WorldWideScience

Sample records for terbium 138

  1. Elastic properties of terbium

    DEFF Research Database (Denmark)

    Spichkin, Y.I.; Bohr, Jakob; Tishin, A.M.

    1996-01-01

    The temperature dependence of the Young modulus along the crystallographic axes b and c (E(b) and E(c)), and the internal friction of a terbium single crystal have been measured. At 4.2 K, E(b) and E(c) are equal to 38 and 84.5 GPa, respectively. The lattice part of the Young modulus and the Debye...... temperature has been calculated. The origin of the Young modulus anomalies arising at the transition to the magnetically ordered state is discussed....

  2. Critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1968-01-01

    The inelasticity of the critical scattering of neutrons in terbium has been measured above the Neél temperature at the (0, 0, 2−Q) satellite position. The results show that dynamic slowing down of the fluctuations does occur in a second‐order phase transition in agreement with the general theory...

  3. Semiconductor composition containing iron, dysprosium, and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.

    2017-09-26

    An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.

  4. 13.8

    CERN Document Server

    Gribbin, John

    2015-01-01

    The twentieth century gave us two great theories of physics. The general theory of relativity describes the behaviour of very large things; quantum theory the behaviour of very small things. In this landmark book, John Gribbin - one of the best-known writers of popular science over the past 30 years - presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified 'Theory of Everything' that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe and everything. With his inimitable mixture of science, history and biography, Gribbin shows how - despite scepticism among many physicists - these two great theories are indeed very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age of the Universe: 13.8 billion years.

  5. Raman spectroscopy study of the doping effect of the encapsulated terbium halogenides on single-walled carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Kharlamova, M.V.; Kramberger, C.; Mittelberger, A. [University of Vienna, Faculty of Physics, Vienna (Austria)

    2017-04-15

    In the present work, the doping effect of terbium chloride, terbium bromide, and terbium iodide on single-walled carbon nanotubes (SWCNTs) was compared by Raman spectroscopy. A precise investigation of the doping-induced alterations of the Raman modes of the filled SWCNTs was conducted. The shifts of the components of the Raman modes and modification of their profiles allowed concluding that the inserted terbium halogenides have acceptor doping effect on the SWCNTs, and the doping efficiency increases in the line with terbium iodide, terbium bromide, and terbium chloride. (orig.)

  6. Magnetocaloric effect of thin Terbium films

    Science.gov (United States)

    Mello, V. D.; Anselmo, D. H. A. L.; Vasconcelos, M. S.; Almeida, N. S.

    2017-12-01

    We report a theoretical study of the magnetocaloric effect of Terbium (Tb) thin films due to finite size and surface effects in the helimagnetic phase, corresponding to a temperature range from TC=219 K to TN=231 K, for external fields of the order of kOe. For a Tb thin film of 6 monolayers submitted to an applied field (ΔH =30 kOe, ΔH =50 kOe and ΔH = 70 kOe) we report a significative change in adiabatic temperature, ΔT / ΔH , near the Néel temperature, of the order ten times higher than that observed for Tb bulk. On the other hand, for small values of the magnetic field, large thickness effects are found. For external field strength around few kOe, we have found that the thermal caloric efficiency increases remarkably for ultrathin films. For an ultrathin film with 6 monolayers, we have found ΔT / ΔH = 43 K/T while for thicker films, with 20 monolayers, ΔT / ΔH = 22 K/T. Our results suggest that thin films of Tb are a promising material for magnetocaloric effect devices for applications at intermediate temperatures.

  7. Femtosecond XUV spectroscopy of gadolinium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Carley, Robert; Frietsch, Bjoern; Doebrich, Kristian; Teichmann, Martin; Gahl, Cornelius; Noack, Frank [Max-Born-Institute, Berlin (Germany); Schwarzkopf, Olaf; Wernet, Philippe [Helmholtz-Zentrum fuer Materialien und Energie (BESSY II), Berlin (Germany); Weinelt, Martin [Max-Born-Institute, Berlin (Germany); Fachbereich Physik, Freie Universitaet, Berlin (Germany)

    2011-07-01

    We present recent results of time-resolved IR-pump-XUV-probe experiments on the ultrafast demagnetization of thin films of Gadolinium(0001) and Terbium(0001) on Tungsten(110). The experiments are the first to be done using a newly developed high-order harmonics (HHG) XUV beamline at the MBI. The beamline delivers monochromated XUV pulses of approximately 150 fs duration with a photon energy resolution of up to 150 meV. Following excitation by intense femtosecond infrared (IR) pulses, photoemission with 35 eV photons allows us to directly probe the 4f electrons and their interaction with the valence band, both in the bulk and at the surface, to follow the ultrafast magnetization dynamics in the Lanthanide metals. As signatures of ultrafast demagnetization of the metal by the IR pulse, we see for the first time, rapid strong reduction of the exchange splitting in the valence band. This is followed by a slower demagnetization due to the spin-lattice interaction.

