis of the spectroscopic ellipsometry data. A detailed analysis of the AFM topography shows that the TbPc2 films consist of islands which increase in size with the thickness of the organic film. Furthermore, the cs-AFM technique allows local variations of the organic film topography to be correlated with electrical transport properties. Local current mapping as well as local I–V spectroscopy shows that despite the granular structure of the films, the electrical transport is uniform through the organic films on the microscale. The AFM-based electrical measurements allow the local charge carrier mobility of the TbPc2 thin films to be quantified with nanoscale resolution.

  6. Highly luminescent charge-neutral europium(iii) and terbium(iii) complexes with tridentate nitrogen ligands.

    Science.gov (United States)

    Senthil Kumar, Kuppusamy; Schäfer, Bernhard; Lebedkin, Sergei; Karmazin, Lydia; Kappes, Manfred M; Ruben, Mario

    2015-09-21

    We report on the synthesis of tridentate-nitrogen pyrazole-pyridine-tetrazole (L(1)H) and pyrazole-pyridine-triazole (L(2)H) ligands and their complexation with lanthanides (Ln = Gd(iii), Eu(iii) and Tb(iii)) resulting in stable, charge-neutral complexes Ln(L(1))3 and Ln(L(2))3, respectively. X-ray crystallographic analysis of the complexes with L(1) ligands revealed tricapped trigonal coordination geometry around the lanthanide ions. All complexes show bright photoluminescence (PL) in the solid state, indicating efficient sensitization of the lanthanide emission via the triplet states of the ligands. In particular, the terbium complexes show high PL quantum yields of 65 and 59% for L(1) and L(2), respectively. Lower PL efficiencies of the europium complexes (7.5 and 9%, respectively) are attributed to large energy gaps between the triplet states of the ligands and accepting levels of Eu(iii). The triplet state energy can be reduced by introducing an electron withdrawing (EW) group at the 4 position of the pyridine ring. Such substitution of L(1)H with a carboxylic ester (COOMe) EW group leads to a europium complex with increased PL quantum yield of 31%. A comparatively efficient PL of the complexes dissolved in ethanol indicates that the lanthanide ions are shielded against nonradiative deactivation via solvent molecules.

  7. Micelle enhanced and terbium sensitized spectrofluorimetric determination of danofloxacin in milk using molecularly imprinted solid phase extraction

    Science.gov (United States)

    Kaur, Kuldeep; Saini, Shivender Singh; Malik, Ashok Kumar; Singh, Baldev

    2012-10-01

    An efficient molecularly imprinted solid phase extraction (MISPE)-spectrofluorimetric method was developed to sensitively determine danofloxacin (DAN) in milk samples. Solid phase extraction procedure using MISPE cartridges was first performed on milk samples and then spectrofluorimetric determination was done at 546 nm using an excitation wavelength of 285 nm in presence of terbium and sodium dodecyl benzene sulfonate (SDBS). It was found that SDBS significantly enhanced the fluorescence intensity of the DAN-Tb3+ complex. Various factors affecting the fluorescence intensity of DAN-Tb3+-SDBS system were studied and conditions were optimized. The enhanced fluorescence intensity of the system (ΔF) showed a good linear relationship with the concentration of DAN over the range of 8.4 × 10-9-3.4 × 10-7 mol L-1 with a correlation coefficient of 0.9996. The detection limit was determined as 2.0 × 10-9 mol L-1 and the limit of quantification was determined as 6.5 × 10-9 mol L-1. The MISPE-spectrofluorimetric procedure was successfully applied to the determination of DAN in milk samples. The method is simple, rapid, sensitive and allows interference free determination of DAN in complex fluorescent matrices like milk. The method can be used to determine whether the DAN residues in milk exceed MRLs or not.

  8. Study of quantum dot based on tin/yttrium mixed oxide doped with terbium to be used as biomarker

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b, E-mail: claudiakodaira@yahoo.co [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f; Nunes, Luiz Antonio O., E-mail: luizant@ifsc.usp.b [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica. Dept. de Fisica e Informatica

    2009-07-01

    Quantum dots (semiconductors nanocrystals) have brought a promising field to develop a new generation of luminescent biomarkers. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. These luminescent dots are functionalized with biomolecules. For the luminophore particle to be connect with biologicals molecules (for example covalent antibody) is necessary a previous chemical treatment to modify luminophore particle surface and this process is called functionalization. A prior chemical treatment with changes on the surface luminophore particle is necessary to couple the luminophore to biological molecules. This process can be used as coating which can protect these particles from being dissolved by acid as well as provide functional groups for biological conjugation. This work presents a photoluminescence study of nanoparticles based on tin/yttrium mixed oxides doped with terbium (SnO{sub 2}/Y{sub 2}O{sub 3}:Tb{sup 3+}), synthesized by coprecipitation method. The nanoparticles were submitted to thermal treatment and characterized by X-Ray Powder Diffraction (XRD) that showed cassiterite phase formation and the influence of thermal treatment on nanoparticles structures. These nanoparticles going to be functionalized with a natural polysaccharide (chitosan) in order to form microspheres. These microspheres going to be irradiated with gamma radiation to sterilization and it can be evaluated if the nanoparticles are resistant to irradiation and they do not lose functionality with this process. (author)

  9. Terbium-doped gadolinium oxysulfide (Gd2O2S:Tb) scintillation-based polymer optical fibre sensor for real time monitoring of radiation dose in oncology

    Science.gov (United States)

    Lewis, E.; O'Keeffe, S.; Grattan, M.; Hounsell, A.; McCarthy, D.; Woulfe, P.; Cronin, J.; Mihai, L.; Sporea, D.; Santhanam, A.; Agazaryan, N.

    2014-05-01

    A PMMA based plastic optical fibre sensor for use in real time radiotherapy dosimetry is presented. The optical fibre tip is coated with a scintillation material, terbium-doped gadolinium oxysulfide (Gd2O2S:Tb), which fluoresces when exposed to ionising radiation (X-Ray). The emitted visible light signal penetrates the sensor optical fibre and propagates along the transmitting fibre at the end of which it is remotely monitored using a fluorescence spectrometer. The results demonstrate good repeatability, with a maximum percentage error of 0.5% and the response is independent of dose rate.

  10. 46 CFR 170.200 - Estimated lightweight vertical center of gravity.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Estimated lightweight vertical center of gravity. 170... Centers of Gravity § 170.200 Estimated lightweight vertical center of gravity. (a) Each tank vessel that... calculations required by §§ 170.170 and 172.065, the vertical center of gravity of a tank vessel in the...

  11. Early (N170/M170 face-sensitivity despite right lateral occipital brain damage in acquired prosopagnosia

    Directory of Open Access Journals (Sweden)

    Esther eAlonso Prieto

    2011-12-01

    Full Text Available Compared to objects, pictures of faces elicit a larger early electromagnetic response at occipito-temporal sites on the human scalp, with an onset of 130 ms and a peak at about 170 ms. This N170 face effect is larger in the right than the left hemisphere and has been associated with the early categorization of the stimulus as a face. Here we tested whether this effect can be observed in the absence of some of the visual areas showing a preferential response to faces as typically identified in neuroimaging. Event related potentials were recorded in response to faces, cars and their phase-scrambled versions in a well-known brain-damaged case of prosopagnosia (PS. Despite the patient’s right inferior occipital gyrus lesion encompassing the most posterior cortical area showing preferential response to faces (occipital face area, OFA, we identified an early face-sensitive component over the right occipito-temporal hemisphere of the patient that was identified as the N170. A second experiment supported this conclusion, showing the typical N170 increase of latency and amplitude in response to inverted faces. In contrast, there was no N170 in the left hemisphere, where PS has a lesion to the middle fusiform gyrus and shows no evidence of face-preferential response in neuroimaging (no left fusiform face area, or lFFA. These results were replicated by a magneto-encephalographic (MEG investigation of the patient, disclosing a M170 component only in the right hemisphere. These observations indicate that face preferential activation in the inferior occipital cortex is not necessary to elicit early visual responses associated with face perception (N170/M170 on the human scalp. These results further suggest that when the right inferior occipital cortex is damaged, the integrity of the middle fusiform gyrus and/or the superior temporal sulcus – two areas showing face preferential responses in the patient’s right hemisphere - might be necessary to generate

  12. Compact all-fiber optical Faraday components using 65-wt%-terbium-doped fiber with a record Verdet constant of -32 rad/(Tm).

    Science.gov (United States)

    Sun, L; Jiang, S; Marciante, J R

    2010-06-07

    A compact all-fiber Faraday isolator and a Faraday mirror are demonstrated. At the core of each of these components is an all-fiber Faraday rotator made of a 4-cm-long, 65-wt%-terbium-doped silicate fiber. The effective Verdet constant of the terbium-doped fiber is measured to be -32 rad/(Tm), which is 27 x larger than that of silica fiber. This effective Verdet constant is the largest value measured to date in any fiber and is 83% of the Verdet constant of commercially available crystal used in bulk optics-based isolators. Combining the all-fiber Faraday rotator with fiber polarizers results in a fully fusion spliced all-fiber isolator whose isolation is measured to be 19 dB. Combining the all-fiber Faraday rotator with a fiber Bragg grating results in an all-fiber Faraday mirror that rotates the polarization state of the reflected light by 88 +/- 4 degrees .

  13. Picomolar Traces of Americium(III) Introduce Drastic Changes in the Structural Chemistry of Terbium(III): A Break in the "Gadolinium Break".

    Science.gov (United States)

    Welch, Jan M; Müller, Danny; Knoll, Christian; Wilkovitsch, Martin; Giester, Gerald; Ofner, Johannes; Lendl, Bernhard; Weinberger, Peter; Steinhauser, Georg

    2017-10-16

    The crystallization of terbium 5,5'-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H 2 O) 7 ZT] 2 ZT⋅10 H 2 O is isostructural to light lanthanide (Ce-Gd) 5,5'-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5'-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H 2 O) 8 ] 2 ZT 3 ⋅6 H 2 O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10 8 -fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microcopy. In addition, the inclusion properties of terbium 5,5'-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. 40 CFR 170.230 - Pesticide safety training for handlers.

    Science.gov (United States)

    2010-07-01

    ... acute and chronic effects, delayed effects, and sensitization. (iii) Routes by which pesticides can... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticide safety training for handlers...) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.230 Pesticide safety...

  15. 48 CFR 1602.170-5 - Cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Cost or pricing data. 1602... Terms 1602.170-5 Cost or pricing data. (a) Experience-rated carriers. Cost or pricing data for... pricing data for community rated carriers is the specialized rating data used by carriers in computing a...

  16. 48 CFR 1845.607-170 - Contractor's approved scrap procedure.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor's approved scrap... Contractor Inventory 1845.607-170 Contractor's approved scrap procedure. (a) When a contractor has an approved scrap procedure, certain property may be routinely disposed of in accordance with that procedure...

  17. Image collection: 170 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 170 Brachiosaurus_altithorax_NL.png ブラキオサウルス Brachiosaurus Brachiosaurus altithorax ... 生物アイコン,脊索動物門,脊椎動物亜門,爬虫綱,恐竜上目・翼竜上目

  18. 48 CFR 1509.170-8 - Contractor Performance Report.

    Science.gov (United States)

    2010-10-01

    ....209-76. The NIH system provides instructions to assist contracting officers and project officers with... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor Performance... AGENCY ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Contractor Performance Evaluations 1509.170-8...

  19. Sonographically determined anomalies and outcome in 170 chromosomally abnormal fetuses

    NARCIS (Netherlands)

    J.W. Wladimiroff (Juriy); W.R. Bhaggoe (W.); M.J.E. Kristelijn (M. J E); T.E. Cohen-Overbeek (Titia); N.S. den Hollander (Nicolette); H. Brandenburg (Helen); F.J. Los

    1995-01-01

    textabstractStructural pathology and outcome were studied in 170 chromosomally abnormal fetuses. Numerical chromosomal abnormalities were established in 158 (93 per cent) cases, of which 110 (71 per cent) represented trisomies, 30 (18 per cent) Turner syndrome, and 18 (11 per cent) triploidy.

  20. 21 CFR 170.19 - Pesticide chemicals in processed foods.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pesticide chemicals in processed foods. 170.19... chemicals in processed foods. When pesticide chemical residues occur in processed foods due to the use of... exemption granted or a tolerance prescribed under section 408 of the Act, the processed food will not be...

  1. 27 CFR 24.170 - Measuring devices and testing instruments.

    Science.gov (United States)

    2010-04-01

    ... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Construction and Equipment § 24.170... contents of tanks and other storage containers, and scales and measuring devices for weighing and measuring wine, spirits, volatile fruit-flavor concentrate, or materials received and used in the production or...

  2. Chinese Characters Elicit Face-Like N170 Inversion Effects

    Science.gov (United States)

    Wang, Man-Ying; Kuo, Bo-Cheng; Cheng, Shih-Kuen

    2011-01-01

    Recognition of both faces and Chinese characters is commonly believed to rely on configural information. While faces typically exhibit behavioral and N170 inversion effects that differ from non-face stimuli (Rossion, Joyce, Cottrell, & Tarr, 2003), the current study examined whether a similar reliance on configural processing may result in similar…

  3. The 170ms Response to Faces as Measured by MEG (M170 Is Consistently Altered in Congenital Prosopagnosia.

    Directory of Open Access Journals (Sweden)

    Andreas Lueschow

    Full Text Available Modularity of face processing is still a controversial issue. Congenital prosopagnosia (cPA, a selective and lifelong impairment in familiar face recognition without evidence of an acquired cerebral lesion, offers a unique opportunity to support this fundamental hypothesis. However, in spite of the pronounced behavioural impairment, identification of a functionally relevant neural alteration in congenital prosopagnosia by electrophysiogical methods has not been achieved so far. Here we show that persons with congenital prosopagnosia can be distinguished as a group from unimpaired persons using magnetoencephalography. Early face-selective MEG-responses in the range of 140 to 200ms (the M170 showed prolonged latency and decreased amplitude whereas responses to another category (houses were indistinguishable between subjects with congenital prosopagnosia and unimpaired controls. Latency and amplitude of face-selective EEG responses (the N170 which were simultaneously recorded were statistically indistinguishable between subjects with cPA and healthy controls which resolves heterogeneous and partly conflicting results from existing studies. The complementary analysis of categorical differences (evoked activity to faces minus evoked activity to houses revealed that the early part of the 170ms response to faces is altered in subjects with cPA. This finding can be adequately explained in a common framework of holistic and part-based face processing. Whereas a significant brain-behaviour correlation of face recognition performance and the size of the M170 amplitude is found in controls a corresponding correlation is not seen in subjects with cPA. This indicates functional relevance of the alteration found for the 170ms response to faces in cPA and pinpoints the impairment of face processing to early perceptual stages.

  4. The 170ms Response to Faces as Measured by MEG (M170) Is Consistently Altered in Congenital Prosopagnosia.

    Science.gov (United States)

    Lueschow, Andreas; Weber, Joachim E; Carbon, Claus-Christian; Deffke, Iris; Sander, Tilmann; Grüter, Thomas; Grüter, Martina; Trahms, Lutz; Curio, Gabriel

    2015-01-01

    Modularity of face processing is still a controversial issue. Congenital prosopagnosia (cPA), a selective and lifelong impairment in familiar face recognition without evidence of an acquired cerebral lesion, offers a unique opportunity to support this fundamental hypothesis. However, in spite of the pronounced behavioural impairment, identification of a functionally relevant neural alteration in congenital prosopagnosia by electrophysiogical methods has not been achieved so far. Here we show that persons with congenital prosopagnosia can be distinguished as a group from unimpaired persons using magnetoencephalography. Early face-selective MEG-responses in the range of 140 to 200ms (the M170) showed prolonged latency and decreased amplitude whereas responses to another category (houses) were indistinguishable between subjects with congenital prosopagnosia and unimpaired controls. Latency and amplitude of face-selective EEG responses (the N170) which were simultaneously recorded were statistically indistinguishable between subjects with cPA and healthy controls which resolves heterogeneous and partly conflicting results from existing studies. The complementary analysis of categorical differences (evoked activity to faces minus evoked activity to houses) revealed that the early part of the 170ms response to faces is altered in subjects with cPA. This finding can be adequately explained in a common framework of holistic and part-based face processing. Whereas a significant brain-behaviour correlation of face recognition performance and the size of the M170 amplitude is found in controls a corresponding correlation is not seen in subjects with cPA. This indicates functional relevance of the alteration found for the 170ms response to faces in cPA and pinpoints the impairment of face processing to early perceptual stages.

  5. Is the N170 face specific? Controversy, context, and theory

    Directory of Open Access Journals (Sweden)

    Brian D. Earp

    2013-04-01

    Full Text Available In cognitive science, there is an ongoing debate about the architecture of the mind: does it consist of a number of mental “organs” each managing a different function in isolation, or is it more of general processor, adaptable to a wide range of tasks? One corner of this debate has centered on face processing. This is because face-perception is crucial to normal human functioning and some evidence shows that faces may be processed by the brain in a privileged way compared to other types of stimuli. For example, in EEG brain recordings, the N170 is a characteristic signal that occurs after a participant is exposed to an image of a face, but it is much less pronounced when other stimuli are shown. More than 15 years of research on the “N170 face effect” have yielded the standard view that the N170 is at the very least face-sensitive, and possibly even face-specific, that is, indexing modular processes tied exclusively to facial geometries. The specificity claim is clearly stronger, and hence subject to significant controversy; while the more conservative “sensitivity” claim had been regarded (until recently as effectively settled. Nevertheless, Thierry and colleagues, in a contentious 2007 article, sought to undermine even this “conservative” consensus: they argued that the apparent face-responsiveness of the N170 in prior research was due to systematic flaws in experimental design. Fiery debate has followed. In this review, we put the debate in its historical and philosophical context, and try to spell out some of the theoretical and logical assumptions that underlie the claims of the competing camps. We then show that the best available evidence counts, at least partially, against the Thierry et al. construal of the N170. Accordingly, it would be premature to abandon the “conservative” account of the N170, according to which it is – minimally – responsive to faces. We conclude by returning to the more controversial claim

  6. 25 CFR 170.900 - What is the purpose of the provisions relating to transportation of hazardous and nuclear waste?

    Science.gov (United States)

    2010-04-01

    ... transportation of hazardous and nuclear waste? 170.900 Section 170.900 Indians BUREAU OF INDIAN AFFAIRS... and Nuclear Waste Transportation § 170.900 What is the purpose of the provisions relating to transportation of hazardous and nuclear waste? Sections 170.900 through 170.907 on transportation of nuclear and...

  7. Crystal structures of two mononuclear complexes of terbium(III) nitrate with the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane.

    Science.gov (United States)

    Gregório, Thaiane; Giese, Siddhartha O K; Nunes, Giovana G; Soares, Jaísa F; Hughes, David L

    2017-02-01

    Two new mononuclear cationic complexes in which the TbIII ion is bis-chelated by the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane (H3LEt, C6H14O3) were prepared from Tb(NO3)3·5H2O and had their crystal and mol-ecular structures solved by single-crystal X-ray diffraction analysis after data collection at 100 K. Both products were isolated in reasonable yields from the same reaction mixture by using different crystallization conditions. The higher-symmetry complex dinitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) nitrate di-meth-oxy-ethane hemisolvate, [Tb(NO3)2(H3LEt)2]NO3·0.5C4H10O2, 1, in which the lanthanide ion is 10-coordinate and adopts an s-bicapped square-anti-prismatic coordination geometry, contains two bidentate nitrate ions bound to the metal atom; another nitrate ion functions as a counter-ion and a half-mol-ecule of di-meth-oxy-ethane (completed by a crystallographic twofold rotation axis) is also present. In product aqua-nitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) dinitrate, [Tb(NO3)(H3LEt)2(H2O)](NO3)2, 2, one bidentate nitrate ion and one water mol-ecule are bound to the nine-coordinate terbium(III) centre, while two free nitrate ions contribute to charge balance outside the tricapped trigonal-prismatic coordination polyhedron. No free water mol-ecule was found in either of the crystal structures and, only in the case of 1, di-meth-oxy-ethane acts as a crystallizing solvent. In both mol-ecular structures, the two tripodal ligands are bent to one side of the coordination sphere, leaving room for the anionic and water ligands. In complex 2, the methyl group of one of the H3LEt ligands is disordered over two alternative orientations. Strong hydrogen bonds, both intra- and inter-molecular, are found in the crystal structures due to the number of different donor and acceptor groups present.

  8. Effect of environmental stress on Sylgard 170 silicone elastomer

    Energy Technology Data Exchange (ETDEWEB)

    Buckalew, W.H.; Wyant, F.J.

    1985-05-01

    Dow Corning Sylgard 170 Silicone Elastomer has been investigated to characterize its response to accelerated thermal aging, radiation exposure, and its behavior under applied compressive forces. Sylgard 170 response to accelerated thermal aging suggests the material properties are not particularly age dependent. Radiation exposures, however, produce significant, monotonic changes in both elongation and hardness with increasing absorbed radiation dose. Elastomer response to an applied compressive force was strongly dependent on environment temperature and degree of material confinement. Variations in temperature produced large changes in compressive forces applied to confined samples. Attempts to mitigate force fluctuations by means of pressure relief paths resulted in total loss of the applied compressive force. Thus, seal applications employing this elastomer in Class 1E equipment required to function during or following an accident should consider the potential loss of compressive force from long-term aging and potential LOCA-temperature transient conditions.

  9. Centrifugal stretching of 170Hf in the interacting boson model

    Directory of Open Access Journals (Sweden)

    Werner V.

    2014-03-01

    Full Text Available We present the results of a recent experiment to deduce lifetimes of members of the ground state rotational band of 170Hf, which show the effect of centrifugal stretching in this deformed isotope. Results are compared to the geometrical confined beta-soft(CBS rotor model, as well as to the interacting boson model (IBM. Two methods to correct for effects due to the finite valence space within the IBM are proposed.

  10. 25 CFR 170.461 - May a tribe approve plans, specifications, and estimates?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false May a tribe approve plans, specifications, and estimates? 170.461 Section 170.461 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER... Facilities Review and Approval of Plans, Specifications, and Estimates § 170.461 May a tribe approve plans...

  11. 33 CFR 167.170 - Off Delaware Bay Approach Traffic Separation Scheme: General.

    Science.gov (United States)

    2010-07-01

    ... Separation Scheme: General. 167.170 Section 167.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY OFFSHORE TRAFFIC SEPARATION SCHEMES Description of Traffic Separation Schemes and Precautionary Areas Atlantic East Coast § 167.170 Off Delaware...

  12. 21 CFR 170.50 - Glycine (aminoacetic acid) in food for human consumption.

    Science.gov (United States)

    2010-04-01

    ... consumption. 170.50 Section 170.50 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES Specific Administrative Rulings and Decisions § 170.50 Glycine (aminoacetic acid) in food for human consumption. (a) Heretofore, the...

  13. 7 CFR 170.14 - What circumstances will prevent participation in the USDA Farmers Market?

    Science.gov (United States)

    2010-01-01

    ...) Participants who arrive after the 10 a.m. opening time may be restricted from participating in the market... USDA Farmers Market? 170.14 Section 170.14 Agriculture Regulations of the Department of Agriculture... FARMERS MARKET § 170.14 What circumstances will prevent participation in the USDA Farmers Market? (a...

  14. 45 CFR 170.423 - Principles of proper conduct for ONC-ATCBs.

    Science.gov (United States)

    2010-10-01

    ... program in accordance with ISO/IEC 17025:2005 (incorporated by reference in § 170.499); (b) Maintain an effective quality management system which addresses all requirements of ISO/IEC 17025:2005 (incorporated by... (incorporated by reference in § 170.499) and ISO/IEC 17025:2005 (incorporated by reference in § 170.499) for the...

  15. 46 CFR 170.095 - Data submittal for a vessel equipped to lift.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Data submittal for a vessel equipped to lift. 170.095 Section 170.095 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND... vessel equipped to lift. The following data must be submitted with the plans required by § 170.075 if the...

  16. 40 CFR 267.170 - Does this subpart apply to me?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Does this subpart apply to me? 267.170 Section 267.170 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... PERMIT Use and Management of Containers § 267.170 Does this subpart apply to me? This subpart applies to...

  17. 25 CFR 170.921 - What emergency or disaster assistance programs are available?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What emergency or disaster assistance programs are available? 170.921 Section 170.921 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Miscellaneous Provisions Emergency Relief § 170.921 What emergency or disaster assistance programs are availabl...

  18. 25 CFR 170.121 - What is a cultural access road?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is a cultural access road? 170.121 Section 170.121 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Use of Irr and Cultural Access Roads § 170...

  19. 25 CFR 170.120 - What restrictions apply to the use of an Indian Reservation Road?

    Science.gov (United States)

    2010-04-01

    ... Reservation Road? 170.120 Section 170.120 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Use of Irr and Cultural Access Roads § 170.120 What restrictions apply to the use of an Indian...

  20. 9 CFR 381.170 - Standards for kinds and classes, and for cuts of raw poultry.

    Science.gov (United States)

    2010-01-01

    ... for cuts of raw poultry. 381.170 Section 381.170 Animals and Animal Products FOOD SAFETY AND... Definitions and Standards of Identity or Composition § 381.170 Standards for kinds and classes, and for cuts..., toughened and darkened meat, and hardened breastbone tip. (2) Turkeys—(i) Fryer-roaster turkey. A fryer...

  1. The response behavior of PPy-DB18C6 electrode to terbium(III in acetonitrile and its thermodynamic application

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Arbab Zavar

    2016-11-01

    Full Text Available Polypyrrole modified electrode prepared by electropolymerization of pyrrole in the presence of a complexing ligand, dibenzo-18-crown-6(DB18C6, was prepared and investigated as a Tb3+-selective electrode in acetonitrile. The potentiometric response of the electrode was linear within the Tb3+ concentration range 1 × 10−5–1 × 10−2 M with a Nernstian slope of 20.9 mVdecade−1 in AN. The electrode was applied to study the complexation of the terbium(III ion in acetonitrile with such other basic aprotic solvent molecules (D as dimethyl sulfoxide, N,N-dimethyl formamide, propylene carbonate and pyridine. The successive complex formation constant (βi and Gibbs energies of transfer (ΔGtr of Tb3+ in AN in relation to such D were obtained.

  2. Luminescence and Magnetic Properties of Two Three-Dimensional Terbium and Dysprosium MOFs Based on Azobenzene-4,4′-Dicarboxylic Linker

    Directory of Open Access Journals (Sweden)

    Belén Fernández

    2016-02-01

    Full Text Available We report the in situ formation of two novel metal-organic frameworks based on terbium and dysprosium ions using azobenzene-4,4′-dicarboxylic acid (H2abd as ligand, synthesized by soft hydrothermal routes. Both materials show isostructural three-dimensional networks with channels along a axis and display intense photoluminescence properties in the solid state at room temperature. Textural properties of the metal-organic frameworks (MOFs have been fully characterized although no appreciable porosity was obtained. Magnetic properties of these materials were studied, highlighting the dysprosium material displays slightly frequency-dependent out of phase signals when measured under zero external field and under an applied field of 1000 Oe.

  3. Luminescent europium and terbium complexes of dipyridoquinoxaline and dipyridophenazine ligands as photosensitizing antennae: structures and biological perspectives.

    Science.gov (United States)

    Dasari, Srikanth; Patra, Ashis K

    2015-12-14

    The europium(III) and terbium(III) complexes, namely [Eu(dpq)(DMF)2(NO3)3] (1), [Eu(dppz)2(NO3)3] (2), [Tb(dpq)(DMF)2Cl3] (3), and [Tb(dppz)(DMF)2Cl3] (4), where dipyrido[3,2-d:2',3'-f]quinoxaline (dpq in 1 and 3), dipyrido[3,2-a:2',3'-c]phenazine (dppz in 2 and 4) and N,N'-dimethylformamide (DMF) have been isolated, characterized from their physicochemical data, luminescence studies and their interaction with DNA, serum albumin protein and photo-induced DNA cleavage activity are studied. The X-ray crystal structures of complexes 1-4 show discrete mononuclear Ln(3+)-based structures. The Eu(3+) in [Eu(dpq)(DMF)2(NO3)3] (1) and [Eu(dppz)2(NO3)3] (2) as [Eu(dppz)2(NO3)3]·dppz (2a) adopts a ten-coordinated bicapped dodecahedron structure with a bidentate N,N-donor dpq ligand, two DMF and three NO3(-) anions in 1 and two bidentate N,N-donor dppz ligands and three NO3(-) anions in 2. Complexes 3 and 4 show a seven-coordinated mono-capped octahedron structure where Tb(3+) contains bidentate dpq/dppz ligands, two DMF and three Cl(-) anions. The complexes are highly luminescent in nature indicating efficient photo-excited energy transfer from the dpq/dppz antenna to Ln(3+) to generate long-lived emissive excited states for characteristic f → f transitions. The time-resolved luminescence spectra of complexes 1-4 show typical narrow emission bands attributed to the (5)D0 → (7)F(J) and (5)D4 → (7)F(J) f-f transitions of Eu(3+) and Tb(3+) ions respectively. The number of inner-sphere water molecules (q) was determined from luminescence lifetime measurements in H2O and D2O confirming ligand-exchange reactions with water in solution. The complexes display significant binding propensity to the CT-DNA giving binding constant values in the range of 1.0 × 10(4)-6.1 × 10(4) M(-1) in the order 2, 4 (dppz) > 1, 3 (dpq). DNA binding data suggest DNA groove binding with the partial intercalation nature of the complexes. All the complexes also show binding propensity (K(BSA)

  4. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden

    1975-01-01

    The selection rules for the linear couplings between magnons and phonons propagating in the c direction of a simple basal-plane hcp ferromagnet are determined by general symmetry considerations. The acoustic-optical magnon-phonon interactions observed in the heavy-rare-earth metals have been expl...... by Liu. The coupled magnon—transverse-phonon system for the c direction of Tb is analyzed in detail, and the strengths of the couplings are deduced as a function of wave vector by combining the experimental studies with the theory....

  5. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden; Bjerrum Møller, Hans

    1975-01-01

    The energies of spin waves propagating in the c direction of Tb have been studied by inelastic neutron scattering, as a function of a magnetic field applied along the easy and hard directions in the basal plane, and as a function of temperature. From a general spin Hamiltonian, consistent...... with the symmetry, we deduce the dispersion relation for the spin waves in a basal-plane ferromagnet. This phenomenological spin-wave theory accounts for the observed behavior of the magnon energies in Tb. The two q⃗-dependent Bogoliubov components of the magnon energies are derived from the experimental results...

  6. Development of Long Pulse and High Power 170GHz Gyrotron

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, Keishi; Kasugai, Atsushi; Minami, Ryutaro; Takahashi, Koji; Kobayashi, Noriyuki [Plasma heating Laboratory, Japan Atomic Energy Research Institute (JAERI), 801-1 Mukoyama, Naka-machi, Ibaraki-ken, 311-0193 (Japan)

    2005-01-01

    Recent activities on the research and development of 170 GHz gyrotron were presented. In the 170 GHz gyrotron experiment in JAERI, pulse duration had been limited by the beam current decrease due to the emission cooling of the electron emitter. A preprogramming control of the heater power was introduced to keep the beam current constant and to avoid the oscillation mode shift to a lower mode during the operation. And, a built-in mode converter system was improved to reduce the stray radiation. In the preliminary experiment results of 0.2 MW/480 sec and 0.13 MW/600 sec were obtained. The pulse extension experiment at higher power will be followed. In parallel, a study of the high order mode oscillation was carried out using a short pulse gyrotron ({approx}1 msec). The oscillation mode is TE{sub 31,12}, which allows 1.5 MW level CW operation. A stable oscillation of TE{sub 31,12} was demonstrated at the power of 1.56 MW. The maximum efficiency was 30% at 1 MW output. This result indicates that the high order mode up to the level of TE{sub 31,12} will be acceptable to increase the power or to reduce the heat load on the cavity wall at 1 MW output.

  7. The microtubule plus-end-tracking protein CLIP-170 associates with the spermatid manchette and is essential for spermatogenesis.

    NARCIS (Netherlands)

    A.S. Akhmanova (Anna); A.L. Mausset-Bonnefont (Anne-Laure); W.A. van Cappellen (Gert); N. Keijzer (Nanda); C.C. Hoogenraad (Casper); T. Stepanova (Tatiana); K. Drabek (Ksenija); J. van der Wees (Jacqueline); M. Mommaas (Mieke); J. Onderwater (Jos); H. van der Meulen (Hans); M.E. Tanenbaum (Marvin); R.H. Medema (Rene); J.W. Hoogerbrugge (Jos); J.T.M. Vreeburg (Jan); E.J. Uringa; J.A. Grootegoed (Anton); F.G. Grosveld (Frank); N.J. Galjart (Niels)

    2005-01-01

    textabstractCLIP-170 is a microtubule "plus-end-tracking protein" implicated in the control of microtubule dynamics, dynactin localization, and the linking of endosomes to microtubules. To investigate the function of mouse CLIP-170, we generated CLIP-170 knockout and GFP-CLIP-170 knock-in alleles.

  8. The microtubule plus-end-tracking protein CLIP-170 associates with the spermatid manchette and is essential for spermatogenesis

    NARCIS (Netherlands)

    Akhmanova, A.S.; Mausset-Bonnefont, A.-L.; Cappellen, W. van; Keijzer, N.; Hoogenraad, C.C.; Stepanova, T.; Drabek, K.; Wees, J. van der; Mommaas, M.; Onderwater, J.; Meulen, H. van der; Tanenbaum, M.E.; Medema, R.H.; Hoogerbrugge, J.; Vreeburg, J.; Uringa, E.-J.; Grootegoed, J.A.; Grosveld, F.; Galjart, N.

    2005-01-01

    CLIP-170 is a microtubule "plus-end-tracking protein" implicated in the control of microtubule dynamics, dynactin localization, and the linking of endosomes to microtubules. To investigate the function of mouse CLIP-170, we generated CLIP-170 knockout and GFP-CLIP-170 knock-in alleles. Residual

  9. 25 CFR 170.207 - What is the intent of IRRHPP emergency/disaster funding?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is the intent of IRRHPP emergency/disaster funding? 170.207 Section 170.207 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Funding Irr High Priority Project (irrhpp) § 170.207 What is the intent of IRRHPP...

  10. Luminescent Properties of Oxazine 170 Perchlorate Doped PMMA Fiber

    Directory of Open Access Journals (Sweden)

    Piotr Miluski

    2017-04-01

    Full Text Available The article presents fabrication and luminescent properties of poly(methyl methacrylate (PMMA fiber doped by Oxazine 170 perchlorate. The bright fluorescence of polymeric fiber (at molar fluorescent organic dye concentration 4.3 × 10−5 was characterized in terms of spectrum and signal attenuation vs. the fiber length. The significant changes in fluorescence spectrum (λmax red shift average slope 4.6 nm/cm and Full Width at Half Maximum (FWHM increasing slope 6.7 nm/cm have been noticed for the length of the fiber (0.02–0.08 m which corresponds to a high overlapping region of absorption and emission spectra of used dye. The red shift of λmax (c.a. 80 nm was presented in fabricated polymeric fiber at distance 0.85 m. The obtained characteristics can be used for luminescent properties optimization of fluorescent organic-dye-doped PMMA fiber.

  11. Synthesis and crystal structure of terbium(III) meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}); Synthese und Kristallstruktur von Terbium(III)-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6})

    Energy Technology Data Exchange (ETDEWEB)

    Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)

    2003-06-01

    The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus

  12. An integrated logic system for time-resolved fluorescent "turn-on" detection of cysteine and histidine base on terbium (III) coordination polymer-copper (II) ensemble.

    Science.gov (United States)

    Xue, Shi-Fan; Lu, Ling-Fei; Wang, Qi-Xian; Zhang, Shengqiang; Zhang, Min; Shi, Guoyue

    2016-09-01

    Cysteine (Cys) and histidine (His) both play indispensable roles in many important biological activities. An enhanced Cys level can result in Alzheimer's and cardiovascular diseases. Likewise, His plays a significant role in the growth and repair of tissues as well as in controlling the transmission of metal elements in biological bases. Therefore, it is meaningful to detect Cys and His simultaneously. In this work, a novel terbium (III) coordination polymer-Cu (II) ensemble (Tb(3+)/GMP-Cu(2+)) was proposed. Guanosine monophosphate (GMP) can self-assemble with Tb(3+) to form a supramolecular Tb(3+) coordination polymer (Tb(3+)/GMP), which can be suited as a time-resolved probe. The fluorescence of Tb(3+)/GMP would be quenched upon the addition of Cu(2+), and then the fluorescence of the as-prepared Tb(3+)/GMP-Cu(2+) ensemble would be restored again in the presence of Cys or His. By incorporating N-Ethylmaleimide and Ni(2+) as masking agents, Tb(3+)/GMP-Cu(2+) was further exploited as an integrated logic system and a specific time-resolved fluorescent "turn-on" assay for simultaneously sensing His and Cys was designed. Meanwhile it can also be used in plasma samples, showing great potential to meet the need of practical application. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Synthesis and photoluminescence properties of cerium-doped terbium-yttrium aluminum garnet phosphor for white light-emitting diodes applications

    Science.gov (United States)

    Wang, Jun; Han, Tao; Lang, Tianchun; Tu, Mingjing; Peng, Lingling

    2015-11-01

    Cerium-doped terbium-yttrium aluminum garnet phosphors were synthesized using the solid-state reaction method. The crystalline phase, morphology, and photoluminescence properties were characterized by x-ray diffraction (XRD), scanning electron microscope (SEM), and fluorescence spectrophotometer, respectively. The XRD results indicate that with an increase of the amount of x (Tb3+), all of the samples have a pure garnet crystal structure without secondary phases. The SEM images reveal that the samples are composed of sphere-like crystallites, which exhibit different degrees of agglomeration. The luminescent properties of Ce ions in )Al5O12∶Ce0.1 have been studied, and it was found that the emission band shifted toward a longer wavelength. The redshift is attributed to the lowering of the 5d energy level centroid of Ce, which can be explained by the nephelauxetic effect and compression effect. These phosphors were coated on blue light-emitting diode (LED) chips to fabricate white light-emitting diodes (WLEDs), and their color-rendering indices, color temperatures, and luminous efficiencies were measured. As a consequence of the addition of Tb, the blue LED pumped )Al5O12∶Ce0.1 phosphors WLEDs showed good optical properties.

  14. Study on the fluorescent enhancement effect in terbium-gadolinium-protein-sodium dodecyl benzene sulfonate system and its application on sensitive detection of protein at nanogram level.

    Science.gov (United States)

    Sun, Changxia; Yang, Jinghe; Wu, Xia; Liu, Shufang; Su, Benyu

    2004-08-01

    The co-luminescence effect in a terbium-gadolinium-protein-sodium dodecyl benzene sulfonate (SDBS) system is reported here. Based on it, the sensitive quantitative analysis of protein at nanogram levels is established. The co-luminescence mechanism is studied using fluorescence, resonance light scattering (RLS), absorption spectroscopy and NMR measurement. It is considered that protein could be unfolded by SDBS, then a efficacious intramolecular fluorescent energy transfer occurs from unfolded protein to rare earth ions through SDBS acting as a "transfer bridge" to enhance the emission fluorescence of Tb3+ in this ternary complex of Tb-SDBS-BSA, where energy transfer from protein to SDBS by aromatic ring stacking is the most important step. Cooperating with the intramolecular energy transfer above is the intermolecular energy transfer between the simultaneous existing complexes of both Tb3+ and Gd3+. The fluorescence quantum yield is increased by an energy-insulating sheath, which is considered to be another reason for the resulting enhancement of the fluorescence. Förster theory is used to calculate the distribution of enhancing factors and has led to a greater understanding of the mechanisms of energy transfer.

  15. [Studies on luminescence properties of seven ternary complexes of terbium with 1,10-phenanthroline and benzoic acid and its derivatives].

    Science.gov (United States)

    Gao, Zhi-hua; Wang, Shu-ping; Liu, Cui-ge; Ma, Rui-xia; Wang, Rui-fen

    2006-04-01

    Seven ternary complexes of Tb(III) were synthesized with benzoic acid (BA), o-, m-, p-methylbenzoic acid (o-MBA, m-MBA, p-MBA), and o-, m-, p-methoxybenzoic acid (o-MOBA, m-MOBA, p-MOBA) as the first ligand, and 1,10-phenanthroline (phen) as the second ligand. The content of C, H and N were measured by using a Flash-EA model 1112 elemental analyzer. Excitation and luminescence spectra of the title solid complexes were recorded by using a Hitachi F-4500 fluorescence spectrophotometer at room temperature. The effects of different varieties and different positions of replacing benzoic acid as the first ligand on fluorescence properties of the ternary complexes of terbium were discussed. The results indicated that the intensity of 5D4-->7F6 (489 nm) and 5D4-->7F5 (545 nm) of substituting benzoic acid complexes was stronger than benzoic acid. Three ternary complexes of Tb(III) with o-, m-, p-methylbenzoic acid showed emission intensity in the consecution: Tb(o-MBA)3 phenMOBA)3phen x H2O>Tb(m-MOBA)3phen x H2O>Tb(p-MOBA)3 phen.

  16. 21 CFR 170.39 - Threshold of regulation for substances used in food-contact articles.

    Science.gov (United States)

    2010-04-01

    ... is at or below 1 percent of the acceptable dietary intake (ADI); (4) Data that will enable the Food... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Threshold of regulation for substances used in food-contact articles. 170.39 Section 170.39 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

  17. 7 CFR 170.10 - Must a participant in the market have insurance?

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Must a participant in the market have insurance? 170...) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.10 Must a participant in the market have insurance? There is no requirement for a participant to have...

  18. N170 Tuning in Chinese : Logographic Characters and Phonetic Pinyin Script

    NARCIS (Netherlands)

    Qin, Rui; Maurits, Natasha; Maassen, Ben

    2016-01-01

    In alphabetic languages, print consistently elicits enhanced, left-lateralized N170 responses in the event-related potential compared to control stimuli. In the current study, we adopted a cross-linguistic design to investigate N170 tuning to logographic Chinese and to pinyin, an auxiliary phonetic

  19. 25 CFR 170.110 - How can State and local governments prevent discrimination or adverse impacts?

    Science.gov (United States)

    2010-04-01

    ... and adverse effects on tribes and Native American populations. (b) Examples of adverse effects include... discrimination or adverse impacts? 170.110 Section 170.110 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE... discrimination or adverse impacts? (a) Under 23 U.S.C. 134 and 135, and 23 CFR part 450, State and local...

  20. 25. juulil toimuvad kodukoha suurmehe Jakob Hurda 170. sünniaastapäeva pidustused

    Index Scriptorium Estoniae

    Vill, Sirje

    2009-01-01

    Jakob Hurda 170. sünniaastapäeva tähistatakse traditsioonilise kultuuriretkega Jakob Hurdaga seotud paikadesse, autasustatakse õpilaste uurimustööde võitjaid ja teemaüritusel "Jakob Hurt 170" Põlva Kultuuri- ja Huvikeskuses antakse üle laureaatidele Hurda-nimelised kultuuriauhinnad

  1. 25 CFR 170.806 - What is an IRR Transportation Facilities Maintenance Management System?

    Science.gov (United States)

    2010-04-01

    ... Transportation Facilities Maintenance Management System? An IRR Transportation Facilities Maintenance Management... 25 Indians 1 2010-04-01 2010-04-01 false What is an IRR Transportation Facilities Maintenance Management System? 170.806 Section 170.806 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND...

  2. 27 CFR 41.170 - Reduction of tobacco products to materials; TTB action.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Reduction of tobacco products to materials; TTB action. 41.170 Section 41.170 Alcohol, Tobacco Products and Firearms ALCOHOL AND... relating to large cigars are based on the lowest sale price applicable to the cigars during the required...

  3. 26 CFR 1.170A-6 - Charitable contributions in trust.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Charitable contributions in trust. 1.170A-6...-6 Charitable contributions in trust. (a) In general. (1) No deduction is allowed under section 170... the donor's entire interest in the property and which is transferred in trust unless the transfer...

  4. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can roads be built in roadless and wild areas? 170.138 Section 170.138 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and...

  5. 7 CFR 170.2 - Is the USDA Farmers Market a producer-only market?

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Is the USDA Farmers Market a producer-only market? 170...) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.2 Is the USDA Farmers Market a producer-only market? Yes. A producer-only market is one that does not offer...

  6. 25 CFR 170.122 - Can a tribe close a cultural access road?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe close a cultural access road? 170.122 Section... ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Use of Irr and Cultural Access Roads § 170.122 Can a tribe close a cultural access road? (a) A tribe with jurisdiction over a cultural...

  7. 21 CFR 170.60 - Nitrites and/or nitrates in curing premixes.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Nitrites and/or nitrates in curing premixes. 170.60 Section 170.60 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... oils, disodium inosinate, disodium guanylate, hydrolysates of animal or plant origin (such as...

  8. 21 CFR 170.30 - Eligibility for classification as generally recognized as safe (GRAS).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Eligibility for classification as generally recognized as safe (GRAS). 170.30 Section 170.30 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... impracticable to list all such substances that are GRAS. A food ingredient of natural biological origin that has...

  9. 33 CFR 207.170 - Federal Dam, Oklawaha River, Moss Bluff, Fla.; pool level.

    Science.gov (United States)

    2010-07-01

    ... Bluff, Fla.; pool level. 207.170 Section 207.170 Navigation and Navigable Waters CORPS OF ENGINEERS..., Moss Bluff, Fla.; pool level. (a) The level of the pool shall normally be maintained at elevation 56.5..., Fla., and subject to such conditions as he may specify. (b) When, in the opinion of the District...

  10. 45 CFR 170.210 - Standards for health information technology to protect electronic health information created...

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Standards for health information technology to protect electronic health information created, maintained, and exchanged. 170.210 Section 170.210 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH INFORMATION TECHNOLOGY HEALTH INFORMATION TECHNOLOGY STANDARDS, IMPLEMENTATION SPECIFICATION...

  11. 25 CFR 170.702 - What activities may the Secretary review and monitor?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What activities may the Secretary review and monitor? 170.702 Section 170.702 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN... review and monitor? The Secretary reviews and monitors the performance of construction activities under...

  12. 17 CFR 1.70 - Notification of State enforcement actions brought under the Commodity Exchange Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Notification of State enforcement actions brought under the Commodity Exchange Act. 1.70 Section 1.70 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION GENERAL REGULATIONS UNDER THE COMMODITY EXCHANGE ACT...

  13. 21 CFR 173.170 - Aminoglycoside 3′-phospho-trans-ferase II.

    Science.gov (United States)

    2010-04-01

    ... development of genetically modified cotton, oilseed rape, and tomatoes in accordance with the following... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aminoglycoside 3â²-phospho-trans-ferase II. 173.170 Section 173.170 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  14. 12 CFR 563.170 - Examinations and audits; appraisals; establishment and maintenance of records.

    Science.gov (United States)

    2010-01-01

    ... office to a branch or service office, or from a branch or service office to its home office or to another...; establishment and maintenance of records. 563.170 Section 563.170 Banks and Banking OFFICE OF THRIFT SUPERVISION... any time, by the Office, with appraisals when deemed advisable, in accordance with general policies...

  15. N170 Tuning in Chinese: Logographic Characters and Phonetic Pinyin Script

    Science.gov (United States)

    Qin, Rui; Maurits, Natasha; Maassen, Ben

    2016-01-01

    In alphabetic languages, print consistently elicits enhanced, left-lateralized N170 responses in the event-related potential compared to control stimuli. In the current study, we adopted a cross-linguistic design to investigate N170 tuning to logographic Chinese and to "pinyin," an auxiliary phonetic system in Chinese. The results…

  16. Eyeglasses elicit effects similar to face-like perceptual expertise: evidence from the N170 response.

    Science.gov (United States)

    Cao, Xiaohua; Yang, Qi; Hu, Fengpei

    2016-03-01

    Studies of event-related potentials show that the specific N170 response has become a stable electrophysiological hallmark of objects related to expertise in early perceptual processing. In the present study, we investigated whether eyeglasses can elicit N170 effects similar to those elicited by objects of expertise. Our results showed that the N170 response elicited by eyeglasses was larger than the response elicited by objects that do not generate perceptual expertise (e.g., houses). Importantly, we found that eyeglasses could produce a within-category N170 adaptation effect, similar to that produced in response to objects of expertise (e.g., faces). Our results have revealed for the first time that with a large amount of experience, eyeglasses could evoke the face-like N170 response, which suggested that eyeglasses may become an object of perceptual expertise to some human observers.

  17. 170th Symposium of the International Astronomical Union

    CERN Document Server

    Radford, Simon; Jewell, Philip; Mangum, Jeffrey; Bally, John

    1997-01-01

    Interstellar carbon monoxide (CO) was first detected in 1970 with the 36 foot diameter telescope of the National Radio Astronomy Observatory! on Kitt Peak in Southern Arizona. R. W. Wilson, K. B. Jefferts, and A. A. Penzias of Bell Labs reported, "We have found intense 2.6 mm line radiation 2 from nine Galactic sources which we attribute to carbon monoxide." Soon afterward, several other basic molecules were also observed in space. IAU Symposium 170, CO: Twenty Five Years of Millimeter Wave Spectroscopy, was organized to commemorate those discoveries. The Symposium reviewed the accomplishments of a quarter century of research on interstellar molec­ ular gas, surveyed the current state of millimeter-wave spectroscopy, and gave a glimpse of what the next 25 years might hold. Studies of interstellar CO have revolutionized our understanding of the phases and dynamics of the interstellar medium, the initial and final stages of stellar evolution, the chemistry of dense and diffuse interstellar matter and of the so...

  18. The face-specific N170 component is modulated by emotional facial expression

    Directory of Open Access Journals (Sweden)

    Tottenham Nim

    2007-01-01

    Full Text Available Abstract Background According to the traditional two-stage model of face processing, the face-specific N170 event-related potential (ERP is linked to structural encoding of face stimuli, whereas later ERP components are thought to reflect processing of facial affect. This view has recently been challenged by reports of N170 modulations by emotional facial expression. This study examines the time-course and topography of the influence of emotional expression on the N170 response to faces. Methods Dense-array ERPs were recorded in response to a set (n = 16 of fear and neutral faces. Stimuli were normalized on dimensions of shape, size and luminance contrast distribution. To minimize task effects related to facial or emotional processing, facial stimuli were irrelevant to a primary task of learning associative pairings between a subsequently presented visual character and a spoken word. Results N170 to faces showed a strong modulation by emotional facial expression. A split half analysis demonstrates that this effect was significant both early and late in the experiment and was therefore not associated with only the initial exposures of these stimuli, demonstrating a form of robustness against habituation. The effect of emotional modulation of the N170 to faces did not show significant interaction with the gender of the face stimulus, or hemisphere of recording sites. Subtracting the fear versus neutral topography provided a topography that itself was highly similar to the face N170. Conclusion The face N170 response can be influenced by emotional expressions contained within facial stimuli. The topography of this effect is consistent with the notion that fear stimuli exaggerates the N170 response itself. This finding stands in contrast to previous models suggesting that N170 processes linked to structural analysis of faces precede analysis of emotional expression, and instead may reflect early top-down modulation from neural systems involved in

  19. When is a Face a Face? Schematic Faces, Emotion, Attention and the N170

    Directory of Open Access Journals (Sweden)

    Frances A. Maratos

    2015-09-01

    Full Text Available Emotional facial expressions provide important non-verbal cues as to the imminent behavioural intentions of a second party. Hence, within emotion science the processing of faces (emotional or otherwise has been at the forefront of research. Notably, however, such research has led to a number of debates including the ecological validity of utilising schematic faces in emotion research, and the face-selectively of N170. In order to investigate these issues, we explored the extent to which N170 is modulated by schematic faces, emotional expression and/or selective attention. Eighteen participants completed a three-stimulus oddball paradigm with two scrambled faces as the target and standard stimuli (counter-balanced across participants, and schematic angry, happy and neutral faces as the oddball stimuli. Results revealed that the magnitude of the N170 associated with the target stimulus was: (i significantly greater than that elicited by the standard stimulus, (ii comparable with the N170 elicited by the neutral and happy schematic face stimuli, and (iii significantly reduced compared to the N170 elicited by the angry schematic face stimulus. These findings extend current literature by demonstrating N170 can be modulated by events other than those associated with structural face encoding; i.e. here, the act of labelling a stimulus a ‘target’ to attend to modulated the N170 response. Additionally, the observation that schematic faces demonstrate similar N170 responses to those recorded for real faces and, akin to real faces, angry schematic faces demonstrated heightened N170 responses, suggests caution should be taken before disregarding schematic facial stimuli in emotion processing research per se.

  20. Measuring the face-sensitive N170 with a gaming EEG system: A validation study.

    Science.gov (United States)

    de Lissa, Peter; Sörensen, Sidsel; Badcock, Nicholas; Thie, Johnson; McArthur, Genevieve

    2015-09-30

    The N170 is a "face-sensitive" event-related potential (ERP) that occurs at around 170ms over occipito-temporal brain regions. The N170's potential to provide insight into the neural processing of faces in certain populations (e.g., children and adults with cognitive impairments) is limited by its measurement in scientific laboratories that can appear threatening to some people. The advent of cheap, easy-to-use portable gaming EEG systems provides an opportunity to record EEG in new contexts and populations. This study tested the validity of the face-sensitive N170 ERP measured with an adapted commercial EEG system (the Emotiv EPOC) that is used at home by gamers. The N170 recorded through both the gaming EEG system and the research EEG system exhibited face-sensitivity, with larger mean amplitudes in response to the face stimuli than the non-face stimuli, and a delayed N170 peak in response to face inversion. The EPOC system produced very similar N170 ERPs to a research-grade Neuroscan system, and was capable of recording face-sensitivity in the N170, validating its use as research tool in this arena. This opens new possibilities for measuring the face-sensitive N170 ERP in people who cannot travel to a traditional ERP laboratory (e.g., elderly people in care), who cannot tolerate laboratory conditions (e.g., people with autism), or who need to be tested in situ for practical or experimental reasons (e.g., children in schools). Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Self-diffusion coefficients of the trivalent f-element ion series in dilute and moderately dilute aqueous solutions: A comparative study between europium, gadolinium, terbium and berkelium

    Science.gov (United States)

    Rafik, Besbes; Noureddine, Ouerfelli; Abderabbou, Abdelmanef; Habib, Latrous

    2010-03-01

    We have continued the studies on the trivalent ions of the 4f and 5f elements. In this paper, we compare the transport properties (self-diffusion coefficient) of the trivalent aquo ions over two ranges of concentrations (0 — 2×10-3M) and (2×10-3 — 1.5M). Self-diffusion coefficients, D, of the trivalent f-element aquo ion series have been determined in aqueous background electrolytes of Gd(NO3)3 and Nd(ClO4)3, at pH=2.5 (HNO3, HClO4) and at 25°C using the open-end capillary method (O.E.C.M.). This method measures the transportation time of ions across a fixed distance. In this paper, we complete a measurement of self-diffusion coefficient for terbium. We optimized the pH to avoid hydrolysis, ion-pairing and complexation of the trivalent 4f and 5f ions. The variation of D versus √C is not linear for dilute solutions (0 — 2×10-3M) and quasi-linear in moderate concentrations (C<=1.5 M). Similar behavior was observed for Tb, as compared with those for Bk, Eu and Gd. We complete the comparison variation of D/D° versus √C for all studied 4f and 5f elements from concentration 0 to 1.5M and we obtained the same variation with √C for all studied elements. All 4f and 5f elements studied follow the Nernst-Hartley expression.

  2. Terbium-based time-gated Förster resonance energy transfer imaging for evaluating protein-protein interactions on cell membranes.

    Science.gov (United States)

    Lindén, Stina; Singh, Manish Kumar; Wegner, K David; Regairaz, Marie; Dautry, François; Treussart, François; Hildebrandt, Niko

    2015-03-21

    Fluorescence imaging of cells and subcellular compartments is an essential tool to investigate biological processes and to evaluate the development and progression of diseases. In particular, protein-protein interactions can be monitored by Förster resonance energy transfer (FRET) between two proximal fluorophores that are attached to specific recognition biomolecules such as antibodies. We investigated the membrane expression of E- and N-cadherins in three different cell lines used as model systems to study epithelial to mesenchymal transition (EMT) and a possible detection of circulating tumour cells (CTCs). EMT is a key process in cancer metastasis, during which epithelial markers (such as E-cadherin) are down-regulated in the primary tumour whereas mesenchymal markers (such as N-cadherin) are up-regulated, leading to enhanced cell motility, intravasation, and appearance of CTCs. Various FRET donor-acceptor pairs and protein recognition strategies were utilized, in which Lumi4-Tb terbium complexes (Tb) and different organic dyes were conjugated to several distinct E- and N-cadherin-specific antibodies. Pulsed excitation of Tb at low repetition rates (100 Hz) and time-gated (TG) imaging of both the Tb-donor and the dye-acceptor photoluminescence (PL) allowed efficient detection of the EMT markers as well as FRET in the case of sufficient donor-acceptor proximity. Efficient FRET was observed only between two E-cadherin-specific antibodies and further experiments indicated that these antibodies recognized the same E-cadherin molecule, suggesting a limited accessibility of cadherins when they are clustered at adherens junctions. The investigated Tb-to-dye FRET systems provided reduced photobleaching compared to the AlexaFluor 488-568 donor-acceptor pair. Our results demonstrate the applicability and advantages of Tb-based TG FRET for efficient and stable imaging of antibody-antibody interactions on different cell lines. They also reveal the limitations of

  3. A broad G protein-coupled receptor internalization assay that combines SNAP-tag labeling, diffusion-enhanced resonance energy transfer, and a highly emissive terbium cryptate acceptor

    Directory of Open Access Journals (Sweden)

    Angélique eLEVOYE

    2015-11-01

    Full Text Available Although G protein-coupled receptor (GPCR internalization has long been considered a major aspect of the desensitization process that tunes ligand responsiveness, internalization is also involved in receptor resensitization and signaling, as well as the ligand scavenging function of some atypical receptors. Internalization thus contributes to the diversity of GPCR-dependent signaling, and its dynamics and quantification in living cells has generated considerable interest. We developed a robust and sensitive assay to follow and quantify ligand-induced and constitutive GPCR internalization but also receptor recycling in living cells. This assay is based on diffusion-enhanced resonance energy transfer (DERET between cell surface GPCRs labeled with a luminescent terbium cryptate donor and a fluorescein acceptor present in the culture medium. GPCR internalization results in a quantifiable reduction of energy transfer. This method yields a high signal-to-noise ratio due to time-resolved measurements. For various GPCRs belonging to different classes, we demonstrated that constitutive and ligand-induced internalization could be monitored as a function of time and ligand concentration, thus allowing accurate quantitative determination of kinetics of receptor internalization but also half-maximal effective or inhibitory concentrations of compounds. In addition to its selectivity and sensitivity, we provided evidence that DERET-based internalization assay is particularly suitable for characterizing biased ligands. Furthermore, the determination of a Z’-factor value of 0.45 indicates the quality and suitability of DERET-based internalization assay for high-throughput screening (HTS of compounds that may modulate GPCRs internalization.

  4. 42 CFR 415.170 - Conditions for payment on a fee schedule basis for physician services in a teaching setting.

    Science.gov (United States)

    2010-10-01

    ... physician services in a teaching setting. 415.170 Section 415.170 Public Health CENTERS FOR MEDICARE... BY PHYSICIANS IN PROVIDERS, SUPERVISING PHYSICIANS IN TEACHING SETTINGS, AND RESIDENTS IN CERTAIN SETTINGS Physician Services in Teaching Settings § 415.170 Conditions for payment on a fee schedule basis...

  5. 25 CFR 170.807 - What must BIA include when it develops an IRR Transportation Facilities Maintenance Management...

    Science.gov (United States)

    2010-04-01

    ... Transportation Facilities Maintenance Management System? 170.807 Section 170.807 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM BIA Road Maintenance § 170.807 What must BIA include when it develops an IRR Transportation Facilities Maintenance Management System...

  6. 33 CFR 207.170a - Eugene J. Burrell Navigation Lock in Haines Creek near Lisbon, Fla.; use, administration, and...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Eugene J. Burrell Navigation Lock in Haines Creek near Lisbon, Fla.; use, administration, and navigation. 207.170a Section 207.170a... REGULATIONS § 207.170a Eugene J. Burrell Navigation Lock in Haines Creek near Lisbon, Fla.; use...

  7. Crystal structure of an eight-coordinate terbium(III ion chelated by N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (bbpen2− and nitrate

    Directory of Open Access Journals (Sweden)

    Thaiane Gregório

    2015-01-01

    Full Text Available The reaction of terbium(III nitrate pentahydrate in acetonitrile with N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (H2bbpen, previously deprotonated with triethylamine, produced the mononuclear compound [N,N′-bis(2-oxidobenzyl-κO-N,N′-bis(pyridin-2-ylmethyl-κNethylenediamine-κ2N,N′](nitrato-κ2O,O′terbium(III, [Tb(C28H28N4O2(NO3]. The molecule lies on a twofold rotation axis and the TbIII ion is eight-coordinate with a slightly distorted dodecahedral coordination geometry. In the symmetry-unique part of the molecule, the pyridine and benzene rings are both essentially planar and form a dihedral angle of 61.42 (7°. In the molecular structure, the N4O4 coordination environment is defined by the hexadentate bbpen ligand and the bidentate nitrate anion. In the crystal, a weak C—H...O hydrogen bond links molecules into a two-dimensional network parallel to (001.

  8. 170 years of debris covered glacier surface evolution

    Science.gov (United States)

    Mölg, Nico; Bolch, Tobias; Vieli, Andreas; Bauder, Andreas

    2017-04-01

    The local effect of debris layer thickness on ice melt can be studied considering short time periods and is quite well known to date. How the reduced melt, the additional weight of the debris, and the formation of ice cliffs and lakes are linked with the flow behaviour of the glacier is less well understood and much longer time periods are required for such investigations, typically in the order of the response time of the respective glacier, if possible even longer. For this reason we selected to study Zmuttgletscher in the Western Swiss Alps, which today is a heavily debris covered valley glacier. We produced a time series of glacier area, debris cover and surface elevation changes on the basis of 14 old maps and aerial images, 11 orthoimages and additional terrestrial photographs starting at the end of the little ice age (LIA) in 1859. During these 170 years the glacier lost a volume of 52.9*106 m3 (mean thickness change of -89 m) at its tongue while its debris covered area increased from about 14 to 20%. Several periods of variable retreat rates can be discerned and spatially varying change patterns become visible. Commonly the glacier has been retreating, but we can discern locally different elevation change, and also stable to positive periods in the 1980s become visible on different dynamical section of the glacier. Surface features that are commonly linked to debris cover and ice flow have emerged after the end of the LIA. For example, supraglacial thermokarst features become visible in 1880 and are widespread in the lower area of the glacier tongue in 1946. Considering big ice cliffs that are typically related to a realtively high, steep elevation difference and a large surface area, their number has increased somewhat from zero in 1859 to about 15 today. However, its the small ice cliffs, lakes and surface water channels that have emerged and also contribute to stronger melt through either exposed clean ice or ice in contact with water. Elevation

  9. [GASTRIC CANCER IN PERUVIAN ANDES: 170 CASES IN HUARAZ

    Science.gov (United States)

    Villanueva Palacios, Jovita; López De Guimaraes, Douglas; Avila Polo, Francisco; Salinas Mota, Felipe; Mosquera Vasquez, Vitaliano

    2000-01-01

    As a contribution to the knowledge of gastric cancer, a study took place at "Victor Ramos Guardia Hospital" in the city of Huaraz (3,100 meters above sea level), from August 1992 to July 1998. 170 cases were reported. All of them had biopsy exam.The accumulated incidence was of 138.2 cases per 100,000. The annual mean was 35.8 cases per year. The endoscopy incidence was of 16.7%. And 100% were advanced cancer. All of them were from the sierra of Ancash. 52.4% were males. 80% came from rural zones. And 91.7% were dedicated to agriculture. Food was mainly tubers, vegetables, ham and other salad meats. Ingestion of fruits was very scarce. Mean age was 60.6 years (32?90). 61.6 for females and 59.8 for males. When diagnosis was made 81.2% referred abdominal pain, 67.4% were pale, 38.2% had hematemesis/ melena, abdominal tumor was found in 37.7% and 28.8% had pyloric syndrome.97.7% of the biopsies were reported as adenocarcinoma. And 2.3% as linfomas. Of the 166 adenocarcinomas, 72.9% were of the intestinal type and 27.1% the diffuse type. The intestinal type was more frequent on males (77.6%) that on females (67.9%). Otherwise the diffuse type was more frequent on females (32.1%) that on males (22.4%). Lesions were classified as Bormann: I (0.6%), II (22.9%); III (62.4%) and IV (14.1%).Gastric cancer was found in the distal body in 41.7% of cases. In 2 regions: antrum and body in 26.5% and in the proximal body in 11.2%. 8.4% was localized in the cardias. The intestinal type was more frequently found an the distal body (77.5%). And on the medium body (73.3%). The diffuse type was mostly found on the proximal body (42.1%). On the following up 30 patients were lost and by April 1999, 95% were dead.We conclude that gastric cancer, probably, has a high incidence in the sierra of Ancash. The onset is of advanced gastric cancer. The intestinal type is predominant. And it is an important cause of disease and mortality in risk population.

  10. P1 and N170 components distinguish human-like and animal-like makeup stimuli.

    Science.gov (United States)

    Luo, Shuwei; Luo, Wenbo; He, Weiqi; Chen, Xu; Luo, Yuejia

    2013-06-19

    This study used event-related potentials to investigate the sensitivity of P1 and N170 components to human-like and animal-like makeup stimuli, which were derived from pictures of Peking opera characters. As predicted, human-like makeup stimuli elicited larger P1 and N170 amplitudes than did animal-like makeup stimuli. Interestingly, a right hemisphere advantage was observed for human-like but not for animal-like makeup stimuli. Dipole source analyses of 130-200-ms window showed that the bilateral fusiform face area may contribute to the differential sensitivity of the N170 component in response to human-like and animal-like makeup stimuli. The present study suggests that the amplitudes of both the P1 and the N170 are sensitive for the mouth component of face-like stimuli.

  11. N170 Changes Show Identifiable Chinese Characters Compete Primarily with Faces Rather than Houses.

    Science.gov (United States)

    Fan, Cong; He, Weiqi; He, Huamin; Ren, Guofang; Luo, Yuejia; Li, Hong; Luo, Wenbo

    2015-01-01

    Character processing is a crucial cognitive skill that is highly emphasized and industriously cultivated in contemporary society. In the present study, using a competition paradigm, we examined the electrophysiological correlates of different relationships between Chinese characters and faces and between Chinese characters and houses during early visual processing. We observed that identifiable Chinese characters compete primarily with faces rather than houses at an early visual processing stage, with a significantly reduced N170 for faces but not for houses, when they were viewed concurrently with identifiable characters relative to when they were viewed concurrently with unidentifiable characters. Consistent with our previous study, there was a significant increase in N170 after characters have been learned, indicating a modulatory effect of Chinese character identification level on N170 amplitude. Furthermore, we found an enlarged N170 in response to faces compared to houses, indicating that the neural mechanisms for processing faces and houses are different at an early visual processing stage.

  12. The naked truth: the face and body sensitive N170 response is enhanced for nude bodies.

    Science.gov (United States)

    Hietanen, Jari K; Nummenmaa, Lauri

    2011-01-01

    Recent event-related potential studies have shown that the occipitotemporal N170 component--best known for its sensitivity to faces--is also sensitive to perception of human bodies. Considering that in the timescale of evolution clothing is a relatively new invention that hides the bodily features relevant for sexual selection and arousal, we investigated whether the early N170 brain response would be enhanced to nude over clothed bodies. In two experiments, we measured N170 responses to nude bodies, bodies wearing swimsuits, clothed bodies, faces, and control stimuli (cars). We found that the N170 amplitude was larger to opposite and same-sex nude vs. clothed bodies. Moreover, the N170 amplitude increased linearly as the amount of clothing decreased from full clothing via swimsuits to nude bodies. Strikingly, the N170 response to nude bodies was even greater than that to faces, and the N170 amplitude to bodies was independent of whether the face of the bodies was visible or not. All human stimuli evoked greater N170 responses than did the control stimulus. Autonomic measurements and self-evaluations showed that nude bodies were affectively more arousing compared to the other stimulus categories. We conclude that the early visual processing of human bodies is sensitive to the visibility of the sex-related features of human bodies and that the visual processing of other people's nude bodies is enhanced in the brain. This enhancement is likely to reflect affective arousal elicited by nude bodies. Such facilitated visual processing of other people's nude bodies is possibly beneficial in identifying potential mating partners and competitors, and for triggering sexual behavior.

  13. N170 ERPs could represent a logographic processing strategy in visual word recognition

    OpenAIRE

    Bernard Christian; Petit Laurent; Simon Gregory; Rebaï Mohamed

    2007-01-01

    Abstract Background Occipito-temporal N170 component represents the first step where face, object and word processing are discriminated along the ventral stream of the brain. N170 leftward asymmetry observed during reading has been often associated to prelexical orthographic visual word form activation. However, some studies reported a lexical frequency effect for this component particularly during word repetition that appears in contradiction with this prelexical orthographic step. Here, we ...

  14. Level densities and gamma-ray strength functions in 170,171,172-Yb

    Energy Technology Data Exchange (ETDEWEB)

    Agvaanluvsan, U; Schiller, A; Becker, J; Bernstein, L; Garrett, P; Guttormsen, M; Mitchell, G; Rekstad, J; Siem, S; Voinov, A; Younes, W

    2004-07-28

    Level densities and radiative strength functions in {sup 171}Yb and {sup 170}Yb nuclei have been measured using the {sup 171}Yb({sup 3}He{sup 3}He{gamma}){sup 171}Yb and {sup 171}Yb({sup 3}He,{alpha}{gamma}){sup 170}Yb reactions. New data on {sup 171}Yb are compared to a previous measurement for {sup 171}Yb from the {sup 172}Yb({sup 3}He,{alpha}{gamma}){sup 171}Yb reaction. Systematics of level densities and radiative strength functions in {sup 170,171,172}Yb are established. The entropy excess in {sup 171}Yb relative to the even-even nuclei {sup 170,172}Yb due to the unpaired neutron quasiparticle is found to be approximately 2k{sub B}. Results for the radiative strength function from the two reactions lead to consistent parameters characterizing the ''pygmy'' resonances. Pygmy resonances in the {sup 170,172}Yb populated by the ({sup 3}He,{alpha}) reaction appear to be split into two components for both of which a complete set of resonance parameters are obtained.

  15. Selective Sensing of Fe(3+) and Al(3+) Ions and Detection of 2,4,6-Trinitrophenol by a Water-Stable Terbium-Based Metal-Organic Framework.

    Science.gov (United States)

    Cao, Li-Hui; Shi, Fang; Zhang, Wen-Min; Zang, Shuang-Quan; Mak, Thomas C W

    2015-10-26

    A water-stable luminescent terbium-based metal-organic framework (MOF), {[Tb(L1 )1.5 (H2 O)]⋅3 H2 O}n (Tb-MOF), with rod-shaped secondary building units (SBUs) and honeycomb-type tubular channels has been synthesized and structurally characterized by single-crystal X-ray diffraction. The high green emission intensity and the microporous nature of the Tb-MOF indicate that it can potentially be used as a luminescent sensor. In this work, we show that Tb-MOF can selectively sense Fe(3+) and Al(3+) ions from mixed metal ions in water through different detection mechanisms. In addition, it also exhibits high sensitivity for 2,4,6-trinitrophenol (TNP) in the presence of other nitro aromatic compounds in aqueous solution by luminescence quenching experiments. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Category specificity in early perception: face and word n170 responses differ in both lateralization and habituation properties.

    Science.gov (United States)

    Maurer, Urs; Rossion, Bruno; McCandliss, Bruce D

    2008-01-01

    N170 event-related potential (ERP) responses to both faces and visual words raises questions about category specific processing mechanisms during early perception and their neural basis. Topographic differences across word and face N170s suggests a form of category specific processing in early perception - the word N170 is consistently left-lateralized, while less consistent evidence supports a right-lateralization for the face N170. Additionally, the face N170 shows a reduction in amplitude across consecutive individual faces, a form of habituation that might differ across studies thereby helping to explain inconsistencies in lateralization. This effect remains unexplored for visual words. The current study directly contrasts N170 responses to words and faces within the same subjects, examining both category-level habituation and lateralization effects. ERP responses to a series of different faces and words were collected under two contexts: blocks that alternated faces and words vs. pure blocks of a single category designed to induce category-level habituation. Global and occipito-temporal measures of N170 amplitude demonstrated an interaction between category (words, faces) and block context (alternating categories, same category). N170 amplitude demonstrated class-level habituation for faces but not words. Furthermore, the pure block context diminished the right-lateralization of the face N170, pointing to class-level habituation as a factor that might drive inconsistencies in findings of right-lateralization across different paradigms. No analogous effect for the word N170 was found, suggesting category specificity for this form of habituation. Taken together, topographic and habituation effects suggest distinct forms of perceptual processing drive the face N170 and the visual word form N170.

  17. Category specificity in early perception: face and word N170 responses differ in both lateralization and habituation properties

    Directory of Open Access Journals (Sweden)

    Urs Maurer

    2008-12-01

    Full Text Available Enhanced N170 ERP responses to both faces and visual words raises questions about category specific processing mechanisms during early perception and their neural basis. Topographic differences across word and face N170s might suggest a form of category specific processing in early perception - the word N170 is consistently left lateralized, while less consistent evidence suggests a right lateralization for the face N170. Additionally, the face N170 shows a reduction in amplitude across consecutive unique faces, a form of habituation that might differ across studies thereby helping to explain inconsistencies in lateralization. This effect remains unexplored for visual words. The current study directly contrasts N170 responses to words and faces within the same subjects, examining both category-level habituation and lateralization effects. ERP responses to a series of different faces and words were collected under two contexts: blocks that alternated faces and words versus pure blocks designed to induce category level habituation. Global and occipito-temporal measures of N170 amplitude demonstrated an interaction between category (word, faces and block context (alternating, pure. N170 amplitude demonstrated class level habituation for faces but not words. Furthermore, the pure block context diminished the right lateralization of the face N170, potentially pointing to class level habituation as a factor that might drive inconsistencies of right lateralization across different paradigms. No analogous effect for the word N170 was found, suggesting category specificity for this process. Taken together, these topographic and habituation effects suggest distinct forms of perceptual processing drive the face N170 and the visual word form N170.

  18. 25 CFR 170.214 - How does award of an emergency/disaster project affect projects on the FPL?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How does award of an emergency/disaster project affect projects on the FPL? 170.214 Section 170.214 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Funding Irr High Priority Project (irrhpp) § 170.214 How does...

  19. Production, quality control and biodistribution studies of thulium-170-labeled ethylenediamine (tetramethylene phosphonic acid)

    Energy Technology Data Exchange (ETDEWEB)

    Shirvani-Arani, S.; Bahrami-Samani, A.; Meftahi, M.; Jalilian, A.R.; Ghannadi-Maragheh, M. [Nuclear Science and Technology Research Institute (NSTRI), Tehran (Iran, Islamic Republic of). Radiopharmaceutical Research and Development Lab (RRDL)

    2013-03-01

    Thulium-170 (T{sub 1/2} = 128.4 d, E{sub {beta}} (max) = 968 keV, E{sub {gamma}} = 84 keV (3.26%)) has radionuclidic properties suitable to be used in palliative therapy of bone metastases as an alternative to {sup 89}SrCl{sub 2}. {sup 170}Tm can be produced by a relatively easy route involving thermal neutron bombardment on natural Tm{sub 2}O{sub 3} (100% {sup 169}Tm) in medium flux research reactors. The requirement for an enriched target does not arise and radionuclidic impurities are not formed by radiative capture during neutron activation. In this study {sup 170}Tm was produced using Tm(NO{sub 3}){sub 3}, prepared by neutron activation (3-4 x 1{sup 13}) of a natural sample. Ethylenediamine (tetramethylene phosphonic acid) (EDTMP) was synthesized and radiolabeled with {sup 170}Tm. Complexation parameters were optimized to achieve maximum yields (>99%). The radiochemical purity of {sup 170}Tm-EDTMP was checked by RTLC. It was found to retain its stability at room temperature even after 2 months of preparation (> 95%). Biodistribution studies of the complexes carried out in wild-type rats showed significant bone uptake with rapid clearance from blood. The properties of produced {sup 170}Tm-EDTMP suggest applying a new efficient bone pain palliative therapeutic agent in the country instead of some other in-use radiopharmaceuticals, such as {sup 89}SrCl{sub 2} and {sup 32}P, in order to overcome metastatic bone pains. (orig.)

  20. The background of reduced face specificity of N170 in congenital prosopagnosia.

    Science.gov (United States)

    Németh, Kornél; Zimmer, Márta; Schweinberger, Stefan R; Vakli, Pál; Kovács, Gyula

    2014-01-01

    Congenital prosopagnosia is lifelong face-recognition impairment in the absence of evidence for structural brain damage. To study the neural correlates of congenital prosopagnosia, we measured the face-sensitive N170 component of the event-related potential in three members of the same family (father (56 y), son (25 y) and daughter (22 y)) and in age-matched neurotypical participants (young controls: n = 14; 24.5 y±2.1; old controls: n = 6; 57.3 y±5.4). To compare the face sensitivity of N170 in congenital prosopagnosic and neurotypical participants we measured the event-related potentials for faces and phase-scrambled random noise stimuli. In neurotypicals we found significantly larger N170 amplitude for faces compared to noise stimuli, reflecting normal early face processing. The congenital prosopagnosic participants, by contrast, showed reduced face sensitivity of the N170, and this was due to a larger than normal noise-elicited N170, rather than to a smaller face-elicited N170. Interestingly, single-trial analysis revealed that the lack of face sensitivity in congenital prosopagnosia is related to a larger oscillatory power and phase-locking in the theta frequency-band (4-7 Hz, 130-190 ms) as well as to a lower intertrial jitter of the response latency for the noise stimuli. Altogether, these results suggest that congenital prosopagnosia is due to the deficit of early, structural encoding steps of face perception in filtering between face and non-face stimuli.

  1. The background of reduced face specificity of N170 in congenital prosopagnosia.

    Directory of Open Access Journals (Sweden)

    Kornél Németh

    Full Text Available Congenital prosopagnosia is lifelong face-recognition impairment in the absence of evidence for structural brain damage. To study the neural correlates of congenital prosopagnosia, we measured the face-sensitive N170 component of the event-related potential in three members of the same family (father (56 y, son (25 y and daughter (22 y and in age-matched neurotypical participants (young controls: n = 14; 24.5 y±2.1; old controls: n = 6; 57.3 y±5.4. To compare the face sensitivity of N170 in congenital prosopagnosic and neurotypical participants we measured the event-related potentials for faces and phase-scrambled random noise stimuli. In neurotypicals we found significantly larger N170 amplitude for faces compared to noise stimuli, reflecting normal early face processing. The congenital prosopagnosic participants, by contrast, showed reduced face sensitivity of the N170, and this was due to a larger than normal noise-elicited N170, rather than to a smaller face-elicited N170. Interestingly, single-trial analysis revealed that the lack of face sensitivity in congenital prosopagnosia is related to a larger oscillatory power and phase-locking in the theta frequency-band (4-7 Hz, 130-190 ms as well as to a lower intertrial jitter of the response latency for the noise stimuli. Altogether, these results suggest that congenital prosopagnosia is due to the deficit of early, structural encoding steps of face perception in filtering between face and non-face stimuli.

  2. Picomolar traces of americium(III) introduce drastic changes in the structural chemistry of terbium(III). A break in the ''gadolinium break''

    Energy Technology Data Exchange (ETDEWEB)

    Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)

    2017-10-16

    The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. Development of a (170)Tm source for mercury monitoring studies in humans using XRF.

    Science.gov (United States)

    Timmaraju, K Phanisree; Fajurally, Bibi Najah; Armstrong, Andrea F; Chettle, David R

    2016-04-01

    The goals of the present study were to develop a (170)Tm radioisotope and generate a K XRF spectrum of mercury. Thulium foil and thulium oxide powder were both tested for impurities and the latter was found to be a better prospect for further studies. The (170)Tm radioisotope was developed from thulium oxide powder following the method of disolution and absorption. A suitable source holder and collimator were also designed based on Monte Carlo simulations. Using the radioisotope thus developed, a mercury XRF spectrum was successfully generated. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. 45 CFR 170.207 - Vocabulary standards for representing electronic health information.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Vocabulary standards for representing electronic... Specifications for Health Information Technology § 170.207 Vocabulary standards for representing electronic... vocabulary standards for the purpose of representing electronic health information: (a) Problems—(1) Standard...

  5. 48 CFR 1815.403-170 - Waivers of cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Waivers of cost or pricing... SPACE ADMINISTRATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 1815.403-170 Waivers of cost or pricing data. (a) NASA has waived the requirement for the submission of...

  6. The face-selective N170 component is modulated by facial color.

    Science.gov (United States)

    Nakajima, Kae; Minami, Tetsuto; Nakauchi, Shigeki

    2012-08-01

    Faces play an important role in social interaction by conveying information and emotion. Of the various components of the face, color particularly provides important clues with regard to perception of age, sex, health status, and attractiveness. In event-related potential (ERP) studies, the N170 component has been identified as face-selective. To determine the effect of color on face processing, we investigated the modulation of N170 by facial color. We recorded ERPs while subjects viewed facial color stimuli at 8 hue angles, which were generated by rotating the original facial color distribution around the white point by 45° for each human face. Responses to facial color were localized to the left, but not to the right hemisphere. N170 amplitudes gradually increased in proportion to the increase in hue angle from the natural-colored face. This suggests that N170 amplitude in the left hemisphere reflects processing of facial color information. Copyright © 2012 Elsevier Ltd. All rights reserved.

  7. 31 CFR 103.170 - Exempted anti-money laundering programs for certain financial institutions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Exempted anti-money laundering... TRANSACTIONS Anti-Money Laundering Programs Anti-Money Laundering Programs § 103.170 Exempted anti-money... establishment of anti-money laundering programs: (1) An agency of the United States Government, or of a State or...

  8. 25 CFR 170.109 - How do the Secretaries prevent discrimination or adverse impacts?

    Science.gov (United States)

    2010-04-01

    ... disproportionately high and adverse effects on tribes and Native American populations. ... 25 Indians 1 2010-04-01 2010-04-01 false How do the Secretaries prevent discrimination or adverse... Consultation, Collaboration, Coordination § 170.109 How do the Secretaries prevent discrimination or adverse...

  9. 25 CFR 170.606 - How do legislation and procurement requirements affect the IRR Program?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How do legislation and procurement requirements affect... Miscellaneous Provisions § 170.606 How do legislation and procurement requirements affect the IRR Program? Other legislation and procurement requirements apply to the IRR Program as shown in the following table. Legislation...

  10. Expectations about person identity modulate the face-sensitive N170.

    Science.gov (United States)

    Johnston, Patrick; Overell, Anne; Kaufman, Jordy; Robinson, Jonathan; Young, Andrew W

    2016-12-01

    Identifying familiar faces is a fundamentally important aspect of social perception that requires the ability to assign very different (ambient) images of a face to a common identity. The current consensus is that the brain processes face identity at approximately 250-300 msec following stimulus onset, as indexed by the N250 event related potential. However, using two experiments we show compelling evidence that where experimental paradigms induce expectations about person identity, changes in famous face identity are in fact detected at an earlier latency corresponding to the face-sensitive N170. In Experiment 1, using a rapid periodic stimulation paradigm presenting highly variable ambient images, we demonstrate robust effects of low frequency, periodic face-identity changes in N170 amplitude. In Experiment 2, we added infrequent aperiodic identity changes to show that the N170 was larger to both infrequent periodic and infrequent aperiodic identity changes than to high frequency identities. Our use of ambient stimulus images makes it unlikely that these effects are due to adaptation of low-level stimulus features. In line with current ideas about predictive coding, we therefore suggest that when expectations about the identity of a face exist, the visual system is capable of detecting identity mismatches at a latency consistent with the N170. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. 25 CFR 170.903 - Who notifies tribes of the transport of radioactive waste?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Who notifies tribes of the transport of radioactive waste... INDIAN RESERVATION ROADS PROGRAM Miscellaneous Provisions Hazardous and Nuclear Waste Transportation § 170.903 Who notifies tribes of the transport of radioactive waste? The Department of Energy (DOE) has...

  12. 25 CFR 170.300 - May tribes use flexible financing to finance IRR transportation projects?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false May tribes use flexible financing to finance IRR... Financing § 170.300 May tribes use flexible financing to finance IRR transportation projects? Yes. Tribes may use flexible financing in the same manner as States to finance IRR transportation projects, unless...

  13. 26 CFR 1.170A-13 - Recordkeeping and return requirements for deductions for charitable contributions.

    Science.gov (United States)

    2010-04-01

    ... applies. For the definition of the term “30-percent capital gain property,” see paragraph (d)(3) of § 1... needy to which section 170(e)(3) applies. The cost of the property to the donor was $5,000, and... the definition of similar items of property. Only one qualified appraisal is required for a group of...

  14. Experimental f″ of As at 170, 200, 250 and 300 K from the Bijvoet ...

    Indian Academy of Sciences (India)

    Unknown

    Experimental f″ of As at 170, 200, 250 and 300 K from the Bijvoet pairs of GaAs. G RAJA SUDHA, K VIMALA DEVI, D ARTHI, S PRASANNA SUBRAMANIAN,. N SRINIVASAN* and R SARAVANAN†. Department of Physics, Thiagarajar College, Madurai 625 009, India. †The Madura College, Madurai 625 011, India.

  15. 25 CFR 170.136 - How can a tribe obtain funds?

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.136 How can a tribe obtain funds? (a) To receive funding for programs that serve recreation, tourism, and...

  16. 25 CFR 170.221 - What funding is available for distribution using the PAF?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What funding is available for distribution using the PAF... § 170.221 What funding is available for distribution using the PAF? When the annual authorization for... using the PAF. Relative Need Distribution Factor ...

  17. 7 CFR 170.9 - What type of information does the application require?