  8. 21 CFR 133.138 - Edam cheese.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Edam cheese. 133.138 Section 133.138 Food and... CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.138 Edam cheese. (a) Description. (1) Edam cheese is the food prepared by the procedure set...

  9. 7 CFR 1956.138 - Processing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Processing. 1956.138 Section 1956.138 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) DEBT SETTLEMENT Debt Settlement-Community and Business Programs § 1956.138 Processing...

  10. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    Glasses; terbium ion; oscillator strengths; fluorescence; lifetimes; fibre lasers. 1. Introduction. Today glasses are most favourable engineering materials for abundant applications due to the wide ability of property altering by compositional modifications. The considerable examination of glass science to achieve required ...

  11. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 39; Issue 3. Green fluorescence of terbium ions in lithium fluoroborate glasses for fibre lasers and display devices. G R DILLIP C MADHUKAR REDDY M RAJESH SHIVANAND CHAURASIA B DEVA PRASAD RAJU S W JOO. Volume 39 Issue 3 June 2016 pp 711-717 ...

  12. Terahertz Cherenkov radiation from ultrafast magnetization in terbium gallium garnet

    Science.gov (United States)

    Gorelov, S. D.; Mashkovich, E. A.; Tsarev, M. V.; Bakunov, M. I.

    2013-12-01

    We report an experimental observation of terahertz Cherenkov radiation from a moving magnetic moment produced in terbium gallium garnet by a circularly polarized femtosecond laser pulse via the inverse Faraday effect. Contrary to some existing theoretical predictions, the polarity of the observed radiation unambiguously demonstrates the paramagnetic, rather than diamagnetic, nature of the ultrafast inverse Faraday effect. From measurements of the radiation field, the Verdet constant in the subpicosecond regime is ˜3-10 times smaller than its table quasistatic value.

  13. 40 CFR 35.138 - Competitive grants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Competitive grants. 35.138 Section 35.138 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE... Competitive grants. (a) Some environmental program grants are awarded through a competitive process. An...

  14. Terbium luminescence in alumina xerogel fabricated in porous anodic alumina matrix under various excitation conditions

    Energy Technology Data Exchange (ETDEWEB)

    Gaponenko, N. V., E-mail: nik@nano.bsuir.edu.by [Belarusian State University of Informatics and Radioelectronics (Belarus); Kortov, V. S. [Yeltsin Ural Federal University (Russian Federation); Orekhovskaya, T. I.; Nikolaenko, I. A. [Belarusian State University of Informatics and Radioelectronics (Belarus); Pustovarov, V. A.; Zvonarev, S. V.; Slesarev, A. I. [Yeltsin Ural Federal University (Russian Federation); Prislopski, S. Ya. [National Academy of Sciences of Belarus, Stepanov Institute of Physics (Belarus)

    2011-07-15

    Terbium-doped alumina xerogel layers are synthesized by the sol-gel method in pores of a porous anodic alumina film 1 {mu}m thick with a pore diameter of 150-180 nm; the film is grown on a silicon substrate. The fabricated structures exhibit terbium photoluminescence with bands typical of trivalent terbium terms. Terbium X-ray luminescence with the most intense band at 542 nm is observed for the first time for such a structure. Morphological analysis of the structure by scanning electron microscopy shows the presence of xerogel clusters in pore channels, while the main pore volume remains unfilled and pore mouths remain open. The data obtained confirm the promising applications of fabricated structures for developing matrix converters of X-rays and other ionizing radiations into visible light. The possibilities of increasing luminescence intensity in the matrix converter are discussed.

  15. 45 CFR 147.138 - Patient protections.

    Science.gov (United States)

    2010-10-01

    ... INSURANCE REFORM REQUIREMENTS FOR THE GROUP AND INDIVIDUAL HEALTH INSURANCE MARKETS § 147.138 Patient... participant (in the individual market, primary subscriber) of the terms of the plan or health insurance.... If a group health plan, or a health insurance issuer offering group or individual health insurance...

  16. 49 CFR 176.138 - Deck stowage.

    Science.gov (United States)

    2010-10-01

    ... Requirements for Class 1 (Explosive) Materials Stowage § 176.138 Deck stowage. (a) [Reserved] (b) Class 1 (explosive) materials may not be stowed within a horizontal distance of 6 m (20 feet) from any fire.... They must be clear of walkways and cargo working areas, fire hydrants, steam pipes, and means of access...