    Science.gov (United States)

    2010-01-01

    ... MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) MISCELLANEOUS MARKETING PRACTICES UNDER THE AGRICULTURAL MARKETING ACT OF 1946 USDA FARMERS MARKET § 170.9 What... Market will provide market management with information on contacts, farm location, type of farming...

  18. 14 CFR 170.13 - Airport Traffic Control Tower (ATCT) establishment criteria.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airport Traffic Control Tower (ATCT... AIR TRAFFIC CONTROL SERVICES AND NAVIGATIONAL FACILITIES Airport Traffic Control Towers § 170.13 Airport Traffic Control Tower (ATCT) establishment criteria. (a) The following criteria along with general...

  19. 25 CFR 170.450 - What archeological and environmental requirements must the IRR Program meet?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What archeological and environmental requirements must... Reservation Roads Program Facilities Environmental and Archeological Requirements § 170.450 What archeological and environmental requirements must the IRR Program meet? (a) The archeological and environmental...

  20. 17 CFR 230.170 - Prohibition of use of certain financial statements.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.170 Prohibition of use of... underwriters are or will be committed to take and pay for all of the securities, if any are taken, prior to or... statement is based. The caption shall be in type at least as large as that used generally in the body of the...

  1. 45 CFR 170.465 - Revocation of authorized testing and certification body status.

    Science.gov (United States)

    2010-10-01

    ... Program for HIT § 170.465 Revocation of authorized testing and certification body status. (a) Type-1... receives the revocation notice. (2) A testing and certification body that has had its ONC-ATCB status... certification body that has had its ONC-ATCB status revoked for a Type-1 violation is prohibited from reapplying...

  2. 42 CFR 435.170 - Pregnant women eligible for extended coverage.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Pregnant women eligible for extended coverage. 435... Mandatory Coverage of Special Groups § 435.170 Pregnant women eligible for extended coverage. (a) The agency... pregnancy to women who, while pregnant, applied for, were eligible for, and received Medicaid services on...

  3. Erratum to: Nuclear triaxiality in the A ∼ 160–170 mass region: the ...

    Indian Academy of Sciences (India)

    Erratum to: Nuclear triaxiality in the A ∼ 160–170 mass region: the story so far. S MUKHOPADHYAY1,∗ and W C MA2. 1Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai 400 085, India. 2Department of Physics, Mississippi State University, Mississippi State, Mississippi 39762, USA. ∗. Corresponding ...

  4. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ...; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, -100... Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av. Brigadeiro Faria Lima... amends Sec. 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER...

  5. 76 FR 7511 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-02-10

    ... Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No...

  6. 76 FR 27237 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-05-11

    ...-153-AD; Amendment 39-16684; AD 2011-10-03] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-10-03 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16684... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100 SU...

  7. 25 CFR 170.623 - How are IRR Program projects and activities included in a self-governance agreement?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How are IRR Program projects and activities included in a self-governance agreement? 170.623 Section 170.623 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE... self-governance agreement? To include an IRR Program project or activity in a self-governance agreement...

  8. 25 CFR 170.622 - What IRR programs, functions, services, and activities are subject to the self-governance...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What IRR programs, functions, services, and activities are subject to the self-governance construction regulations? 170.622 Section 170.622 Indians BUREAU OF..., functions, services, and activities are subject to the self-governance construction regulations? All IRR...

  9. 75 FR 40849 - Implementation of Question 10 of 25 CFR Part 170, Subpart C, Indian Reservation Roads Program

    Science.gov (United States)

    2010-07-14

    ... Bureau of Indian Affairs Implementation of Question 10 of 25 CFR Part 170, Subpart C, Indian Reservation... change in how BIA and the Federal Highway Administration (FHWA) will implement Question 10 of 25 CFR Part 170, Subpart C. Question 10 determines the percentages that certain transportation facilities...

  10. 41 CFR 102-85.170 - Can flexitime and other alternative work schedules cost the customer agency more?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can flexitime and other alternative work schedules cost the customer agency more? 102-85.170 Section 102-85.170 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 85-PRICING POLICY...

  11. 25 CFR 170.607 - Can a tribe use its allocation of IRR Program funds for contract support costs?

    Science.gov (United States)

    2010-04-01

    ... costs? Yes. Contract support costs are an eligible item out of a tribe's IRR Program allocation and need... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe use its allocation of IRR Program funds for contract support costs? 170.607 Section 170.607 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE...

  12. 41 CFR 102-75.170 - What happens to the related personal property in a structure scheduled for demolition?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What happens to the related personal property in a structure scheduled for demolition? 102-75.170 Section 102-75.170 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 75-REAL...

  13. Combined Effects of Inversion and Feature Removal on N170 Responses Elicited by Faces and Car Fronts

    Science.gov (United States)

    Kloth, Nadine; Itier, Roxane J.; Schweinberger, Stefan R.

    2013-01-01

    The face-sensitive N170 is typically enhanced for inverted compared to upright faces. Itier, Alain, Sedore, and McIntosh (2007) recently suggested that this N170 inversion effect is mainly driven by the eye region which becomes salient when the face configuration is disrupted. Here we tested whether similar effects could be observed with non-face…

  14. 45 CFR 170.304 - Specific certification criteria for Complete EHRs or EHR Modules designed for an ambulatory setting.

    Science.gov (United States)

    2010-10-01

    ... or EHR Modules designed for an ambulatory setting. 170.304 Section 170.304 Public Welfare DEPARTMENT... for Complete EHRs or EHR Modules designed for an ambulatory setting. The Secretary adopts the following certification criteria for Complete EHRs or EHR Modules designed to be used in an ambulatory...

  15. Sodium terbium(III polyphosphate

    Directory of Open Access Journals (Sweden)

    Abdelghani Oudahmane

    2010-04-01

    Full Text Available Single crystals of the title compound, NaTb(PO34, were obtained by solid-state reaction. This compound belongs to type II of long-chain polyphosphates with the general formula AIBIII(PO34. It is isotypic with the NaNd(PO34 and NaEr(PO34 homologues. The crystal structure is built up of infinite crenelated chains of corner-sharing PO4 tetrahedra with a repeating unit of four tetrahedra. These chains, extending parallel to [100], are linked by isolated TbO8 square antiprisms, forming a three-dimensional framework. The Na+ ions are located in channels running along [010] and are surrounded by six oxygen atoms in a distorted octahedral environment within a cut-off distance <2.9 Å.

  16. Cognitive Bias by Gender Interaction on N170 Response to Emotional Facial Expressions in Major and Minor Depression.

    Science.gov (United States)

    Wu, Xingqu; Chen, Jiu; Jia, Ting; Ma, Wentao; Zhang, Yan; Deng, Zihe; Yang, Laiqi

    2016-03-01

    States of depression are considered to relate to a cognitive bias reactivity to emotional events. Moreover, gender effect may influence differences in emotional processing. The current study is to investigate whether there is an interaction of cognitive bias by gender on emotional processing in minor depression (MiD) and major depression (MaD). N170 component was obtained during a visual emotional oddball paradigm to manipulate the processing of emotional information in 33 MiD, 36 MaD, and 32 controls (CN). Compared with CN, in male, both MiD and MaD had lower N170 amplitudes for happy faces, but MaD had higher N170 amplitudes for sad faces; in female, both MiD and MaD had lower N170 amplitudes for happy and neutral faces, but higher N170 amplitudes for sad faces. Compared with MaD in male, MiD had higher N170 amplitudes for happy faces, lower N170 amplitudes for sad faces; in female, MiD only had higher N170 amplitudes for sad faces. Interestingly, a negative relationship was observed between N170 amplitude and the HDRS score for identification of happy faces in depressed patients while N170 amplitude was positively correlated with the HDRS score for sad faces identification. These results provide novel evidence for the mood-brightening effect with an interaction of cognitive bias by gender on emotional processing. It further suggests that female depression may be more vulnerable than male during emotional face processing with the unconscious negative cognitive bias and depressive syndromes may exist on a spectrum of severity on emotional face processing.

  17. Study of encapsulated {sup 170}Tm sources for their potential use in brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Ballester, Facundo; Granero, Domingo; Perez-Calatayud, Jose; Venselaar, Jack L. M.; Rivard, Mark J. [Department of Atomic, Molecular and Nuclear Physics, University of Valencia, E-46100 Burjassot (Spain) and IFIC, CSIC, University of Valencia, E-46100 Burjassot (Spain); Department of Radiation Oncology, ERESA, Hospital General Universitario, E-46014 Valencia (Spain); Department of Radiation Oncology, La Fe University Hospital, E-46009 Valencia (Spain); Department of Medical Physics, Instituut Verbeeten, Tilburg 5000LA (Netherlands); Department of Radiation Oncology, Tufts University School of Medicine, Boston, Massachusetts 02111 (United States)

    2010-04-15

    Purpose: High dose-rate (HDR) brachytherapy is currently performed with {sup 192}Ir sources, and {sup 60}Co has returned recently into clinical use as a source for this kind of cancer treatment. Both radionuclides have mean photon energies high enough to require specific shielded treatment rooms. In recent years, {sup 169}Yb has been explored as an alternative for HDR-brachytherapy implants. Although it has mean photon energy lower than {sup 192}Ir, it still requires extensive shielding to deliver treatment. An alternative radionuclide for brachytherapy is {sup 170}Tm (Z=69) because it has three physical properties adequate for clinical practice: (a) 128.6 day half-life, (b) high specific activity, and (c) mean photon energy of 66.39 keV. The main drawback of this radionuclide is the low photon yield (six photons per 100 electrons emitted). The purpose of this work is to study the dosimetric characteristics of this radionuclide for potential use in HDR-brachytherapy. Methods: The authors have assumed a theoretical {sup 170}Tm cylindrical source encapsulated with stainless steel and typical dimensions taken from the currently available HDR {sup 192}Ir brachytherapy sources. The dose-rate distribution was calculated for this source using the GEANT4 Monte Carlo (MC) code considering both photon and electron {sup 170}Tm spectra. The AAPM TG-43 U1 brachytherapy dosimetry parameters were derived. To study general properties of {sup 170}Tm encapsulated sources, spherical sources encapsulated with stainless steel and platinum were also studied. Moreover, the influence of small variations in the active core and capsule dimensions on the dosimetric characteristics was assessed. Treatment times required for a {sup 170}Tm source were compared to those for {sup 192}Ir and {sup 169}Yb for the same contained activity. Results: Due to the energetic beta spectrum and the large electron yield, the bremsstrahlung contribution to the dose was of the same order of magnitude as from the

  18. The N170 is not modulated by attention in autism spectrum conditions.

    Science.gov (United States)

    Churches, Owen; Wheelwright, Sally; Baron-Cohen, Simon; Ring, Howard

    2010-04-21

    Face processing deficits are characteristic of autism spectrum conditions. However, event-related potential studies of autism spectrum conditions have found inconsistent results for the face selective N170 component. In this study, 15 adult males with autism spectrum conditions and 15 matched, typically developing controls completed a task in which pictures of faces were either attended to or ignored. In the control group, the N170 was larger when faces were attended to. However, there was no such modulation in the autism spectrum conditions group. This finding helps clarify the results from the earlier event-related potential studies of face processing in autism spectrum conditions and suggests that visual attention does not enhance face processing in autism spectrum conditions as it does in typical development.

  19. Page | 170

    African Journals Online (AJOL)

    Fr. Ikenga

    situation Idoma women find themselves using the Idoma dialect that ege lotu chanya geni,njegede nlotu ..... The Pagan Arabs considered women as chattels to be inherited or disposed of at the whims of the male ..... the verse within the Qur'anic framework, Abu Sulayman concludes that the Arabic word “daraba” does not ...

  20. Page | 170

    African Journals Online (AJOL)

    Fr. Ikenga

    Abstract. Violence against women in the home has been part of human history. This issue has been a subject of fierce discourse around the globe owing to the persistent cruel or inhuman treatment meted out against women. It is as a result of this that various international instruments such as CEDAW, UNDHR, ACHR.

  1. Responsivity to dyslexia training indexed by the N170 amplitude of the brain potential elicited by word reading.

    Science.gov (United States)

    Fraga González, G; Žarić, G; Tijms, J; Bonte, M; Blomert, L; Leppänen, P; van der Molen, M W

    2016-07-01

    The present study examined training effects in dyslexic children on reading fluency and the amplitude of N170, a negative brain-potential component elicited by letter and symbol strings. A group of 18 children with dyslexia in 3rd grade (9.05±0.46years old) was tested before and after following a letter-speech sound mapping training. A group of 20 third-grade typical readers (8.78±0.35years old) performed a single time on the same brain potential task. The training was differentially effective in speeding up reading fluency in the dyslexic children. In some children, training had a beneficial effect on reading fluency ('improvers') while a training effect was absent in others ('non-improvers'). Improvers at pre-training showed larger N170 amplitude to words compared to non-improvers. N170 amplitude decreased following training in improvers but not in non-improvers. But the N170 amplitude pattern in improvers continued to differ from the N170 amplitude pattern across hemispheres seen in typical readers. Finally, we observed a positive relation between the decrease in N170 amplitude and gains in reading fluency. Collectively, the results that emerged from the present study indicate the sensitivity of N170 amplitude to reading fluency and its potential as a predictor of reading fluency acquisition. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  2. Ride-along data LOS 130, 170 & LO330 shots z3139, 3140 and 3141

    Energy Technology Data Exchange (ETDEWEB)

    Loisel, Guillaume Pascal [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-10-01

    Each instrument records the x-ray emission from the Z-pinch dynamic hohlraum (ZPDH); LOS 130 TIXTLs instruments record the absorption of the pinch backlighter through an expanding NaF/Mg foil; LOS 170 MLM instruments record monochromatic images at 276 and 528 eV energies near and before ZPDH stagnation time; LOS 330 TREX 6A & B: recoded time resolved absorption spectra from a radiatively heated Ne gas.

  3. 75 FR 32818 - National Endowment for the Arts; National Council on the Arts 170th Meeting

    Science.gov (United States)

    2010-06-09

    ... ARTS AND THE HUMANITIES National Endowment for the Arts; National Council on the Arts 170th Meeting... hereby given that a meeting of the National Council on the Arts will be held on June 24-25, 2009 in Rooms... of this meeting, from 12:30 p.m.-2 p.m. on June 24th, will be closed for National Medal of Arts...

  4. Dynein, Lis1 and CLIP-170 counteract Eg5-dependent centrosome separation during bipolar spindle assembly

    Science.gov (United States)

    Tanenbaum, Marvin E; Macůrek, Libor; Galjart, Niels; Medema, René H

    2008-01-01

    Bipolar spindle assembly critically depends on the microtubule plus-end-directed motor Eg5 that binds antiparallel microtubules and slides them in opposite directions. As such, Eg5 can produce the necessary outward force within the spindle that drives centrosome separation and inhibition of this antiparallel sliding activity results in the formation of monopolar spindles. Here, we show that upon depletion of the minus-end-directed motor dynein, or the dynein-binding protein Lis1, bipolar spindles can form in human cells with substantially less Eg5 activity, suggesting that dynein and Lis1 produce an inward force that counteracts the Eg5-dependent outward force. Interestingly, we also observe restoration of spindle bipolarity upon depletion of the microtubule plus-end-tracking protein CLIP-170. This function of CLIP-170 in spindle bipolarity seems to be mediated through its interaction with dynein, as loss of CLIP-115, a highly homologous protein that lacks the dynein–dynactin interaction domain, does not restore spindle bipolarity. Taken together, these results suggest that complexes of dynein, Lis1 and CLIP-170 crosslink and slide microtubules within the spindle, thereby producing an inward force that pulls centrosomes together. PMID:19020519

  5. Fast, visual specialization for reading in English revealed by the topography of the N170 ERP response

    Directory of Open Access Journals (Sweden)

    McCandliss Bruce D

    2005-08-01

    Full Text Available Abstract Background N170 effects associated with visual words may be related to perceptual expertise effects that have been demonstrated for faces and other extensively studied classes of visual stimuli. Although face and other object expertise effects are typically bilateral or right-lateralized, the spatial topography of reading-related N170 effects are often left-lateralized, providing potential insights into the unique aspects of reading-related perceptual expertise. Methods Extending previous research in German 1, we use a high-density channel array to characterize the N170 topography for reading-related perceptual expertise in English, a language with inconsistent spelling-to-sound mapping. N170 effects related to overall reading-related expertise are defined by contrasting responses to visual words versus novel symbol strings. By contrasting each of these conditions to pseudowords, we examined how this reading-related N170 effect generalizes to well-ordered novel letter strings. Results A sample-by-sample permutation test computed on word versus symbol ERP topographies revealed differences during two time windows corresponding to the N170 and P300 components. Topographic centroid analysis of the word and symbol N170 demonstrated significant differences in both left-right as well as inferior-superior dimensions. Words elicited larger N170 negativities than symbols at inferior occipito-temporal channels, with the maximal effect over left inferior regions often unsampled in conventional electrode montages. Further contrasts produced inferior-superior topographic effects for the pseudoword-symbol comparison and left-lateralized topographic effects for the word-pseudoword comparison. Conclusion Fast specialized perception related to reading experience produces an N170 modulation detectable across different EEG systems and different languages. Characterization of such effects may be improved by sampling with greater spatial frequency recordings

  6. 25 CFR 170.926 - Can a tribe administer approved ERFO repairs under a self-determination contract or a self...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe administer approved ERFO repairs under a self-determination contract or a self-governance agreement? 170.926 Section 170.926 Indians BUREAU OF INDIAN AFFAIRS... Relief § 170.926 Can a tribe administer approved ERFO repairs under a self-determination contract or a...

  7. Does aspartate 170 of the D1 polypeptide ligate the manganese cluster in photosystem II? An EPR and ESEEM Study.

    Science.gov (United States)

    Debus, Richard J; Aznar, Constantino; Campbell, Kristy A; Gregor, Wolfgang; Diner, Bruce A; Britt, R David

    2003-09-16

    Aspartate 170 of the D1 polypeptide provides part of the high-affinity binding site for the first Mn(II) ion that is photooxidized during the light-driven assembly of the (Mn)(4) cluster in photosystem II [Campbell, K. A., Force, D. A., Nixon, P. J., Dole, F., Diner, B. A., and Britt, R. D. (2000) J. Am. Chem. Soc. 122, 3754-3761]. However, despite a wealth of data on D1-Asp170 mutants accumulated over the past decade, there is no consensus about whether this residue ligates the assembled (Mn)(4) cluster. To address this issue, we have conducted an EPR and ESEEM (electron spin-echo envelope modulation) study of D1-D170H PSII particles purified from the cyanobacterium Synechocystis sp. PCC 6803. The line shapes of the S(1) and S(2) state multiline EPR signals of D1-D170H PSII particles are unchanged from those of wild-type PSII particles, and the signal amplitudes correlate approximately with the lower O(2) evolving activity of the mutant PSII particles (40-60% compared to that of the wild type). These data provide further evidence that the assembled (Mn)(4) clusters in D1-D170H cells function normally, even though the assembly of the (Mn)(4) cluster is inefficient in this mutant. In the two-pulse frequency domain ESEEM spectrum of the 9.2 GHz S(2) state multiline EPR signal of D1-D170H PSII particles, the histidyl nitrogen modulation observed at 4-5 MHz is unchanged from that of wild-type PSII particles and no significant new modulation is observed. Three scenarios are presented to explain this result. (1) D1-Asp170 ligates the assembled (Mn)(4) cluster, but the hyperfine couplings to the ligating histidyl nitrogen of D1-His170 are too large or anisotropic to be detected by ESEEM analyses conducted at 9.2 GHz. (2) D1-Asp170 ligates the assembled (Mn)(4) cluster, but D1-His170 does not. (3) D1-Asp170 does not ligate the assembled (Mn)(4) cluster.

  8. Left-lateralized N170 effects of visual expertise in reading: evidence from Japanese syllabic and logographic scripts.

    Science.gov (United States)

    Maurer, Urs; Zevin, Jason D; McCandliss, Bruce D

    2008-10-01

    The N170 component of the event-related potential (ERP) reflects experience-dependent neural changes in several forms of visual expertise, including expertise for visual words. Readers skilled in writing systems that link characters to phonemes (i.e., alphabetic writing) typically produce a left-lateralized N170 to visual word forms. This study examined the N170 in three Japanese scripts that link characters to larger phonological units. Participants were monolingual English speakers (EL1) and native Japanese speakers (JL1) who were also proficient in English. ERPs were collected using a 129-channel array, as participants performed a series of experiments viewing words or novel control stimuli in a repetition detection task. The N170 was strongly left-lateralized for all three Japanese scripts (including logographic Kanji characters) in JL1 participants, but bilateral in EL1 participants viewing these same stimuli. This demonstrates that left-lateralization of the N170 is dependent on specific reading expertise and is not limited to alphabetic scripts. Additional contrasts within the moraic Katakana script revealed equivalent N170 responses in JL1 speakers for familiar Katakana words and for Kanji words transcribed into novel Katakana words, suggesting that the N170 expertise effect is driven by script familiarity rather than familiarity with particular visual word forms. Finally, for English words and novel symbol string stimuli, both EL1 and JL1 subjects produced equivalent responses for the novel symbols, and more left-lateralized N170 responses for the English words, indicating that such effects are not limited to the first language. Taken together, these cross-linguistic results suggest that similar neural processes underlie visual expertise for print in very different writing systems.

  9. Performance Evaluation of Siemens ADVIA Centaur and Roche MODULAR Analytics E170 Total 25-OH Vitamin D Assays

    Science.gov (United States)

    Chen, Yu; Kinney, Lois; Božović, Andrea; Smith, Hilary; Tarr, Heather; Diamandis, Eleftherios P.; LeBlanc, Adrien

    2014-01-01

    Objectives To evaluate the newly developed Roche MODULAR Analytics E170 Total Vitamin D and the Siemens ADVIA Centaur® Vitamin D Total assays. Materials and Methods Assays were evaluated using the Clinical and Laboratory Standards Institute protocols. Split patient samples were compared with LC-MS/MS and DiaSorin LIAISON assays (n=79 including 15 specimens with detectable endogenous 25-OH vitamin D2). Assay accuracy was also evaluated using the Vitamin D External Quality Assessment Scheme samples. Results The ADVIA Centaur and E170 assays demonstrated maximum total CVs of 14.1% and 5.9%, respectively. Both showed excellent linearity (R2 >0.99). The ADVIA Centaur assay demonstrated interference with bilirubin at 800 μmol/L, hemolysis at 1.25 g/L, and triglycerides at 2.8 mmol/L. Compared to LC-MS/MS, the ADVIA Centaur assay demonstrated a R2 value of 0.893, average bias of −8.8%; the E170 assay an R2 value of 0.872, average bias of 14.3% with underestimation of 25-OH vitamin D2. Compared to the LIAISON assay, the ADVIA Centaur assay demonstrated an R2 value of 0.781, average bias of −17.3%; the E170 assay an R2 value of 0.823, average bias of 11.4%. The ADVIA Centaur and E170 assays demonstrated a biases of <20% in 10/10 and 8/10 samples, respectively. Conclusions The ADVIA Centaur and E170 vitamin D assays demonstrated acceptable linearity, imprecision, and accuracy. The E170 assay demonstrated consistent underestimation of 25-OH vitamin D2 levels. Compared with LC-MS/MS, the ADVIA Centaur assay demonstrated a higher R2 value and a smaller average bias than the E170 assay. PMID:22705028

  10. Training by visual identification and writing leads to different visual word expertise N170 effects in preliterate Chinese children.

    Science.gov (United States)

    Zhao, Pei; Li, Su; Zhao, Jing; Gaspar, Carl M; Weng, Xuchu

    2015-10-01

    The N170 component of EEG evoked by visual words is an index of perceptual expertise for the visual word across different writing systems. In the present study, we investigated whether these N170 markers for Chinese, a very complex script, could emerge quickly after short-term learning (∼ 100 min) in young Chinese children, and whether early writing experience can enhance the acquisition of these neural markers for expertise. Two groups of preschool children received visual identification and free writing training respectively. Short-term character training resulted in selective enhancement of the N170 to characters, consistent with normal expert processing. Visual identification training resulted in increased N170 amplitude to characters in the right hemisphere, and N170 amplitude differences between characters and faces were decreased; whereas the amplitude difference between characters and tools increased. Writing training led to the disappearance of an initial amplitude difference between characters and faces in the right hemisphere. These results show that N170 markers for visual expertise emerge rapidly in young children after word learning, independent of the type of script young children learn; and visual identification and writing produce different effects. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  11. Endoplasmic reticulum chaperone glucose regulated protein 170-Pokemon complexes elicit a robust antitumor immune response in vivo.

    Science.gov (United States)

    Yuan, Bangqing; Xian, Ronghua; Wu, Xianqu; Jing, Junjie; Chen, Kangning; Liu, Guojun; Zhou, Zhenhua

    2012-07-01

    Previous evidence suggested that the stress protein grp170 can function as a highly efficient molecular chaperone, binding to large protein substrates and acting as a potent vaccine against specific tumors when purified from the same tumor. In addition, Pokemon can be found in almost all malignant tumor cells and is regarded to be a promising candidate for the treatment of tumors. However, the potential of the grp170-Pokemon chaperone complex has not been well described. In the present study, the natural chaperone complex between grp170 and the Pokemon was formed by heat shock, and its immunogenicity was detected by ELISPOT and (51)Cr-release assays in vitro and by tumor bearing models in vivo. Our results demonstrated that the grp170-Pokemon chaperone complex could elicit T cell responses as determined by ELISPOT and (51)Cr-release assays. In addition, immunized C57BL/6 mice were challenged with subcutaneous (s.c.) injection of Lewis cancer cells to induce primary tumors. Treatment of mice with the grp170-Pokemon chaperone complex also significantly inhibited tumor growth and prolonged the life span of tumor-bearing mice. Our results indicated that the grp170-Pokemon chaperone complex might represent a powerful approach to tumor immunotherapy and have significant potential for clinical application. Copyright © 2012 Elsevier GmbH. All rights reserved.

  12. Training by visual identification and writing leads to different visual word expertise N170 effects in preliterate Chinese children

    Directory of Open Access Journals (Sweden)

    Pei Zhao

    2015-10-01

    Full Text Available The N170 component of EEG evoked by visual words is an index of perceptual expertise for the visual word across different writing systems. In the present study, we investigated whether these N170 markers for Chinese, a very complex script, could emerge quickly after short-term learning (∼100 min in young Chinese children, and whether early writing experience can enhance the acquisition of these neural markers for expertise. Two groups of preschool children received visual identification and free writing training respectively. Short-term character training resulted in selective enhancement of the N170 to characters, consistent with normal expert processing. Visual identification training resulted in increased N170 amplitude to characters in the right hemisphere, and N170 amplitude differences between characters and faces were decreased; whereas the amplitude difference between characters and tools increased. Writing training led to the disappearance of an initial amplitude difference between characters and faces in the right hemisphere. These results show that N170 markers for visual expertise emerge rapidly in young children after word learning, independent of the type of script young children learn; and visual identification and writing produce different effects.

  13. Doppler sonographic evaluation of venogenic extremity swellings: Analysis of 170 patients from Kano, Nigeria.

    Science.gov (United States)

    Ismail, A; Tabari, A M; Isyaku, K

    2017-08-01

    Deep venous thrombosis (DVT) is a serious problem that can potentially lead to many complications including life-threatening pulmonary arterial thrombosis. Screening and confirmation of the diagnosis are critical in the care of this condition. The objective of this study was to evaluate the role of Doppler sonography in diagnosing DVT and to illustrate the pattern in 170 suspected cases from our local environment. This study was conducted at our department over 18 months. A total of 170 patients with clinical suspicion of limb DVT were recruited. The characteristics of the patients, risk factor for DVT, and the site of the lesion were documented. Sonographic examination was done using 7.5 MHz linear and 3.5 MHz convex transducers. Out of the 170 patients, there are 89 (52.35%) males and 81 (47.65%) females. Their mean age was 50.6 years (+17.9 years). The common risk factors for DVT include chronic medical illness (28.8%), long distance travel (15.3%), previous DVT (8.8%), stroke/paralysis (5.3%), neoplasms (5.9%), pregnancy (5.9%), and trauma/surgery (5.9%). About 55.8% (95) of them were confirmed to have DVT on ultrasound while 44.2% (75) had normal ultrasound findings. There was a female preponderance among the 95 cases of DVT, 58.9% of them were females while 41.1% of them were males. It was found that contiguous femoro-popliteal and ilio-femoro-popliteal segments were most commonly thrombosed. These lesions were predominantly left sided (59.5%). There was a predominance of females and femoro-popliteal segments in DVT. Doppler ultrasound is very useful in the evaluation of extremity DVT. All clinically suspected cases should be evaluated with this modality due to limited sensitivity of clinical evaluation in the diagnosis of DVT. Further correlative studies in comparison to venography and hematologic indices are also recommended.

  14. Two-photon-excited fluorescence spectroscopy of atomic fluorine at 170 nm

    Science.gov (United States)

    Herring, G. C.; Dyer, Mark J.; Jusinski, Leonard E.; Bischel, William K.

    1988-01-01

    Two-photon-excited fluorescence spectroscopy of atomic fluorine is reported. A doubled dye laser at 286-nm is Raman shifted in H2 to 170 nm (sixth anti-Stokes order) to excite ground-state 2P(0)J fluorine atoms to the 2D(0)J level. The fluorine atoms are detected by one of two methods: observing the fluorescence decay to the 2PJ level or observing F(+) production through the absorption of an additional photon by the excited atoms. Relative two-photon absorption cross sections to and the radiative lifetimes of the 2D(0)J states are measured.

  15. A parametric study based on spectral fatigue analysis for 170k LNGC

    Directory of Open Access Journals (Sweden)

    Tae-Yoon Park

    2011-06-01

    Full Text Available The Spectral Fatigue Analysis is representative fatigue life assessment method for vessels. This Analysis is performed generally for the whole vessel and many assessment sites. The spectral fatigue analysis is performed through the process of hydrodynamic response analysis, global structural analysis, local structural analysis and calculation of fatigue damage. In these processes, fatigue damage is affected by many variables. The representative variables are S-N curve data, wave scatter data, wave spectrum, bandwidth effect and etc. In this paper, the effects of these variables to the fatigue damage are analyzed through the spectral fatigue analysis for 170k LNGC.

  16. Broadband Tuning (170nm) of InGaAs Quantum Well Lasers

    OpenAIRE

    Eng, L. E.; Mehuys, D. G.; Mittelstein, M.; Yariv, A.

    1990-01-01

    The wavelength tuning properties of strained InGaAs quantum well lasers using an external grating for feedback is reported. Tunable laser oscillation has been observed over a range of 170 nm, between 840 and 1010 nm, under pulsed current excitation. The optimal conditions for broadband tunability for the InGaAs lasers are different from GaAs lasers, which is attributed to a difference in spectral gain curves. Together with an optimised GaAs quantum well laser the entire region between 740 and...

  17. Development of Rogowski-Coil Type CT for Application in 170kV GIS

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Y.H.; Kim, J.B.; Song, W.P.; Kim, D.S. [Hyosung corporation (Korea)

    2001-07-01

    Traditionally, instrument transformer of the ferromagnetic core type have been used for measuring current in GIS (Gas Insulated Switchgear). Recently, with the introduction of digital technology at the protection relay of measurement device level, the use of new current sensor can be foreseen. Current measurement by means of Rogowski coil is just one illustration of this. This paper describes the progress of development of Rogowski-coil type CT for application in 170kV GIS. (author). 4 refs., 8 figs., 2 tabs.

  18. N170 face specificity and face memory depend on hometown size.

    Science.gov (United States)

    Balas, Benjamin; Saville, Alyson

    2015-03-01

    Face recognition depends on visual experience in a number of different ways. Infrequent exposure to faces belonging to categories defined by species, age, or race can lead to diminished memory for and discrimination between members of those categories relative to faces belonging to categories that dominate an observer's environment. Early visual impairment can also have long-lasting and broad effects on face discrimination - just a few months of visual impairment due to congenital cataracts can lead to diminished discrimination between faces that differ in their configuration, for example (Le Grand et al., 2001). Presently, we consider a novel aspect of visual experience that may impact face recognition: The approximate amount of different faces observers encountered during their childhood. We recruited undergraduate observers from small (500-1000 individuals) and large communities (30,000-100,000 individuals) and asked them to complete a standard face memory test and a basic ERP paradigm designed to elicit a robust N170 response, including the classic face inversion effect. We predicted that growing up in a small community might lead to diminished face memory and an N170 response that was less specific to faces. These predictions were confirmed, suggesting that the sheer number of faces one can interact with during their upbringing shapes their behavioral abilities and the functional architecture of face processing in the brain. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Analysis and Measurements of 170 GHz ITER ECH Transmission Line Components

    Science.gov (United States)

    Jawla, Sudheer; Schaub, Samuel; Shapiro, Michael; Kowalski, Elizabeth; Temkin, Richard; Hanson, Gregory

    2014-10-01

    In this paper we discuss two important issues related to the ITER 170 GHz ECH 63.5-mm diameter corrugated waveguide Transmission Lines (TL); 1) calculation of mode conversion losses in the expansion units for the TL, and, 2) determination of mode contents in corrugated waveguides. Expansion units are needed to accommodate expansion and contraction along the TL from the gyrotron to the tokamak. A numerical mode matching code has been developed to estimate power losses due to mode conversion of the operating mode, HE11, to higher order modes as a result of the radial discontinuities in a sliding joint. Two designs were evaluated, a simple gap expansion unit and a more complex tapered expansion unit. We also present a novel method for determining the mode content of the linearly polarized (LP) modes of a corrugated waveguide using the method of moments. This method is based on calculating the low order irradiance moments of the measured radiated intensity profiles at several distances from the waveguide aperture. The proposed method is experimentally validated by the data measured from the 63.5-mm diameter corrugated waveguide using the vector network analyzer and a high purity HE11 mode generator at 170 GHz built by General Atomics. This research was supported by the U.S. Department of Energy, Office of Fusion Energy Sciences and by the U.S. ITER Project managed by Battelle/Oak Ridge National Laboratory.

  20. RELATION BETWEEN THE PHYSICAL WORKING CAPACITY (PWC170 AND STATIC RELATIVE STRENGTH

    Directory of Open Access Journals (Sweden)

    Abdulla Elezi

    2012-09-01

    Full Text Available Determining the relationship within the segments, and establish the correlation between the functional and motor areas may be important for programming load both in education and in sports and recreation. For this reason we set goals and work this year. The main objective of this research is to determine association and motor characteristics impact on functional ability (physical work capacity. The sample is defined as a sample of 263 respondents drawn from the population of secondary schools: Gymnasium Zenel Hajdini; Marin Barleti and Mehmet Isai in city of Gjilan. Nine tests were used to estimate motoric capabilities and a test of functional capacity of aerobic-type (physical work capacity. To determine the relation between the predictor (motor variables and criterion variables (physical working capacity - PWC170 it is prepared the regression analysis of the manifest space. Analyses were made to the program SPSS 12.0 for Windows. The connection of the entire system of variables static relative strength with a score of Physics working capacity (PWC170 on a bicycle ergo meter as aerobic type variable explains the coefficient of multiple correlations, which is RO 0.394. Regression analysis indicates that the better results on a bicycle ergo meter will have respondents who score better in tests of static relative strength of the leg (at the test isometric muscle contraction quadriceps thighs and static tests of the relative strength of arm and shoulder area (at the test of isometric contraction triceps muscle circumference.

  1. The N170 component is sensitive to face-like stimuli: a study of Chinese Peking opera makeup.

    Science.gov (United States)

    Liu, Tiantian; Mu, Shoukuan; He, Huamin; Zhang, Lingcong; Fan, Cong; Ren, Jie; Zhang, Mingming; He, Weiqi; Luo, Wenbo

    2016-12-01

    The N170 component is considered a neural marker of face-sensitive processing. In the present study, the face-sensitive N170 component of event-related potentials (ERPs) was investigated with a modified oddball paradigm using a natural face (the standard stimulus), human- and animal-like makeup stimuli, scrambled control images that mixed human- and animal-like makeup pieces, and a grey control image. Nineteen participants were instructed to respond within 1000 ms by pressing the 'F' or 'J' key in response to the standard or deviant stimuli, respectively. We simultaneously recorded ERPs, response accuracy, and reaction times. The behavioral results showed that the main effect of stimulus type was significant for reaction time, whereas there were no significant differences in response accuracies among stimulus types. In relation to the ERPs, N170 amplitudes elicited by human-like makeup stimuli, animal-like makeup stimuli, scrambled control images, and a grey control image progressively decreased. A right hemisphere advantage was observed in the N170 amplitudes for human-like makeup stimuli, animal-like makeup stimuli, and scrambled control images but not for grey control image. These results indicate that the N170 component is sensitive to face-like stimuli and reflect configural processing in face recognition.

  2. The effects of facial color and inversion on the N170 event-related potential (ERP) component.

    Science.gov (United States)

    Minami, T; Nakajima, K; Changvisommid, L; Nakauchi, S

    2015-12-17

    Faces are important for social interaction because much can be perceived from facial details, including a person's race, age, and mood. Recent studies have shown that both configural (e.g. face shape and inversion) and surface information (e.g. surface color and reflectance properties) are important for face perception. Therefore, the present study examined the effects of facial color and inverted face properties on event-related potential (ERP) responses, particularly the N170 component. Stimuli consisted of natural and bluish-colored faces. Faces were presented in both upright and upside down orientations. An ANOVA was used to analyze N170 amplitudes and verify the effects of the main independent variables. Analysis of N170 amplitude revealed the significant interactions between stimulus orientation and color. Subsequent analysis indicated that N170 was larger for bluish-colored faces than natural-colored faces, and N170 to natural-colored faces was larger in response to inverted stimulus as compared to upright stimulus. Additionally, a multivariate pattern analysis (MVPA) investigated face-processing dynamics without any prior assumptions. Results distinguished, above chance, both facial color and orientation from single-trial electroencephalogram (EEG) signals. Decoding performance for color classification of inverted faces was significantly diminished as compared to an upright orientation. This suggests that processing orientation is predominant over facial color. Taken together, the present findings elucidate the temporal and spatial distribution of orientation and color processing during face processing. Copyright © 2015 IBRO. Published by Elsevier Ltd. All rights reserved.

  3. A europium- and terbium-coated magnetic nanocomposite as sorbent in dispersive solid phase extraction coupled with ultra-high performance liquid chromatography for antibiotic determination in meat samples.

    Science.gov (United States)

    Castillo-García, M L; Aguilar-Caballos, M P; Gómez-Hens, A

    2015-12-18

    A new magnetic dispersive solid-phase extraction approach based on Eu- and Tb-coated magnetic nanocomposites, combined with ultra-high performance liquid chromatography with fluorometric detection, is reported for the extraction and simultaneous determination of veterinary antibiotics. The method is aimed at monitoring of potential residues of three tetracyclines, namely oxytetracycline, tetracycline, chlortetracycline and three acidic quinolones, such as oxolinic acid, nalidixic acid and flumequine, chosen as model analytes, in animal muscle samples. The nanocomposites were obtained by synthesizing magnetic nanoparticles by a co-precipitation method and their coating with terbium and europium ions. The limits of detection obtained using standard solutions were: 1.0, 1.5, 3.8, 0.25, 0.7 and 1.2ngmL(-1), which corresponds to 3.3, 5.0, 12.7, 0.8, 2.3 and 4.0μgkg(-1) for oxytetracycline, tetracycline, chlortetracycline, oxolinic acid, nalidixic acid and flumequine, respectively, in meat samples. The precision values, obtained in the presence of the sample matrix, were in the ranges 0.12-2.0% and 2.6-15.4% for retention times and areas, respectively. The selectivity of the method was checked by assaying different veterinary drugs, finding that most of them did not interfere at the same concentration levels as that of analytes. A recovery study was performed in the presence of chicken and pork muscle samples, which provided values in the range of 61.5-102.6%. Copyright © 2015 Elsevier B.V. All rights reserved.

  4. Flow measurement in a 170-MW hydraulic turbine using the Gibson method; Medicion del flujo de una turbina hidraulica de 170 MW utilizando el metodo Gibson

    Energy Technology Data Exchange (ETDEWEB)

    Urquiza, Gustavo [Universidad Autonoma del Estado de Morelos (Mexico); Adamkowski, Adam [The Szewalski Institute of Fluid-Flow Machinery (Poland); Kubiak, Janusz; Sierra, Fernando [Universidad Autonoma del Estado de Morelos (Mexico); Janicki, Waldemar [The Szewalski Institute of Fluid-Flow Machinery (Poland); Fernandez, J. Manuel [Comision Federal de Electricidad (Mexico)

    2007-07-15

    This paper describes the methodology applied for measuring water flow through a 170-MW hydraulic turbine. The flow rate was measured using the pressure-time method, also known as the Gibson method. This method uses the well-known water hammer phenomenon in pipelines; in turbine penstocks, for instance. The version of this method used here is based on measuring, during total stop of the water stream, the time-history of pressure change in one section of the turbine penstock and relate it to the pressure in the upper reservoir to which the penstock is connected. The volumetric flow rate is determined from the relevant integration of the measured temporary pressure rise. Flow measurement was possible this way because the influence of the penstock inlet was negligible as far as an error of the measurement is concerned. The length of the penstock was 300 m. Previous experience and a standard IEC-41-1991 were the criteria adopted and applied. A fast and efficient acquisition system, including a 16 bit card, was used. The flow rate was calculated using a computer program developed and tested on several cases. The results obtained with the Gibson method were used for calibration of the on-line flow measuring system based on the Winter-Kennedy method as one of the index methods. This method is very often used for continuous monitoring of the flow rate through hydraulic turbines, when the calibration has been done on site by using the results of measurements obtained by the absolute method. Having measured the flow rate and output power, the efficiency was calculated for any operating conditions. A curve showing the best operating conditions based on the highest efficiency is presented and discussed. The details of the instrumentation, its installation, and the results obtained are discussed in the paper. [Spanish] Este articulo describe la metodologia aplicada para la medicion del flujo en una turbina hidraulica de 170 MW. El flujo se midio utilizando el metodo de presion

  5. Eritrodermia: estudo clínico-laboratorial e histopatológico de 170 casos Erythroderma: a clinico-laboratorial and histopathological study of 170 cases

    Directory of Open Access Journals (Sweden)

    Nurimar C. Fernandes

    2008-12-01

    Full Text Available FUNDAMENTOS - A dermatite esfoliativa/eritrodermia é síndrome rara e grave, de etiologia freqüentemente desconhecida. A hospitalização é necessária para avaliação inicial e tratamento. OBJETIVO - Determinar o perfil clínico, laboratorial e histopatológico dos eritrodérmicos internados no HUCFF-UFRJ. MÉTODOS - No período de 1990 a 2007, 170 casos foram submetidos a hemograma, velocidade de hemossedimentação, bioquímica do sangue, provas de função hepática, proteínas totais e frações, pesquisa de células de Sézary no esfregaço de sangue periférico, radiografia de campos pleuropulmonares e biópsia de pele em três locais. RESULTADOS - Entre 92 homens e 78 mulheres, na faixa de 30 a 80 anos, identificaram-se 99 casos (58,23% com dermatoses preexistentes; 37 (21,77% com farmacodermias; 18 (10,58% com linfomas cutâneos de células T e 16 (9,4% de causa indeterminada. Calafrios, prurido, linfonodomegalias e edema de membros inferiores destacaram-se dentre sinais e sintomas. O perfil laboratorial consistiu de aumento da VHS, eosinofilia, leucocitose, linfocitose e anemia. No grupo de etiologia indeterminada, dois padrões histológicos emergiram: dermatite psoriasiforme e dermatite inespecífica. CONCLUSÃO - A psoríase foi a causa mais freqüente; três biópsias de pele simultâneas podem aumentar a acurácia do diagnóstico histopatológico.BACKGROUND - Exfoliative dermatitis (erythroderma is a rare, severe syndrome, frequently of unknown etiology. The hospitalization is required for the initial evaluation and to establish the treatment. OBJECTIVE - to determine the clinical, laboratorial and histologic profile of erythrodermic inpatients at HUCFF-UFRJ. METHODS - in the period 1990-2007, 170 patients were submitted to complete blood cell count, erythrocyte sedimentation rate, blood urea, glucose and creatinine, liver function tests, proteinogram, circulating Sézary cells count, chest X Rays and skin biopsy of three

  6. NVP-QBE170: an inhaled blocker of the epithelial sodium channel with a reduced potential to induce hyperkalaemia.

    Science.gov (United States)

    Coote, K J; Paisley, D; Czarnecki, S; Tweed, M; Watson, H; Young, A; Sugar, R; Vyas, M; Smith, N J; Baettig, U; Groot-Kormelink, P J; Gosling, M; Lock, R; Ethell, B; Williams, G; Schumacher, A; Harris, J; Abraham, W M; Sabater, J; Poll, C T; Faller, T; Collingwood, S P; Danahay, H

    2015-06-01

    Inhaled amiloride, a blocker of the epithelial sodium channel (ENaC), enhances mucociliary clearance (MCC) in cystic fibrosis (CF) patients. However, the dose of amiloride is limited by the mechanism-based side effect of hyperkalaemia resulting from renal ENaC blockade. Inhaled ENaC blockers with a reduced potential to induce hyperkalaemia provide a therapeutic strategy to improve mucosal hydration and MCC in the lungs of CF patients. The present study describes the preclinical profile of a novel ENaC blocker, NVP-QBE170, designed for inhaled delivery, with a reduced potential to induce hyperkalaemia. The in vitro potency and duration of action of NVP-QBE170 were compared with amiloride and a newer ENaC blocker, P552-02, in primary human bronchial epithelial cells (HBECs) by short-circuit current. In vivo efficacy and safety were assessed in guinea pig (tracheal potential difference/hyperkalaemia), rat (hyperkalaemia) and sheep (MCC). In vitro, NVP-QBE170 potently inhibited ENaC function in HBEC and showed a longer duration of action to comparator molecules. In vivo, intratracheal (i.t.) instillation of NVP-QBE170 attenuated ENaC activity in the guinea pig airways with greater potency and duration of action than that of amiloride without inducing hyperkalaemia in either guinea pig or rat. Dry powder inhalation of NVP-QBE170 by conscious sheep increased MCC and was better than inhaled hypertonic saline in terms of efficacy and duration of action. NVP-QBE170 highlights the potential for inhaled ENaC blockers to exhibit efficacy in the airways with a reduced risk of hyperkalaemia, relative to existing compounds. © 2015 The British Pharmacological Society.