  17. RNF138 joins the HR team

    DEFF Research Database (Denmark)

    Bekker-Jensen, Simon; Mailand, Niels

    2015-01-01

    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  18. Optical Properties of Lithium Terbium Fluoride and Implications for Performance in High Power Lasers (Postprint)

    Science.gov (United States)

    2016-02-01

    AFRL-RX-WP-JA-2016-0323 OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS... AMERICA (STINFO COPY) AIR FORCE RESEARCH LABORATORY MATERIALS AND MANUFACTURING DIRECTORATE WRIGHT-PATTERSON AIR FORCE BASE, OH 45433-7750 AIR...OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS (POSTPRINT) 5a. CONTRACT NUMBER IN-HOUSE 5b

  19. Detection of biothiols in cells by a terbium chelate-Hg (II) system

    Science.gov (United States)

    Tan, Hongliang; Chen, Yang

    2012-01-01

    Great efforts have been devoted to the development of sensitive and specific analysis methods for biothiols because of their important roles in biological systems. We present a new detection system for biothiols that is based on the reversible quenching and restoration of fluorescence of terbium chelate caused by Hg2+ and thiol species. In the presence of biothiols, a restoration of fluorescence of terbium chelate after quenching by Hg2+ was observed due to the interaction of Hg2+ with thiol groups, and the restored fluorescence increased with the concentration of biothiols. This method was sensitive and selective for biothiols. The detection limit was 80 nM for glutathione, 100 nM for Hcy, and 400 nM for Cysteine, respectively. The terbium chelate-Hg (II) system was successfully applied to determine the levels of biothiols in cancer cells and urine samples. Further, it was also shown to be comparable to Ellman's assay. Compared to other fluorescence methods, the terbium chelate probe is advantageous because interference from short-lived nonspecific fluorescence can be efficiently eliminated due to the long fluorescence lifetime of terbium chelate, which allows for detection by time-resolved fluorescence. The terbium chelate probe can serve as a diagnostic tool for the detection of abnormal levels of biothiols in disease.

  20. Cryogenic temperature characteristics of Verdet constant of terbium sesquioxide ceramics

    Science.gov (United States)

    Snetkov, I. L.; Palashov, O. V.

    2016-12-01

    The dependence of the Verdet constant on temperature in the (80-300 K) range for a promising magneto-active material terbium sesquioxide Tb2O3 at the wavelengths of 405-1064 nm is considered. For each of the studied wavelengths, the Verdet constant of the material cooled down to the liquid nitrogen temperature increased by more than a factor of 3.2 as compared to the room temperature value. Similarly to the other paramagnetics, the increase follows the law ∼1/T. Approximations for the temperature dependence of the Verdet constant have been obtained and the value of 1/V·(dV/dT) has been estimated. This information is needed to determine the angle of rotation as well as the variation of the extinction ratio of a Faraday isolator with temperature and extremely important at creation a cryogenic Faraday devices.

  1. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  2. Biogenic terbium oxide nanoparticles as the vanguard against osteosarcoma

    Science.gov (United States)

    Iram, Sana; Khan, Salman; Ansary, Abu Ayoobul; Arshad, Mohd; Siddiqui, Sahabjada; Ahmad, Ejaz; Khan, Rizwan H.; Khan, Mohd Sajid

    2016-11-01

    The synthesis of inner transition metal nanoparticles via an ecofriendly route is quite difficult. This study, for the first time, reports synthesis of terbium oxide nanoparticles using fungus, Fusarium oxysporum. The biocompatible terbium oxide nanoparticles (Tb2O3 NPs) were synthesized by incubating Tb4O7 with the biomass of fungus F. oxysporum. Multiple physical characterization techniques, such as UV-visible and photoluminescence spectroscopy, TEM, SAED, and zeta-potential were used to confirm the synthesis, purity, optical and surface characteristics, crystallinity, size, shape, distribution, and stability of the nanoemulsion of Tb2O3 NPs. The Tb2O3 NPs were found to inhibit the propagation of MG-63 and Saos-2 cell-lines (IC50 value of 0.102 μg/mL) and remained non-toxic up to a concentration of 0.373 μg/mL toward primary osteoblasts. Cell viability decreased in a concentration-dependent manner upon exposure to 10 nm Tb2O3 NPs in the concentration range 0.023-0.373 μg/mL. Cell toxicity was evaluated by observing changes in cell morphology, cell viability, oxidative stress parameters, and FACS analysis. Morphological examinations of cells revealed cell shrinkage, nuclear condensation, and formation of apoptotic bodies. The level of ROS within the cells-an indicator of oxidative stress was significantly increased. The induction of apoptosis at concentrations ≤ IC50 was corroborated by 4‧,6-diamidino-2-phenylindole dihydrochloride (DAPI) staining (DNA damage and nuclear fragmentation). Flow-cytometric studies indicated that the response was dose dependent with a threshold effect.

  3. 22 CFR Appendix A to Part 138 - Certification Regarding Lobbying

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certification Regarding Lobbying A Appendix A to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. A Appendix A to Part 138—Certification Regarding Lobbying Certification for Contracts, Grants...

  4. 22 CFR 138.300 - Professional and technical services.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.300 Section 138.300 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on...

  5. 32 CFR 935.138 - Motor bus operation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

  6. Autofluorescence-free Live-cell Imaging Using Terbium Nanoparticles.

    Science.gov (United States)

    Cardoso Dos Santos, Marcelina; Goetz, Joan; Bartenlian, Hortense; Wong, Ka-Leung; Charbonniere, Loïc Joanny; Hildebrandt, Niko

    2018-02-20

    Fluorescent nanoparticles (NPs) have become irreplaceable tools for advanced cellular and sub-cellular imaging. While very bright NPs require excitation with UV or visible light, which can create strong autofluorescence of biological components, NIR-excitable NPs without autofluorescence issues exhibit much lower brightness. Here, we show the application of a new type of surface-photosensitized terbium NPs (Tb-NPs) for autofluorescence-free intracellular imaging in live HeLa cells. Combination of exceptionally high brightness, high photostability, and long photoluminecence (PL) lifetimes for highly efficient suppression of the short-lived autofluorescence, allowed for time-gated PL imaging of intracellular vesicles over 72 h without toxicity and at extremely low Tb-NP concentrations down to 12 pM. Detection of highly resolved long-lifetime (ms) PL decay curves from small (~10 µm2) areas within single cells within a few seconds emphasized the unprecedented photophysical properties of Tb-NPs for live-cell imaging that extend well beyond currently available nanometric imaging agents.

  7. Solar Thermochemical Hydrogen Production via Terbium Oxide Based Redox Reactions

    Directory of Open Access Journals (Sweden)

    Rahul Bhosale

    2016-01-01

    Full Text Available The computational thermodynamic modeling of the terbium oxide based two-step solar thermochemical water splitting (Tb-WS cycle is reported. The 1st step of the Tb-WS cycle involves thermal reduction of TbO2 into Tb and O2, whereas the 2nd step corresponds to the production of H2 through Tb oxidation by water splitting reaction. Equilibrium compositions associated with the thermal reduction and water splitting steps were determined via HSC simulations. Influence of oxygen partial pressure in the inert gas on thermal reduction of TbO2 and effect of water splitting temperature (TL on Gibbs free energy related to the H2 production step were examined in detail. The cycle (ηcycle and solar-to-fuel energy conversion (ηsolar-to-fuel efficiency of the Tb-WS cycle were determined by performing the second-law thermodynamic analysis. Results obtained indicate that ηcycle and ηsolar-to-fuel increase with the decrease in oxygen partial pressure in the inert flushing gas and thermal reduction temperature (TH. It was also realized that the recuperation of the heat released by the water splitting reactor and quench unit further enhances the solar reactor efficiency. At TH=2280 K, by applying 60% heat recuperation, maximum ηcycle of 39.0% and ηsolar-to-fuel of 47.1% for the Tb-WS cycle can be attained.

  8. Folate Receptor Targeted Alpha-Therapy Using Terbium-149

    CERN Document Server

    Müller, Cristina; Haller, Stephanie; Dorrer, Holger; Köster, Ulli; Johnston, Karl; Zhernosekov, Konstantin; Türler, Andreas; Schibli, Roger

    2014-01-01

    Terbium-149 is among the most interesting therapeutic nuclides for medical applications. It decays by emission of short-range α-particles (Eα = 3.967 MeV) with a half-life of 4.12 h. The goal of this study was to investigate the anticancer efficacy of a 149Tb-labeled DOTA-folate conjugate (cm09) using folate receptor (FR)-positive cancer cells in vitro and in tumor-bearing mice. 149Tb was produced at the ISOLDE facility at CERN. Radiolabeling of cm09 with purified 149Tb resulted in a specific activity of ~1.2 MBq/nmol. In vitro assays performed with 149Tb-cm09 revealed a reduced KB cell viability in a FR-specific and activity concentration-dependent manner. Tumor-bearing mice were injected with saline only (group A) or with 149Tb-cm09 (group B: 2.2 MBq; group C: 3.0 MBq). A significant tumor growth delay was found in treated animals resulting in an increased average survival time of mice which received 149Tb-cm09 (B: 30.5 d; C: 43 d) compared to untreated controls (A: 21 d). Analysis of blood parameters rev...

  9. Hardness and dielectric characteristics of flux grown terbium aluminate crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, K.K.; Kotru, P.N. [Jammu Univ. (India). Dept. of Physics; Tandon, R.P. [National Physical Laboratory, New Delhi (India); Wanklyn, B.M. [Clarendon Laboratory, University of Oxford, Oxford (United Kingdom)

    1999-01-29

    Results of indentation induced Vickers hardness testing and dielectric studies conducted on flux-grown terbium aluminate crystals are presented. It is shown that the Vickers hardness value (H{sub v}) is independent of indentation time, but depends on the applied load. Applying the concept of Hays and Kendall, the load independent values are estimated for (110) and (001) planes. Differential behaviour in the crack formation of two different planes (110) and (001) is observed, while (001) plane develops Palmqvist cracks in the whole load range of 10-100 g, (110) plane shows a transition from Palmqvist to median cracks at 70 g. The fracture toughness, brittleness index and yield strength are determined for both the planes. The hardness anisotropy is reported. The dielectric constant, dielectric loss and conductivity are shown to be dependent on temperature and frequency of the applied a.c. field. The dielectric constant versus temperature shows a transition peak at 230 C, which remains independent of the frequency of the applied a.c. field in the range 1 kHz-13 MHz. (orig.) 36 refs.