  7. Photodynamic therapy of early stage oral cavity and oropharynx neoplasms: an outcome analysis of 170 patients

    Science.gov (United States)

    van Oudenaarde, Kim; Copper, Marcel P.; Klop, W. M. C.; van Veen, Robert; Wildeman, Maarten; Bing Tan, I.

    2010-01-01

    The indications of photodynamic therapy (PDT) of oral cavity and oropharynx neoplasms are not well defined. The main reason is that the success rates are not well established. The current paper analyzes our institutional experience of early stage oral cavity and oropharynx neoplasms (Tis-T2) to identify the success rates for each subgroup according to T stage, primary or non-primary treatment and subsites. In total, 170 patients with 226 lesions are treated with PDT. From these lesions, 95 are primary neoplasms, 131 were non-primaries (recurrences and multiple primaries). The overall response rate is 90.7% with a complete response rate of 70.8%. Subgroup analysis identified oral tongue, floor of mouth sites with more favorable outcome. PDT has more favorable results with certain subsites and with previously untreated lesions. However, PDT can find its place for treating lesions in previously treated areas with acceptable results. PMID:20706842

  8. Explosive eruption, flank collapse and megatsunami at Tenerife ca. 170 ka

    Science.gov (United States)

    Paris, Raphaël; Bravo, Juan J. Coello; González, María E. Martín; Kelfoun, Karim; Nauret, François

    2017-05-01

    Giant mass failures of oceanic shield volcanoes that generate tsunamis potentially represent a high-magnitude but low-frequency hazard, and it is actually difficult to infer the mechanisms and dynamics controlling them. Here we document tsunami deposits at high elevation (up to 132 m) on the north-western slopes of Tenerife, Canary Islands, as a new evidence of megatsunami generated by volcano flank failure. Analyses of the tsunami deposits demonstrate that two main tsunamis impacted the coasts of Tenerife 170 kyr ago. The first tsunami was generated during the submarine stage of a retrogressive failure of the northern flank of the island, whereas the second one followed the debris avalanche of the subaerial edifice and incorporated pumices from an on-going ignimbrite-forming eruption. Coupling between a massive retrogressive flank failure and a large explosive eruption represents a new type of volcano-tectonic event on oceanic shield volcanoes and a new hazard scenario.

  9. Status of the development of the EU 170 GHz/1 MW/CW gyrotron

    Energy Technology Data Exchange (ETDEWEB)

    Pagonakis, Ioannis Gr., E-mail: ioannis.pagonakis@kit.edu [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Albajar, Ferran [The European Joint Undertaking for ITER and The Development of Fusion Energy, Barcelona (Spain); Alberti, Stefano [École Polytechnique Fédérale de Lausanne, Centre de Recherches en Physique des Plasmas (CRPP), Lausanne (Switzerland); Avramidis, Konstantinos [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Bonicelli, Tullio [The European Joint Undertaking for ITER and The Development of Fusion Energy, Barcelona (Spain); Braunmueller, Falk [École Polytechnique Fédérale de Lausanne, Centre de Recherches en Physique des Plasmas (CRPP), Lausanne (Switzerland); Bruschi, Alex [Plasma Physics Institute, National Research Council of Italy, Milano (Italy); Chelis, Ioannis [School of Electrical and Computer Engineering, National Technical University of Athens (Greece); Cismondi, Fabio [The European Joint Undertaking for ITER and The Development of Fusion Energy, Barcelona (Spain); Gantenbein, Gerd [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Hermann, Virgile [Thales Electron Devices (TED), Vélizy-Villacoublay (France); Hesch, Klaus [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Hogge, Jean-Philippe [École Polytechnique Fédérale de Lausanne, Centre de Recherches en Physique des Plasmas (CRPP), Lausanne (Switzerland); Jelonnek, John; Jin, Jianbo; Illy, Stefan [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); Ioannidis, Zisis C. [Faculty of Physics, National and Kapodistrian University of Athens (Greece); Kobarg, Thorsten [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany); and others

    2015-10-15

    The progress in the development of the European 170 GHz, 1 MW/CW gyrotron for electron cyclotron heating & current drive (ECH&CD) on ITER is reported. A continuous wave (CW) prototype is being manufactured by Thales Electron Devices (TED), France, while a short-pulse (SP) prototype gyrotron is in parallel under manufacture at Karlsruhe Institute of Technology (KIT), with the purpose of validating the design of the CW industrial prototype components. The fabrication of most of the sub-assemblies of the SP prototype has been completed. In a first step, an existing magnetron injection gun (MIG) available at KIT was used. Despite this non-ideal configuration, the experiments provided a validation of the design, substantiated by an excellent agreement with numerical simulations. The tube, operated without a depressed collector, is able to produce more than 1 MW of output power with efficiency in excess of 30%, as expected, and compatible with the ITER requirements.

  10. Explosive eruption, flank collapse and megatsunami at Tenerife ca. 170 ka.

    Science.gov (United States)

    Paris, Raphaël; Bravo, Juan J Coello; González, María E Martín; Kelfoun, Karim; Nauret, François

    2017-05-15

    Giant mass failures of oceanic shield volcanoes that generate tsunamis potentially represent a high-magnitude but low-frequency hazard, and it is actually difficult to infer the mechanisms and dynamics controlling them. Here we document tsunami deposits at high elevation (up to 132 m) on the north-western slopes of Tenerife, Canary Islands, as a new evidence of megatsunami generated by volcano flank failure. Analyses of the tsunami deposits demonstrate that two main tsunamis impacted the coasts of Tenerife 170 kyr ago. The first tsunami was generated during the submarine stage of a retrogressive failure of the northern flank of the island, whereas the second one followed the debris avalanche of the subaerial edifice and incorporated pumices from an on-going ignimbrite-forming eruption. Coupling between a massive retrogressive flank failure and a large explosive eruption represents a new type of volcano-tectonic event on oceanic shield volcanoes and a new hazard scenario.

  11. 10 CFR 8.2 - Interpretation of Price-Anderson Act, section 170 of the Atomic Energy Act of 1954.

    Science.gov (United States)

    2010-01-01

    ... Interpretation of Price-Anderson Act, section 170 of the Atomic Energy Act of 1954. (a) It is my opinion that an... incident occurs.” (c) In the case of damage outside of the United States caused by a nuclear facility based... (1959). (f) The point in question received scant consideration during the hearings preceding adoption of...

  12. Responsivity to dyslexia training indexed by the N170 amplitude of the brain potential elicited by word reading

    NARCIS (Netherlands)

    Fraga González, G.; Žarić, G.; Tijms, J.; Bonte, M.; Blomert, L.; Leppänen, P.; van der Molen, M.W.

    The present study examined training effects in dyslexic children on reading fluency and the amplitude of N170, a negative brain-potential component elicited by letter and symbol strings. A group of 18 children with dyslexia in 3rd grade (9.05 ± 0.46 years old) was tested before and after following a

  13. 25 CFR 170.135 - Can a tribe use Federal funds for its recreation, tourism, and trails program?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe use Federal funds for its recreation, tourism... Eligibility Recreation, Tourism and Trails § 170.135 Can a tribe use Federal funds for its recreation, tourism... funds for recreation, tourism, and trails programs if the programs are included in the IRRTIP...

  14. 26 CFR 1.509(a)-2 - Exclusion for certain organizations described in section 170(b)(1)(A).

    Science.gov (United States)

    2010-04-01

    ... classification as a section 509(a)(1) organization, such organization need not be committed to spend every... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Exclusion for certain organizations described in....509(a)-2 Exclusion for certain organizations described in section 170(b)(1)(A). (a) General rule...

  15. 25 CFR 170.137 - What types of activities can a recreation, tourism, and trails program include?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What types of activities can a recreation, tourism, and... INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.137 What types of activities can a recreation, tourism, and...

  16. Impact of head models in N170 component source imaging: results in control subjects and ADHD patients

    Science.gov (United States)

    Beltrachini, L.; Blenkmann, A.; von Ellenrieder, N.; Petroni, A.; Urquina, H.; Manes, F.; Ibáñez, A.; Muravchik, C. H.

    2011-12-01

    The major goal of evoked related potential studies arise in source localization techniques to identify the loci of neural activity that give rise to a particular voltage distribution measured on the surface of the scalp. In this paper we evaluate the effect of the head model adopted in order to estimate the N170 component source in attention deficit hyperactivity disorder (ADHD) patients and control subjects, considering faces and words stimuli. The standardized low resolution brain electromagnetic tomography algorithm (sLORETA) is used to compare between the three shell spherical head model and a fully realistic model based on the ICBM-152 atlas. We compare their variance on source estimation and analyze the impact on the N170 source localization. Results show that the often used three shell spherical model may lead to erroneous solutions, specially on ADHD patients, so its use is not recommended. Our results also suggest that N170 sources are mainly located in the right occipital fusiform gyrus for faces stimuli and in the left occipital fusiform gyrus for words stimuli, for both control subjects and ADHD patients. We also found a notable decrease on the N170 estimated source amplitude on ADHD patients, resulting in a plausible marker of the disease.

  17. 45 CFR 309.170 - What statistical and narrative reporting requirements apply to Tribal IV-D programs?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What statistical and narrative reporting... (IV-D) PROGRAM Statistical and Narrative Reporting Requirements § 309.170 What statistical and narrative reporting requirements apply to Tribal IV-D programs? (a) Tribes and Tribal organizations...

  18. 33 CFR 207.170c - Kissimmee River, navigation locks between Lake Tohopekaliga and Lake Okeechobee, Fla.; use...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Kissimmee River, navigation locks between Lake Tohopekaliga and Lake Okeechobee, Fla.; use, administration, and navigation. 207.170c Section... Lake Okeechobee, Fla.; use, administration, and navigation. (a) The owner of or agency controlling the...

  19. Dissociated neural mechanisms for face detection and configural encoding: evidence from N170 and induced gamma-band oscillation effects.

    Science.gov (United States)

    Zion-Golumbic, Elana; Bentin, Shlomo

    2007-08-01

    Despite ample research, the structure and the functional characteristics of neural systems involved in human face processing are still a matter of active debate. Here we dissociated between a neural mechanism manifested by the face-sensitive N170 event-related potential effect and a mechanism manifested by induced electroencephalographic oscillations in the gamma band, which have been previously associated with the integration of individually coded features and activation of corresponding neural representations. The amplitude of the N170 was larger in the absence of the face contour but not affected by the configuration of inner components (ICs). Its latency was delayed by scrambling the configuration of the components as well as by the absence of the face contour. Unlike the N170, the amplitude of the induced gamma activity was sensitive to the configuration of ICs but insensitive to their presence within or outside a face contour. This pattern suggests a dual mechanism for early face processing, each utilizing different visual cues, which might indicate their respective roles in face processing. The N170 seems to be associated primarily with the detection and categorization of faces, whereas the gamma oscillations may be involved in the activation of their mental representation.

  20. Normal perception of Mooney faces in developmental prosopagnosia: Evidence from the N170 component and rapid neural adaptation.

    Science.gov (United States)

    Towler, John; Gosling, Angela; Duchaine, Bradley; Eimer, Martin

    2016-03-01

    Individuals with developmental prosopagnosia (DP) have a severe difficulty recognizing the faces of known individuals in the absence of any history of neurological damage. These recognition problems may be linked to selective deficits in the holistic/configural processing of faces. We used two-tone Mooney images to study the processing of faces versus non-face objects in DP when it is based on holistic information (or the facial gestalt) in the absence of obvious local cues about facial features. A rapid adaptation procedure was employed for a group of 16 DPs. Naturalistic photographs of upright faces were preceded by upright or inverted Mooney faces or by Mooney houses. DPs showed face-sensitive N170 components in response to Mooney faces versus houses, and N170 amplitude reductions for inverted as compared to upright Mooney faces. They also showed the typical pattern of N170 adaptation effects, with reduced N170 components when upright naturalistic test faces were preceded by upright Mooney faces, demonstrating that the perception of Mooney and naturalistic faces recruits shared neural populations. Our findings demonstrate that individuals with DP can utilize global information about face configurations for categorical discriminations between faces and non-face objects, and suggest that face processing deficits emerge primarily at more fine-grained higher level stages of face perception. © 2014 The British Psychological Society.

  1. When rapid adaptation paradigm is not too rapid: Evidence of face-sensitive N170 adaptation effects.

    Science.gov (United States)

    Tian, Tengxiang; Feng, Xue; Feng, Chunliang; Gu, Ruolei; Luo, Yue-Jia

    2015-07-01

    Recent findings have demonstrated that N170 adaptation effects evoked by face adaptors are general to face and non-face tests, implicating adaptor-locked interferences in the rapid adaptation paradigm. Here we examined the extent to which adaptor-locked interferences confound N170 adaptation effects in different experimental parameters by manipulating the stimulus onset asynchrony (SOA) duration and jitter between adaptors and tests. In the short SOA, those interferences were well visible for the grand-average ERP waveforms evoked by tests, and they are likely to render rapid adaptation paradigm with short SOA unreliable. The adaptor-locked interferences were attenuated by appropriately increasing SOA duration, such that face-sensitive adaptation effects were evident in the long SOA for both baseline-to-peak and peak-to-peak N170 measurements. These findings suggest that the rapid adaptation paradigm may work with a relative long SOA. Our findings provide useful information for future studies regarding the choosing of appropriate experimental parameters and measurements for the rapid adaptation paradigm. In addition, future studies are needed to investigate how to objectively subtract the overlaps of adaptors from tests and to validate the N170 adaptation effect with appropriate behavioral performance. Copyright © 2015 Elsevier B.V. All rights reserved.

  2. 25 CFR 170.413 - What is the public role in developing the long-range transportation plan?

    Science.gov (United States)

    2010-04-01

    ... Roads Program Facilities Long-Range Transportation Planning § 170.413 What is the public role in developing the long-range transportation plan? BIA or the tribe must solicit public involvement. If there are... newspapers when the draft long-range transportation plan is complete. In the absence of local public...

  3. 75 FR 19193 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-04-14

    ...-063-AD; Amendment 39-16257; AD 2010-08-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-08-02 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16257... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, -100 SU, -200 LR...

  4. 75 FR 52238 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... new AD: 2010-18-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16414. Docket No... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100 SU...

  5. 75 FR 14333 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and...

    Science.gov (United States)

    2010-03-25

    ...-055-AD; Amendment 39-16248; AD 2010-07-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... by adding the following new AD: 2010-07-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER... applies to Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and...

  6. 45 CFR 170.306 - Specific certification criteria for Complete EHRs or EHR Modules designed for an inpatient setting.

    Science.gov (United States)

    2010-10-01

    ... OF HEALTH AND HUMAN SERVICES HEALTH INFORMATION TECHNOLOGY HEALTH INFORMATION TECHNOLOGY STANDARDS... TECHNOLOGY Certification Criteria for Health Information Technology § 170.306 Specific certification criteria.... Electronically calculate all of the clinical quality measures specified by CMS for eligible hospitals and...

  7. The Idea Is Good, but…: Failure to Replicate Associations of Oxytocinergic Polymorphisms with Face-Inversion in the N170.

    Directory of Open Access Journals (Sweden)

    Aisha J L Munk

    Full Text Available In event-related potentials, the N170 manifests itself especially in reaction to faces. In the healthy population, face-inversion leads to stronger negative amplitudes and prolonged latencies of the N170, effects not being present in patients with autism-spectrum-disorder (ASD. ASD has frequently been associated with differences in oxytocinergic neurotransmission. This ERP-study aimed to investigate the face-inversion effect in association with oxytocinergic candidate genes. It was expected that risk-allele-carriers of the oxytocin-receptor-gene-polymorphism (rs53576 and of CD38 (rs379863 responded similar to upright and inverted faces as persons with ASD. Additionally, reactions to different facial emotional expressions were studied. As there have been difficulties with replications of those molecular genetic association studies, we aimed to replicate our findings in a second study.Seventy-two male subjects in the first-, and seventy-eight young male subjects in the replication-study conducted a face-inversion-paradigm, while recording EEG. DNA was extracted from buccal cells.Results revealed stronger N170-amplitudes and longer latencies in reaction to inverted faces in comparison to upright ones. Furthermore, effects of emotion on N170 were evident. Those effects were present in the first and in the second study. Whereas we found molecular-genetic associations of oxytocinergic polymorphisms with the N170 in the first study, we failed to do so in the replication sample.Results indicate that a deeper theoretical understanding of this research-field is needed, in order to generate possible explanations for these findings. Results, furthermore, support the hypotheses that success of reproducibility is correlated with strength of lower original p-values and larger effect sizes in the original study.

  8. 25 CFR 170.809 - Can a tribe perform road maintenance under a self-determination contract or self-governance...

    Science.gov (United States)

    2010-04-01

    ...-determination contract or self-governance agreement? 170.809 Section 170.809 Indians BUREAU OF INDIAN AFFAIRS... a tribe perform road maintenance under a self-determination contract or self-governance agreement? Yes. Any tribe may enter into a self-determination contract or self-governance agreement to conduct...

  9. Clinicopathological characteristics of tumours of the intraoral minor salivary glands in 170 Brazilian patients.

    Science.gov (United States)

    Abrahão, Aline Corrêa; Santos Netto, Juliana de Noronha; Pires, Fábio Ramôa; Santos, Teresa Cristina Ribeiro Bartholomeu dos; Cabral, Márcia Grillo

    2016-01-01

    Tumours of the minor salivary glands are relatively uncommon, and publications from around the world normally include tumours of both the minor and major salivary glands, making it difficult to assess their prevalence and distribution. Our aim was to evaluate retrospectively the clinicopathological features of a series of tumours of the intraoral minor salivary glands from two universities in Rio de Janeiro, Brazil, and to compare the data with those from other epidemiological studies. A total of 170 such tumours were diagnosed from 1942 to 2012, and were selected from two university departments of oral pathology. Eighty-nine of the tumours were benign (52%). Pleomorphic adenoma (n=75) and mucoepidermoid carcinoma (n=23) were the most common benign (44%) and malignant tumours (14%), respectively. There were 104 female patients (61%) and both benign and malignant tumours affected more women than men. Significantly more tumours were in the palate (n=95, 56%; p=0.001). We conclude that these tumours had features similar to those from other studies from North and Latin America, but differ from the results presented from Asia. Further studies should be designed to highlight possible geographical and population-specific characteristics of these tumours. Copyright © 2015 The British Association of Oral and Maxillofacial Surgeons. Published by Elsevier Ltd. All rights reserved.

  10. Evaluation of lymphography in 170 patients with carcinoma of the uterine cervix

    Energy Technology Data Exchange (ETDEWEB)

    Hamada, Tatsumi; Kumano, Machiko; Shindo, Hiroshi and others

    1988-01-01

    From November, 1975 to December, 1985, 170 patients with carcinoma of the uterine cervix underwent bipedal lymphography prior to treatment. Seventy one of them, who were mainly at Stage II, underwent radical hysterectomy with pelvic lymphadenectomy. In 30 of the 71 cases, lymph node metastases were detected. The main lymphographic findings of the positive cases were filling defect, stasis and oozing of the contrast medium, which were found in 53 %, 60 % and 33 % of the cases, respectively. A correlation was observed between the filling defect and stasis. No patient had matastasis and negative findings. Of the remaining 41 patients without metastasis, lymphograms were negative in 78 %. In 99 patients, who did not undergo surgery, the percentage of positive lymphographic findings increased significantly with progress of clinical stage. In Stage IV disease (29 cases), blockade of lymphatics (25 %), lymphatico-venous anastomosis, lymphocyst, collateral and reflux, as well as filling defect (48 %), stasis (31 %) and oozing (31 %), were seen. Lymphography in cervical carcinoma may be useful for examining lymph node metastasis.

  11. Distribution of ametropia in 1 170 preschool children with low vision

    Directory of Open Access Journals (Sweden)

    Li-Li Sun

    2016-03-01

    Full Text Available AIM:To observe and study the distribution of ametropia in 1 170 preschool children with low vision.METHODS:Ten kindergartens in the urban area of Jinzhou were randomly selected. For the preschool children aged from 3 to 6, the vision conditions including sight test, ocular inspection, refraction status, conventional ophthalmic testing and stereo tests were conducted. The children with visionRESULTS:(1rates of abnormal vision were 6.37% in children aged 3,7.79% in those aged 4,15.24% in those aged 5 and 8.93% in those aged 6; abnormal rate in children aged 5 was significantly higher than those in the other age groups(PCONCLUSION:For preschool children with low vision, the abnormal rate is reduced with the increasing ages since the vision is gradually mature. Based on the results, hyperopia is the main causes for low vision in preschool children(aged from 3 to 6. Based on the factors of myopia, strabismus and amblyopia, it is important to conduct the general survey in curing eye diseases as early as possible.

  12. Lifetime measurements in {sup 170}Yb using the generalized centroid difference method

    Energy Technology Data Exchange (ETDEWEB)

    Karayonchev, Vasil; Regis, Jean-Marc; Jolie, Jan; Dannhoff, Moritz; Saed-Samii, Nima; Blazhev, Andrey [Institute of Nuclear Physics, University of Cologne, Cologne (Germany)

    2016-07-01

    An experiment using the electronic γ-γ ''fast-timing'' technique was performed at the 10 MV Tandem Van-De-Graaff accelerator of the Institute for Nuclear Physics, Cologne in order to measure lifetimes of the yrast states in {sup 170}Yb. The lifetime of the first 2{sup +} state was determined using the slope method, which means by fitting an exponential decay to the ''slope'' seen in the energy-gated time-difference spectra. The value of τ=2.201(57) ns is in good agreement with the lifetimes measured using other techniques. The lifetimes of the first 4{sup +} and the 6{sup +} states are determined for the first time. They are in the ps range and were measured using the generalized centroid difference method, an extension of the well-known centroid-shift method and developed for fast-timing arrays. The derived reduced transition probabilities B(E2) values are compared with calculations done using the confined beta soft model and show good agreement within the experimental uncertainties.

  13. Perceived arousal of facial expressions of emotion modulates the N170, regardless of emotional category: Time domain and time-frequency dynamics.

    Science.gov (United States)

    Almeida, Pedro R; Ferreira-Santos, Fernando; Chaves, Pedro L; Paiva, Tiago O; Barbosa, Fernando; Marques-Teixeira, João

    2016-01-01

    Findings concerning the emotional modulation of the N170 component of the visual event-related potential are mixed. In the present report we tested the hypothesis that the emotional modulation of the N170 may be driven by the perceived emotional arousal of the stimuli, rather than by specific emotional categories. Fifty-four participants viewed facial expressions of anger, disgust, fear and happiness, plus low arousal neutral faces. All emotional categories were matched in arousal, while stimuli within each category varied parametrically in this dimension. The modulation of the electrocortical activity on the N170 time-window was analyzed in the time domain and via time-frequency decomposition. The effects of emotion and arousal were analyzed separately. In the time domain N170 amplitudes co-varied parametrically with perceived arousal, regardless of emotional category. This modulation was linearly associated with the power of the theta, alpha, and beta frequency bands. Moreover, fear was associated with a trend for increased N170 amplitudes, enhanced alpha power, and increased broad band inter-trial phase coherence. These results support the views that a) the activity in N170 time window is fundamentally modulated by perceived arousal, b) the modulation of the N170 may be the product of an increased evoked response, rather than the result of phase resetting processes, and c) facial expressions of fear retain some processing primacy, that may be related to their increased value as environmental cues. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Predictors of independent lung ventilation: an analysis of 170 single-lung transplantations.

    Science.gov (United States)

    Pilcher, David V; Auzinger, Georg M; Mitra, Biswadev; Tuxen, David V; Salamonsen, Robert F; Davies, Andrew R; Williams, Trevor J; Snell, Gregory I

    2007-04-01

    Single-lung transplantation for chronic obstructive pulmonary disease can cause unique postoperative problems that might require independent lung ventilation. We evaluated preoperative and immediate postoperative factors to predict the need for independent lung ventilation. We retrospectively studied 170 patients who received a single-lung transplant over a 15-year period, 20 (12%) of whom required independent lung ventilation. Patients requiring independent lung ventilation were similar in age, sex, ischemic time, and donor characteristics to those who required conventional ventilation. Patients receiving independent lung ventilation had a greater degree of preoperative airflow limitation, more hyperinflation, lower postoperative PaO2/fraction of inspired oxygen ratios, more radiologic mediastinal shift, and more transplant lung infiltrate on the postoperative chest radiograph. Multivariate logistic regression analysis showed that independent lung ventilation was associated with increasing levels of recipient hyperinflation (percentage total lung capacity compared with predicted value; odds ratio, 1.04; 95% confidence interval, 1.01-1.07; P = .032) and reduced early postoperative PaO2/fraction of inspired oxygen ratio (odds ratio, 0.97; 95% confidence interval, 0.95-0.99; P = .005). Length of ventilation and intensive care unit stay and mortality were higher in the independent lung ventilation group. Among patients who survived to hospital discharge, there were no differences in long-term mortality between the 2 groups. The need for independent lung ventilation in patients undergoing single-lung transplantation for obstructive lung disease is predicted by the combination of increased hyperinflation measured on recipients' preoperative lung function tests and a low PaO2/fraction of inspired oxygen ratio, indicating graft dysfunction in the immediate postoperative period.

  15. Neutron emission in deep inelastic collisions of /sup 28/Si on /sup 64/Ni at 170 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Manduchi, C.; Russo Manduchi, M.T.; Segato, G.F.; Tornielli, G.

    1989-06-01

    Energy and angular distributions of neutrons were measured in coincidence with the projectile-like fragments in deep inelastic collisions of /sup 28/Si on /sup 64/Ni at 170 MeV. Our data are consistent with the assumption of isotropic emission of neutrons in the rest frame of the fully accelerated fragments. Neutron multiplicities suggest that thermal equilibrium is not reached at least for energy losses of the system around 50 MeV.

  16. 75 FR 34488 - National Endowment for the Arts; National Council on the Arts 170th Meeting; Correction

    Science.gov (United States)

    2010-06-17

    ... ARTS AND THE HUMANITIES National Endowment for the Arts; National Council on the Arts 170th Meeting... the Arts. The meeting will be held on June 24-25, 2010 not June 24-25, 2009, in Rooms 527 and M-09 at..., from 12:30 p.m.-2 p.m. on June 24th, will be closed for National Medal of Arts review and...

  17. 25 CFR 170.301 - Can a tribe use IRR Program funds to leverage other funds or pay back loans?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe use IRR Program funds to leverage other funds... Financing § 170.301 Can a tribe use IRR Program funds to leverage other funds or pay back loans? (a) A tribe can use IRR Program funds to leverage other funds. (b) A tribe can use IRR Program funds to pay back...

  18. Interaktionen des Flavonoids Flavon mit dem P-glykoprotein 170 beeinflussen Parameter der Tumorentstehung in vitro und in vivo

    OpenAIRE

    Schumacher, Marco

    2014-01-01

    Die erhöhte Expression ATP-abhängiger Effluxpumpen, wie des Phosphoglykoproteins-170 (P-gp), des Multidrugresistance related proteins-2 (MRP 2) oder des Breast cancer resistance proteins (BCRP), im Tumorgewebe reduziert die intrazellulären Konzentrationen der transportierten Tumortherapeutika. Damit wird die Prognose einer erfolgreichen Therapie von Krebserkrankungen verschlechtert. Flavonoide aus Pflanzen könnten potente Inhibitoren der ABC Transporter darstellen und sich somit als reversing...

  19. Increased Dietary Intake of Saturated Fatty Acid Heptadecanoic Acid (C17:0) Associated with Decreasing Ferritin and Alleviated Metabolic Syndrome in Dolphins

    Science.gov (United States)

    Venn-Watson, Stephanie K.; Parry, Celeste; Baird, Mark; Stevenson, Sacha; Carlin, Kevin; Daniels, Risa; Smith, Cynthia R.; Jones, Richard; Wells, Randall S.; Ridgway, Sam; Jensen, Eric D.

    2015-01-01

    Similar to humans, bottlenose dolphins (Tursiops truncatus) can develop metabolic syndrome and associated high ferritin. While fish and fish-based fatty acids may protect against metabolic syndrome in humans, findings have been inconsistent. To assess potential protective factors against metabolic syndrome related to fish diets, fatty acids were compared between two dolphin populations with higher (n = 30, Group A) and lower (n = 19, Group B) mean insulin (11 ± 12 and 2 ± 5 μIU/ml, respectively; P dolphins. Capelin, a common dietary fish for Group A, had no detectable C17:0, while pinfish and mullet, common in Group B’s diet, had C17:0 (41 and 67 mg/100g, respectively). When a modified diet adding 25% pinfish and/or mullet was fed to six Group A dolphins over 24 weeks (increasing the average daily dietary C17:0 intake from 400 to 1700 mg), C17:0 serum levels increased, high ferritin decreased, and blood-based metabolic syndrome indices normalized toward reference levels. These effects were not found in four reference dolphins. Further, higher total serum C17:0 was an independent and linear predictor of lower ferritin in dolphins in Group B dolphins. Among off the shelf dairy products tested, butter had the highest C17:0 (423mg/100g); nonfat dairy products had no detectable C17:0. We hypothesize that humans’ movement away from diets with potentially beneficial saturated fatty acid C17:0, including whole fat dairy products, could be a contributor to widespread low C17:0 levels, higher ferritin, and metabolic syndrome. PMID:26200116

  20. CATASTROPHIC FLANK COLLAPSE ON TA’U ISLAND AND SUBSEQUENT TSUNAMI: HAS THIS OCCURRED DURING THE LAST 170 YEARS?

    Directory of Open Access Journals (Sweden)

    Shaun Williams

    2012-01-01

    Full Text Available Ta’u, the easternmost inhabited island in the Samoan Islands archipelago, exhibits a series of down-faulted benches on its southern flank, believed to be the remnant of ~30 km3 catastrophic collapse. A historical map of Ta’u charted in 1839 during the United States Exploring Expedition, which did not show the benches, suggests that the event occurred less than 170 years ago. A collapse event of this magnitude would have generated a locally devastating tsunami, with possible impacts experienced at the regional level. However, no written or oral records of such an event exist. A number of key questions thus emerge, and formed the basis for this study. Did this event actually happen within the last 170 years, and if so, how and why could it have gone unnoticed? Or, is the event much older than the impression obtained from the literature? The catastrophic flank collapse was modeled using 100 m contour-resolution bathymetry data of the Ta’u region, coupled with rational assumptions made on the geometry of the failed mass. This enabled numerical landslide- tsunami simulation in the Cornell Multigrid Coupled Tsunami Model (COMCOT. The results indicate that if an event of this magnitude occurred in the last 170 years, it could not have gone unnoticed by local inhabitants. It thus seems likely that the initial survey conducted during the Exploring Expedition was inaccurate. Nevertheless, the well-preserved nature of the benches indicates collapse relatively recently and raises the possibility of future collapse.

  1. Effects of rhizobacteria Paenibacillus polymyxa APEC136 and >Bacillus subtilis APEC170 on biocontrol of postharvest pathogens of apple fruits.

    Science.gov (United States)

    Kim, Young Soo; Balaraju, Kotnala; Jeon, Yongho

    In this study, plant growth-promoting rhizobacteria (PGPR) were evaluated as potential biocontrol agents against postharvest pathogens of apple fruits. In vitro bioassays revealed that, out of 30 isolates screened, isolates APEC136 and APEC170 had the most significant inhibitory effects against the mycelial growth of several fungal pathogens. Analysis of 16S ribosomal RNA (rRNA) sequences identified the two effective isolates as Paenibacillus polymyxa and Bacillus subtilis, respectively. The two strains showed greater growth in brain-heart infusion broth than in other growth media. Treatment of harvested apples with suspensions of either strain reduced the symptoms of anthracnose disease caused by two fungal pathogens, Colletotrichum gloeosporioides and Colletotrichum acutatum, and white rot disease caused by Botryosphaeria dothidea. Increased productions of amylase and protease by APEC136, and increased productions of chitinase, amylase, and protease by APEC170 might have been responsible for inhibiting mycelial growth. The isolates caused a greater reduction in the growth of white rot than of anthracnose. These results indicate that the isolates APEC136 and APEC170 are promising agents for the biocontrol of anthracnose and white rot diseases in apples after harvest, and suggest that these isolates may be useful in controlling these diseases under field conditions.

  2. Electrical Stimulation over Bilateral Occipito-Temporal Regions Reduces N170 in the Right Hemisphere and the Composite Face Effect

    Science.gov (United States)

    Yang, Li-Zhuang; Zhang, Wei; Shi, Bin; Yang, Zhiyu; Wei, Zhengde; Gu, Feng; Zhang, Jing; Cui, Guanbao; Liu, Ying; Zhou, Yifeng; Zhang, Xiaochu; Rao, Hengyi

    2014-01-01

    Transcranial direct current stimulation (tDCS) is a non-invasive brain stimulation technique that can modulate cortical excitability. Although the clinical value of tDCS has been advocated, the potential of tDCS in cognitive rehabilitation of face processing deficits is less understood. Face processing has been associated with the occipito-temporal cortex (OT). The present study investigated whether face processing in healthy adults can be modulated by applying tDCS over the OT. Experiment 1 investigated whether tDCS can affect N170, a face-sensitive ERP component, with a face orientation judgment task. The N170 in the right hemisphere was reduced in active stimulation conditions compared with the sham stimulation condition for both upright faces and inverted faces. Experiment 2 further demonstrated that tDCS can modulate the composite face effect, a type of holistic processing that reflects the obligatory attention to all parts of a face. The composite face effect was reduced in active stimulation conditions compared with the sham stimulation condition. Additionally, the current polarity did not modulate the effect of tDCS in the two experiments. The present study demonstrates that N170 can be causally manipulated by stimulating the OT with weak currents. Furthermore, our study provides evidence that obligatory attention to all parts of a face can be affected by the commonly used tDCS parameter setting. PMID:25531112

  3. Partial pressure (or fugacity) of carbon dioxide, salinity and other variables collected from time series observations using Bubble type equilibrator for autonomous carbon dioxide (CO2) measurement, Carbon dioxide (CO2) gas analyzer and other instruments from MOORING TAO170W and TAO170W0N in the South Pacific Ocean from 2005-07-04 to 2011-02-04 (NODC Accession 0100078)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0100078 includes chemical, meteorological, physical and time series data collected from MOORING TAO170W and TAO170W0N in the South Pacific Ocean from...

  4. Increased Dietary Intake of Saturated Fatty Acid Heptadecanoic Acid (C17:0 Associated with Decreasing Ferritin and Alleviated Metabolic Syndrome in Dolphins.

    Directory of Open Access Journals (Sweden)

    Stephanie K Venn-Watson

    Full Text Available Similar to humans, bottlenose dolphins (Tursiops truncatus can develop metabolic syndrome and associated high ferritin. While fish and fish-based fatty acids may protect against metabolic syndrome in humans, findings have been inconsistent. To assess potential protective factors against metabolic syndrome related to fish diets, fatty acids were compared between two dolphin populations with higher (n = 30, Group A and lower (n = 19, Group B mean insulin (11 ± 12 and 2 ± 5 μIU/ml, respectively; P < 0.0001 and their dietary fish. In addition to higher insulin, triglycerides, and ferritin, Group A had lower percent serum heptadecanoic acid (C17:0 compared to Group B (0.3 ± 0.1 and 1.3 ± 0.4%, respectively; P < 0.0001. Using multivariate stepwise regression, higher percent serum C17:0, a saturated fat found in dairy fat, rye, and some fish, was an independent predictor of lower insulin in dolphins. Capelin, a common dietary fish for Group A, had no detectable C17:0, while pinfish and mullet, common in Group B's diet, had C17:0 (41 and 67 mg/100g, respectively. When a modified diet adding 25% pinfish and/or mullet was fed to six Group A dolphins over 24 weeks (increasing the average daily dietary C17:0 intake from 400 to 1700 mg, C17:0 serum levels increased, high ferritin decreased, and blood-based metabolic syndrome indices normalized toward reference levels. These effects were not found in four reference dolphins. Further, higher total serum C17:0 was an independent and linear predictor of lower ferritin in dolphins in Group B dolphins. Among off the shelf dairy products tested, butter had the highest C17:0 (423mg/100g; nonfat dairy products had no detectable C17:0. We hypothesize that humans' movement away from diets with potentially beneficial saturated fatty acid C17:0, including whole fat dairy products, could be a contributor to widespread low C17:0 levels, higher ferritin, and metabolic syndrome.

  5. Structural and Biochemical Evidence That a TEM-1 [beta]-Lactamase N170G Active Site Mutant Acts via Substrate-assisted Catalysis

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Nicholas G.; Shanker, Sreejesh; Prasad, B.V. Venkataram; Palzkill, Timothy; (Baylor)

    2010-03-12

    TEM-1 {beta}-lactamase is the most common plasmid-encoded {beta}-lactamase in Gram-negative bacteria and is a model class A enzyme. The active site of class A {beta}-lactamases share several conserved residues including Ser{sup 70}, Glu{sup 166}, and Asn{sub 170} that coordinate a hydrolytic water involved in deacylation. Unlike Ser{sup 70} and Glu{sup 166}, the functional significance of residue Asn{sup 170} is not well understood even though it forms hydrogen bonds with both Glu{sup 166} and the hydrolytic water. The goal of this study was to examine the importance of Asn{sup 170} for catalysis and substrate specificity of {beta}-lactam antibiotic hydrolysis. The codon for position 170 was randomized to create a library containing all 20 possible amino acids. The random library was introduced into Escherichia coli, and functional clones were selected on agar plates containing ampicillin. DNA sequencing of the functional clones revealed that only asparagine (wild type) and glycine at this position are consistent with wild-type function. The determination of kinetic parameters for several substrates revealed that the N170G mutant is very efficient at hydrolyzing substrates that contain a primary amine in the antibiotic R-group that would be close to the Asn{sup 170} side chain in the acyl-intermediate. In addition, the x-ray structure of the N170G enzyme indicated that the position of an active site water important for deacylation is altered compared with the wild-type enzyme. Taken together, the results suggest the N170G TEM-1 enzyme hydrolyzes ampicillin efficiently because of substrate-assisted catalysis where the primary amine of the ampicillin R-group positions the hydrolytic water and allows for efficient deacylation.

  6. Draft genome sequence of Burkholderia sordidicola S170, a potential plant growth promoter isolated from coniferous forest soil in the Czech Republic

    DEFF Research Database (Denmark)

    Lladó, Salvador; Xu, Zhuofei; Sørensen, Søren Johannes

    2014-01-01

    Burkholderia species are key players in the accumulation of carbon from cellulose decomposition in coniferous forest ecosystems. We report here the draft genome of Burkholderia sordidicola strain S170, containing features associated with known genes involved in plant growth promotion, the biologi......Burkholderia species are key players in the accumulation of carbon from cellulose decomposition in coniferous forest ecosystems. We report here the draft genome of Burkholderia sordidicola strain S170, containing features associated with known genes involved in plant growth promotion...

  7. Conversion of asynchronous 10 Gbit/s Ethernet NRZ frame into a synchronous RZ frame and multiplexing to 170 Gbit/s

    DEFF Research Database (Denmark)

    Laguardia Areal, Janaina; Hu, Hao; Palushani, Evarist

    2010-01-01

    This paper presents an optical circuit for frame synchronization and pulse compression of 10G Ethernet frames with 12000 bits and multiplexing to a 170 Gbit/s optical time division multiplexed data stream.......This paper presents an optical circuit for frame synchronization and pulse compression of 10G Ethernet frames with 12000 bits and multiplexing to a 170 Gbit/s optical time division multiplexed data stream....

  8. Spectroscopic analysis of lithium terbium tetrafluoride

    DEFF Research Database (Denmark)

    Christensen, H.P.

    1978-01-01

    . The rare-earth site in LiTbF4 possesses S4 symmetry, which allows six crystal-field parameters. ζ and the six Bim were varied to obtain the best agreement with the experimentally observed levels. Keeping F2=434 cm-1 fixed, a fit with a standard deviation of 12 cm-1 was obtained at 10 K with the following...... were calculated by diagonalizing an effective spin-orbit and crystal-field Hamiltonian in an LS basis. H=Σλi(L→·S→)i+ΣαiΣBimOim, where the parameters λi are functions of the spin-orbit parameter ζ and the Slater parameter F2. The Oim and αi are Racah operators and reduced matrix elements, respectively...