  10. Thermoluminescence of cerium and terbium -doped calcium pyrophosphate

    Energy Technology Data Exchange (ETDEWEB)

    Roman L, J.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Lozano R, I. B.; Diaz G, J. A. I., E-mail: jesus.roman@nucleares.unam.mx [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, 11500 Mexico D. F. (Mexico)

    2015-10-15

    The aim of this work is to report the thermoluminescence (Tl) response of Calcium Pyrophosphate phosphor doped with Cerium and Terbium impurities (Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+}). The phosphors were synthesized using the co-precipitation method and annealed at 900 degrees C by two hours for obtain the β phase. The intentional doping with Ce and Tb ions was 1 at.% and 0.1 at.%, whereas in the EDS results the concentration of impurities was 0.39 at.% and 0.05 at.%, respectively. The superficial morphology of phosphor is mainly composed by thin wafers of different size. All samples were exposed to gamma rays from {sup 60}Co in the Gammacell-200 irradiator. The Tl response of the phosphor was measured from Rt up to 350 degrees C and under nitrogen atmosphere in a Harshaw TLD 3500 reader. The glow curves of the Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+} powders showed a broad intense Tl peak centered at 165 degrees C and a shoulder at approximate 260 degrees C was observed. A linear Tl response in the range of absorbed dose of 0.2 to 10 Gy was obtained. Tl glow curves were analyzed using the initial rise (IR)and computerized glow curve deconvolution methods to evaluate the kinetics parameters such as activation energy (E), frequency factor (s) and kinetic order (b). (Author)

  11. Solvent polarity and oxygen sensitivity, rather than viscosity, determine lifetimes of biaryl-sensitised terbium luminescence.

    Science.gov (United States)

    Walter, Edward R H; Williams, J A Gareth; Parker, David

    2017-12-14

    In a macrocyclic terbium complex incorporating a biaryl sensitiser, the observed variation of emission lifetime is shown to be determined by the solubility of oxygen in the solvent system and the relative energy of the chromophore excited state, rather than any dependence on solvent viscosity.

  12. 42 CFR 433.138 - Identifying liable third parties.

    Science.gov (United States)

    2010-10-01

    ... relationship to the applicant or recipient, the social security number (SSN) of the policy holder, and the name... 42 Public Health 4 2010-10-01 2010-10-01 false Identifying liable third parties. 433.138 Section 433.138 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN...

  13. 7 CFR 1703.138-1703.139 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false 1703.138-1703.139 Section 1703.138-1703.139 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Combination Loan and Grant Program §§ 1703...

  14. 19 CFR 10.138 - Proof of use.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Proof of use. 10.138 Section 10.138 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... of a given type of merchandise from a particular importer during a given period, or all such...

  15. 22 CFR 138.600 - Semi-annual compilation.

    Science.gov (United States)

    2010-04-01

    ... Relations of the Senate and the Committee on Foreign Affairs of the House of Representatives or the... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Semi-annual compilation. 138.600 Section 138.600 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Agency Reports...

  16. Dicty_cDB: VSA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA138 (Link to dictyBase) - - - Contig-U15185-1 VSA138E (Link to Original site)...- - - - - - VSA138E 332 Show VSA138 Library VS (Link to library) Clone ID VSA138 (Link to dictyBase)...AL116011 |AL116011.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15...AL116009 |AL116009.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15...AL115603 |AL115603.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15

  17. Arginine-responsive terbium luminescent hybrid sensors triggered by two crown ether carboxylic acids

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Lasheng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Tang, Ke; Ding, Xiaoping [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Zhou, Zhan; Xiao, Rui [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China)

    2013-12-01

    Crown ether carboxylic acids constitute main building blocks for the synthesis of terbium containing covalent cross-linked luminescent materials. Both the complexes and the hybrid nanomaterials could exhibit remarkable green emissions in pure water. More importantly, they were found to have a profound effect on the luminescence responses to arginine compared with glutamic acid, histidine, tryptophan, threonine, tyrosine and phenylalanine in aqueous environment. The present study provided the possibility of using a host–guest mechanism as a way of signal transduction based on lanthanide supramolecular hybrid materials. - Highlights: • Crown ether carboxylic acids were found to sensitize terbium ions among a group of ethers. • The complexes and silica hybrid materials were both prepared and characterized. • They could exhibit remarkable green emissions in pure water.

  18. Comparative analysis of conjugated alkynyl chromophore-triazacyclononane ligands for sensitized emission of europium and terbium.

    Science.gov (United States)

    Soulié, Marine; Latzko, Frédéric; Bourrier, Emmanuel; Placide, Virginie; Butler, Stephen J; Pal, Robert; Walton, James W; Baldeck, Patrice L; Le Guennic, Boris; Andraud, Chantal; Zwier, Jurriaan M; Lamarque, Laurent; Parker, David; Maury, Olivier

    2014-07-07

    A series of europium and terbium complexes based on a functionalized triazacyclononane carboxylate or phosphinate macrocyclic ligand is described. The influence of the anionic group, that is, carboxylate, methylphosphinate, or phenylphosphinate, on the photophysical properties was studied and rationalized on the basis of DFT calculated structures. The nature, number, and position of electron-donating or electron-withdrawing aryl substituents were varied systematically within the same phenylethynyl scaffold in order to optimize the brightness of the corresponding europium complexes and investigate their two-photon absorption properties. Finally, the europium complexes were examined in cell-imaging applications, and selected terbium complexes were studied as potential oxygen sensors. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe

    OpenAIRE

    Ramezani, Amir M.; Manzoori, Jamshid L.; Amjadi, Mohammad; Jouyban, Abolghasem

    2012-01-01

    A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb3+-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum resp...

  20. 33 CFR 138.65 - Issuance of Certificates.

    Science.gov (United States)

    2010-07-01

    ... Section 138.65 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Responsibility (Water Pollution) (Form CG-5585) in electronic form. Copies of the Certificate may be downloaded from NPFC's E-COFR Web site. ...

  1. Genetically Encoded FRET-Sensor Based on Terbium Chelate and Red Fluorescent Protein for Detection of Caspase-3 Activity

    Directory of Open Access Journals (Sweden)

    Alexander S. Goryashchenko

    2015-07-01

    Full Text Available This article describes the genetically encoded caspase-3 FRET-sensor based on the terbium-binding peptide, cleavable linker with caspase-3 recognition site, and red fluorescent protein TagRFP. The engineered construction performs two induction-resonance energy transfer processes: from tryptophan of the terbium-binding peptide to Tb3+ and from sensitized Tb3+ to acceptor—the chromophore of TagRFP. Long-lived terbium-sensitized emission (microseconds, pulse excitation source, and time-resolved detection were utilized to eliminate directly excited TagRFP fluorescence and background cellular autofluorescence, which lasts a fraction of nanosecond, and thus to improve sensitivity of analyses. Furthermore the technique facilitates selective detection of fluorescence, induced by uncleaved acceptor emission. For the first time it was shown that fluorescence resonance energy transfer between sensitized terbium and TagRFP in the engineered construction can be studied via detection of microsecond TagRFP fluorescence intensities. The lifetime and distance distribution between donor and acceptor were calculated using molecular dynamics simulation. Using this data, quantum yield of terbium ions with binding peptide was estimated.

  2. Green light emission in aluminum oxide powders doped with different terbium concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Mariscal B, L; Falcony, C. [IPN, Centro de Investigacion y de Estudios Avanzados, 07360 Ciudad de Mexico (Mexico); Carmona T, S.; Murrieta, H.; Sanchez A, M. A. [UNAM, Instituto de Fisica, 04510 Ciudad de Mexico (Mexico); Vazquez A, R. [IPN, Escuela Superior de Computo, 07738 Ciudad de Mexico (Mexico); Garcia R, C. M., E-mail: mariscal2005@gmail.com [UNAM, Facultad de Ciencias, 04510 Ciudad de Mexico (Mexico)

    2016-11-01

    Different emission intensities presented in aluminum oxide phosphors corresponding to different concentrations of doping performed with terbium are analyzed. The phosphors were synthesized by the evaporation technique and were characterized by photo and cathodoluminescence, X-ray diffraction and EDS techniques for different incorporation percentages of terbium as dopant; they show characteristic transitions in 494, 543, 587 and 622 nm, corresponding to {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4} and {sup 5}D{sub 4} → {sup 7}F{sub 3}, respectively when they are excited with λ{sub exc} = 380 nm wavelength at room temperature. The results of X-ray diffraction show the presence of α-Al{sub 2}O{sub 3} phases with peaks located at 2θ = 25.78, 35.34, 37.96, 43.56, 45.8, 52.74, 57.7, 61.5, 66.74, 68.44, 77.12 and 80.94, and the δ-Al{sub 2}O-3 phase 2θ = 32.82, 45.8, 61.36 and 66.74. These compounds were heat treated for two hours at 1100 degrees Celsius. EDS analyzes indicate that these compounds have close to 60% oxygen around of 40% aluminum in the presence of terbium as dopant which indicates a stoichiometry close to the expected one for alumina. (Author)