  9. Inelastic critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1967-01-01

    We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition.......We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition....

  10. Crystal structure of family 4 uracil-DNA glycosylase from Sulfolobus tokodaii and a function of tyrosine 170 in DNA binding.

    Science.gov (United States)

    Kawai, Akito; Higuchi, Shigesada; Tsunoda, Masaru; Nakamura, Kazuo T; Yamagata, Yuriko; Miyamoto, Shuichi

    2015-09-14

    Uracil-DNA glycosylases (UDGs) excise uracil from DNA by catalyzing the N-glycosidic bond hydrolysis. Here we report the first crystal structures of an archaeal UDG (stoUDG). Compared with other UDGs, stoUDG has a different structure of the leucine-intercalation loop, which is important for DNA binding. The stoUDG-DNA complex model indicated that Leu169, Tyr170, and Asn171 in the loop are involved in DNA intercalation. Mutational analysis showed that Tyr170 is critical for substrate DNA recognition. These results indicate that Tyr170 occupies the intercalation site formed after the structural change of the leucine-intercalation loop required for the catalysis. Copyright © 2015 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  11. A new measurement of the proton capture rate on $^{7}$Be and the S$_{17}$(0) factor

    CERN Document Server

    Baby, L T; Goldring, G; Hass, M; Weissman, L; Fedosseev, V; Köster, U; Haquin, G; Gäggeler, H W; Weinreich, R

    2003-01-01

    The $^{7}$Be(p, $\\gamma$) $ \\,^{8}$B reaction plays a central role in the evaluation of solar neutrino fluxes. We report on a new precision measurement of the cross section of this reaction, following our previous experiment with an implanted target, a raster scanned beam and the elimination of back-scattering losses. The new measurement incorporates a higher activity $^{7}$Be target and a number of improvements in design and procedure. The cross section at Ec.m. = 850 keV was measured several times under varying experimental conditions, yielding a value of S$_{17}$(Ec.m.=850 keV) = 24.0 $\\pm$ 0.5 eV b. Measurements were carried out at lower energies as well. We obtain from the entire set of measurements an extrapolated value of S$_{17}$(0) = 21.2 $\\pm$ 0.7 eV b.

  12. CdSe optical parametric oscillator operating at 12.07 μm with 170 mW output

    Science.gov (United States)

    Yuan, Jinhe; Chen, Yi; Duan, Xiaoming; Yao, Baoquan; Dai, Tongyu; Ju, Youlun

    2017-07-01

    A CdSe optical parametric oscillator (OPO) was demonstrated to operate at 12.07 μm with a maximum output power of 170 mW at a pulse repetition frequency of 1.2 kHz pumped at 2.09 μm with 14.64 W from an acousto-optic Q-switched Ho:YAG laser. To the best of our knowledge, 12.07 μm is the longest wavelength obtained with a 2-μm laser-pumped CdSe OPO. Besides, the angular tuning curve for type II CdSe was also investigated, and the idler wavelength from the OPO could be tuned from 10.24 to 12.07 μm.

  13. Synaptojanin 1: localization on coated endocytic intermediates in nerve terminals and interaction of its 170 kDa isoform with Eps15

    DEFF Research Database (Denmark)

    Haffner, C; Takei, K; Chen, H

    1997-01-01

    that synaptojanin-170, an alternatively spliced isoform of synaptojanin 1, binds Eps15, a clathrin coat-associated protein. Binding is mediated by the COOH-terminal region of synaptojanin-170 which we show here to be poorly conserved from rat to humans, but to contain in both species three asparagine......-proline-phenylalanine (NPF) repeats. This motif has been found to be the core of the binding site for the EH domains of Eps15. Together with previous data, our results suggest that synaptojanin 1 can be recruited to clathrin-coated pits via a multiplicity of interactions....

  14. Radiochemical studies, pre-clinical investigation and preliminary clinical evaluation of170Tm-EDTMP prepared using in-house freeze-dried EDTMP kit.

    Science.gov (United States)

    Das, Tapas; Shinto, Ajit; Kamaleshwaran, Koramadai K; Sarma, Haladhar D; Mohammed, Sahiralam Khan; Mitra, Arpit; Lad, Sangita; Rajan, M G R; Banerjee, Sharmila

    2017-04-01

    The objective of the present work is to formulate 170 Tm-EDTMP using an in-house freeze-dried EDTMP kit and evaluate its potential as a bone pain palliation agent. Patient dose of 170 Tm-EDTMP was prepared with high radiochemical purity using the lyophilized kit at room temperature within 15min. Pre-clinical evaluation in normal Wistar rats revealed selective skeletal accumulation with extended retention. Preliminary clinical investigation in 8 patients with disseminated skeletal metastases exhibited selective uptake in the bone and retention therein for a long duration. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Functional analysis of U1-70K interacting SR proteins in pre-mRNA splicing in Arabidopsis

    Energy Technology Data Exchange (ETDEWEB)

    A.S.N. Reddy

    2008-11-25

    Proteins of a serine/arginine-rich (SR) family are part of the spliceosome and are implicated in both constitutive and alternative splicing of pre-mRNAs. With the funding from DOE we have been studying alternative of splicing of genes encoding serine/arginine-rich (SR) proteins and the roles of SR proteins that interact with U1-70K in regulating basic and alternative splicing. Alternative splicing of pre-mRNAs of Arabidopsis serine/arginine-rich proteins and its regulation by hormones and stresses: We analyzed the splicing of all 19 Arabidopsis genes in different tissues, during different seedling stages and in response to various hormonal and stress treatments. Remarkably, about 90 different transcripts are produced from 15 SR genes, thereby increasing the transcriptome complexity of SR genes by about five fold. Using the RNA isolated from polysomes we have shown that most of the splice variants are recruited for translation. Alternative splicing of some SR genes is controlled in a developmental and tissue-specific manner (Palusa et al., 2007). Interestingly, among the various hormones and abiotic stresses tested, temperature stress (cold and heat) and ultraviolet light dramatically altered alternative splicing of pre-mRNAs of several SR genes whereas hormones altered the splicing of only two SR genes (Palusa et al., 2007). Localization and dynamics of a novel serine/arginine-rich protein that interacts with U1-70K: We analyzed the intranuclear movement of SR45 fused to GFP by fluorescence recovery after photobleaching (FRAP) and fluorescence loss in photobleaching (FLIP). We demonstrate that the movement of GFP-SR45 is ATP-dependent. Interestingly, inhibition of transcription or phosphorylation slowed the mobility of GFP-SR45 (Ali et al., 2006). Our studies have revealed that the nuclear localization signals are located in arg/ser-rich domains (RS) 1 and 2, whereas the speckle targeting signals are exclusively present in RS2 (Ali et al., 2006). The regulation of

  16. Facial Cosmetics Exert a Greater Influence on Processing of the Mouth Relative to the Eyes: Evidence from the N170 Event-Related Potential Component.

    Science.gov (United States)

    Tanaka, Hideaki

    2016-01-01

    Cosmetic makeup significantly influences facial perception. Because faces consist of similar physical structures, cosmetic makeup is typically used to highlight individual features, particularly those of the eyes (i.e., eye shadow) and mouth (i.e., lipstick). Though event-related potentials have been utilized to study various aspects of facial processing, the influence of cosmetics on specific ERP components remains unclear. The present study aimed to investigate the relationship between the application of cosmetic makeup and the amplitudes of the P1 and N170 event-related potential components during facial perception tasks. Moreover, the influence of visual perception on N170 amplitude, was evaluated under three makeup conditions: Eye Shadow, Lipstick, and No Makeup. Electroencephalography was used to monitor 17 participants who were exposed to visual stimuli under each these three makeup conditions. The results of the present study subsequently demonstrated that the Lipstick condition elicited a significantly greater N170 amplitude than the No Makeup condition, while P1 amplitude was unaffected by any of the conditions. Such findings indicate that the application of cosmetic makeup alters general facial perception but exerts no influence on the perception of low-level visual features. Collectively, these results support the notion that the application of makeup induces subtle alterations in the processing of facial stimuli, with a particular effect on the processing of specific facial components (i.e., the mouth), as reflected by changes in N170 amplitude.

  17. Facial Cosmetics Exert a Greater Influence on Processing of the Mouth Relative to the Eyes: Evidence from the N170 Event-Related Potential Component

    Science.gov (United States)

    Tanaka, Hideaki

    2016-01-01

    Cosmetic makeup significantly influences facial perception. Because faces consist of similar physical structures, cosmetic makeup is typically used to highlight individual features, particularly those of the eyes (i.e., eye shadow) and mouth (i.e., lipstick). Though event-related potentials have been utilized to study various aspects of facial processing, the influence of cosmetics on specific ERP components remains unclear. The present study aimed to investigate the relationship between the application of cosmetic makeup and the amplitudes of the P1 and N170 event-related potential components during facial perception tasks. Moreover, the influence of visual perception on N170 amplitude, was evaluated under three makeup conditions: Eye Shadow, Lipstick, and No Makeup. Electroencephalography was used to monitor 17 participants who were exposed to visual stimuli under each these three makeup conditions. The results of the present study subsequently demonstrated that the Lipstick condition elicited a significantly greater N170 amplitude than the No Makeup condition, while P1 amplitude was unaffected by any of the conditions. Such findings indicate that the application of cosmetic makeup alters general facial perception but exerts no influence on the perception of low-level visual features. Collectively, these results support the notion that the application of makeup induces subtle alterations in the processing of facial stimuli, with a particular effect on the processing of specific facial components (i.e., the mouth), as reflected by changes in N170 amplitude. PMID:27656161

  18. 25 CFR 170.462 - When may a self-determination contract or self-governance agreement include PS&E review and...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false When may a self-determination contract or self-governance... Estimates § 170.462 When may a self-determination contract or self-governance agreement include PS&E review... and approve PS&E packages under a self-determination contract or self-governance agreement if the...

  19. 33 CFR 207.170b - Apopka-Beauclair Navigation Lock in Apopka-Beauclair Canal in Lake County, Fla.; use...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Apopka-Beauclair Navigation Lock in Apopka-Beauclair Canal in Lake County, Fla.; use, administration, and navigation. 207.170b Section... Lake County, Fla.; use, administration, and navigation. (a) The owner of or agency controlling the lock...

  20. 42 CFR 440.170 - Any other medical care or remedial care recognized under State law and specified by the Secretary.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Any other medical care or remedial care recognized... PROGRAMS SERVICES: GENERAL PROVISIONS Definitions § 440.170 Any other medical care or remedial care... lodging en route to and from medical care, and while receiving medical care; and (iii) The cost of an...

  1. Facial Cosmetics Exert a Greater Influence on Processing of the Mouth Relative to the Eyes: Evidence from the N170 Event-related Potential Component

    Directory of Open Access Journals (Sweden)

    Hideaki Tanaka

    2016-09-01

    Full Text Available Cosmetic makeup significantly influences facial perception. Because faces consist of similar physical structures, cosmetic makeup is typically used to highlight individual features, particularly those of the eyes (i.e., eye shadow and mouth (i.e., lipstick. Though event-related potentials have been utilized to study various aspects of facial processing, the influence of cosmetics on specific ERP components remains unclear. The present study aimed to investigate the relationship between the application of cosmetic makeup and the amplitudes of the P1 and N170 event-related potential components during facial perception tasks. Moreover, the influence of visual perception on N170 amplitude, was evaluated under three makeup conditions: Eye Shadow, Lipstick, and No Makeup. Electroencephalography was used to monitor 17 participants who were exposed to visual stimuli under each these three makeup conditions. The results of the present study subsequently demonstrated that the Lipstick condition elicited a significantly greater N170 amplitude than the No Makeup condition, while P1 amplitude was unaffected by any of the conditions. Such findings indicate that the application of cosmetic makeup alters general facial perception but exerts no influence on the perception of low-level visual features. Collectively, these results support the notion that the application of makeup induces subtle alterations in the processing of facial stimuli, with a particular effect on the processing of specific facial components (i.e., the mouth, as reflected by changes in N170 amplitude.

  2. Effects of feeding regimen on weight gain, semen characteristics, libido, and lameness in 170- to 250-kilogram Duroc boars.

    Science.gov (United States)

    Wang, C; Li, J L; Wei, H K; Zhou, Y F; Tan, J J; Sun, H Q; Jiang, S W; Peng, J

    2016-11-01

    A 2-period field trial was conducted to determine the effects of feeding regimen on weight gain, semen characteristics, libido, and lameness in 170- to 200-kg (period 1) and 200- to 250-kg (period 2) boars. Sixty-one Duroc boars were allotted to 1 of 3 dietary treatments and 15 g/d fish oil was also provided for each experimental boar, to maintain the n-6:n-3 intake ratio at approximately 6.1:1. The energy intakes of the 3 treatment groups were controlled by basing the feed intake on a corn-soybean meal-based diet (3.11 Mcal/kg of ME) to create: 1) low energy intake group (L, = 20, 7.3 Mcal/d of ME), 2) medium energy intake group (M, = 20, 7.7 Mcal/d of ME), and 3) high energy intake group (H, = 21, 8.3 Mcal/d of ME) in period 1. Feed intake was then increased to 7.6, 8.2, and 8.6 Mcal/d of ME for the 3 groups, respectively, in period 2. During the 28-wk experimental period, boar weight gain, testis volume, semen characteristics, libido, toe measurements, claw lesions, and lameness were examined, and the number of boars culled in each group was recorded to calculate the culling rate. Although there were no differences in testis volume, sperm concentration, and motility, the percentage of abnormal sperm, the percentage of claw lesions, and claw lesion scores differed among treatments ( > 0.05), and ADG was significantly increased with the increase of energy intake between the 2 periods ( 0.05). Nonetheless, the H boars took more time to mount the collection dummy and produce an ejaculate and, in particular, showed a greater percentage of lameness than the L and M boars ( < 0.05). Therefore, the medium energy intake regimen (energy intakes of 7.7 and 8.2 Mcal/d of ME with ADG of 454.5 and 375.3 g/d in 2 periods, respectively) improved the total sperm number and functional sperm number, and meanwhile decreased the occurrence of lameness in 170- to 250-kg Duroc boars.

  3. Search for chargino and neutralino production at $\\sqrt{s}$ = 170 and 172 GeV at LEP

    CERN Document Server

    Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Beeston, C.; Behnke, T.; Bell, A.N.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bloomer, J.E.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Bouwens, B.T.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davies, R.; De Jong, S.; del Pozo, L.A.; Desch, K.; Dienes, B.; Dixit, M.S.; do Couto e Silva, E.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Edwards, J.E.G.; Estabrooks, P.G.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ingram, M.R.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, G.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Morii, M.; Muller, U.; Mihara, S.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pearce, M.J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rees, D.L.; Rigby, D.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Ros, E.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Rylko, R.; Sachs, K.; Saeki, T.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schenk, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schultz-Coulon, H.C.; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Utzat, P.; Van Kooten, Rick J.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilkens, B.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.

    1998-01-01

    A search for charginos and neutralinos, predicted by supersymmetric theories, has been performed using a data sample of 10.3 pb^-1 at centre-of-mass energies of sqrt(s) = 170 and 172 GeV with the OPAL detector at LEP. No evidence for these particles has been found. The results are combined with those from previous OPAL chargino and neutralino searches at lower energies to obtain limits. Exclusion regions at 95% C.L. of parameters of the Minimal Supersymmetric Standard Model are determined. Within this framework, for tan(beta) >= 1.0, lower mass limits are placed on the lightest chargino and the three lightest neutralinos. The 95% C.L. lower mass limit on the lightest chargino, assuming that it is heavier than the lightest neutralino by more than 10 GeV, is 84.5 GeV for the case of a large universal scalar mass (m_0 > ~1 TeV) and 65.7 GeV for the smallest m_0 compatible with current limits on the sneutrino and slepton masses. The lower limit on the lightest neutralino mass at 95% C.L. for tan(beta) >= 1.0 is 2...

  4. Computer simulation of the CSPAD, ePix10k, and RayonixMX170HS X-ray detectors

    Energy Technology Data Exchange (ETDEWEB)

    Tina, Adrienne

    2015-08-21

    The invention of free-electron lasers (FELs) has opened a door to an entirely new level of scientific research. The Linac Coherent Light Source (LCLS) at SLAC National Accelerator Laboratory is an X-ray FEL that houses several instruments, each with its own unique X-ray applications. This light source is revolutionary in that while its properties allow for a whole new range of scientific opportunities, it also poses numerous challenges. For example, the intensity of a focused X-ray beam is enough to damage a sample in one mere pulse; however, the pulse speed and extreme brightness of the source together are enough to obtain enough information about that sample, so that no further measurements are necessary. An important device in the radiation detection process, particularly for X-ray imaging, is the detector. The power of the LCLS X-rays has instigated a need for better performing detectors. The research conducted for this project consisted of the study of X-ray detectors to imitate their behaviors in a computer program. The analysis of the Rayonix MX170-HS, CSPAD, and ePix10k in particular helped to understand their properties. This program simulated the interaction of X-ray photons with these detectors to discern the patterns of their responses. A scientist’s selection process of a detector for a specific experiment is simplified from the characterization of the detectors in the program.

  5. Atypical Modulations of N170 Component during Emotional Processing and Their Links to Social Behaviors in Ex-combatants

    Directory of Open Access Journals (Sweden)

    Sandra P. Trujillo

    2017-05-01

    Full Text Available Emotional processing (EP is crucial for the elaboration and implementation of adaptive social strategies. EP is also necessary for the expression of social cognition and behavior (SCB patterns. It is well-known that war contexts induce socio-emotional atypical functioning, in particular for those who participate in combats. Thus, ex-combatants represent an ideal non-clinical population to explore EP modulation and to evaluate its relation with SCB. The aim of this study was to explore EP and its relation with SCB dimensions such as empathy, theory of mind and social skills in a sample of 50 subjects, of which 30 were ex-combatants from illegally armed groups in Colombia, and 20 controls without combat experience. We adapted an Emotional Recognition Task for faces and words and synchronized it with electroencephalographic recording. Ex-combatants presented with higher assertion skills and showed more pronounced brain responses to faces than Controls. They did not show the bias toward anger observed in control participants whereby the latter group was more likely to misclassify neutral faces as angry. However, ex-combatants showed an atypical word valence processing. That is, words with different emotions yielded no differences in N170 modulations. SCB variables were successfully predicted by neurocognitive variables. Our results suggest that in ex-combatants the links between EP and SCB functions are reorganized. This may reflect neurocognitive modulations associated to chronic exposure to war experiences.

  6. Electromagnetic properties in {sup 160-170}Dy nuclei. A microscopic description by the pseudo-SU(3) shell model

    Energy Technology Data Exchange (ETDEWEB)

    Vargas, Carlos E.; Bagatella-Flores, Norma [Universidad Veracruzana, Facultad de Fisica, Veracruz (Mexico); Velazquez, Victor [Universidad Nacional Autonoma de Mexico, Facultad de Ciencias, Mexico D.F. (Mexico); Lerma-Hernandez, Sergio [Universidad Veracruzana, Facultad de Fisica, Veracruz (Mexico); Universidad Nacional Autonoma de Mexico, Instituto de Ciencias Nucleares, Mexico D.F. (Mexico)

    2017-04-15

    The large collectivity observed in the rare-earth region of the nuclear landscape is well known. The microscopic studies are difficult to perform in this region due to the enormous size of the valence spaces, a problem that can be avoided by means of the use of symmetry-based models. Here we present calculations for electromagnetic properties of {sup 160-170}Dy nuclei within the pseudo-SU(3) scheme. The model Hamiltonian includes the preserving symmetry Q.Q term and the symmetry-breaking Nilsson and pairing terms, systematically parametrized for all members of the chain. The model is used to calculate B(E2) and B(M1) inter-band transition strengths between the ground state, γ and β-bands. In addition, we present results for quadrupole moments and g factors in these rotational bands. The results show that the pseudo-SU(3) shell model is a powerful microscopic theory for a description of electromagnetic properties of states in the normal parity sector in heavy deformed nuclei. (orig.)

  7. Atypical Modulations of N170 Component during Emotional Processing and Their Links to Social Behaviors in Ex-combatants

    Science.gov (United States)

    Trujillo, Sandra P.; Valencia, Stella; Trujillo, Natalia; Ugarriza, Juan E.; Rodríguez, Mónica V.; Rendón, Jorge; Pineda, David A.; López, José D.; Ibañez, Agustín; Parra, Mario A.

    2017-01-01

    Emotional processing (EP) is crucial for the elaboration and implementation of adaptive social strategies. EP is also necessary for the expression of social cognition and behavior (SCB) patterns. It is well-known that war contexts induce socio-emotional atypical functioning, in particular for those who participate in combats. Thus, ex-combatants represent an ideal non-clinical population to explore EP modulation and to evaluate its relation with SCB. The aim of this study was to explore EP and its relation with SCB dimensions such as empathy, theory of mind and social skills in a sample of 50 subjects, of which 30 were ex-combatants from illegally armed groups in Colombia, and 20 controls without combat experience. We adapted an Emotional Recognition Task for faces and words and synchronized it with electroencephalographic recording. Ex-combatants presented with higher assertion skills and showed more pronounced brain responses to faces than Controls. They did not show the bias toward anger observed in control participants whereby the latter group was more likely to misclassify neutral faces as angry. However, ex-combatants showed an atypical word valence processing. That is, words with different emotions yielded no differences in N170 modulations. SCB variables were successfully predicted by neurocognitive variables. Our results suggest that in ex-combatants the links between EP and SCB functions are reorganized. This may reflect neurocognitive modulations associated to chronic exposure to war experiences. PMID:28588462

  8. Light-dependent phosphorylation of the Drosophila inactivation no afterpotential D (INAD scaffolding protein at Thr170 and Ser174 by eye-specific protein kinase C.

    Directory of Open Access Journals (Sweden)

    Olaf Voolstra

    Full Text Available Drosophila inactivation no afterpotential D (INAD is a PDZ domain-containing scaffolding protein that tethers components of the phototransduction cascade to form a supramolecular signaling complex. Here, we report the identification of eight INAD phosphorylation sites using a mass spectrometry approach. PDZ1, PDZ2, and PDZ4 each harbor one phosphorylation site, three phosphorylation sites are located in the linker region between PDZ1 and 2, one site is located between PDZ2 and PDZ3, and one site is located in the N-terminal region. Using a phosphospecific antibody, we found that INAD phosphorylated at Thr170/Ser174 was located within the rhabdomeres of the photoreceptor cells, suggesting that INAD becomes phosphorylated in this cellular compartment. INAD phosphorylation at Thr170/Ser174 depends on light, the phototransduction cascade, and on eye-Protein kinase C that is attached to INAD via one of its PDZ domains.

  9. Spectroscopy of Neutron-Rich $^{168,170}$Dy: Yrast Band Evolution Close to the $N_{p}N_{n}$ Valence Maximum

    CERN Document Server

    Söderström, P A; Regan, P H; Algora, A; de Angelis, G; Ashley, S F; Aydin, S; Bazzacco, D; Casperson, R J; Catford, W N; Cederkäll, J; Chapman, R; Corradi, L; Fahlander, C; Farnea, E; Fioretto, E; Freeman, S J; Gadea, A; Gelletly, W; Gottardo, A; Grodner, E; He, C Y; Jones, G A; Keyes, K; Labiche, M; Liang, X; Liu, Z; Lunardi, S; Muarginean, N; Mason, P; Menegazzo, R; Mengoni, D; Montagnoli, G; Napoli, D; Ollier, J; Pietri, S; Podolyák, Z; Pollarolo, G; Recchia, F; Şahin, E; Scarlassara, F; Silvestri, R; Smith, J F; Spohr, K M; Steer, S J; Stefanini, A M; Szilner, S; Thompson, N J; Tveten, G M; Ur, C A; Valiente-Dobón, J J; Werner, V; Williams, S J; Xu, F R; Zhu, J Y

    2010-01-01

    The yrast sequence of the neutron-rich dysprosium isotope Dy-168 has been studied using multi-nucleon transfer reactions following the collision of a 460-MeV Se-82 beam and a Er-170 target. The reaction products were identified using the PRISMA magnetic spectrometer and the gamma rays detected using the CLARA HPGe-detector array. The 2+ and 4+ members of the previously measured ground state rotational band of Dy-168 was confirmed and the yrast band extended up to 10+. A tentative candidate for the 4+ to 2+ transition in Dy-170 was also identified. The data on this and lighter even-even dysprosium isotopes are interpreted in terms of Total Routhian Surface calculations and the evolution of collectivity approaching the proton-neutron valence product maximum is discussed.

  10. Characteristics of PI-RADS 4 lesions within the prostatic peripheral zone: a retrospective diagnostic accuracy study evaluating 170 lesions.

    Science.gov (United States)

    Shankar, Prasad R; Curci, Nicole E; Davenport, Matthew S

    2017-12-02

    To determine whether peripheral zone PI-RADS 4 observations can be further risk-stratified. This was an IRB-approved HIPAA-compliant retrospective diagnostic accuracy study. Peripheral zone PI-RADS 4 observations prospectively identified at the study institution from 8/1/2015 to 12/31/2016 (n = 170 in 149 mpMRIs) were reviewed independently by two blinded genitourinary radiologists on the basis of (a) PI-RADS v2 shape, (b) pattern of peripheral zone sparing, and (c) rationale for PI-RADS 4 designation. Reference standard was targeted MR-ultrasound fusion biopsy and detection of Gleason 7+ prostate cancer. Positive predictive values (PPVs) were calculated. Predictors were assessed with binary logistic regression. PI-RADS 4 lesions with a DWI score of 4 were more likely to represent Gleason 7+ prostate cancer (p = 0.008-0.01; Reader 1 PPV: 53%; Reader 2 PPV: 48%). Pattern of peripheral zone sparing and most lesion shapes were not predictive (p > 0.05); however, oval lesions were predictive for Reader 1 (PPV = 59%, p = 0.03) and lentiform lesions were predictive for Reader 2 (PPV = 74%, p = 0.01). Lesions scored as "not meeting PI-RADS 4 criteria" had significantly lower PPV (p = 0.016-0.003; Reader 1 PPV: 14%, Reader 2 PPV: 16%). Peripheral zone PI-RADS 4 lesions with a DWI score of 4 are more likely Gleason 7+ cancer than those with a DWI score of 3. Lesions overcalled as PI-RADS 4 have PPV similar to published PI-RADS 3 data. Lesion shape and peripheral zone sparing in general do not predict Gleason 7+ cancer within PI-RADS 4 observations.

  11. Rates of dinosaur body mass evolution indicate 170 million years of sustained ecological innovation on the avian stem lineage.

    Science.gov (United States)

    Benson, Roger B J; Campione, Nicolás E; Carrano, Matthew T; Mannion, Philip D; Sullivan, Corwin; Upchurch, Paul; Evans, David C

    2014-05-01

    Large-scale adaptive radiations might explain the runaway success of a minority of extant vertebrate clades. This hypothesis predicts, among other things, rapid rates of morphological evolution during the early history of major groups, as lineages invade disparate ecological niches. However, few studies of adaptive radiation have included deep time data, so the links between extant diversity and major extinct radiations are unclear. The intensively studied Mesozoic dinosaur record provides a model system for such investigation, representing an ecologically diverse group that dominated terrestrial ecosystems for 170 million years. Furthermore, with 10,000 species, extant dinosaurs (birds) are the most speciose living tetrapod clade. We assembled composite trees of 614-622 Mesozoic dinosaurs/birds, and a comprehensive body mass dataset using the scaling relationship of limb bone robustness. Maximum-likelihood modelling and the node height test reveal rapid evolutionary rates and a predominance of rapid shifts among size classes in early (Triassic) dinosaurs. This indicates an early burst niche-filling pattern and contrasts with previous studies that favoured gradualistic rates. Subsequently, rates declined in most lineages, which rarely exploited new ecological niches. However, feathered maniraptoran dinosaurs (including Mesozoic birds) sustained rapid evolution from at least the Middle Jurassic, suggesting that these taxa evaded the effects of niche saturation. This indicates that a long evolutionary history of continuing ecological innovation paved the way for a second great radiation of dinosaurs, in birds. We therefore demonstrate links between the predominantly extinct deep time adaptive radiation of non-avian dinosaurs and the phenomenal diversification of birds, via continuing rapid rates of evolution along the phylogenetic stem lineage. This raises the possibility that the uneven distribution of biodiversity results not just from large-scale extrapolation of

  12. Probiotic modulation of the gut bacterial community of juvenile Litopenaeus vannamei challenged with Vibrio parahaemolyticus CAIM 170

    Directory of Open Access Journals (Sweden)

    Irasema E Luis-Villaseñor

    2015-09-01

    Full Text Available The protective effects of two probiotic mixtures was studied using the fingerprints of the bacterial community of Litopenaeus vannamei juveniles exposed to probiotics and challenged with Vibrio parahaemolyticus CAIM 170. Fingerprints were constructed using 16S rRNA gene and the PCR-SSCP (Single strand conformation polymorphism technique, and the probiotics used were an experimental Bacillus mixture (Bacillus tequilensis YC5-2 + B. endophyticus C2-2 and YC3-B and the commercial probiotic Alibio. The DNA for PCR-SSCP analyses was extracted directly from the guts of shrimps treated for 20 days with the probiotics and injected with 2.5*10(5 CFU g-1 of V. parahaemolyticus one week after suspension of the probiotic treatment. Untreated shrimps served as positive (injected with V. parahaemolyticus and negative (not injected controls Analysis of the bacterial community carried out after inoculation and 12 and 48 h later confirmed that V. parahaemolyticus was present in shrimps of the positive control , but not in the negative control or treated with the probiotic mixtures. A significant difference in the diversity of the bacterial community was observed between times after infection. The band patterns in 0-12 h were clustered into a different group from that determined after 48 h, and suggested that during bacterial infection the guts of whiteleg shrimp were dominated by gamma proteobacteria represented by Vibrio sp. and Photobacterium sp. Our results indicate that the experimental and the commercial mixtures are suitable to modulate the bacterial community of L. vannamei and could be used as a probiotic to control vibriosis in juvenile shrimp.

  13. Rates of dinosaur body mass evolution indicate 170 million years of sustained ecological innovation on the avian stem lineage.

    Directory of Open Access Journals (Sweden)

    Roger B J Benson

    2014-05-01

    Full Text Available Large-scale adaptive radiations might explain the runaway success of a minority of extant vertebrate clades. This hypothesis predicts, among other things, rapid rates of morphological evolution during the early history of major groups, as lineages invade disparate ecological niches. However, few studies of adaptive radiation have included deep time data, so the links between extant diversity and major extinct radiations are unclear. The intensively studied Mesozoic dinosaur record provides a model system for such investigation, representing an ecologically diverse group that dominated terrestrial ecosystems for 170 million years. Furthermore, with 10,000 species, extant dinosaurs (birds are the most speciose living tetrapod clade. We assembled composite trees of 614-622 Mesozoic dinosaurs/birds, and a comprehensive body mass dataset using the scaling relationship of limb bone robustness. Maximum-likelihood modelling and the node height test reveal rapid evolutionary rates and a predominance of rapid shifts among size classes in early (Triassic dinosaurs. This indicates an early burst niche-filling pattern and contrasts with previous studies that favoured gradualistic rates. Subsequently, rates declined in most lineages, which rarely exploited new ecological niches. However, feathered maniraptoran dinosaurs (including Mesozoic birds sustained rapid evolution from at least the Middle Jurassic, suggesting that these taxa evaded the effects of niche saturation. This indicates that a long evolutionary history of continuing ecological innovation paved the way for a second great radiation of dinosaurs, in birds. We therefore demonstrate links between the predominantly extinct deep time adaptive radiation of non-avian dinosaurs and the phenomenal diversification of birds, via continuing rapid rates of evolution along the phylogenetic stem lineage. This raises the possibility that the uneven distribution of biodiversity results not just from large

  14. Rates of Dinosaur Body Mass Evolution Indicate 170 Million Years of Sustained Ecological Innovation on the Avian Stem Lineage

    Science.gov (United States)

    Benson, Roger B. J.; Campione, Nicolás E.; Carrano, Matthew T.; Mannion, Philip D.; Sullivan, Corwin; Upchurch, Paul; Evans, David C.

    2014-01-01

    Large-scale adaptive radiations might explain the runaway success of a minority of extant vertebrate clades. This hypothesis predicts, among other things, rapid rates of morphological evolution during the early history of major groups, as lineages invade disparate ecological niches. However, few studies of adaptive radiation have included deep time data, so the links between extant diversity and major extinct radiations are unclear. The intensively studied Mesozoic dinosaur record provides a model system for such investigation, representing an ecologically diverse group that dominated terrestrial ecosystems for 170 million years. Furthermore, with 10,000 species, extant dinosaurs (birds) are the most speciose living tetrapod clade. We assembled composite trees of 614–622 Mesozoic dinosaurs/birds, and a comprehensive body mass dataset using the scaling relationship of limb bone robustness. Maximum-likelihood modelling and the node height test reveal rapid evolutionary rates and a predominance of rapid shifts among size classes in early (Triassic) dinosaurs. This indicates an early burst niche-filling pattern and contrasts with previous studies that favoured gradualistic rates. Subsequently, rates declined in most lineages, which rarely exploited new ecological niches. However, feathered maniraptoran dinosaurs (including Mesozoic birds) sustained rapid evolution from at least the Middle Jurassic, suggesting that these taxa evaded the effects of niche saturation. This indicates that a long evolutionary history of continuing ecological innovation paved the way for a second great radiation of dinosaurs, in birds. We therefore demonstrate links between the predominantly extinct deep time adaptive radiation of non-avian dinosaurs and the phenomenal diversification of birds, via continuing rapid rates of evolution along the phylogenetic stem lineage. This raises the possibility that the uneven distribution of biodiversity results not just from large-scale extrapolation

  15. Activation of serotonin 2A receptors underlies the psilocybin-induced effects on α oscillations, N170 visual-evoked potentials, and visual hallucinations.

    Science.gov (United States)

    Kometer, Michael; Schmidt, André; Jäncke, Lutz; Vollenweider, Franz X

    2013-06-19

    Visual illusions and hallucinations are hallmarks of serotonergic hallucinogen-induced altered states of consciousness. Although the serotonergic hallucinogen psilocybin activates multiple serotonin (5-HT) receptors, recent evidence suggests that activation of 5-HT2A receptors may lead to the formation of visual hallucinations by increasing cortical excitability and altering visual-evoked cortical responses. To address this hypothesis, we assessed the effects of psilocybin (215 μg/kg vs placebo) on both α oscillations that regulate cortical excitability and early visual-evoked P1 and N170 potentials in healthy human subjects. To further disentangle the specific contributions of 5-HT2A receptors, subjects were additionally pretreated with the preferential 5-HT2A receptor antagonist ketanserin (50 mg vs placebo). We found that psilocybin strongly decreased prestimulus parieto-occipital α power values, thus precluding a subsequent stimulus-induced α power decrease. Furthermore, psilocybin strongly decreased N170 potentials associated with the appearance of visual perceptual alterations, including visual hallucinations. All of these effects were blocked by pretreatment with the 5-HT2A antagonist ketanserin, indicating that activation of 5-HT2A receptors by psilocybin profoundly modulates the neurophysiological and phenomenological indices of visual processing. Specifically, activation of 5-HT2A receptors may induce a processing mode in which stimulus-driven cortical excitation is overwhelmed by spontaneous neuronal excitation through the modulation of α oscillations. Furthermore, the observed reduction of N170 visual-evoked potentials may be a key mechanism underlying 5-HT2A receptor-mediated visual hallucinations. This change in N170 potentials may be important not only for psilocybin-induced states but also for understanding acute hallucinatory states seen in psychiatric disorders, such as schizophrenia and Parkinson's disease.

  16. BRP-170 and BRP190 Isoforms of Bruchpilot Protein Differentially Contribute to the Frequency of Synapses and Synaptic Circadian Plasticity in the Visual System of Drosophila

    Directory of Open Access Journals (Sweden)

    Olga eWoznicka

    2015-06-01

    Full Text Available In the first optic neuropil (lamina of the optic lobe of Drosophila melanogaster, two classes of synapses, tetrad and feedback, show daily rhythms in the number and size of presynaptic profiles examined at the level of transmission electron microscopy (TEM. Number of tetrad presynaptic profiles increases twice a day, once in the morning and again in the evening, and their presynaptic ribbons are largest in the evening. In contrast, feedback synapses peak at night. The frequency of synapses is correlated with size of the presynaptic element measured as the platform size of so-called T-bars, with T-bar platforms being largest with increasing synapse frequency. The large scaffold protein Bruchpilot (BRP is a major essential constituent of T-bars, with two major isoforms of 190 and 170 kD forming T-bars of the peripheral NMJ synapses and in the brain. In addition to the analysis of cyclic plasticity of tetrad and feedback synapses in wild-type flies, we used TEM to examine daily changes in the size and distribution of synapses within isoform-specific BRP mutants, expressing BRP-190 (BRP170 or BRP-170 (BRP190 only. We found that the number and circadian plasticity of synapses depends on both isoforms. In the BRP190 lacking BRP-190 there was almost 50% less tetrad synapses demonstrable than when both isoforms were present. The lack of BRP-170 and BRP-190 increased and decreased, respectively the number of feedback synapses, indicating that BRP-190 forms most of the feedback synapses. In both mutants, the daily plasticity of tetrad and feedback presynaptic profiles was abolished, except for feedback synapses in BRP190. The oscillations in the number and size of presynaptic elements seem to depend on a different contribution of BRP isoforms in a presynaptic element at different time during the day and night and at various synapse types. The participation of both BRP isoforms may vary in different classes of synapses.

  17. Early processing of emotional faces in a Go/NoGo task: lack of N170 right-hemispheric specialisation in children with major depression.

    Science.gov (United States)

    Grunewald, Madlen; Stadelmann, Stephanie; Brandeis, Daniel; Jaeger, Sonia; Matuschek, Tina; Weis, Steffi; Kalex, Virgenie; Hiemisch, Andreas; von Klitzing, Kai; Döhnert, Mirko

    2015-09-01

    Emotionally biased information processing towards sad and away from happy information characterises individuals with major depression. To learn more about the nature of these dysfunctional modulations, developmental and neural aspects of emotional face processing have to be considered. By combining measures of performance (attention control, inhibition) in an emotional Go/NoGo task with an event-related potential (ERP) of early face processing (N170), we obtained a multifaceted picture of emotional face processing in a sample of children and adolescents (11-14 years) with major depression (MDD, n = 26) and healthy controls (CTRL, n = 26). Subjects had to respond to emotional faces (fearful, happy or sad) and withhold their response to calm faces or vice versa. Children of the MDD group displayed shorter N170 latencies than children of the CTRL group. Typical right lateralisation of the N170 was observed for all faces in the CTRL but not for happy and calm faces in the MDD group. However, the MDD group did not differ in their behavioural reaction to emotional faces, and effects of interference by emotional information on the reaction to calm faces in this group were notably mild. Although we could not find a typical pattern of emotional bias, the results suggest that alterations in face processing of children with major depression can be seen at early stages of face perception indexed by the N170. The findings call for longitudinal examinations considering effects of development in children with major depression as well as associations to later stages of processing.

  18. The protease inhibitor alpha-2-macroglobulin-like-1 is the p170 antigen recognized by paraneoplastic pemphigus autoantibodies in human.

    Directory of Open Access Journals (Sweden)

    Isabelle Schepens

    Full Text Available BACKGROUND: Paraneoplastic pemphigus (PNP is a devastating autoimmune blistering disease, involving mucocutaneous and internal organs, and associated with underlying neoplasms. PNP is characterized by the production of autoantibodies targeting proteins of the plakin and cadherin families involved in maintenance of cell architecture and tissue cohesion. Nevertheless, the identity of an antigen of Mr 170,000 (p170, thought to be critical in PNP pathogenesis, has remained unknown. METHODOLOGY/PRINCIPAL FINDINGS: Using an immunoprecipitation and mass spectrometry based approach, we identified p170 as alpha-2-macroglobuline-like-1, a broad range protease inhibitor expressed in stratified epithelia and other tissues damaged in the PNP disease course. We demonstrate that 10 PNP sera recognize alpha-2-macroglobuline-like-1 (A2ML1, while none of the control sera obtained from patients with bullous pemphigoid, pemphigus vulgaris, pemphigus foliaceus and normal subjects does. CONCLUSIONS/SIGNIFICANCE: Our study unravels a broad range protease inhibitor as a new class of target antigens in a paraneoplastic autoimmune multiorgan syndrome and opens a new challenging investigation avenue for a better understanding of PNP pathogenesis.

  19. Prolonged QRS duration (QRS >/=170 ms) and left axis deviation in the presence of left bundle branch block: A marker of poor left ventricular systolic function?

    Science.gov (United States)

    Das, M K; Cheriparambil, K; Bedi, A; Kassotis, J; Reddy, C V; Makan, M; Dunbar, C C; Saul, B

    2001-11-01

    Left bundle branch block (LBBB) is commonly associated with structural heart disease and left ventricular dysfunction. We propose that the QRS duration and degree of left-axis deviation (LAD) identify significant left ventricular systolic dysfunction in patients with LBBB. In this prospective study the ejection fraction (EF) of 300 consecutive patients with LBBB was evaluated by echocardiography. The relationship between QRS duration and LAD (axis between -30 degrees and -90 degrees ) and EF were derived. There was no significant difference in age, sex, presence of ischemic or nonischemic cardiomyopathy and valvular heart disease, and EF among the patients with or without LAD. The EF of patients with QRS >/=170 milliseconds with LAD (n = 20) and without LAD (n = 18) was 25% +/- 16% and 23% +/- 13%, respectively (P =.71). The mean EF (24% +/- 10%) of the patients with a QRS duration of >/=170 milliseconds (n = 38) was significantly lower than the mean EF (36% +/- 16%) of the patients with a QRS duration of axis was not significantly correlated with EF and did not have added predictive value. The QRS duration has a significant inverse relationship with EF and prolongation of QRS duration (>/=170 milliseconds) in the presence of LBBB is a marker of significant left ventricular systolic dysfunction. The presence of LAD in LBBB does not signify a further decrease in EF.

  20. Fluorescence ratiometric optical broad range pH sensor based on CdSe/ZnS quantum dots and O170 embedded in ethyl cellulose matrix

    Science.gov (United States)

    Chu, Cheng-Shane; Su, Chih-Jen

    2017-04-01

    This paper presents a ratiometric optical broad range pH sensor that comprises an optical fiber coated at one end with CdSe/ZnS quantum dots (QDs) and Oxazine 170 perchlorate (O170) embedded in ethyl cellulose (EC) matrix. The feasibility of coating an optical fiber with the sensing film to fabricate a ratiometric fiber optic broad range pH sensor is investigated. Using an LED with a central wavelength 405 nm as an excitation light source, the CdSe/ZnS QDs shows that the emission wavelength at 575 nm highly sensitive to pH and O170 shows the emission wavelength at 655 nm insensitive to pH. The ratio of fluorescence intensities at 575 nm and 655 nm has a linear relationship with pH in the 0.9-12.2 range. The ratiometric sensing approach presented in this study has the advantage of suppressing spurious fluctuations in the intensity of the excitation source and optical transmission properties of the optical fiber sensor.