  3. Graphene quantum dots-terbium ions as novel sensitive and selective time-resolved luminescent probes.

    Science.gov (United States)

    Llorent-Martínez, Eulogio J; Durán, Gema M; Ríos, Ángel; Ruiz-Medina, Antonio

    2018-01-01

    We propose an alternative approach for the development of analytical methods based on terbium-sensitized luminescence (TSL). TSL is based on the complexation between Tb(III) ions and fluorescent organic compounds that have appropriate functional groups to complex with Tb(III). We report the use of graphene quantum dot (GQDs) nanoparticles to improve the sensitivity and selectivity of TSL detection. GQDs can react with terbium ions through the carboxylic groups present in their structure. These Tb(III)-GQD complexes, formed in situ in aqueous solution, can be used as time-resolved luminescent probes. Ascorbic acid was selected as a target analyte to demonstrate the suitability of the proposed method. The selectivity of the TSL method was highly improved for most of the interferences tested. Under the optimum conditions [Tb(III) concentration 5 × 10-4 mol L-1, GQD concentration 4 mg L-1], a minimum 100% increase in selectivity was observed for several vitamins and common cations that may be present in the samples to be analyzed. In addition, the analytical signal showed a 30% enhancement with the use of GQDs compared with the use of merely Tb(III) ions, with a detection limit of 0.12 μg mL-1. The repeatability and intermediate precision were lower than 3% and 5%, respectively. From the results obtained, the implementation of GQDs in TSL can lead to the development of novel time-resolved luminescent probes with high analytical potential. Graphical abstract Quenching of Tb(III)-graphene quantum dot (GQD) luminescence by ascorbic acid (AA). TBL terbium-sensitized luminescence.

  4. Fluorescence study of some terbium-oligopeptide complexes in methanolic solution.

    Science.gov (United States)

    Rabouan, S; Delage, J; Durand, W; Prognon, P; Barthes, D

    2000-04-03

    This study concerned the use of lanthanide chelates to detect glycyl-leucyl-phenylalanine (GLF) and its homologues. Spectroscopic analysis of peptides without or with terbium complexation revealed the formation of (LF)(3)(Tb)(2), (GF)(3)(Tb)(2), (GLF)(3)(Tb)(2) and (FL)(4)Tb, (FG)(4)Tb complexes with high stability constants in methanolic solutions (pK(d)>13). Lanthanide chelate emission displayed a large Stokes shift (>270 nm), which allowed Tb chelates of GLF and its derivatives to be used for detection purposes. However, this preliminary study indicated some important limitations associated with lanthanide chelation, such as high methanolic content.

  5. Electromagnetic properties of terbium gallium garnet at millikelvin temperatures and low photon energy

    Science.gov (United States)

    Kostylev, Nikita; Goryachev, Maxim; Bushev, Pavel; Tobar, Michael E.

    2017-07-01

    Electromagnetic properties of single crystal terbium gallium garnet are characterised from room down to millikelvin temperatures using the whispering gallery mode method. Microwave spectroscopy is performed at low powers equivalent to a few photons in energy and conducted as functions of the magnetic field and temperature. A phase transition is detected close to the temperature of 3.5 K. This is observed for multiple whispering gallery modes causing an abrupt negative frequency shift and a change in transmission due to extra losses in the new phase caused by a change in complex magnetic susceptibility.

  6. Nuclear excitation functions from 40 to 200 MeV proton irradiation of terbium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W., E-mail: jwengle@lanl.gov; Mashnik, Stepan G.; Parker, Lauren A.; Jackman, Kevin R.; Bitteker, Leo J.; Ullmann, John L.; Gulley, Mark S.; Pillai, Chandra; John, Kevin D.; Birnbaum, Eva R.; Nortier, Francois M.

    2016-01-01

    Nuclear formation cross sections are reported for 26 radionuclides, measured with 40–200 MeV proton irradiations of terbium foils. These data provide the basis for the production of medically relevant radionuclides (e.g., {sup 152}Tb, {sup 155}Tb, {sup 155}Eu, and {sup 156}Eu) and {sup 153}Gd, a potential source used in ongoing efforts to characterize stellar nucleosynthesis routes. Computational predictions from the ALICE2011, CEM03.03, Bertini, and INCL + ABLA codes are compared with newly measured data to contribute to the ongoing process of code development, and yields are calculated for selected radionuclides using measured data.

  7. Phenotype abnormality: 138 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 138 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u644i decreased efficiency... for trait of beta-fructofuranosidase activity ... decreased efficiency ... beta-fructofuranosidase activity

  8. 42 CFR 460.138 - Committees with community input.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Committees with community input. 460.138 Section... community input. A PACE organization must establish one or more committees, with community input, to do the... implementation of, and results from, the quality assessment and performance improvement plan. (c) Provide input...