  1. Definition of an electrostatic relay switch critical for the cAMP-dependent activation of protein kinase A as revealed by the D170A mutant of RIalpha.

    Science.gov (United States)

    Abu-Abed, Mona; Das, Rahul; Wang, Lijun; Melacini, Giuseppe

    2007-10-01

    The Regulatory (R) subunit of Protein Kinase A (PKA) inhibits its kinase activity by shielding the Catalytic (C) subunit from physiological substrates. This inhibition is reversed in response to extra-cellular signals that increase cAMP levels in the cytoplasm. Upon cAMP binding to R, C is allosterically released from R, activating a spectrum of downstream signaling cascades. Crystallographic data indicated that a series of distinct conformational changes within CBD-A must occur to relay the cAMP signal from the cAMP binding site to the R:C interaction interface. One critical cAMP relay site within the CBD-A of R has been identified as Asp170 because the D170A mutation selectively reduces the negative cooperativity between the cAMP- and C-recognition sites (i.e. the KD for the R:C complex in the presence of cAMP is reduced by more than 12-fold), without significantly compromising the high affinity of R for both binding partners. Here, utilizing an integrated set of comparative NMR analyses we have elucidated how this critical electrostatic switch is able to control the interaction network which transmits the cAMP signal within CBD-A. The D170A-induced variations in backbone chemical shifts as well as in hydrogen-deuterium and hydrogen-hydrogen exchange profiles show that Asp170 not only plays a pivotal role in controlling the local conformation of the phosphate binding cassette (PBC), where cAMP docks, but also significantly affects the long-range cAMP-dependent interaction network that extends from the PBC to the three major sites of C-recognition. We also found that the D170A mutation promotes partial unfolding, thus assisting the uncoupling of the alpha- and beta-subdomains of CBD-A as required for the major alpha-helical conformational re-arrangement necessary for C-binding. Overall, the emerging map of allosteric networks features Asp170 as an essential component of an electrostatic switch mechanism that stabilizes the conformation of the PBC region for

  2. Influence of education level on design-induced N170 and P300 components of event related potentials in the human brain.

    Science.gov (United States)

    Begum, Tahamina; Reza, Faruque; Ahmed, Izmer; Abdullah, Jafri Malin

    2014-03-01

    Simple geometric and organic shapes and their arrangement are being used in different neuropsychology tests for the assessment of cognitive function, special memory and also for the therapy purpose in different patient groups. Until now there is no electrophysiological evidence of cognitive function determination for simple geometric, organic shapes and their arrangement. Then the main objective of this study is to know the cortical processing and amplitude, latency of visual induced N170 and P300 event related potential components on different geometric, organic shapes and their arrangement and different educational influence on it, which is worthwhile to know for the early and better treatment for those patient groups. While education influenced on cognitive function by using auditory oddball task, little is known about the influence of education on cognitive function induced by visual attention task in case of the choice of geometric, organic shapes and their arrangements. Using a 128-electrode sensor net, we studied the responses of the choice of the different geometric and organic shapes randomly in experiment 1 and their arrangements in experiment 2 in the high, medium and low education groups. In both experiments, subjects push the button "1" or "2" if like or dislike, respectively. Total 45 healthy subjects (15 in each group) were recruited. ERPs were measured from 11 electrode sites and analyzed to see the evoked N170/N240 and P300 ERP components. There were no differences between like and dislike in amplitudes even in latencies in every stimulus in both experiments. We fixed geometric shapes and organic shapes stimuli only, not like and dislike. Upon the stimulus types, N170 ERP component was found instead of N240, in occipito-temporal (T5, T6, O1 and O2) locations where the amplitude is the highest at O2 location and P300 was distributed in the central (Cz and Pz) locations in both experiments in all groups. In experiment 1, significant low amplitude and

  3. Modulation of the N170 with Classical Conditioning: The Use of Emotional Imagery and Acoustic Startle in Healthy and Depressed Participants.

    Science.gov (United States)

    Camfield, David A; Mills, Jessica; Kornfeld, Emma J; Croft, Rodney J

    2016-01-01

    Recent studies have suggested that classical conditioning may be capable of modulating early sensory processing in the human brain, and that there may be differences in the magnitude of the conditioned changes for individuals with major depressive disorder. The effect of conditioning on the N170 event-related potential was investigated using neutral faces as conditioned stimuli (CS+) and emotional imagery and acoustic startle as unconditioned stimuli (UCS). In the first experiment, electroencephalogram was recorded from 24 undergraduate students (M = 21.07 years, SD = 3.38 years) under the following conditions: (i) CS+/aversive imagery, (ii) CS+/aversive imagery and acoustic startle, (iii) CS+/acoustic startle, and (iv) CS+/pleasant imagery. The amplitude of the N170 was enhanced following conditioning with aversive imagery as well as acoustic startle. In the second experiment, 26 healthy control participants were tested (17 females and 9 males, age M = 25.97 years, SD = 9.42) together with 18 depressed participants (13 females and 5 males, age M = 23.26 years, SD = 4.01) and three conditions were used: CS+/aversive imagery, CS+/pleasant imagery, and CS-. N170 amplitude at P7 was increased for the CS+/aversive condition in comparison to CS- in the conditioning blocks versus baseline. No differences between depressed and healthy participants were found. Across both experiments, evaluative conditioning was absent. It was concluded that aversive UCS are capable of modulating early sensory processing of faces, although further research is also warranted in regards to positive UCS.

  4. Heavy rotation – evolution of quadrupole collectivity centred at the neutron-rich doubly mid-shell nucleus {sup 170}Dy

    Energy Technology Data Exchange (ETDEWEB)

    Söderström, P.-A., E-mail: pasoder@ribf.riken.jp; Doornenbal, P.; Nishimura, S.; Baba, H.; Fukuda, N.; Inabe, N.; Isobe, T.; Kubo, T.; Kubono, S.; Suzuki, H.; Takeda, H. [RIKEN Nishina Center, 2-1 Hirosawa, Wako-shi, Saitama 351-0198 (Japan); Regan, P. H. [Department of Physics, University of Surrey, Guildford, GU2 7XH (United Kingdom); National Physical Laboratory, Teddington, Middlesex, TW11 0LW (United Kingdom); Walker, P. M.; Carroll, R.; Lalkovski, S.; Lotay, G.; Patel, Z.; Podolyák, Zs.; Shand, C. M. [Department of Physics, University of Surrey, Guildford, GU2 7XH (United Kingdom); Watanabe, H. [IRCNPC, Beihang University, Beijing 100191 (China); School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); and others

    2015-10-15

    In this contribution the low-excitation structural properties of the doubly mid-shell nucleus {sup 170}Dy are discussed, with a special empasis on the evolution of the ground state rotational band within the dysprosium isotopic chain. Recent results from an experiment with the EURICA setup at RIKEN are shown in the context of previous measurements at the PRISMA+CLARA as well as the PRISMA+AGATA setups at Laboratori Nazionali di Legnaro. A brief outlook on future planned measurements is also given.

  5. A CONVERSÃO DE CONHECIMENTO ATRAVÉS DO “LEARNING BY HIRING” NO PROGRAMA EMBRAER 170/190 [doi: 10.5329/RECADM.20080701008

    Directory of Open Access Journals (Sweden)

    Ricardo Gentil Peixoto da Costa

    2008-05-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 RESUMO Fim da década de 1990. A Embraer prepara-se para lançar um novo programa de aeronaves, denominado Embraer 170/190. Este programa representará um passo importante para a empresa, que almeja, através dele, consolidar sua posição dentre os líderes mundiais  na produção de aeronaves civis a jato e atingir um nicho de mercado ainda inexplorado. Mas a empresa não conta com todas as tecnologias de que necessita, decidindo por buscar no mercado internacional profissionais que lhe aportem as tecnologias de base das quais necessita. Como converter em conhecimento da empresa o conhecimento trazido por estes especialistas internacionais numa indústria de intensivo conhecimento tecnológico? Este artigo, baseado na revisão bibliográfica e no estudo do caso sobre o programa Embraer 170/190, explora a maneira como a Embraer conseguiu vencer este desafio, através da conversão do conhecimento mediante o Aprendizado pela Contratação, Learning by Hiring, colaborando para o estudo acadêmico do tema, em linha com a literatura existente no momento.   Palavras-Chave Conhecimento, EMBRAER, “Learning by Hiring”.     ABSTRACT In the end of the ´90s, Embraer had made its decision to launch a new aircraft program, named Embraer 170/190. This program represented an important challenge for Embraer, because it would place the company among the leaders in civil Aircraft industry, as well as venture into an unexplored market niche.  But the company did not have all the necessary technologies, deciding, then to search the international market for specialists in the fields of knowledge it needed. How can a Brazilian aircraft manufacturer company competing in a knowledge-intensive sector handle this kind of situation? Based on literature review and a case study of the 170/190 program at Embraer this article presents in what manner Embraer manage this challenge converting

  6. Thermally activated transport and vortex-glass phase transition of {{\\rm{K}}}_{0.78}Fe{}_{1.70}Se2 single crystals

    Science.gov (United States)

    Yu, Yi; Wang, Chunchang; Li, Qiuju; Wang, Hong; Zhang, Changjin

    2017-08-01

    The transport property (ρ -T) and flux motion together with the superconductivity of {{{K}}}0.78 Fe{}1.70 Se2 single crystals are studied. In the transport measurement, contrasting behavior is observed under two different magnetic field orientations, i.e., {{{H}}}//c-{{axis}} and {{{H}}}\\perp c-{{axis}}, which is ascribed to different vortex configurations. In the flux motion study, the tail of the ρ -T well fits the description of the vortex-glass (VG) critical behavior, which is confirmed by VG scaling. The strong pinning nature of {{{K}}}0.78Fe{}1.70Se2 implies great sustainability under high magnetic fields and the potential for practical application of the system. The ρ -T relation under T c follows Arrhenius thermally activated flux flow (TAFF) behavior. The existence of a crossover behavior in a magnetic field is discovered via the magnetic dependence of the effective pinning barrier, which is related to the change in pinning strength of the point defects and the entanglements of the flux lines. Finally, a vortex phase diagram is proposed based on the evolution of upper critical field and other dynamic characteristics.

  7. Coherent Bremsstrahlung, Coherent Pair Production, Birefringence and Polarimetry in the 20-170 GeV energy range using aligned crystals

    CERN Document Server

    Apyan, A; Badelek, B; Ballestrero, S; Biino, C; Birol, I; Cenci, P; Connell, S H; Eichblatt, S; Fonseca, T; Freund, A; Gorini, B; Groess, R; Ispirian, K; Ketel, T; Kononets, Y V; López, A; Mangiarotti, A; Sellschop, J P Friedel; Shieh, M; Sona, P; Strakhovenko, V M; Uggerhøj, U; Uggerhøj, Erik; Van Rens, B; Velasco, M; Vilakazi, Z Z; Wessely, O; Ünel, G; Kononets, Yu V

    2008-01-01

    The processes of coherent bremsstrahlung (CB) and coherent pair production (CPP) based on aligned crystal targets have been studied in the energy range 20-170 GeV. The experimental arrangement allowed these phenomena as well as their polarization dependence to be evaluated under conditions where single-photon cross-sections could be measured. This proved very important as the theoretical description of CB and CPP is an area of active theoretical debate and development. The theoretical approach used in this paper predicts both the cross sections and polarization observables very well for the experimental conditions investigated, indicating that the understanding of CB and CPP is reliable up to energies of 170 GeV. A birefringence effect in CPP was studied and it was demonstrated this enabled new technologies for high energy photon beam optics, such as polarimeters (for both linear and circular polarization) and phase plates. We also present new results regarding the features of coherent high energy photon emis...

  8. Molluscum contagiosum: to treat or not to treat? Experience with 170 children in an outpatient clinic setting in the northeastern United States.

    Science.gov (United States)

    Basdag, Hatice; Rainer, Barbara M; Cohen, Bernard A

    2015-01-01

    Despite the high prevalence of molluscum contagiosum (MC) in children, epidemiologic data on this common self-limited viral infection is limited. In this report we review our experience with the demographic characteristics, clinical characteristics, management, and time to resolution of MC in 170 children. A retrospective medical chart review and telephone survey were conducted on children younger than 16 years of age evaluated for MC in the Division of Pediatric Dermatology at the Johns Hopkins Children's Center, Baltimore, Maryland, from January 1, 2008, to December 31, 2011. Of 170 children with MC, 51.8% were female and 77.1% were Caucasian. The median age at diagnosis was 5 years and 46.5% had a history of atopic dermatitis (AD). Children with AD had significantly more MC lesions than those without (p children did not receive any treatment. MC lesions completely cleared within 12 months in 45.6% of treated and 48.4% of untreated children and within 18 months in 69.5% of treated and 72.6% of untreated children. Treatment (if any), sex, race, diagnosing physician, number of lesions at diagnosis, number of anatomic locations, or history of AD did not predict time to resolution of MC lesions. MC lesions completely resolved in approximately 50% of children within 12 months and in 70% within 18 months. Treatment did not shorten the time to resolution. © 2015 Wiley Periodicals, Inc.

  9. Imaging hypoxia in tumors using a new {sup 18}F-labeled 2-nitroimidazole analog, [{sup 18}F]FRP-170

    Energy Technology Data Exchange (ETDEWEB)

    Takai, Yoshihiro; Kaneta, Tomohiro; Umezu, Atsushi [Tohoku Univ., Sendai (Japan). School of Medicine] (and others)

    2001-01-01

    A purpose of this study is to investigate the potential of the new [{sup 18}F] labeled 2-nitroimidazole analog: [{sup 18}F]ERP-170 as a new radiopharmaceutical for detecting tumor hypoxia by PET. To assess the in vivo biodistribution, syngenic WHT/Ht albino mice bearing the squamous cell carcinoma (sqcc) or fibrosarcoma were used. The tumor-to-blood ratios were 1.97 (1.36-2.9) for sqcc and 2.50 (1.72-3.60) for fibrosarcoma at 120 min after [{sup 18}F]FRP-17 injection. Double-tracer autoradiographs revealed that the distribution of [{sup 18}F]FRP-170 was just reversed to the distribution of [{sup 14}C]IAP. This means that the uptake of [{sup 18}F]FRP-17 occurs in the region of low blood flow. We conclude from these data that [{sup 18}F]FRP-17 is a promising new hypoxia tracer in patients. (author)

  10. Flow sheet at Lu-Op plant for auto gasoline for 170/sup 0/ E. P. gasoline for DHD from bituminous coal

    Energy Technology Data Exchange (ETDEWEB)

    1942-11-02

    Several tables with varied information concerning gasoline production are presented. The first table concerned the 700 atm liquid phase running to produce: (1) gasoline and middle oil or (2) 32% heavy oil excess. This gave information such as the rate of primary crusing, drying, paste milling and pressing, gas circulation, oil washing, compression, centrifuge plant operations, kiln plant operations, cold catchpot products, and yields. It also gave stall sizes. The second and third charts contained information for the 300 atm and 700 atm vapor phase processes with subdivisions for auto gasoline and 170/sup 0/C endpoint gasoline. It showed rates for injection pumps, gas circulation, compression, yield from columns, L.P.G. production, gasoline stabilization and wash, hydrogenation gas production with 95% recovery, percent of aromatic recovery, and total hydrogen consumption. The fourth chart concerned hydrogen production for the Lu-Op plant from bituminous coal. The first major category was coke with subcategories of DHD gasoline in the 700 atm vapor phase system and in the 300 atm vapor phase system. The second category was hydrogenation gas splitting with the same subcategories as above. A table of power requirements for 170/sup 0/C endpoint gasoline including the liquid phase and hydrogen production for 300 atm and 700 atm vapor phase processes is included. 5 tables

  11. Search for Unstable Heavy and Excited Leptons in $e^+ e^-$ Collisions at $\\sqrt{s}$ = 170-172 GeV

    CERN Document Server

    Ackerstaff, K; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Beeston, C; Behnke, T; Bell, A N; Bell, K W; Bella, G; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bloomer, J E; Bobinski, M; Bock, P; Bonacorsi, D; Boutemeur, M; Bouwens, B T; Braibant, S; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Clarke, P E L; Cohen, I; Conboy, J E; Cooke, O C; Cuffiani, M; Dado, S; Dallapiccola, C; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; Desch, Klaus; Dienes, B; Dixit, M S; do Couto e Silva, E; Doucet, M; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Edwards, J E G; Estabrooks, P G; Evans, H G; Evans, M; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fischer, H M; Fleck, I; Folman, R; Fong, D G; Foucher, M; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Geddes, N I; Geich-Gimbel, C; Geralis, T; Giacomelli, G; Giacomelli, P; Giacomelli, R; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Goodrick, M J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hajdu, C; Hanson, G G; Hansroul, M; Hapke, M; Hargrove, C K; Hart, P A; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Hutchcroft, D E; Igo-Kemenes, P; Imrie, D C; Ingram, M R; Ishii, K; Jawahery, A; Jeffreys, P W; Jeremie, H; Jimack, Martin Paul; Joly, A; Jones, C R; Jones, G; Jones, M; Jost, U; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kirk, J; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kress, T; Krieger, P; Von Krogh, J; Kyberd, P; Lafferty, G D; Lahmann, R; Lai, W P; Lanske, D; Lauber, J; Lautenschlager, S R; Layter, J G; Lazic, D; Lee, A M; Lefebvre, E; Lellouch, Daniel; Letts, J; Levinson, L; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Macchiolo, A; MacPherson, A L; Mannelli, M; Marcellini, S; Markus, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mikenberg, G; Miller, D J; Mincer, A; Mir, R; Mohr, W; Montanari, A; Mori, T; Morii, M; Müller, U; Mihara, S; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oh, A; Oldershaw, N J; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pearce, M J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, J L; Plane, D E; Poffenberger, P R; Poli, B; Posthaus, A; Rees, D L; Rigby, D; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Rooke, A M; Ros, E; Rossi, A M; Routenburg, P; Rozen, Y; Runge, K; Runólfsson, O; Ruppel, U; Rust, D R; Rylko, R; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schenk, P; Schieck, J; Schleper, P; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schultz-Coulon, H C; Schumacher, M; Schwick, C; Scott, W G; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skillman, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Springer, R W; Sproston, M; Stephens, K; Steuerer, J; Stockhausen, B; Stoll, K; Strom, D; Szymanski, P; Tafirout, R; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Utzat, P; Van Kooten, R; Verzocchi, M; Vikas, P; Vokurka, E H; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilkens, B; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D

    1998-01-01

    We have searched for unstable neutral and charged heavy leptons, N and L^+/-, and for excited states of neutral and charged leptons, nu*, e*, mu* and tau*, in e^+e^- collisions at centre-of-mass energies of 170 and 172 GeV using the OPAL detector at LEP. No evidence for their existence was found. From the analysis of charged-current decays of pair-produced unstable heavy leptons, and of charged-current and photonic decays of pair-produced excited leptons, lower limits on their masses are derived. From the analysis of charged-current and photonic decays of singly-produced excited leptons, upper limits on the ratio of the coupling to the compositeness scale, f/Lambda, are determined for masses up to the kinematic limit.

  12. Breast cancer risk variants at 6q25 display different phenotype associations and regulate ESR1, RMND1 and CCDC170

    Science.gov (United States)

    Dunning, Alison M; Michailidou, Kyriaki; Kuchenbaecker, Karoline B; Thompson, Deborah; French, Juliet D; Beesley, Jonathan; Healey, Catherine S; Kar, Siddhartha; Pooley, Karen A; Lopez-Knowles, Elena; Dicks, Ed; Barrowdale, Daniel; Sinnott-Armstrong, Nicholas A; Sallari, Richard C; Hillman, Kristine M; Kaufmann, Susanne; Sivakumaran, Haran; Marjaneh, Mahdi Moradi; Lee, Jason S; Hills, Margaret; Jarosz, Monika; Drury, Suzie; Canisius, Sander; Bolla, Manjeet K; Dennis, Joe; Wang, Qin; Hopper, John L; Southey, Melissa C; Broeks, Annegien; Schmidt, Marjanka K; Lophatananon, Artitaya; Muir, Kenneth; Beckmann, Matthias W; Fasching, Peter A; dos-Santos-Silva, Isabel; Peto, Julian; Sawyer, Elinor J; Tomlinson, Ian; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E; Flyger, Henrik; González-Neira, Anna; Perez, Jose I A; Anton-Culver, Hoda; Eunjung, Lee; Arndt, Volker; Brenner, Hermann; Meindl, Alfons; Schmutzler, Rita K; Brauch, Hiltrud; Hamann, Ute; Aittomäki, Kristiina; Blomqvist, Carl; Ito, Hidemi; Matsuo, Keitaro; Bogdanova, Natasha; Dörk, Thilo; Lindblom, Annika; Margolin, Sara; Kosma, Veli-Matti; Mannermaa, Arto; Tseng, Chiu-chen; Wu, Anna H; Lambrechts, Diether; Wildiers, Hans; Chang-Claude, Jenny; Rudolph, Anja; Peterlongo, Paolo; Radice, Paolo; Olson, Janet E; Giles, Graham G; Milne, Roger L; Haiman, Christopher A; Henderson, Brian E; Goldberg, Mark S; Teo, Soo H; Yip, Cheng Har; Nord, Silje; Borresen-Dale, Anne-Lise; Kristensen, Vessela; Long, Jirong; Zheng, Wei; Pylkäs, Katri; Winqvist, Robert; Andrulis, Irene L; Knight, Julia A; Devilee, Peter; Seynaeve, Caroline; Figueroa, Jonine; Sherman, Mark E; Czene, Kamila; Darabi, Hatef; Hollestelle, Antoinette; van den Ouweland, Ans M W; Humphreys, Keith; Gao, Yu-Tang; Shu, Xiao-Ou; Cox, Angela; Cross, Simon S; Blot, William; Cai, Qiuyin; Ghoussaini, Maya; Perkins, Barbara J; Shah, Mitul; Choi, Ji-Yeob; Kang, Daehee; Lee, Soo Chin; Hartman, Mikael; Kabisch, Maria; Torres, Diana; Jakubowska, Anna; Lubinski, Jan; Brennan, Paul; Sangrajrang, Suleeporn; Ambrosone, Christine B; Toland, Amanda E; Shen, Chen-Yang; Wu, Pei-Ei; Orr, Nick; Swerdlow, Anthony; McGuffog, Lesley; Healey, Sue; Lee, Andrew; Kapuscinski, Miroslav; John, Esther M; Terry, Mary Beth; Daly, Mary B; Goldgar, David E; Buys, Saundra S; Janavicius, Ramunas; Tihomirova, Laima; Tung, Nadine; Dorfling, Cecilia M; van Rensburg, Elizabeth J; Neuhausen, Susan L; Ejlertsen, Bent; Hansen, Thomas V O; Osorio, Ana; Benitez, Javier; Rando, Rachel; Weitzel, Jeffrey N; Bonanni, Bernardo; Peissel, Bernard; Manoukian, Siranoush; Papi, Laura; Ottini, Laura; Konstantopoulou, Irene; Apostolou, Paraskevi; Garber, Judy; Rashid, Muhammad Usman; Frost, Debra; Izatt, Louise; Ellis, Steve; Godwin, Andrew K; Arnold, Norbert; Niederacher, Dieter; Rhiem, Kerstin; Bogdanova-Markov, Nadja; Sagne, Charlotte; Stoppa-Lyonnet, Dominique; Damiola, Francesca; Sinilnikova, Olga M; Mazoyer, Sylvie; Isaacs, Claudine; Claes, Kathleen B M; De Leeneer, Kim; de la Hoya, Miguel; Caldes, Trinidad; Nevanlinna, Heli; Khan, Sofia; Mensenkamp, Arjen R; Hooning, Maartje J; Rookus, Matti A; Kwong, Ava; Olah, Edith; Diez, Orland; Brunet, Joan; Pujana, Miquel Angel; Gronwald, Jacek; Huzarski, Tomasz; Barkardottir, Rosa B; Laframboise, Rachel; Soucy, Penny; Montagna, Marco; Agata, Simona; Teixeira, Manuel R; Park, Sue Kyung; Lindor, Noralane; Couch, Fergus J; Tischkowitz, Marc; Foretova, Lenka; Vijai, Joseph; Offit, Kenneth; Singer, Christian F; Rappaport, Christine; Phelan, Catherine M; Greene, Mark H; Mai, Phuong L; Rennert, Gad; Imyanitov, Evgeny N; Hulick, Peter J; Phillips, Kelly-Anne; Piedmonte, Marion; Mulligan, Anna Marie; Glendon, Gord; Bojesen, Anders; Thomassen, Mads; Caligo, Maria A; Yoon, Sook-Yee; Friedman, Eitan; Laitman, Yael; Borg, Ake; von Wachenfeldt, Anna; Ehrencrona, Hans; Rantala, Johanna; Olopade, Olufunmilayo I; Ganz, Patricia A; Nussbaum, Robert L; Gayther, Simon A; Nathanson, Katherine L; Domchek, Susan M; Arun, Banu K; Mitchell, Gillian; Karlan, Beth Y; Lester, Jenny; Maskarinec, Gertraud; Woolcott, Christy; Scott, Christopher; Stone, Jennifer; Apicella, Carmel; Tamimi, Rulla; Luben, Robert; Khaw, Kay-Tee; Helland, Åslaug; Haakensen, Vilde; Dowsett, Mitch; Pharoah, Paul D P; Simard, Jacques; Hall, Per; García-Closas, Montserrat; Vachon, Celine; Chenevix-Trench, Georgia; Antoniou, Antonis C; Easton, Douglas F; Edwards, Stacey L

    2016-01-01

    We analyzed 3,872 common genetic variants across the ESR1 locus (encoding estrogen receptor α) in 118,816 subjects from three international consortia. We found evidence for at least five independent causal variants, each associated with different phenotype sets, including estrogen receptor (ER+ or ER−) and human ERBB2 (HER2+ or HER2−) tumor subtypes, mammographic density and tumor grade. The best candidate causal variants for ER− tumors lie in four separate enhancer elements, and their risk alleles reduce expression of ESR1, RMND1 and CCDC170, whereas the risk alleles of the strongest candidates for the remaining independent causal variant disrupt a silencer element and putatively increase ESR1 and RMND1 expression. PMID:26928228

  13. Administration of 5% human serum albumin in critically ill small animal patients with hypoalbuminemia: 418 dogs and 170 cats (1994-2008).

    Science.gov (United States)

    Viganó, Fabio; Perissinotto, Linda; Bosco, Valentina R F

    2010-04-01

    To describe the administration of 5% human serum albumin (HSA) in 588 critically ill hypoalbuminemic dogs and cats, and report outcome to discharge, changes in albumin concentration, and adverse effects during hospitalization. Retrospective clinical study. Private emergency and general veterinary center. Client-owned dogs and cats. None. The medical records of 588 critically ill hypoalbuminemic animals (418 dogs and 170 cats) were reviewed. All animals had hypoalbuminemia (serum albuminanimal. In this study, administration of 5% HSA appeared to be safe in a large group of critically ill, hypoalbuminemic dogs and cats. The results should be interpreted with caution due to the retrospective, descriptive nature of the study, the absence of control groups and the lack of follow-up data, as well as the potentially life-threatening complications of HSA administration.

  14. Breast cancer risk variants at 6q25 display different phenotype associations and regulate ESR1, RMND1 and CCDC170.

    Science.gov (United States)

    Dunning, Alison M; Michailidou, Kyriaki; Kuchenbaecker, Karoline B; Thompson, Deborah; French, Juliet D; Beesley, Jonathan; Healey, Catherine S; Kar, Siddhartha; Pooley, Karen A; Lopez-Knowles, Elena; Dicks, Ed; Barrowdale, Daniel; Sinnott-Armstrong, Nicholas A; Sallari, Richard C; Hillman, Kristine M; Kaufmann, Susanne; Sivakumaran, Haran; Moradi Marjaneh, Mahdi; Lee, Jason S; Hills, Margaret; Jarosz, Monika; Drury, Suzie; Canisius, Sander; Bolla, Manjeet K; Dennis, Joe; Wang, Qin; Hopper, John L; Southey, Melissa C; Broeks, Annegien; Schmidt, Marjanka K; Lophatananon, Artitaya; Muir, Kenneth; Beckmann, Matthias W; Fasching, Peter A; Dos-Santos-Silva, Isabel; Peto, Julian; Sawyer, Elinor J; Tomlinson, Ian; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E; Flyger, Henrik; González-Neira, Anna; Perez, Jose I A; Anton-Culver, Hoda; Eunjung, Lee; Arndt, Volker; Brenner, Hermann; Meindl, Alfons; Schmutzler, Rita K; Brauch, Hiltrud; Hamann, Ute; Aittomäki, Kristiina; Blomqvist, Carl; Ito, Hidemi; Matsuo, Keitaro; Bogdanova, Natasha; Dörk, Thilo; Lindblom, Annika; Margolin, Sara; Kosma, Veli-Matti; Mannermaa, Arto; Tseng, Chiu-Chen; Wu, Anna H; Lambrechts, Diether; Wildiers, Hans; Chang-Claude, Jenny; Rudolph, Anja; Peterlongo, Paolo; Radice, Paolo; Olson, Janet E; Giles, Graham G; Milne, Roger L; Haiman, Christopher A; Henderson, Brian E; Goldberg, Mark S; Teo, Soo H; Yip, Cheng Har; Nord, Silje; Borresen-Dale, Anne-Lise; Kristensen, Vessela; Long, Jirong; Zheng, Wei; Pylkäs, Katri; Winqvist, Robert; Andrulis, Irene L; Knight, Julia A; Devilee, Peter; Seynaeve, Caroline; Figueroa, Jonine; Sherman, Mark E; Czene, Kamila; Darabi, Hatef; Hollestelle, Antoinette; van den Ouweland, Ans M W; Humphreys, Keith; Gao, Yu-Tang; Shu, Xiao-Ou; Cox, Angela; Cross, Simon S; Blot, William; Cai, Qiuyin; Ghoussaini, Maya; Perkins, Barbara J; Shah, Mitul; Choi, Ji-Yeob; Kang, Daehee; Lee, Soo Chin; Hartman, Mikael; Kabisch, Maria; Torres, Diana; Jakubowska, Anna; Lubinski, Jan; Brennan, Paul; Sangrajrang, Suleeporn; Ambrosone, Christine B; Toland, Amanda E; Shen, Chen-Yang; Wu, Pei-Ei; Orr, Nick; Swerdlow, Anthony; McGuffog, Lesley; Healey, Sue; Lee, Andrew; Kapuscinski, Miroslav; John, Esther M; Terry, Mary Beth; Daly, Mary B; Goldgar, David E; Buys, Saundra S; Janavicius, Ramunas; Tihomirova, Laima; Tung, Nadine; Dorfling, Cecilia M; van Rensburg, Elizabeth J; Neuhausen, Susan L; Ejlertsen, Bent; Hansen, Thomas V O; Osorio, Ana; Benitez, Javier; Rando, Rachel; Weitzel, Jeffrey N; Bonanni, Bernardo; Peissel, Bernard; Manoukian, Siranoush; Papi, Laura; Ottini, Laura; Konstantopoulou, Irene; Apostolou, Paraskevi; Garber, Judy; Rashid, Muhammad Usman; Frost, Debra; Izatt, Louise; Ellis, Steve; Godwin, Andrew K; Arnold, Norbert; Niederacher, Dieter; Rhiem, Kerstin; Bogdanova-Markov, Nadja; Sagne, Charlotte; Stoppa-Lyonnet, Dominique; Damiola, Francesca; Sinilnikova, Olga M; Mazoyer, Sylvie; Isaacs, Claudine; Claes, Kathleen B M; De Leeneer, Kim; de la Hoya, Miguel; Caldes, Trinidad; Nevanlinna, Heli; Khan, Sofia; Mensenkamp, Arjen R; Hooning, Maartje J; Rookus, Matti A; Kwong, Ava; Olah, Edith; Diez, Orland; Brunet, Joan; Pujana, Miquel Angel; Gronwald, Jacek; Huzarski, Tomasz; Barkardottir, Rosa B; Laframboise, Rachel; Soucy, Penny; Montagna, Marco; Agata, Simona; Teixeira, Manuel R; Park, Sue Kyung; Lindor, Noralane; Couch, Fergus J; Tischkowitz, Marc; Foretova, Lenka; Vijai, Joseph; Offit, Kenneth; Singer, Christian F; Rappaport, Christine; Phelan, Catherine M; Greene, Mark H; Mai, Phuong L; Rennert, Gad; Imyanitov, Evgeny N; Hulick, Peter J; Phillips, Kelly-Anne; Piedmonte, Marion; Mulligan, Anna Marie; Glendon, Gord; Bojesen, Anders; Thomassen, Mads; Caligo, Maria A; Yoon, Sook-Yee; Friedman, Eitan; Laitman, Yael; Borg, Ake; von Wachenfeldt, Anna; Ehrencrona, Hans; Rantala, Johanna; Olopade, Olufunmilayo I; Ganz, Patricia A; Nussbaum, Robert L; Gayther, Simon A; Nathanson, Katherine L; Domchek, Susan M; Arun, Banu K; Mitchell, Gillian; Karlan, Beth Y; Lester, Jenny; Maskarinec, Gertraud; Woolcott, Christy; Scott, Christopher; Stone, Jennifer; Apicella, Carmel; Tamimi, Rulla; Luben, Robert; Khaw, Kay-Tee; Helland, Åslaug; Haakensen, Vilde; Dowsett, Mitch; Pharoah, Paul D P; Simard, Jacques; Hall, Per; García-Closas, Montserrat; Vachon, Celine; Chenevix-Trench, Georgia; Antoniou, Antonis C; Easton, Douglas F; Edwards, Stacey L

    2016-04-01

    We analyzed 3,872 common genetic variants across the ESR1 locus (encoding estrogen receptor α) in 118,816 subjects from three international consortia. We found evidence for at least five independent causal variants, each associated with different phenotype sets, including estrogen receptor (ER(+) or ER(-)) and human ERBB2 (HER2(+) or HER2(-)) tumor subtypes, mammographic density and tumor grade. The best candidate causal variants for ER(-) tumors lie in four separate enhancer elements, and their risk alleles reduce expression of ESR1, RMND1 and CCDC170, whereas the risk alleles of the strongest candidates for the remaining independent causal variant disrupt a silencer element and putatively increase ESR1 and RMND1 expression.

  15. Inelastic scattering of neutrons by spin waves in terbium

    DEFF Research Database (Denmark)

    Bjerrum Møller, Hans; Houmann, Jens Christian Gylden

    1966-01-01

    Measurements of spin-wave dispersion relations for magnons propagating in symmetry directions in ferromagnetic Tb; it is first experiment to give detailed information on magnetic excitations in heavy rare earths; Tb was chosen for these measurements because it is one of few rare-earth metals whic...... does not have very high thermal-neutron capture cross section, so that inelastic neutron scattering experiments can give satisfactory information on magnon dispersion relations....

  16. Coherent magnetic structures in terbium/holmium superlattices

    DEFF Research Database (Denmark)

    Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

    1997-01-01

    Neutron-scattering techniques have been used to investigate the magnetic properties of three Tb/Ho superlattices grown by molecular-beam epitaxy. It is revealed that for temperatures in the range T = 10 to T-N(Ho)approximate to 130 K, there is a basal-plane ferromagnetic alignment of Tb moments w...

  17. Optical Property Retention Methods for the T-170M Space Telescope Mirrors Surface in the Project «Spektr-UF» at the Preflight Preparation Stage

    Directory of Open Access Journals (Sweden)

    F L. Chubarov

    2017-01-01

    Full Text Available Astrophysical observations in the ultraviolet band have many advantages. At present, the «Spektr-UF» project is under implementation to create a large space observatory for operation in the ultraviolet spectrum.Requirements for the ultraviolet telescope optics quality are extremely high. Therefore, both to manufacture such a large space telescope as the T-170M and to transport it to the launch complex are rather difficult challenges in terms of technology.When manufacturing optical elements of the telescope T-170M, a combination of Al+MgF2 coatings has been preferred. At the same time, atmospheric oxygen penetrates through the pores in the magnesium fluoride, thereby forming a Al2O3 oxide layer on the sputtered aluminum, which significantly degrades the UV reflectivity of the mirror surface. It is also necessary to fulfill the requirements for surface cleanliness of optical system elements of the telescope during the finished product transportation and its storage and to provide for the autonomous operation of the system that maintains atmosphere control.To solve the set tasks:1    a dust-proof-and-moisture-proof sheath (DPAMPS was designed to prevent the optical system mirror surfaces of the telescope from coming in contact with atmosphere;2    to provide a controlled atmosphere inside the DPAMPS the need is justified to blow gaseous nitrogen of special purity (grade 1 in accordance with GOST 9293-74 with a dew point temperature of -50°С, at most, inside the telescope; calculations have proved that charging with the super-atmospheric pressure of 10 kPa provides the optimal conditions for maintaining the optical properties of the space telescope mirrors surface, and also minimizes the loads on the easily damaging elements of the telescope;3    to ensure the required cleanliness of the optical system elements surfaces of the telescope inside the DPAMPS, a class of purity Class 7 ISO, at worst, is established in accordance with GOST

  18. Ligation of D1-His332 and D1-Asp170 to the Manganese Cluster of Photosystem II from Synechocystis Assessed by Multifrequency Pulse EPR Spectroscopy†**

    Science.gov (United States)

    Stich, Troy A.; Yeagle, Gregory J.; Service, Rachel J.; Debus, Richard J.; Britt, R. David

    2012-01-01

    Multifrequency electron-spin echo envelope modulation (ESEEM) spectroscopy is used to ascertain the nature of the bonding interactions of various active site amino acids with the Mn ions that compose the oxygen-evolving cluster (OEC) in photosystem II (PSII) from the cyanobacterium Synechocystis sp. PCC 6803 poised in the S2 state. Spectra of natural isotopic abundance PSII (14N-PSII), uniformly 15N-labeled PSII (15N-PSII), as well as 15N-PSII containing 14N-histidine (14N-His/15N-PSII) are compared. These complementary data sets allow for a precise determination of the spin Hamiltonian parameters of the postulated histidine nitrogen interaction with the Mn ions of the OEC. These results are compared to those from a similar study on PSII isolated from spinach. Upon mutation of His332 of the D1 polypeptide to a glutamate residue, all isotopically sensitive spectral features vanish. Additional Ka- and Q-band ESEEM experiments on the D1-D170H site-directed mutant give no indication of new 14N-based interactions. PMID:21790179

  19. Ligation of D1-His332 and D1-Asp170 to the manganese cluster of photosystem II from Synechocystis assessed by multifrequency pulse EPR spectroscopy.

    Science.gov (United States)

    Stich, Troy A; Yeagle, Gregory J; Service, Rachel J; Debus, Richard J; Britt, R David

    2011-08-30

    Multifrequency electron spin-echo envelope modulation (ESEEM) spectroscopy is used to ascertain the nature of the bonding interactions of various active site amino acids with the Mn ions that compose the oxygen-evolving cluster (OEC) in photosystem II (PSII) from the cyanobacterium Synechocystis sp. PCC 6803 poised in the S(2) state. Spectra of natural isotopic abundance PSII ((14)N-PSII), uniformly (15)N-labeled PSII ((15)N-PSII), and (15)N-PSII containing (14)N-histidine ((14)N-His/(15)N-PSII) are compared. These complementary data sets allow for a precise determination of the spin Hamiltonian parameters of the postulated histidine nitrogen interaction with the Mn ions of the OEC. These results are compared to those from a similar study on PSII isolated from spinach. Upon mutation of His332 of the D1 polypeptide to a glutamate residue, all isotopically sensitive spectral features vanish. Additional K(a)- and Q-band ESEEM experiments on the D1-D170H site-directed mutant give no indication of new (14)N-based interactions.

  20. Protection of hamsters from amebic liver abscess formation by immunization with the 150- and 170-kDa surface antigens of Entamoeba histolytica.

    Science.gov (United States)

    Cheng, X J; Tachibana, H

    2001-02-01

    A monoclonal antibody, EH3015, prevents in vitro adherence of Entamoeba histolytica trophozoites to mammalian cells and inhibits amebic liver abscess formation in hamsters. By immunoaffinity chromatography with the monoclonal antibody, purified E. histolytica antigens with molecular masses of 150 and 170 kDa under non-reduced conditions were obtained. Hamsters were immunized with these antigens (group I) or with fractions further purified by polyacrylamide gel electrophoresis (group II). Pooled immune sera from the two groups inhibited in vitro amebic adherence to Chinese hamster ovary cells by 98% at 1:10 dilutions. The immunized hamsters were challenged by the intrahepatic injection of E. histolytica trophozoites. Complete protection from abscess formation was observed in 38% of hamsters in group I and 67% in group II, whereas all control hamsters inoculated only with adjuvant developed amebic liver abscesses. In the immunized hamsters, the abscesses in the two groups were significantly smaller than in the controls. These results demonstrate that the E. histolytica antigens are possible vaccine candidates for amebiasis.

  1. Lactobacillus backii and Pediococcus damnosus isolated from 170-year-old beer recovered from a shipwreck lack the metabolic activities required to grow in modern lager beer.

    Science.gov (United States)

    Kajala, Ilkka; Bergsveinson, Jordyn; Friesen, Vanessa; Redekop, Anna; Juvonen, Riikka; Storgårds, Erna; Ziola, Barry

    2017-11-08

    In 2010, bottles of beer containing viable bacteria of the common beer-spoilage species Lactobacillus backii and Pediococcus damnosus were recovered from a shipwreck near the Åland Islands, Finland. The 170-year quiescent state maintained by the shipwreck bacteria presented a unique opportunity to study lactic acid bacteria (LAB) evolution vis a vis growth and survival in the beer environment. Three shipwreck bacteria (one L. backii strain and two P. damnosus strains) and modern-day beer-spoilage isolates of the same two species were genome sequenced, characterized for hop iso-α-acid tolerance, and growth in degassed lager and wheat beer. In addition, plasmid variants of the modern-day P. damnosus strain were analyzed for the effect of plasmid-encoded genes on growth in lager beer. Coding content on two plasmids was identified as essential for LAB growth in modern lager beer. Three chromosomal regions containing genes related to sugar transport and cell wall polysaccharides were shared by pediococci able to grow in beer. Our results show that the three shipwreck bacteria lack the necessary plasmid-located genetic content to grow in modern lager beer, but carry additional genes related to acid tolerance and biofilm formation compared to their modern counterparts. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. A Pilot Genome-Wide Association Study in Postmenopausal Mexican-Mestizo Women Implicates the RMND1/CCDC170 Locus Is Associated with Bone Mineral Density

    Directory of Open Access Journals (Sweden)

    Marisela Villalobos-Comparán

    2017-01-01

    Full Text Available To identify genetic variants influencing bone mineral density (BMD in the Mexican-Mestizo population, we performed a GWAS for femoral neck (FN and lumbar spine (LS in Mexican-Mestizo postmenopausal women. In the discovery sample, 300,000 SNPs were genotyped in a cohort of 411 postmenopausal women and seven SNPs were analyzed in the replication cohort (n=420. The combined results of a meta-analysis from the discovery and replication samples identified two loci, RMND1 (rs6904364, P=2.77×10−4 and CCDC170 (rs17081341, P=1.62×10−5, associated with FN BMD. We also compared our results with those of the Genetic Factors for Osteoporosis (GEFOS Consortium meta-analysis. The comparison revealed two loci previously reported in the GEFOS meta-analysis: SOX6 (rs7128738 and PKDCC (rs11887431 associated with FN and LS BMD, respectively, in our study population. Interestingly, rs17081341 rare in Caucasians (minor allele frequency < 0.03 was found in high frequency in our population, which suggests that this association could be specific to non-Caucasian populations. In conclusion, the first pilot Mexican GWA study of BMD confirmed previously identified loci and also demonstrated the importance of studying variability in diverse populations and/or specific populations.

  3. Breakup of 8B on 58Ni at energies around the Coulomb barrier and the astrophysical S17(0 factor revisited

    Directory of Open Access Journals (Sweden)

    Morales-Rivera J.C.

    2017-01-01

    Full Text Available Calculations of breakup and direct proton transfer for the 8B+58Ni system at energies around the Coulomb barrier (EB,lab=22.95 MeV were performed by the continuum-discretized coupled channels (CDCC method and the coupled-reaction-channels (CRC method, respectively. For the 7Be+58Ni interaction, we used a semimicroscopic optical model potential (OMP that combines microscopic calculations of the mean-field double folding potential and a phenomenological construction of the dynamical polarization potential (DPP. The 7Be angular distribution at Elab=25.75 MeV from the 8B breakup on 58Ni was calculated and the spectroscopic factor for 8B → 7Be+p vertex, Sexpt = 1.10 ± 0.05, was deduced. The astrophysical S17(0 factor was calculated equal to 20.7 ±1.1 eV•b, being in good agreement with the previously reported values.

  4. 170 - 174_Yarube_revised

    African Journals Online (AJOL)

    User

    National Academy of Sciences (2011).Guide for the. Care and Use of Laboratory Animals. National Academies Press, Washington, D.C.,. U.S.A., 246 pp. Sharma, S., Chopra, K. and Kulkarni, S.K. (2007). Effect of insulin and its combination with resveratrol or curcumin in attenuation of diabetic neuropathic pain: participation ...

  5. DNA repair in mammalian cells exposed to combinations of carcinogenic agents. [uv radiation; AAAF; 4-NQO; DMBA-epoxide; ICR-170

    Energy Technology Data Exchange (ETDEWEB)

    Setlow, R.B.; Ahmed, F.E.

    1979-01-01

    Cells defective in one or more aspects of repair are killed and often mutagenized more readily than normal cells by DNA damaging agents, and humans whose cells are deficient in repair are at an increased carcinogenic risk compared to normal individuals. The excision repair of uv induced pyrimidine dimers is a well studied system, but the details of the steps in this repair system are far from being understood in human cells. We know that there are a number of chemicals that mimic uv in that normal human cells repair DNA damage from both these agents and from uv by a long patch excision repair system, and that xeroderma pigmentosum cells defective in repair of uv are also defective in the repair of damage from these chemicals. The chemicals we have investigated are AAAF, 4-NQO, DMBA-epoxide, and ICR-170. We describe experiments, using several techniques, in which DNA excision repair is measured after treatment of various human cell strains with combinations of uv and these agents. If two agents have a common rate limiting step then, at doses high enough to saturate the repair system, one would expect the observed repair after a treatment with a combination of agents to be equal to that from one agent alone. Such is not the case for normal human or excision-deficient XP cells. In the former repair is additive and in the latter repair is usually appreciably less than that observed with either agent alone. Models that attempt to explain these surprising results involve complexes of enzymes and cofactors.

  6. An analysis of 170 glioma patients and systematic review to investigate the association between IDH-1 mutations and preoperative glioma-related epilepsy.

    Science.gov (United States)

    Yang, Yuan; Mao, Qing; Wang, Xiang; Liu, Yanhui; Mao, Yunhe; Zhou, Qiao; Luo, Jiewen

    2016-09-01

    Seizure is a common presenting symptom of glioma, and many biomarkers have been suggested to be associated with preoperative seizure; however, the relationships between IDH (isocitrate dehydrogenase) mutations and glioma-related epilepsy only recently been studied. The authors aimed to examine the correlations between IDH mutations in glioma patients with preoperative seizures and tumor location. A series of 170 glioma samples were analyzed for IDH1 R132H mutations (amino acid change from arginine to histidine at codon 132) with immunohistochemistry (IHC) staining and for IDH mutations with direct DNA sequencing when the IHC results were negative. If either the IHC or direct DNA sequencing result was positive, the IDH status was defined as mutated. The results of the IDH mutation examinations were used to analyze the relationship between mutations and glioma-related epilepsy. The study population consisted of 64 (37.6%) World Health Organization (WHO) grade II gliomas, 58 (34.1%) grade III, and 48 (28.3%) grade IV gliomas. A total of 84 samples with IDH1 mutations were observed in our study, and 54 of these presented with seizures as the initial symptoms, whereas 28 of the patients with wild-type IDH status presented with seizures (p=0.043 for the WHO grade II gliomas, p=0.002 for the grade III gliomas and p=0.942 for the grade IV gliomas, chi-squared tests). Among the WHO grade II and III gliomas, IDH1 mutations were significantly associated with preoperative seizures, but no significant relationship between IDH mutations and preoperative seizures was found with glioblastoma multiforme. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Job Strain as a Risk Factor for Leisure-Time Physical Inactivity: An Individual-Participant Meta-Analysis of Up to 170,000 Men and Women

    Science.gov (United States)

    Fransson, Eleonor I.; Heikkilä, Katriina; Nyberg, Solja T.; Zins, Marie; Westerlund, Hugo; Westerholm, Peter; Väänänen, Ari; Virtanen, Marianna; Vahtera, Jussi; Theorell, Töres; Suominen, Sakari; Singh-Manoux, Archana; Siegrist, Johannes; Sabia, Séverine; Rugulies, Reiner; Pentti, Jaana; Oksanen, Tuula; Nordin, Maria; Nielsen, Martin L.; Marmot, Michael G.; Magnusson Hanson, Linda L.; Madsen, Ida E. H.; Lunau, Thorsten; Leineweber, Constanze; Kumari, Meena; Kouvonen, Anne; Koskinen, Aki; Koskenvuo, Markku; Knutsson, Anders; Kittel, France; Jöckel, Karl-Heinz; Joensuu, Matti; Houtman, Irene L.; Hooftman, Wendela E.; Goldberg, Marcel; Geuskens, Goedele A.; Ferrie, Jane E.; Erbel, Raimund; Dragano, Nico; De Bacquer, Dirk; Clays, Els; Casini, Annalisa; Burr, Hermann; Borritz, Marianne; Bonenfant, Sébastien; Bjorner, Jakob B.; Alfredsson, Lars; Hamer, Mark; Batty, G. David; Kivimäki, Mika

    2012-01-01

    Unfavorable work characteristics, such as low job control and too high or too low job demands, have been suggested to increase the likelihood of physical inactivity during leisure time, but this has not been verified in large-scale studies. The authors combined individual-level data from 14 European cohort studies (baseline years from 1985–1988 to 2006–2008) to examine the association between unfavorable work characteristics and leisure-time physical inactivity in a total of 170,162 employees (50% women; mean age, 43.5 years). Of these employees, 56,735 were reexamined after 2–9 years. In cross-sectional analyses, the odds for physical inactivity were 26% higher (odds ratio = 1.26, 95% confidence interval: 1.15, 1.38) for employees with high-strain jobs (low control/high demands) and 21% higher (odds ratio = 1.21, 95% confidence interval: 1.11, 1.31) for those with passive jobs (low control/low demands) compared with employees in low-strain jobs (high control/low demands). In prospective analyses restricted to physically active participants, the odds of becoming physically inactive during follow-up were 21% and 20% higher for those with high-strain (odds ratio = 1.21, 95% confidence interval: 1.11, 1.32) and passive (odds ratio = 1.20, 95% confidence interval: 1.11, 1.30) jobs at baseline. These data suggest that unfavorable work characteristics may have a spillover effect on leisure-time physical activity. PMID:23144364

  8. Effects of the bHLH domain on axial coordination of heme in the PAS-A domain of neuronal PAS domain protein 2 (NPAS2): conversion from His119/Cys170 coordination to His119/His171 coordination.

    Science.gov (United States)

    Uchida, Takeshi; Sagami, Ikuko; Shimizu, Toru; Ishimori, Koichiro; Kitagawa, Teizo

    2012-03-01

    Neuronal PAS domain protein 2 (NPAS2), which is a CO-dependent transcription factor, consists of a basic helix-loop-helix domain (bHLH), and two heme-containing PAS domains (PAS-A and PAS-B). In our previous study on the isolated PAS-A domain, we concluded that His119 and Cys170 are the axial ligands of the ferric heme, while Cys170 is replaced by His171 upon reduction of heme (Uchida et al., J. Biol. Chem. 270, (2005) 21358-21368.). Recently, we characterized the PAS-A domain combined with the N-terminal bHLH domain, and found that some spectroscopic features were different from those of the isolated PAS-A domain (Mukaiyama et al., FEBS J. 273, (2006) 2528-2539.). Therefore, we reinvestigated the coordination structure of heme in the bHLH-PAS-A domain and prepared four histidine and one cysteine mutants. Resonance Raman spectrum of the Cys170Ala mutant is the same as that of wild type with a dominant 6-coordinate heme in the ferric form. In contrast, His119Ala and His171Ala mutants significantly increase amounts of the 5-coordinate species, indicating that His119 and His171, not Cys170, are axial ligands of the ferric heme in the bHLH-PAS-A domain. We had confirmed that the coordination structure of the isolated PAS-A domain is in equilibrium between Cys-Fe-His and His-Fe-His coordinated species but newly found that interaction of the PAS-A domain with the bHLH domain shifts the equilibrium toward the latter structure. Such flexibility in the heme coordination structure seems to be in favor of signal transduction in NPAS2. Copyright © 2011 Elsevier Inc. All rights reserved.

  9. Frequency of tail lesions and risk factors for tail biting in heavy pig production from weaning to 170 kg live weight.

    Science.gov (United States)

    Scollo, A; Contiero, B; Gottardo, F

    2016-01-01

    Tail biting lesions have a negative effect on both the welfare of pigs and on the revenue of the pig farm. Due to the multifactorial nature of this abnormal behaviour and its sporadic onset, an epidemiological approach was adopted to identify the management and housing factors influencing the occurrence of tail biting and the frequency of bitten pigs in the weaning and fattening phases up to 170 kg live weight in heavy pig production. Data were collected from a sample of 67 commercial pig farms via an on-farm visit and a questionnaire to the farmer. Data collected included general farm information, hygiene and herd health, prevention, management, climate control, feeding and production traits. In the weaning phase, the occurrence of tail biting was increased by a factor of 16.64 for tipped vs. short-docked tails, by a factor of 68.09 when the observer detected poor air quality, and by a factor of 14.44 when the feeding time was variable. In fattening pigs, a high stocking density increased the risk of tail biting by a factor of 18.00. The frequency of lesions in weaners was greater in pigs with tipped tails (0.29 vs. 0.03%; P = 0.034), whereas in fatteners the frequency of lesions was greater when drinkers were not present in the lying area (0.71 vs. 0.05%; P = 0.009) and when air turnover was not detected in the barn (0.70 vs. 0.07%; P = 0.005). There was also a trend for increased tail biting when the stocking density was high (1.06 vs. 0.33%; P = 0.057). Many of the risk factors that emerged for heavy pigs in the present study could be easily managed to reduce the risk of tail biting and the frequency of tail lesions through the systematic evaluation and control of stocking density, climate, and feed and water management. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Ofidismo en la provincia de Chanchamayo, Junín: revisión de 170 casos consecutivos en el Hospital de Apoyo de La Merced

    Directory of Open Access Journals (Sweden)

    Miguel Villanueva Forero

    2004-04-01

    Full Text Available Objetivo: Describir las características clínico-epidemiológicas del ofidismo en la provincia de Chanchamayo, Junín, Perú. Materiales y métodos: Se revisaron todas las historias clínicas de pacientes con diagnóstico de ofidismo en el "Hospital de Apoyo de La Merced" (HALM, Junín, Perú entre enero de 1998 y diciembre del 2000. Se recogieron datos de demográficos y clínico-epidemiológicos. Resultados: Las historias clínicas revisadas fueron 195, de estas, 170 fueron incluidas en el análisis. La media edad fue 26.2 años (rango: 1-76 años. La mayoría (62.4% era de sexo masculino. El 43.5% provenía del distrito de La Merced. Los casos de ofidismo ocurrieron con mayor frecuencia (67% durante los meses de lluvia (de diciembre a mayo. La localización más frecuente de la mordedura fue en los miembros inferiores (67.7%. El tiempo entre el accidente y la atención médica fue en promedio de 5 hrs. 43 min. (± 5 hrs. 56 min.. El animal agresor se identificó en 37.6% de las veces, siendo el más frecuente el Bothrops atrox (36.5%. Los síntomas más comunes que acompañaron el cuadro clínico fueron dolor, edema, eritema (80%. La mayoría (78.3% recibió suero antiofídico, de estos, 18.8% presentaron reacciones anafilactoides o urticariformes luego de la administración. La complicación más frecuente fue celulitis, presentándose mas comúnmente en pacientes que recibieron corticoides por más de 5 días (p=0.024. Ningún paciente falleció. Conclusiones: La mayoría de accidentes ofídicos en esta región ocurren en el ámbito rural. La utilización de corticoides por más de 5 días se asoció con una mayor frecuencia de celulitis. Las reacciones de hipersensibilidad hacia el suero antiofídico no son raras, siendo recomendable realizar la prueba intradérmica antes de su administración. (Rev Med Hered 2004; 15: 82-87.

  11. Dietary fat and total energy intake modifies the association of genetic profile risk score on obesity: evidence from 48 170 UK Biobank participants.

    Science.gov (United States)

    Celis-Morales, C A; Lyall, D M; Gray, S R; Steell, L; Anderson, J; Iliodromiti, S; Welsh, P; Guo, Y; Petermann, F; Mackay, D F; Bailey, M E S; Pell, J P; Gill, J M R; Sattar, N

    2017-12-01

    Obesity is a multifactorial condition influenced by both genetics and lifestyle. The aim of this study was to investigate whether the association between a validated genetic profile risk score for obesity (GPRS-obesity) and body mass index (BMI) or waist circumference (WC) was modified by macronutrient intake in a large general population study. This study included cross-sectional data from 48 170 white European adults, aged 37-73 years, participating in the UK Biobank. Interactions between GPRS-obesity and macronutrient intake (including total energy, protein, fat, carbohydrate and dietary fibre intake) and its effects on BMI and WC were investigated. The 93-single-nucleotide polymorphism (SNP) GPRS was associated with a higher BMI (β: 0.57 kg m - 2 per s.d. increase in GPRS (95% confidence interval: 0.53-0.60); P=1.9 × 10 -183 ) independent of major confounding factors. There was a significant interaction between GPRS and total fat intake (P ( interaction) =0.007). Among high-fat-intake individuals, BMI was higher by 0.60 (0.52, 0.67) kg m -2 per s.d. increase in GPRS-obesity; the change in BMI with GPRS was lower among low-fat-intake individuals (β: 0.50 (0.44, 0.57) kg m -2 ). Significant interactions with similar patterns were observed for saturated fat intake (high β: 0.66 (0.59, 0.73) versus low β: 0.49 (0.42, 0.55) kg m -2 , P ( interaction) =2 × 10 -4 ) and for total energy intake (high β: 0.58 (0.51, 0.64) versus low β: 0.49 (0.42, 0.56) kg m -2 , P ( interaction) =0.019), but not for protein intake, carbohydrate intake and fibre intake (P ( interaction) >0.05). The findings were broadly similar using WC as the outcome. These data suggest that the benefits of reducing the intake of fats and total energy intake may be more important in individuals with high genetic risk for obesity.

  12. Identification of g.170G>A and g.332G>A mutations in exon 3 of leptin gene (Bcnl and Cail) and their association with semen quality and testicular dimensions in Sanjabi rams.

    Science.gov (United States)

    Bakhtiar, Roya; Abdolmohammadi, Alireza; Hajarian, Hadi; Nikousefat, Zahra; Kalantar-Neyestanaki, Davood

    2017-04-01

    The purpose of this study was to investigate leptin gene polymorphisms and their relationships with the characteristics of sperm quality and testicular dimensions. Semen samples were collected from 96 Sanjabi rams during autumn and spring seasons over two years. Simultaneously, the dimensions of length, width and scrotal circumference were measured. Blood samples were taken from the jugular vein to extract DNA. PCR was performed to amplify a 463bp fragment including exon 3 of leptin gene. PCR products were digested by Bcnl and Cail restriction enzymes to identify 170G>A and 332G>A mutations in exon 3, respectively. Leptin gene polymorphism in 170G>A locus had an effect on individual motility trait, water test and scrotal circumference (PA locus had a significant effect on viability trait, water test and scrotal circumference as GA genotypes had the highest amounts for these traits compared with GG genotypes (Pleptin gene polymorphisms with sperm fertility and testicular dimensions in sheep, which suggests leptin gene as a potential gene to be used in breeding programs in order to improve fertility in herds. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Increased frequency of mutations in the hprt gene of T cells isolated from patients with anti-U1-70kD-autoantibody-positive connective tissue disease.

    Science.gov (United States)

    Holyst, M M; Hill, D L; Sharp, G C; Hoffman, R W

    1994-11-01

    Mixed connective tissue disease (MCTD) is characterized by the presence of high titers of anti-U1-70kD autoantibodies which are the result of substantial B cell activation. The hprt gene encodes the constitutively expressed enzyme hypoxanthine-guanine phosphoribosyl transferase which is active in the purine salvage pathway. Rapidly dividing cells randomly accumulate gene mutations, including mutations in the hprt gene. These mutations may be used to identify activated cells. If activated T cells play a role in the pathogenesis of MCTD, an increased frequency of mutations in the hprt gene might be expected among T cells isolated from such patients. To examine this hypothesis, we isolated and cloned T cells from 10 anti-U1-70kD-autoantibody-positive MCTD patients and determined the precursor frequencies of cells possessing mutations in hprt by comparing the frequency of cells grown in the presence and absence of the purine analogue 6-thioguanine. We found that the frequency of 6-thioguanine-resistant hprt-negative T cells was significantly increased among MCTD patients (mean 566/10(6); range 122-2,845/10(6)) versus age- and sex-matched controls (mean 42/10(6); range 21-78/10(6); p < 0.003). These results demonstrate that there is an increase in the measured mutant frequency of T cells from MCTD patients. Such T cells may play a role in the pathogenesis of this disease.

  14. A CONVERSÃO DE CONHECIMENTO ATRAVÉS DO “LEARNING BY HIRING” NO PROGRAMA EMBRAER 170/190

    Directory of Open Access Journals (Sweden)

    Ricardo Gentil Peixoto da Costa

    2008-05-01

    ; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

    RESUMO

    Fim da década de 1990. A Embraer prepara-se para lançar um novo programa de aeronaves, denominado Embraer 170/190. Este programa representará um passo importante para a empresa, que almeja, através dele, consolidar sua posição dentre os líderes mundiais  na produção de aeronaves civis a jato e atingir um nicho de mercado ainda inexplorado. Mas a empresa não conta com todas as tecnologias de que necessita, decidindo por buscar no mercado internacional profissionais que lhe aportem as tecnologias de base das quais necessita. Como converter em conhecimento da empresa o conhecimento trazido por estes especialistas internacionais numa indústria de intensivo conhecimento tecnológico? Este artigo, baseado na revisão bibliográfica e no estudo do caso sobre o programa Embraer 170/190, explora a maneira como a Embraer conseguiu vencer este desafio, através da conversão do conhecimento mediante o Aprendizado pela Contratação, Learning by Hiring, colaborando para o estudo acadêmico do tema, em linha com a literatura existente no momento.

     

    Palavras-Chave

    Conhecimento, EMBRAER, “Learning by Hiring”.

     

     

    ABSTRACT

    In the end of the ´90s, Embraer had made its

  15. A variable temperature EPR study of Mn(2+)-doped NH(4)Cl(0.9)I(0.1) single crystal at 170 GHz: zero-field splitting parameter and its absolute sign.

    Science.gov (United States)

    Misra, Sushil K; Andronenko, Serguei I; Chand, Prem; Earle, Keith A; Paschenko, Sergei V; Freed, Jack H

    2005-06-01

    EPR measurements have been carried out on a single crystal of Mn(2+)-doped NH(4)Cl(0.9)I(0.1) at 170-GHz in the temperature range of 312-4.2K. The spectra have been analyzed (i) to estimate the spin-Hamiltonian parameters; (ii) to study the temperature variation of the zero-field splitting (ZFS) parameter; (iii) to confirm the negative absolute sign of the ZFS parameter unequivocally from the temperature-dependent relative intensities of hyperfine sextets at temperatures below 10K; and (iv) to detect the occurrence of a structural phase transition at 4.35K from the change in the structure of the EPR lines with temperature below 10K.

  16. Study of {sup nat}Mg(d,d{sub 0}) reaction at detector angles between 90° and 170°, for the energy range E{sub d,lab}=1660–1990 keV

    Energy Technology Data Exchange (ETDEWEB)

    Patronis, N., E-mail: npatronis@uoi.gr [Department of Physics, University of Ioannina, 45110 Ioannina (Greece); Aslanoglou, X. [Department of Physics, University of Ioannina, 45110 Ioannina (Greece); Axiotis, M. [Tandem Accelerator Laboratory, Institute of Nuclear and Particle Physics, N.C.S.R. Demokritos, Aghia Paraskevi, 15310 Athens (Greece); Georgiadou, A. [Department of Physics, University of Ioannina, 45110 Ioannina (Greece); Kokkoris, M. [Department of Physics, National Technical University of Athens, Zografou Campus, 15780 Athens (Greece); Lagoyannis, A. [Tandem Accelerator Laboratory, Institute of Nuclear and Particle Physics, N.C.S.R. Demokritos, Aghia Paraskevi, 15310 Athens (Greece); Misaelides, P. [Department of Chemistry, Aristotle University, GR-54124 Thessaloniki (Greece); Paneta, V. [Tandem Accelerator Laboratory, Institute of Nuclear and Particle Physics, N.C.S.R. Demokritos, Aghia Paraskevi, 15310 Athens (Greece); Department of Physics, National Technical University of Athens, Zografou Campus, 15780 Athens (Greece)

    2014-10-15

    In the present work, the study of the {sup nat}Mg(d,d{sub 0}) is presented for the energy range E{sub d,lab} = 1660–1990 keV (in steps of 5 keV), for detector angles between 90° and 170°. Elastic scattering data for two forward angles (55° and 70°) were also obtained. In order to validate the obtained experimental results a thick Mg sample with Au evaporated on top was fabricated and benchmarking measurements were performed at various deuteron beam energies. The results of the present work are complementary to the recently published {sup 24}Mg(d,p{sub 0,1,2}) reaction cross section data, thus facilitating the simultaneous depth profiling study of magnesium by both the d-NRA and EBS techniques.

  17. Study of natMg(d,d0) reaction at detector angles between 90° and 170°, for the energy range Ed,lab=1660-1990 keV

    Science.gov (United States)

    Patronis, N.; Aslanoglou, X.; Axiotis, M.; Georgiadou, A.; Kokkoris, M.; Lagoyannis, A.; Misaelides, P.; Paneta, V.

    2014-10-01

    In the present work, the study of the natMg(d,d0) is presented for the energy range Ed,lab = 1660-1990 keV (in steps of 5 keV), for detector angles between 90° and 170°. Elastic scattering data for two forward angles (55° and 70°) were also obtained. In order to validate the obtained experimental results a thick Mg sample with Au evaporated on top was fabricated and benchmarking measurements were performed at various deuteron beam energies. The results of the present work are complementary to the recently published 24Mg(d,p0,1,2) reaction cross section data, thus facilitating the simultaneous depth profiling study of magnesium by both the d-NRA and EBS techniques.

  18. A 430 mW 16 b 170 MS/s CMOS pipelined ADC with 77.2 dB SNR and 97.6 dB SFDR

    Science.gov (United States)

    Hui, Zhang; Dan, Li; Lei, Wan; Hui, Zhang; Haijun, Wang; Yuan, Gao; Feili, Zhu; Ziqi, Wang; Xuexin, Ding

    2016-03-01

    A 16-bit 170 MS/s pipelined ADC implemented in 0.18 μm CMOS process is presented in this paper. An improved digital calibration method and a linearized sampling front-end are employed to achieve a high SFDR. The enlarged full scale range makes it possible to obtain a high SNR with smaller sampling capacitors, thus achieving higher speed and low power. This ADC attains an SNR of 77.2 dBFS, an SFDR of 97.6 dBc for a 10 MHz input signal, while preserving an SFDR > 80 dBc up to 300 MHz input frequency. The ADC consumes 430 mW from a 1.8 V supply and occupies a 17 mm2 active area. Project supported by the National Science and Technology Major Project (No. 2009ZX01034-002-001-016).

  19. A High-Energy Charge-Separated State of 1.70 eV from a High-Potential Donor-Acceptor Dyad: A Catalyst for Energy-Demanding Photochemical Reactions.

    Science.gov (United States)

    Lim, Gary N; Obondi, Christopher O; D'Souza, Francis

    2016-09-12

    A high potential donor-acceptor dyad composed of zinc porphyrin bearing three meso-pentafluorophenyl substituents covalently linked to C60 , as a novel dyad capable of generating charge-separated states of high energy (potential) has been developed. The calculated energy of the charge-separated state was found to be 1.70 eV, the highest reported for a covalently linked porphyrin-fullerene dyad. Intramolecular photoinduced electron transfer leading to charge-separated states of appreciable lifetimes in polar and nonpolar solvents has been established from studies involving femto- to nanosecond transient absorption techniques. The high energy stored in the form of charge-separated states along with its persistence of about 50-60 ns makes this dyad a potential electron-transporting catalyst to carry out energy-demanding photochemical reactions. This type of high-energy harvesting dyad is expected to open new research in the areas of artificial photosynthesis especially producing energy (potential) demanding light-to-fuel products. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Impact of the growth temperature on the performance of 1.70-eV Al0.22Ga0.78As solar cells grown by MBE

    Science.gov (United States)

    Onno, Arthur; Tang, Mingchu; Oberbeck, Lars; Wu, Jiang; Liu, Huiyun

    2017-10-01

    Growth of high material quality Aluminum Gallium Arsenide (AlxGa1-xAs) is known to be challenging, in particular with an Al content x above 20%. As a result, the use of AlxGa1-xAs in devices requiring high minority carrier lifetimes, such as solar cells, has been limited. Nonetheless, it has long been established that the substrate temperature is a key parameter in improving AlxGa1-xAs material quality. In order to optimize the growth temperature of 1.70-eV Al0.22Ga0.78As solar cells, five samples have been grown by Solid-Source Molecular Beam Epitaxy (SSMBE) at 580 °C, 600 °C, 620 °C, 640 °C, and 660 °C, respectively. A strong improvement in performance is observed with increasing the growth temperature from 580 °C to 620 °C. An open-circuit voltage above 1.21 V has in particular been demonstrated on the sample grown at 620 °C, translating into a bandgap-voltage offset Woc below 0.5 V. Above 620 °C, performances - in particular the short-circuit current density - moderately decrease. This trend is confirmed by photoluminescence, current density versus voltage characterization under illumination, and external quantum efficiency measurements.

  1. Publications | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Districts and sub-districts are crucial to the functioning of the district health system and the successful implementation of health sector reforms, which have been at the centre of public debate in the past few years. While policy intentions and service challenges are much debated, little... Knowledge management : the forgotten ...

  2. 10 CFR 170.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., bureau, division, service, office, officer, authority, administration, or other establishment in the.... Human use means the internal or external administration of byproduct, source, or special nuclear... any other special nuclear material. Reference systems concept means a concept that involves the review...

  3. 40 CFR 141.170 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving... filtration and disinfection that are in addition to criteria under which filtration and disinfection are... installing and properly operating water treatment processes which reliably achieve: (1) At least 99 percent...

  4. 24 CFR 1720.170 - Service.

    Science.gov (United States)

    2010-04-01

    ... (INTERSTATE LAND SALES REGISTRATION PROGRAM) FORMAL PROCEDURES AND RULES OF PRACTICE Adjudicatory Proceedings... officials in the Office of Interstate Land Sales Registration: Administrator; Associate Administrator; Director, Office of Interstate Land Sales Registration: Provided, however, That during the pendency of a...

  5. 21 CFR 158.170 - Frozen peas.

    Science.gov (United States)

    2010-04-01

    ... the words “frozen” or “quick frozen”. The name of the food shall include a declaration of any... paragraph (a)(2) of this section or the applicable sieve size. However, the optional descriptive words..., specified in paragraph (b)(3)(i) (a) or (b) of this section, diluted to 9.5 liters with water). (iii) Drying...

  6. 21 CFR 131.170 - Eggnog.

    Science.gov (United States)

    2010-04-01

    .... Sugar (sucrose), beet or cane; invert sugar (in paste or sirup form); brown sugar; refiner's sirup... sugar; or any of the sweeteners listed in part 168 of this chapter, except table sirup. (e) Other...

  7. Publications | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    It aims to increase the pool of experts working in... Tackling food losses : outlook for postharvest research and innovation in Mozambique (restricted access). Mitigation of postharvest (PH) losses are part of a major effort to overcome food insecurity and poverty in food deficit countries. Where data quality is poor, government, ...

  8. 21 CFR 170.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... procedures include those human, animal, analytical, and other scientific studies, whether published or..., and animal feed. (n) The following general food categories are established to group specific related..._federal_regulations/ibr_locations.html. (1) Baked goods and baking mixes, including all ready-to-eat and...

  9. 40 CFR 35.170 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... program regulations are found in 40 CFR parts 141, 142, and 143. ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE STATE AND LOCAL... carry out public water system supervision programs including implementation and enforcement of the...

  10. 40 CFR 170.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... grown or maintained for commercial or research purposes and includes, but is not limited to, food, feed, and fiber plants; trees; turfgrass; flowers, shrubs; ornamentals; and seedlings. Chemigation means the application of pesticides through irrigation systems. Commercial pesticide handling establishment means any...

  11. 5 CFR 1207.170 - Compliance procedures.

    Science.gov (United States)

    2010-01-01

    ... subjected to discrimination on the basis of disability in the adjudication of the case, the party may raise... recommendation by the time the party learns of the alleged discrimination, the party may raise the allegation in... Rehabilitation Act of 1973 (29 U.S.C. 791). (b) Allegations of discrimination in the adjudication of a Board case...

  12. 24__170 - 177_Muhammad and Mukhtar

    African Journals Online (AJOL)

    pc

    This probably provided adequate aeration in the soil and improved microbial activities (Xio and Li, 2006). On the other hand turmeric plant when treated with Nitrogen fertilizer remained green longer and resulted in a higher vegetative growth and yield (Mazid, 1993; and. Seobi, 2005 and Anes and Johnson, 1980). Several.

  13. 48 CFR 203.170 - Business practices.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 203..., contract negotiation, and contract award, departments and agencies shall adhere to the following best...

  14. 46 CFR 108.170 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... which flammable hydrocarbon gas or vapors, resulting from the drilling operations, may be present in... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT... installations on mobile offshore drilling units see Subchapters “F” and “J” of this chapter. ...

  15. Alexander Graham Bell (170th birthday anniversary

    Directory of Open Access Journals (Sweden)

    V. P. Samokhin

    2017-01-01

    Full Text Available A brief overview of the main works and achievements of Alexander Graham Bell, an educated teacher for the hard of hearing and public figure, author of 30 US patents, is mainly given in the field of telephony and sound recording and reproduction. Biographical information about the Bell family, as well as some interesting facts from his life and activities are given. Scotsman by birth, A. Bell from his youthful years was carried away by the acoustic features of the human voice apparatus and devoted his entire life to teaching the deaf to the perception of oral speech. The first success in this field Bell reached, opening a private school for the deaf in Boston. Bell's creation of the phone was the result of his attempts to facilitate communication with the hard-of-hearing and led to the development of mass communications technology around the world. Alexander Bell is also known for his achievements in the design of hydroplanes, hydrofoils and as one of the founders of the popular magazine National Geographic. He was awarded many honorable awards and academic titles.

  16. Vegetation - Western Riverside Co. [ds170

    Data.gov (United States)

    California Department of Resources — The California Department of Fish and Game (CDFG) contracted with the California Native Plant Society (CNPS) and Aerial Information Systems (AIS) to produce an...

  17. Publications | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Managing the Essence of Life. After years of neglect, the water treatment and distribution system in Lebanon has become the focus of an ambitious modernization program. In 2000, the Lebanese government passed a new water law. Under this legislation, the 21... Trade, jobs, and wages: Does exporting matter for the poor ...

  18. 48 CFR 217.170 - General.

    Science.gov (United States)

    2010-10-01

    ... order quantity procurement in excess of $20 million in any one year (see 217.174(a)(1)); (iii) Employ an... quantity procurement in excess of $20 million in any one year (see 217.174(a)(2)); or (v) Include a... (Acquisition, Technology, and Logistics) (OUSD(AT&L)DPAP), and to the Deputy Under Secretary of Defense...

  19. 40 CFR 170.112 - Entry restrictions.

    Science.gov (United States)

    2010-07-01

    ... equipment. (x) Each worker is instructed in the prevention, recognition, and first aid treatment of heat... to dry. (vi) Personal protective equipment contaminated with pesticides is kept separately and washed... without implementing, when appropriate, measures to prevent heat-related illness. (8) During any early...

  20. 45 CFR 170.102 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... and certify that health information technology includes required capabilities. Certified EHR... information presented to him or her regardless of the method of presentation. Implementation specification... Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH INFORMATION TECHNOLOGY HEALTH INFORMATION...

  1. 28 CFR 39.170 - Compliance procedures.

    Science.gov (United States)

    2010-07-01

    ... Subcommittee on the Handicapped and the House Committee on Education and Labor and its Subcommittee on Select... 1978 amendment in floor debate, including its sponsor, Rep. James M. Jeffords, that the Federal...

  2. 46 CFR 134.170 - Operating manual.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS ADDED PROVISIONS FOR...; (iii) Wave height; (iv) Wave period; (v) Wind; (vi) Current; (vii) Temperatures; and (viii) Other.... (13) A diagram of the hazardous locations (if applicable). (14) A diagram of the emergency-power...

  3. 21 CFR 137.170 - Instantized flours.

    Science.gov (United States)

    2010-04-01

    ...: (1) A selective grinding and bolting procedure or other milling procedure, whereby controlled... set out in paragraph (a) of this section. (c) The name of each product covered by this section is the...

  4. Photoluminescence studies of a Terbium(III) complex as a fluorescent probe for DNA detection

    Energy Technology Data Exchange (ETDEWEB)

    Khorasani-Motlagh, Mozhgan, E-mail: mkhorasani@chem.usb.ac.ir; Noroozifar, Meissam; Niroomand, Sona; Moodi, Asieh

    2013-11-15

    The photoluminescence properties of a Tb(III) complex of the form [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] (phen=1,10-phenanthroline) in different solvents are presented. It shows the characteristic luminescence of the corresponding Ln{sup 3+} ion in the visible region. The emission intensity of this complex in coordinating solvent is higher than non-coordinating one. The suggested mechanism for the energy transfer between the ligand and Tb{sup 3+} ion is the intramolecular energy transfer mechanism. The interactions of the Tb(III) complex with fish salmon DNA are studied by fluorescence spectroscopy, circular dichroism study and viscosity measurements. The results of fluorescence titration reveal that DNA strongly quenches the intrinsic fluorescence of the complex through a static quenching procedure. The binding constant (K{sub b}) of the above metal complex at 25 °C is determined by the fluorescence titration method and it is found to be (8.06±0.01)×10{sup 3} M{sup −1}. The thermodynamic parameters (ΔH{sup 0}>0, ΔS{sup 0}>0 and ΔG{sup 0}<0) indicate that the hydrophobic interactions play a major role in DNA–Tb complex association. The results support the claim that the title complex bonds to FS-DNA by a groove mode. -- Highlights: • Photoluminescence of [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] in different solvents are studied. • Tb(III) complex shows good binding affinity to FS DNA with K{sub b}=(8.06±0.01)×10{sup 3} M{sup −1}. • Viscosity of DNA almost unchanged by increasing amount of Tb complex. • CD spectrum of DNA has a little change with increasing amount of Tb complex. • Thermodynamic parameters indicate that the binding reaction is entropically driven.

  5. Lanthanides in Nuclear Medicine. The Production of Terbium-149 by Heavy Ion Beams

    CERN Document Server

    Dmitriev, S N; Zaitseva, N G; Maslov, O D; Molokanova, L G; Starodub, G Ya; Shishkin, S V; Shishkina, T V

    2001-01-01

    Among radioactive isotopes of lanthanide series elements, finding the increasing using in nuclear medicine, alpha-emitter {149}Tb (T_{1/2} = 4.118 h; EC 76.2 %; beta^+ 7.1 %; alpha 16.7 %) is considered as a perspective radionuclide for radioimmunotherapy. The aim of the present work is to study experimental conditions of the {149}Tb production in reactions Nd({12}C, xn){149}Dy (4.23 min; beta^+, EC)\\to {149}Tb when the Nd targets have been irradiated by heavy ions of carbon. On the basis of results of formation and decay of {149}Dy\\to{149}Tb evaluation of the {149}Tb activity, is made which can be received under optimum conditions (enriched {142}Nd target, {12}C ions with the energy 120 MeV and up to current 100 mu A, time of irradiating 8-10 hours). Under these conditions {149}Tb can be obtained up to 30 GBq (up to 0.8 Ci).

  6. Poly[[aqua-?3-picolinato-?2-picolinato-dipicolinatopotassium(I)terbium(III)] 2.5-hydrate

    OpenAIRE

    Filipe A. Almeida Paz; João Rocha; Jacek Klinowski; Tito Trindade; Nogueira,Helena I. S.; Soares-Santos, Paula C. R.; Cunha-Silva, Lu?s

    2008-01-01

    In the title compound, [KTb(C6H4NO2)4(H2O)]·2.5H2O, each Tb3+ centre is coordinated by four N and five O atoms from five distinct picolinate ligands in a geometry resembling a highly distorted tricapped trigonal prism. One of the ligands establishes a skew bridge between neighbouring Tb3+ centres, leading to the formation of one-dimensional anionic polymeric chains, {[(C6H4NO2)4Tb]−}n, running along the direction [010]. Each K+ cation is seven-coordinated by six O atoms from one an...

  7. Spin waves in terbium. III. Magnetic anisotropy at zero wave vector

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden; Jensen, J.; Touborg, P.

    1975-01-01

    The energy gap at zero wave vector in the spin-wave dispersion relation of ferromagnetic. Tb has been studied by inelastic neutron scattering. The energy was measured as a function of temperature and applied magnetic field, and the dynamic anisotropy parameters were deduced from the results....... The axial anisotropy is found to depend sensitively on the orientation of the magnetic moments in the basal plane. This behavior is shown to be a convincing indication of considerable two-ion contributions to the magnetic anisotropy at zero wave vector. With the exception of the sixfold basal...... the effects of zero-point deviations from the fully aligned ground state, and we tentatively propose polarization-dependent two-ion couplings as their origin....

  8. Structural and Magnetic Anisotropy in Amorphous Terbium-Iron Thin Films

    Science.gov (United States)

    Hufnagel, Todd Clayton

    1995-01-01

    High density, removable media magnetooptic disk drives have recently begun to make significant gains in the information mass storage market. The media in these disks are amorphous rare-earth/transition-metal (RE-TM) alloys. One vital property of these materials is a large perpendicular magnetic anisotropy; that is, an easy axis of magnetization which is perpendicular to the plane of the film. A variety of theories, sometimes contradictory, have been proposed to account for this surprising presence of an anisotropic property in an amorphous material. Recent research indicates that there is an underlying atomic-scale structural anisotropy which is responsible for the observed magnetic anisotropy. Several different types of structural anisotropy have been proposed to account for the observed magnetic anisotropy, including pair-ordering anisotropy (anisotropic chemical short-range order) and bond orientation anisotropy (an anisotropy in coordination number or distances independent of chemical ordering). We have studied the structural origins of perpendicular magnetic anisotropy in amorphous Tb-Fe thin films by employing high-energy and anomalous dispersion x-ray scattering. The as-deposited films show a clear structural anisotropy, with a preference for Tb-Fe near neighbors to align in the out-of-plane direction. These films also have a large perpendicular magnetic anisotropy. Upon annealing, the magnetic anisotropy energy drops significantly, and we see a corresponding reduction in the structural anisotropy. The radial distribution functions indicate that the number of Tb-Fe near-neighbors increases in the in-plane direction, but does not change in the out-of-plane direction. Therefore, the distribution of Tb-Fe near-neighbors becomes more uniform upon annealing. We propose that the observed reduction in perpendicular magnetic anisotropy energy is a result of this change in structure. Our results support the pair -ordering anisotropy model of the structural anisotropy in amorphous Tb-Fe thin films. We see no evidence to support the bond orientation anisotropy model.

  9. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    Antonov-Romanovskii et al [2] firstly suggested applications of OSL for personal dosime- try. This technique got momentum for personnel dosime- try after the development of α-Al2O3:C. OSL properties of α-Al2O3:C have been investigated for personnel dosimetry, environmental dosimetry, medical dosimetry and space.

  10. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    The powder X-ray diffraction (PXRD), photoluminescence (PL) emission and excitation spectra, thermoluminescence (TL) and optically stimulated luminescence (OSL) were measured. The particle size was calculated using the Debye Scherrer formula and found to be 79.42 nm. PL emission spectra of Li 3 PO 4 :Tb 3 + ...

  11. Charge-transfer-based terbium MOF nanoparticles as fluorescent pH sensor for extreme acidity.

    Science.gov (United States)

    Qi, Zewan; Chen, Yang

    2017-01-15

    Newly emerged metal organic frameworks (MOFs) have aroused the great interest in designing functional materials by means of its flexible structure and component. In this study, we used lanthanide Tb 3+ ions and small molecular ligands to design and assemble a kind of pH-sensitive MOF nanoparticle based on intramolecular-charge-transfer effect. This kind of made-to-order MOF nanoparticle for H + is highly specific and sensitive and could be used to fluorescently indicate pH value of strong acidic solution via preset mechanism through luminescence of Tb 3+ . The long luminescence lifetime of Tb 3+ allows eliminating concomitant non-specific fluorescence by time-revised fluorescence techniques, processing an advantage in sensing H + in biological media with strong autofluorescence. Our method showed a great potential of MOF structures in designing and constructing sensitive sensing materials for specific analytes directly via the assembly of functional ions/ligands. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Assessment of terbium (III) as a luminescent probe for the detection of tuberculosis biomarkers

    Energy Technology Data Exchange (ETDEWEB)

    Bamogo, W. [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Mugherli, L. [CEA, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Banyasz, A. [CNRS, IRAMIS, LIDyL/Laboratoire Francis Perrin, URA 2453, F-91191 Gif-sur-Yvette (France); Novelli-Rousseau, A.; Mallard, F. [BioMérieux SA, F-38000 Grenoble (France); Tran-Thi, T.-H., E-mail: thu-hoa.tran-thi@cea.fr [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France)

    2015-10-08

    A detection method for nicotinic acid, a specific metabolite marker of Mycobacterium tuberculosis present in cultures and patients' breath, is studied in complex solutions containing other metabolites and in biological media such as urine, saliva and breath condensate. The method is based on the analysis of the luminescence increase of Tb{sup 3+} complexes in the presence of nicotinic acid due to the energy transfer from the excited ligand to the lanthanide ion. It is shown that other potential markers found in M. tuberculosis culture supernatant, such as methyl phenylacetate, p-methyl anisate, methyl nicotinate and 2-methoxy biphenyl, can interfere with nicotinic acid via a competitive absorption of the excitation photons. A new strategy to circumvent these interferences is proposed with an upstream trapping of volatile markers preceding the detection of nicotinic acid in the liquid phase via the luminescence of Tb{sup 3+} complexes. The cost of the method is evaluated and compared with the Xpert MTB/RIF test endorsed by the World Health Organization. - Highlights: • Nicotinic acid, a specific marker of M. tuberculosis, can be detected via luminescence. • The detection limit with a commercial phosphorimeter is 0.4 µmol·L{sup -1}. • Other metabolites of M. tuberculosis can interfere via absorbed excitation light. • The interference can be removed via trapping of the most volatile metabolites. • A breath analysis procedure's cost is compared with the Xpert TBM/RIF test.

  13. A highly porous luminescent terbium-organic framework for reversible anion sensing

    Energy Technology Data Exchange (ETDEWEB)

    Wong, K.L.; Law, G.L.; Wong, W.T. [Department of Chemistry, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Yang, Y.Y. [School of Chemistry and Chemical Engineering, Sun Yat-Sen University, Guangzhou 510275 (China)

    2006-04-18

    Unique tailored porous frameworks incorporating a lanthanide metal center have been designed to function as chemical detectors. A flexible multidentate ligand, mucic acid, is used to differentiate between several anions, thus creating an organic framework that is ideally suited for applications in gas separation, sensors, and chemical switches. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  14. Synthesis and characterization of wide bandgap semiconductors doped with terbium for electroluminescent devices

    OpenAIRE

    Montañez Huamán, Liz Margarita

    2016-01-01

    En el presente trabajo de investigación se ha estudiado propiedades estequiometrias, estructurales y de emisión de luz de semiconductor de amplio ancho de banda dopados con terbio. La difracción de rayos-X en ángulo rasante confirma el estado amorfo de las películas. Los espectros de absorción infrarroja muestran la formación de óxidos en las películas y la espectroscopia de foto-electrones de rayos-X revela la formación de oxinitruro de aluminio y oxicarburo de silicio. Las pe...

  15. Synthesis and characterization of terbium-doped SrSnO3 pigments

    Czech Academy of Sciences Publication Activity Database

    Dohnalová, Ž.; Gorodylova, N.; Šulcová, P.; Vlček, Milan

    2014-01-01

    Roč. 40, č. 8 (2014), s. 12637-12645 ISSN 0272-8842 Institutional support: RVO:61389013 Keywords : pigments * solid state reaction * perovskites Subject RIV: CA - Inorganic Chemistry Impact factor: 2.605, year: 2014

  16. An optical material for the detection of β-hydroxybutyrate based on a terbium complex

    Science.gov (United States)

    Wang, Xiaomiao; Chen, Huili; Li, Hua

    2014-02-01

    A novel Tb3+ complex (Tb(C14H10O4)ṡCl, TbL2) based on benzoic acid (L+H) was successfully synthesized, and gave a weak green emission in methanol-water (V:V, 4:1, pH 4.49). With the addition of β-hydroxybutyrate (β-HB) to a semi-aqueous solution of TbL2, an increment of the luminescent intensity at 545 nm assigned to 5D4 → 7F5 transition of Tb3+ was measured, which was evident to the naked eye. The response showed high selectivity for β-HB compared with other common anions including Cl-, NO3-, CO32-, PO43-, HPO42-, HPO4-, CO42-, PO74-, SO42-, lactate, AcO-, citrate, malate therefore it has the potential to be applied as a luminescent sensor for β-HB.

  17. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Aleixandre, J. L.

    1967-07-01

    145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

  18. Anonimo, “Mout home son qe dizon q’an amicx” (BdT 461.170 con Anonimi, “Fraire, tot lo sen e·l saber” (BdT 461.123b, “Quecs deuria per aver esser pros” (BdT 461.173, “Mant home son ades plus cobetos” (BdT 461.162

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2010-12-01

    Full Text Available This paper will offer a new edition, with critical apparatus, commentary and translation, of an anonymous poem (BdT 461.170 that has so far not been edited (nor commented yet it appears of great interest for some linguistic aspects as well as for the fact that it reflects a later period and a mentality that might be termed protobourgeois. The poem will also be placed in context within the macrotext to which it belongs, because it forms a meaningful sequence together with the two stanzas that follow it in Chansonnier P (BdT 461.173 e 461.162, of which an edition with commentary and translation will be provided. Furthermore, the paper will examine the intertextual relationships of BdT 461.170 with other poems belonging to the same genre (short troubadour poems of a sententious and gnomic type: as far as these are concerned, the text reveals surprising links with the ‘cobla’ BdT 461.123b that opens the anthology of ‘esparsas’ in Chansonnier J (a new edition of this latter cobla will also be given here.

  19. pH dependent photophysical studies of new europium and terbium complexes of tripodal ligand: Experimental and semiempirical approach

    Energy Technology Data Exchange (ETDEWEB)

    Akbar, Rifat [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India); Baral, Minati [Department of Chemistry, National Institute of Technology Kurukshetra, Haryana 136119 (India); Kanungo, B K, E-mail: b.kanungo@gmail.com [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India)

    2015-11-15

    The photophysical properties of adduct of a novel nonadentate tripodal ligand, 5,5′-(2-(((8-hydroxyquinolin-5-yl)methylamino)methyl)-2-methylpropane-1, 3-diyl)bis(azanediyl)bis(methylene diquinolin-8-ol, (TAME5OX), with Eu{sup 3+} and Tb{sup 3+} metal ions have been probed for photonics applications. The absorption spectroscopy of these complexes show remarkable spectral changes due to characteristic lanthanide transitions, which support the use of TAME5OX as a sensitive optical pH based sensor to detect Ln{sup 3+} metal ions in biological systems. In addition, these complexes have also been shown to exhibit strong green fluorescence allowing simultaneous sensing within the visible region under physiological pH in competitive medium for both Eu{sup 3+} and Tb{sup 3+} ions. The intense fluorescence from these compounds were revealed to intermittently get quenched under acidic as well as basic conditions due to the photoinduced intramolecular electron transfer from excited 8-hydroxyquinoline (8-HQ) moiety to metal ion, just an opposite process. This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensor. The thermodynamic stability and aqueous coordination chemistry of the chelator with the said lanthanide ions have also been probed by potentiometric, UV–visible and fluorescence spectrophotometric method. TAME5OX has been found to form two protonated complexes [Ln(H{sub 5}L)]{sup 5+} and [Ln(H{sub 4}L)]{sup 4+} below pH 2.5 with both metal ions, which consecutively deprotonates through one proton process with rise of pH. The formation constants (log β{sub 11n}) of neutral complexes have been determined to be 33.51 and 32.16 with pLn (pLn=−log[Ln{sup 3+}]) values of 16.14 and 19.48 for Eu{sup 3+} and Tb{sup 3+} ions, respectively, calculated at pH 7.4, indicating TAME5OX is a good lanthanide synthetic chelator. The emission lifetimes of the Eu{sup 3+} and Tb{sup 3+} complexes recorded in D{sub 2}O and H{sub 2}O suggest the presence of water molecules in the first coordination sphere of the metal ions. NMR titrations were carried out to determine the stoichiometry of chelates. The complexe's coordination geometries were optimized by using PM7 as sparkle/PM7 model. The theoretical electronic behavior was evaluated to support the experimental findings, based on ZINDO/S methodology at configuration interaction with single excitations (CIS) level. These results emphasize the capability of the use of the theoretical models in prediction of geometries and all other calculations of compounds containing lanthanide ions and create new interesting possibilities for the design in-silico of novel and highly efficient lanthanide–organic edifice. - Highlights: • Photophysical behavior of Eu{sup 3+} and Tb{sup 3+} complexes of TAME5OX has been investigated. • This tripodal ligand forms thermodynamically stable Ln{sup 3+} complexes. • These compounds exhibit strong green fluorescence under physiological pH. • Green fluorescence gets quenched under acidic and basic conditions, due to PET process. • This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensors.

  20. Visible photoluminescence in polycrystalline terbium doped aluminum nitride (Tb:AlN) ceramics with high thermal conductivity

    Science.gov (United States)

    Wieg, A. T.; Kodera, Y.; Wang, Z.; Imai, T.; Dames, C.; Garay, J. E.

    2012-09-01

    Thermal management continues to be one of the major challenges in the development of high powered light sources such as solid state lasers. In particular, the relatively low thermal conductivity of standard photoluminescent (PL) materials limits the overall power output and/or duty cycle. We present a method based on current activated pressure assisted densification for the fabrication of high thermal conductivity PL materials: rare earth doped polycrystalline bulk aluminum nitride. Specifically, the ceramics are translucent and are doped with Tb3+, allowing for emission in the visible. Remarkably, the ceramics have a room temperature thermal conductivity of 94 W/(m K) which is almost seven times higher than that of the state of the art host material, Nd-doped yttrium aluminum garnet. These light emitting properties coupled with very high thermal conductivity should enable the development of a wide variety of more powerful light sources.

  1. Preparation of extractive resins for producing terbium-161; Preparacion de resinas extractivas para produccion de terbio-161

    Energy Technology Data Exchange (ETDEWEB)

    De la Cruz B, C. C.; Monroy G, F. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)], e-mail: fabiola.monroy@inin.gob.mx

    2009-10-15

    This paper presents the development of a methodology for extractive resins preparation to base of HDEHP, which allows to separation of Tb from Gd generating an own technology of preparation of these resins. The study included the extractive resins preparation from 6 different supports: kieselguhr Dg, alumina, red volcanic rock, chiluca, quarry and fluorite; two treatment types of of supports and varied concentrations of HDEHP extractant (di(2-etil hexyl) orthophosphoric acid), in order to determine which resin has improved efficiency of Gd and Tb separation, and radionuclide purity of {sup 161}Tb. Resins were prepared to base of kieselguhr to determine the most appropriate silicon deposition process. Two silicon deposition treatments were realized: treatment I , by contact with silicon deposition solution (dimethyldichlorosilane / heptane 1:30) and treatment II by contact with vapors of dimethyldichlorosilane in vacuum. The extractant retention was carried out to different concentrations of HDEHP / acetone: 1:4, 1:8, 1:15, 1:20, 1:30 and 1:40. According to the results, there is not direct relation of HDEHP concentration used in extractive resins preparation to base of kieselguhr over the efficiency of Gd and Tb separation and of radionuclide purity of {sup 161}Tb. The effect of support in the efficiency of Gd and Tb separation was studied to prepare resins with the supports kieselguhr, alumina, quarry, chiluca, volcanic rock and fluorite, using the silicon deposition treatment II for the supports and a concentration of HDEHP / acetone 1:20, for extractant retention. Only resins based on kieselguhr could separate to Gd from Tb quantitatively, the resin at a concentration of HDEHP / Acetone 1:20 was the best results obtained in Gd and Tb separation, achieving a separation efficiency greater than 90% and a radionuclide purity higher than 99%. (Author)

  2. Synthesis and Characterization of Europium(III) and Terbium(III) Complexes: An Advanced Undergraduate Inorganic Chemistry Experiment

    Science.gov (United States)

    Swavey, Shawn

    2010-01-01

    Undergraduate laboratories rarely involve lanthanide coordination chemistry. This is unfortunate in light of the ease with which many of these complexes are made and the interesting and instructive photophysical properties they entail. The forbidden nature of the 4f transitions associated with the lanthanides is overcome by incorporation of…

  3. Sensitized green emission of terbium with dibenzoylmethane and 1, 10 phenanthroline in polyvinyl alcohol and polyvinyl pyrrolidone blends

    Science.gov (United States)

    Kumar, Brijesh; Kaur, Gagandeep; Rai, S. B.

    2017-12-01

    Tb doped polyvinyl alcohol: polyvinyl pyrrolidone blends with dibenzoylmethane (DBM) and 1, 10 Phenanthroline (Phen) have been prepared by solution cast technique. Bond formation amongst the ligands and Tb3 + ions in the doped polymer has been confirmed employing Fourier Transform Infrared (FTIR) techniques. Optical properties of the Tb3 + ions have been investigated using UV-Vis absorption, excitation and fluorescence studies excited by different radiations. Addition of dimethylbenzoate and 1, 10 Phenanthroline to the polymer blend increases the luminescence from Tb3 + ions along with energy transfer from the polymer blend itself. Luminescence decay curve analysis affirms the non-radiative energy transfer from DBM and Phen to Tb3 + ions, which is identified as the reason behind this enhancement. The fluorescence decay time of PVA-PVP host decreases from 6.02 ns to 2.31 ns showing an evidence of energy transfer from the host blend to the complexed Tb ions. Similarly the lifetime of DBM and Phen and both in the blend reduces in the complexed system showing the feasibility of energy transfer from these excited DBM and Phen to Tb3 + and is proposed as the cause of the above observations. These entire phenomena have been explained by the energy level diagram.

  4. A Terbium Metal-Organic Framework for Highly Selective and Sensitive Luminescence Sensing of Hg2+Ions in Aqueous Solution.

    Science.gov (United States)

    Xia, Tifeng; Song, Tao; Zhang, Gege; Cui, Yuanjing; Yang, Yu; Wang, Zhiyu; Qian, Guodong

    2016-12-19

    A series of isomorphic lanthanide metal-organic frameworks (MOFs) Ln(TATAB)⋅(DMF) 4 (H 2 O)(MeOH) 0.5 (LnTATAB, Ln=Eu, Tb, Sm, Dy, Gd; H 3 TATAB=4,4',4''-s-triazine-1,3,5-triyltri-p-aminobenzoic acid) have been solvothermally synthesized and structurally characterized. Among these MOFs, TbTATAB exhibits good water stability and a high fluorescence quantum yield. Because mercury ions (Hg 2+ ) have a high affinity to nitrogen atoms, and the space between multiple nitrogen atoms from triazine and imino groups is suitable for interacting with Hg 2+ ions, TbTATAB shows highly selective and sensitive detection of Hg 2+ in aqueous solution with a detection limit of 4.4 nm. Furthermore, it was successfully applied to detect Hg 2+ ions in natural water samples. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. 46 CFR 170.015 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    .... The material is also available for inspection at the U.S. Coast Guard, Office of Design and..., Philadelphia, PA 19111: (1) MIL-P-21929B, Plastic Material, Cellular Polyurethane, Foam in Place, Rigid, 1970...

  6. 40 CFR 170.240 - Personal protective equipment.

    Science.gov (United States)

    2010-07-01

    ... aprons, chemical-resistant headgear, and protective eyewear. (2) Long-sleeved shirts, short-sleeved... “chemical-resistant headgear” is specified by the product labeling, it shall be either a chemical resistant...-resistant footwear need not be worn. A helmet may be substituted for chemical-resistant headgear. A visor...

  7. 40 CFR 170.130 - Pesticide safety training for workers.

    Science.gov (United States)

    2010-07-01

    ... in effect, the agricultural employer shall assure that the worker has been provided the pesticide... applies has been applied or a restricted-entry interval for such pesticide has been in effect, the...) Hazards of pesticides resulting from toxicity and exposure, including acute and chronic effects, delayed...

  8. 26 CFR 1.170A-14 - Qualified conservation contributions.

    Science.gov (United States)

    2010-04-01

    ... farmland and forest land) within the meaning of paragraph (d)(4) of this section, or (iv) The preservation... real property interest to preserve open space (including farmland and forest land) will meet the... is surrounded by a high stone wall which obscures the public's view of it from the street. Pursuant...

  9. Socrus non socra (App. Pr. 170. The Hispanic Epigraphic Dossier

    Directory of Open Access Journals (Sweden)

    Juan Manuel Abascal Palazón

    2015-12-01

    Full Text Available The use of socra instead of socrus is common in the Latin epigraphy of the Principate. In the whole Roman Empire, textual evidences of socra/socera surpass the testimonies of socrus. In the light of the expression socrus non socra collected in the Appendix Probi, are discussed the five testimonies of the word socra known today in the Roman inscriptions of the Iberian Peninsula. The article includes a textual correction of a Roman stela from Campo Arcís (Requena, Valencia. Hispania citerior.

  10. Glacial Features (Point) - Quad 170 (PORTSMOUTH, NH-ME)

    Data.gov (United States)

    University of New Hampshire — The Glacial Features (Point) layer describes point features associated with surficial geology. These glacial features include, but are not limited to, delta forsets,...

  11. 14 CFR 135.170 - Materials for compartment interiors.

    Science.gov (United States)

    2010-01-01

    ... and the peak heat release rate must not exceed 100 kilowatts per square meter. (ii) Each airplane with... heat release rate shall not exceed 100 kilowatts per square meter. (vi) Each airplane that was type... August 20, 1990, must comply with the heat release rate testing provisions of § 25.853(d) in effect March...

  12. Publications | Page 170 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce guide est destiné aux personnes qui travaillent dans le secteur de la recherche et du développement. Il présente les concepts de la communication participative pour le développement, traite des méthodes de communication bilatérale efficaces, et présente une méthodologie pour planifier,... Wastewater Use in Irrigated ...

  13. Thomas Alva Edison (170th Anniversary of His Birth)

    OpenAIRE

    V. P. Samokhin; E A. Tikhomirovа

    2017-01-01

    A brief overview of the major technical achievements of Thomas Edison, an outstanding American inventor, author of more than 1,000 US patents and several thousand patents in other countries, honorary academician of the USSR. Presents biographical information and details of the formation of Edison, his work as a telegrapher, organizing the world's first industrial research laboratory for the continuous development of technological innovations, as well as some interesting facts about his life a...

  14. Thomas Alva Edison (170th Anniversary of His Birth

    Directory of Open Access Journals (Sweden)

    V. P. Samokhin

    2017-01-01

    Full Text Available A brief overview of the major technical achievements of Thomas Edison, an outstanding American inventor, author of more than 1,000 US patents and several thousand patents in other countries, honorary academician of the USSR. Presents biographical information and details of the formation of Edison, his work as a telegrapher, organizing the world's first industrial research laboratory for the continuous development of technological innovations, as well as some interesting facts about his life and work. This includes pioneering work on the creation of Edison incandescent lighting, the distribution system for their power and cinema. Edison can be considered the founder of the multimedia technology, as it was the beginning of the invention of the phonograph of phonics and disc phonograph recording of depth was the basis of mechanical recording. Name Edison are geographic features, a lot of companies and educational institutions. He was a member of many Academies of Sciences and entered the list of "100 most outstanding people for 1,000 years." Bust open in the Hall of Fame of great Americans, and a bronze statue - sculptures at the National Hall on Capitol Hill.

  15. 46 CFR 154.170 - Outer hull steel plating.

    Science.gov (United States)

    2010-10-01

    ... strake must be at least Grade E steel or a grade of steel that has equivalent chemical properties... chemical properties, mechanical properties, and heat treatment, and that is specially approved by the... ambient cold conditions of still air at 5 °C (41 °F) and still sea water at 0 °C (32 °F); (ii) For cargo...

  16. Dicty_cDB: CFF170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FIYFNDDIFFGAPVSVSDFWDSDAGQAIYK SSWTAPQSKEKQSNIWHACIAYTNDLLNNIWEVDNKNRHYASHGHQFFTREIFDRMYQDL EPEFKKTS...FIYFNDDIFFGAPVSVSDFWDSDAGQAIYK SSWTAPQSKEKQSNIWHACIAYTNDLLNNIWEVDNKNRHYASHGHQFFTREIFDRMYQDL EPEFKKTS

  17. CASSINI HIGH RATE DETECTOR V17.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The High Rate Detector (HRD) from the University of Chicago is an independent part of the CDA instrument on the Cassini Orbiter that measures the dust flux and...

  18. Dicty_cDB: AHB170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N BI742991 |BI742991.1 kx37e02.y1 Parastrongyloides trichosuri IL pAMP1 v1 ... ;, mRNA sequence. 70 5e-09 2 BI743756 |BI743756.1 kx52f02.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastrongy...0 5e-09 2 BI501287 |BI501287.1 kx30d02.y1 Parastrongyloides trichosuri PA pAMP1 v...1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to TR:O08810 O08810 U5-116KD. ;, mRNA sequ...ence. 70 7e-09 2 BI743844 |BI743844.1 kx53f10.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastrongyloides

  19. What we do | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Avian Influenza in Migratory Birds : Regional Surveillance and Monitoring Network. The highly pathogenic avian influenza (HPAI) virus H5N1 produces severe disease and high mortality in domestic poultry, waterfowl and other bird species. Central Asia, Far East Asia, South Asia, Cambodia, China, Indonesia, Viet Nam, ...

  20. 41 CFR 105-8.170-11 - Hearing.

    Science.gov (United States)

    2010-07-01

    ... a petition if, in his or her opinion, the petitioner has a legitimate interest in the proceedings...) Receive, rule on, exclude, or limit evidence; (6) Rule on procedural items pending before him or her; and... Administrative Procedure Act (5 U.S.C. 551-559). (d) Technical rules of evidence shall not apply to hearings...

  1. jess170.pdf | aug2010 | jess | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    How to combat infectious diseases: The role of Science Academies · Academy Public Lecture and INSA–Leopoldina Lecture by Prof. Jörg Hacker, President, German Academy of Sciences Leopoldina. 4 December, 2017, 4 PM Faculty Hall, Indian Institute ...

  2. 30 CFR 206.170 - What does this subpart contain?

    Science.gov (United States)

    2010-07-01

    ... Federal leases. (b) If the specific provisions of any Federal statute, treaty, negotiated agreement... are inconsistent with any regulation in this subpart, then the Federal statute, treaty, negotiated... calculate the value of production for royalty purposes under methods other than those the regulations in...

  3. 21 CFR 170.22 - Safety factors to be considered.

    Science.gov (United States)

    2010-04-01

    ... evidence is submitted which justifies use of a different safety factor, a safety factor in applying animal experimentation data to man of 100 to 1, will be used; that is, a food additive for use by man will not be granted... experimental animals. ...

  4. 21 CFR 161.170 - Canned Pacific salmon.

    Science.gov (United States)

    2010-04-01

    ... 1.814 kg (64 oz). 301×411 454 g (16 oz). 301×408 439 g (151/2 oz). 401×211 439 g (151/2 oz). 607×406×108 439 g (151/2 oz). 301×308 340 g (12 oz). 307×200.25 220 g (73/4 oz). 513×307×103 220 g (73/4 oz... substandard fill specified in § 130.14(b) of this chapter, in the manner and form therein specified. [42 FR...

  5. 7 CFR 1.170 - Appeal to the Judicial Officer.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Rules of Practice Governing... ordered in advance by the Judicial Officer for good cause shown upon request of a party or upon the... given reasonable notice of such determination, so as to permit preparation of adequate arguments on all...

  6. 48 CFR 2132.170 - Recurring premium payments to Contractors.

    Science.gov (United States)

    2010-10-01

    ... MANAGEMENT, FEDERAL EMPLOYEES GROUP LIFE INSURANCE FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING.... (b) Withdrawals from the LOC account for benefit costs of $5,000 or more will be made on a claims... Contractor's bank for payment. (c) Nothing in this chapter will affect the ability of the Contractor to hold...

  7. 45 CFR 170.299 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    ...) Regenstrief Institute, Inc., LOINC® c/o Medical Informatics The Regenstrief Institute, Inc 410 West 10th... for Immunization and Respiratory Diseases Immunization Information System Support Branch—Informatics...

  8. 25 CFR 170.923 - What qualifies for ERFO funding?

    Science.gov (United States)

    2010-04-01

    ... any external cause. The Secretary of Transportation determines eligible repairs under 23 CFR 668, subpart B. (1) Examples of natural disasters include, but are not limited to, floods, earthquakes...

  9. 40 CFR 52.170 - Identification of plan.

    Science.gov (United States)

    2010-07-01

    ... at 1445 Ross Avenue, Suite 700, Dallas, Texas, 75202-2733; the EPA, Air and Radiation Docket and... Nitrogen Oxides 07/03/06 04/12/07 (72 FR 18394) Reg. 31.410 Offset Requirements 07/03/06 04/12/07 (72 FR.../72 05/31/72 (37 FR 10841) Ref 52.200(a) & (b). 82-1942 Radiation Control Law Not Amended or Repealed...

  10. 48 CFR 207.170-3 - Policy and procedures.

    Science.gov (United States)

    2010-10-01

    ... $6 million unless the acquisition strategy includes— (1) The results of market research; (2) Identification of any alternative contracting approaches that would involve a lesser degree of consolidation; and... justified if the benefits of the acquisition strategy substantially exceed the benefits of each of the...

  11. Page 170 Use of Electronic Resources by Undergraduates in Two ...

    African Journals Online (AJOL)

    The evolution of information technology in the twentieth century has influenced students' use of information resources. Today, many students access information electronically via the Internet using desktop, laptop, palmtop and mobile phones. Electronic resources supply all the information that a library provides through ...

  12. 10 CFR 170.12 - Payment of fees.

    Science.gov (United States)

    2010-01-01

    ... permit or combined license referencing the permit is filed. If, at the end of the renewal period of the permit, no facility application referencing the early site permit has been docketed, the permit holder... licensees' land-use survey reports; (v) 10 CFR 50.71 final safety analysis reports; and (vi) Contested...

  13. 40 CFR 170.235 - Posted pesticide safety information.

    Science.gov (United States)

    2010-07-01

    ..., and a hat or scarf). (iv) Wash/shower with soap and water, shampoo hair, and put on clean clothes... immediately in the nearest clean water if pesticides are spilled or sprayed on the body. As soon as possible, shower, shampoo, and change into clean clothes. (vii) Follow directions about keeping out of treated or...

  14. 40 CFR 170.135 - Posted pesticide safety information.

    Science.gov (United States)

    2010-07-01

    ... and socks, and a hat or scarf). (iv) Wash/shower with soap and water, shampoo hair, and put on clean...) Wash immediately in the nearest clean water if pesticides are spilled or sprayed on the body. As soon as possible, shower, shampoo, and change into clean clothes. (vii) Follow directions about keeping...

  15. 40 CFR 170.110 - Restrictions associated with pesticide applications.

    Science.gov (United States)

    2010-07-01

    ... greater than 150 psi, or (b) Applied as a: (i) Fumigant, or (ii) Smoke, or (iii) Mist, or (iv) Fog, or (v... respiratory protection device is required for application by the product labeling. (3) Applied otherwise... fans or other mechanical ventilating systems; or (iii) Four hours of ventilation using vents, windows...

  16. Dicty_cDB: VSD170 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available f query: 144 length of database: 80,480,566 effective HSP length: 17 effective length of query: 127 effective... length of database: 78,821,179 effective search space: 10010289733 effective se...ces better than 10.0: 0 length of query: 144 length of database: P,794,892,705 effective HSP length: 21 effective... length of query: 123 effective length of database: P,261,936,330 effective search space: 3968218168590 effective

  17. Role of mp 170 Seprase in Breast Cancer.

    Science.gov (United States)

    1999-07-01

    Proteina ) whose expression is selectively induced in vivo in stromal fibroblasts of various human carcinomas (breast, ovarian, colorectal, bladder and...Aigner, A., Tuveson, A.T., Berchem, G ., and Wellstein, A. (1997) Nat. Med. 3,1137-1140 10. Czubayko, F., Smith, R.V., Chung, H.C., and Wellstein, A...Wellstein, A. (1997) Oncogene 14, 2671-2681 14. Wellstein, A, Lupu, R, Zugmaier, G ., Flamm, S.L., Cheville, A.L., Delli Bovi, P., Basilico, C, Lippman

  18. All projects related to | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2013-02-25

    Women-owned enterprises tend to concentrate near the lower end of the productivity and growth scale in sub-Saharan Africa. Start Date: February 25, 2013. End Date: August 25, 2015. Topic: WOMEN MANAGERS, ENTREPRENEURS, Poverty, GENDER DISCRIMINATION, Economic and social development, GENDER ...

  19. 48 CFR 702.170-3 - Contracting activities.

    Science.gov (United States)

    2010-10-01

    ... within the responsibility of other contracting activities, or which are otherwise assigned to it. (b) The overseas field contracting activities. Each USAID Mission or post overseas is a contracting activity...), which sets forth the contracting authority for Mission Directors and principal USAID officers at posts. ...

  20. 26 CFR 1.170A-9T - Definition of section 170(b)(1)(A) organization (temporary).

    Science.gov (United States)

    2010-04-01

    ... governmentally supported museums of history, art, or science, libraries, community centers to promote the arts...; and (C) Amounts paid to child placement or child guidance organizations under government programs for services rendered to children in the community, are considered payments the purpose of which is primarily...

  1. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  2. CCDC 954774: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4'-(tetrazol-2-id-5-yl)biphenyl-4-carboxylate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  3. CCDC 959634: Experimental Crystal Structure Determination : octakis(mu~3~-Hydroxo)-undecakis(mu~2~-2-fluorobenzoato)-(N,N-dimethylformamide)-nitrato-hexa-aqua-hexa-terbium

    KAUST Repository

    Guillerm, Vincent

    2014-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  4. CCDC 954773: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4-(tetrazol-2-id-5-yl)benzoate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  5. CCDC 954775: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(2-fluoro-4-(1H-tetrazol-5-yl)benzoate) tetrahydroxide tetradecahydrate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  6. CCDC 1411423: Experimental Crystal Structure Determination : catena-[dimethylammonium hexakis(mu-fumarato)-octakis(mu-hydroxo)-hexa-terbium N,N-dimethylformamide solvate hexahydrate

    KAUST Repository

    Assen, Ayalew H.

    2016-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  7. CCDC 1410946: Experimental Crystal Structure Determination : catena-[dimethylammonium tris(mu-naphthalene-1,4-dicarboxylato)-tetrakis(mu-hydroxo)-triaqua-tri-terbium(iii) unknown solvate

    KAUST Repository

    Xue, Dongxu

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  8. Phthalimides: Supramolecular Interactions in Crystals, Hypersensitive Solution 1H-NMR Dynamics and Energy Transfer to Europium(III and Terbium(III States

    Directory of Open Access Journals (Sweden)

    David J. Williams

    2003-07-01

    Full Text Available Detailed crystal structures and 1H-NMR characteristics of some alkylaminephthalimides, including dendritic polyphthalimides, are reported. These investigations were undertaken in order to obtain a better understanding of the relationship between solid-state supramolecular interactions, their persistence in solution and associated dynamics of magnetically hypersensitive phthalimide aromatic AA'BB'-AA'XX' proton NMR resonances. Some alkylamine phthalimides feature folded molecular geometries, which we attribute to n-π interactions among proximal amine-phthalimide sites; those alkylamine-phthalimides that have no possibility for such interactions feature fully extended phthalimide functionalities. Accordingly, alkylamine phthalimide compounds with folded solid-state geometries feature solvent and temperature dependent hypersensitive AA'BB'-AA'XX' 1H-NMR line profiles, which we attribute to the n-π interactions. Luminescence of Eu3+(5D0 and Tb3+(5D4 states show well defined metal ion environments in their complexes with dendritic phthalimides, as well as relatively weak phthalimide-lanthanide(III interactions.

  9. Analysis of tryptophan at nmoll(-1) level based on the fluorescence enhancement of terbium-gadolinium-tryptophan-sodium dodecyl benzene sulfonate system.

    Science.gov (United States)

    Liu, Shufang; Yang, Jinghe; Wu, Xia; Su, Benyu; Sun, Changxia; Wang, Feng

    2004-10-08

    It is found that Tb(3+) can react with tryptophan (Trp) and sodium dodecyl benzene sulfonate (SDBS), and emits the intrinsic fluoresence of Tb(3+). The fluorescence intensity can be enhanced by La(3+), Gd(3+), Lu(3+), Sc(3+) and Y(3+), among which Gd(3+) has the greatest enhancement. This is a new co-luminescence system. The studies indicate that in the Tb-Gd-Trp-SDBS system, there is both Tb-Trp-SDBS and Gd-Trp-SDBS complexes, and they aggregate together and form a large congeries. The fluorescence enhancement of the Tb-Gd-Trp-SDBS system is considered to originate from intramolecular and intermolecular energy transfers, and the energy-insulating sheath effect of Gd-Trp-SDBS complex. Under the optimum conditions, the enhanced intensity of fluorescence is in proportion to the concentration of Trp in the range from 4x10(-8) to 4x10(-5)moll(-1). The detection limit is 10(-9)moll(-1). The proposed method is one of the most sensitive fluoremetries of Trp.

  10. Preparation, characterization, and properties of PMMA-doped polymer film materials: a study on the effect of terbium ions on luminescence and lifetime enhancement.

    Science.gov (United States)

    Zhang, Hui-Jie; Fan, Rui-Qing; Wang, Xin-Ming; Wang, Ping; Wang, Yu-Lei; Yang, Yu-Lin

    2015-02-14

    Poly(methylmethacrylate) (PMMA) doped with Tb-based imidazole derivative coordination polymer {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) (1) (L = N,N'-bis(acetoxy)biimidazole) was synthesized and its photophysical properties were studied. The L'(L' = N,N'-bis(ethylacetate)biimidazole) ligand was synthesized by an N-alkylation reaction process followed by ester hydrolysis to produce ligand L. Polymer 1 and ligand L' have been characterized by (1)H NMR and IR spectroscopy, elemental analysis, PXRD and X-ray single-crystal diffraction. Coordination polymer 1 is the first observation of a CdCl(2) structure constructed with hydroxy groups and decorated by ligand L in lanthanide N-heterocyclic coordination polymers. In the 2D layered structure of 1, each Tb3 metal center is connected with three Tb1 and three Tb2 metal centers by seven hydroxyl groups in different directions, resulting in a six-membered ring. After doping, not only the luminescence intensity and lifetime enhanced, but also their thermal stability was increased in comparison with 1. When 1 was doped into poly(methylmethacrylate) (1@PMMA), polymer film materials were formed with the PMMA polymer matrix (w/w = 2.5%-12.5%) acting as a co-sensitizer for Tb(3+) ions. The luminescence intensity of the Tb(3+) emission at 544 nm increases when the content of Tb(3+) was 10%. The lifetime of 1@PMMA (914.88 μs) is more than four times longer than that of 1 (196.24 μs). All τ values for the doped polymer systems are higher than coordination polymer 1, indicating that radiative processes are operative in all the doped polymer films. This is because PMMA coupling with the O-H oscillators from {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) can suppress multiphonon relaxation. According to the variable-temperature luminescence (VT-luminescence) investigation, 1@PMMA was confirmed to be a stable green luminescent polymer film material.

  11. Changing Single-Molecule Magnet Properties of a Windmill-Like Distorted Terbium(III) α-Butoxy-Substituted Phthalocyaninato Double-Decker Complex by Protonation/Deprotonation.

    Science.gov (United States)

    Horii, Yoji; Horie, Yusuke; Katoh, Keiichi; Breedlove, Brian K; Yamashita, Masahiro

    2018-01-16

    Synthesis, structures, and magnetic properties of α-butoxy-substituted phthalocyaninato double-decker complexes Tb(α-obPc)2 (1-) (α-obPc: dianion of 1,4,8,11,15,18,22,25-octa(n-butoxy)phthalocyaninato) with protonated (1H), deprotonated (1[HDBU]), and diprotonated forms (1H2+) are discussed. X-ray analysis was used to confirm the position of the proton in 1H, and it was revealed that the protonation induced asymmetric distortion in 1H. In contrast, 1[HDBU] was distorted in a highly symmetric windmill-like fashion. 1H is arranged in a slipped column array in the crystal packing, whereas 1[HDBU] is arranged in a one-dimensional fashion, in which the magnetic easy axes of 1[HDBU] lie along the same line. From direct-current (dc) magnetic measurements, ferromagnetic Tb-Tb interactions occur in both 1H and 1[HDBU], and magnetic hysteresis was observed. However, the area of the magnetic hysteresis in 1[HDBU] is larger than that in 1H, meaning that magnetic relaxation time (τ) is longer in 1[HDBU]. In addition, the results of alternating-current magnetic measurements in a zero dc magnetic field indicate that τ of 1[HDBU] is longer as compared to 1H. In other words, protonation/deprotonation affects not only the molecular structures and crystal packing but also the single-molecule magnet properties.

  12. A Water-Stable Dual-Channel Luminescence Sensor for UO22+Ions Based on an Anionic Terbium(III) Metal-Organic Framework.

    Science.gov (United States)

    Ye, Junwei; Bogale, Raji F; Shi, Yangwei; Chen, Yanzhen; Liu, Xigang; Zhang, Siqi; Yang, Yaoyao; Zhao, Jianzhang; Ning, Guiling

    2017-06-07

    A stable 3D Tb III -based metal-organic framework [Tb(BPDC) 2 ]⋅(CH 3 ) 2 NH 2 (DUT-101) was synthesized, and it is the first efficient dual-channel luminescence sensor for aqueous UO 2 2+ ions. DUT-101 contains an anionic three-dimensional framework and protonated dimethylamine molecules embedded within the channels. The intense green emission of DUT-101 could be highly selectively and sensitively quenched by UO 2 2+ ions even in the presence of other competing metal ions. A possible sensing mechanism was proposed based on both suppression of luminescence resonance energy transfer and enhancement of intermolecular electron transfer. Furthermore, visual green fluorescent test papers based on DUT-101 were fabricated and could be used to discriminate UO 2 2+ ions among various metal ions. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. [?-N,N?-Bis(3-meth?oxy-2-oxidobenzyl?idene)propane-1,3-diamine]trinitratocopper(II)terbium(III) acetone solvate

    OpenAIRE

    Zhang Fang; Liu Fei

    2008-01-01

    In the title complex, [CuTb(C19H20N2O4)(NO3)3]·CH3COCH3, the CuII atom is four-coordinated by two O atoms and two N atoms from the deprotonated Schiff base in a square-planar geometry, while the TbIII atom is ten-coordinated by four O atoms from the deprotonated Schiff base and six O atoms from three bidentate nitrate anions. The compound is isostructural with the previously reported GdIII analogue [Elmali & Elerman (2004). Z. Naturforsch. Teil B, 59, 535–540], which was described ...

  14. Crystal structure of a mixed-ligand terbium(III coordination polymer containing oxalate and formate ligands, having a three-dimensional fcu topology

    Directory of Open Access Journals (Sweden)

    Chainok Kittipong

    2016-01-01

    Full Text Available The title compound, poly[(μ3-formato(μ4-oxalatoterbium(III], [Tb(CHO2(C2O4]n, is a three-dimensional coordination polymer, and is isotypic with the LaIII, CeIII and SmIII analogues. The asymmetric unit contains one TbIII ion, one formate anion (CHO2− and half of an oxalate anion (C2O42−, the latter being completed by application of inversion symmetry. The TbIII ion is nine-coordinated in a distorted tricapped trigonal–prismatic manner by two chelating carboxylate groups from two C2O42− ligands, two carboxylate oxygen atoms from another two C2O42− ligands and three oxygen atoms from three CHO2− ligands, with the Tb—O bond lengths and the O—Tb—O bond angles ranging from 2.4165 (19 to 2.478 (3 Å and 64.53 (6 to 144.49 (4°, respectively. The CHO2− and C2O42− anions adopt μ3-bridging and μ4-chelating-bridging coordination modes, respectively, linking adjacent TbIII ions into a three-dimensional 12-connected fcu topology with point symbol (324.436.56. The title compound exhibits thermal stability up to 623 K, and also displays strong green photoluminescence in the solid state at room temperature.

  15. Leptin receptor 170 kDa (OB-R170) protein expression is reduced in obese human skeletal muscle: a potential mechanism of leptin resistance

    DEFF Research Database (Denmark)

    Fuentes, T; Ara, I; Guadalupe-Grau, A

    2010-01-01

    To examine whether obesity-associated leptin resistance could be due to down-regulation of leptin receptors (OB-Rs) and/or up-regulation of suppressor of cytokine signalling 3 (SOCS3) and protein tyrosine phosphatase 1B (PTP1B) in skeletal muscle, which blunt janus kinase 2-dependent leptin...... had a greater amount of leptin receptors than the vastus lateralis, whilst SOCS3 protein expression was increased and basal STAT3, AMPKalpha and ACCbeta phosphorylation levels were reduced in the vastus lateralis compared with the deltoid muscle (all P leptin...... receptors and leptin signalling are reduced in obesity, particularly in the leg muscles....

  16. CCDC 1410822: Experimental Crystal Structure Determination : heptakis(dimethylammonium) dodecakis(mu-hydroxo)-bis(mu-oxo)-nonaaqua-nona-terbium tris(octakis(mu-hydroxo)-triaqua-bis(2-fluorobenzoato)-bis(formato)-hexa-terbium) dodecakis(5-[(4-carboxylatophenyl)methoxy]benzene-1,3-dicarboxylate) unknown solvate

    KAUST Repository

    Alezi, Dalal

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  17. Photodynamic therapy of early stage oral cavity and oropharynx neoplasms: an outcome analysis of 170 patients

    NARCIS (Netherlands)

    Karakullukcu, B.; van Oudenaarde, K.; Copper, M.P.; Klop, W.M.C.; van Veen, R.; Wildeman, M.; Tan, I.

    2011-01-01

    The indications of photodynamic therapy (PDT) of oral cavity and oropharynx neoplasms are not well defined. The main reason is that the success rates are not well established. The current paper analyzes our institutional experience of early stage oral cavity and oropharynx neoplasms (Tis-T2) to

  18. 45 CFR 170.302 - General certification criteria for Complete EHRs or EHR Modules.

    Science.gov (United States)

    2010-10-01

    ... specifications adopted in this part: (a) Drug-drug, drug-allergy interaction checks—(1) Notifications...-drug and drug-allergy contraindications based on medication list, medication allergy list, and... notifications provided for drug-drug and drug-allergy interaction checks. (b) Drug-formulary checks. Enable a...

  19. 26 CFR 1.170A-3 - Reduction of charitable contribution for interest on certain indebtedness.

    Science.gov (United States)

    2010-04-01

    ..., 1970, payment of $275. (c) The market value of the bond on December 1, 1970, was $9,902. Such value... bond, a liability is assumed by the recipient or by any other person, or if the bond is subject to a... purchase or carry such bond, and which is attributable to any period before the making of the contribution...

  20. Nasrin et al., Afr J Tradit Complement Altern Med. (2011) 8(S):170 ...

    African Journals Online (AJOL)

    AJTCAM

    Considering the controversy over the risk of toxic heavy metals in Ayurvedic herbo-mineral .... (Approved by the Government of Bangladesh vide Ministry of Health and Family Welfare Memo No. ... parameters such as total protein, serum albumin, bilirubin (total and direct), serum ..... Preparation and characterization of a.