  9. Nuclear structure in odd-odd nucleus [sup 138]Pr

    Energy Technology Data Exchange (ETDEWEB)

    Rizzutto, M.A.; Cybulska, E.W.; Vanin, V.R.; Oliveira, J.R.B.; Emediato, L.G.R.; Ribas, R.V.; Seale, W.A.; Rao, M.N.; Medina, N.H.; Botelho, S.; Acquadro, J.C.; Lima, C.L. (Sao Paulo Univ., SP (Brazil). Lab. Pelletron)

    1992-12-01

    With the view of extending the systematics of odd-odd Pr nuclei toward the N=82 closed shell, high-spin states in [sup 138]Pr nucleus have been investigated with the [sup 128]Te([sup 14]N, 4n[gamma]) reaction. Configurations and spin assignments are suggested for three of the observed band-structures. (orig.).

  10. Micelle-enhanced and terbium-sensitized spectrofluorimetric determination of gatifloxacin and its interaction mechanism

    Science.gov (United States)

    Guo, Changchuan; Wang, Lei; Hou, Zhun; Jiang, Wei; Sang, Lihong

    2009-05-01

    A terbium-sensitized spectrofluorimetric method using an anionic surfactant, sodium dodecyl benzene sulfonate (SDBS), was developed for the determination of gatifloxacin (GFLX). A coordination complex system of GFLX-Tb 3+-SDBS was studied. It was found that SDBS significantly enhanced the fluorescence intensity of the complex (about 11-fold). Optimal experimental conditions were determined as follows: excitation and emission wavelengths of 331 and 547 nm, pH 7.0, 2.0 × 10 -4 mol l -1 terbium (III), and 2.0 × 10 -4 mol l -1 SDBS. The enhanced fluorescence intensity of the system (Δ If) showed a good linear relationship with the concentration of GFLX over the range of 5.0 × 10 -10 to 5.0 × 10 -8 mol l -1 with a correlation coefficient of 0.9996. The detection limit (3 σ) was determined as 6.0 × 10 -11 mol l -1. This method has been successfully applied to the determination of GFLX in pharmaceuticals and human urine/serum samples. Compared with most of other methods reported, the rapid and simple procedure proposed in the text offers higher sensitivity, wider linear range, and better stability. The interaction mechanism of the system is also studied by the research of ultraviolet absorption spectra, surface tension, solution polarity and fluorescence polarization.

  11. Circularly Polarized Luminescence in Enantiopure Europium and Terbium Complexes with Modular, All-Oxygen Donor Ligands

    Science.gov (United States)

    Seitz, Michael; Do, King; Ingram, Andrew J.; Moore, Evan G.; Muller, Gilles; Raymond, Kenneth N.

    2009-01-01

    Abstract: Circulaly polarized luminescence from terbium(III) complexed and excited by chiral antenna ligands gives strong emission The modular synthesis of three new octadentate, enantiopure ligands are reported - one with the bidentate chelating unit 2-hydroxyisophthalamide (IAM) and two with 1-hydroxy-2-pyridinone (1,2-HOPO) units. A new design principle is introduced for the chiral, non-racemic hexamines which constitute the central backbones for the presented class of ligands. The terbium(III) complex of the IAM ligand, as well as the europium(III) complexes of the 1,2-HOPO ligands are synthesized and characterized by various techniques (NMR, UV, CD, luminescence spectroscopy). All species exhibit excellent stability and moderate to high luminescence efficiency (quantum yields ΦEu = 0.05–0.08 and ΦTb = 0.30–0.57) in aqueous solution at physiological pH. Special focus is put onto the properties of the complexes in regard to circularly polarized luminescence (CPL). The maximum luminescence dissymmetry factors (glum) in aqueous solution are high with |glum|max = 0.08 – 0.40. Together with the very favorable general properties (good stability, high quantum yields, long lifetimes), the presented lanthanide complexes can be considered as good candidates for analytical probes based on CPL in biologically relevant environments. PMID:19639983

  12. Luminescent method of determination of composition of europium and terbium complexes in solution by change of intensity ratio of luminescence bands

    Energy Technology Data Exchange (ETDEWEB)

    Bel' tyukova, S.V.; Nazarenko, N.A.; Poluehktov, N.S.

    1982-03-01

    The complexes of europium and terbium with phenanthroline, ethylenediaminetetraacetate, nitrilotriacetate, some acids-phenol derivatives and ..beta..-diketones series have been used as an example to demonstrate that the value of the ratio of intensities on the two bands of europium(terbium) luminescence spectra - the one corresponding to the hypersensitive'' transition and the other, to the magnetic dipole one - can be used for determination of the complexes composition in solutions.

  13. Thermo-transferred thermoluminescence (TTTl) in potassium-yttrium double fluoride doped with terbium

    Energy Technology Data Exchange (ETDEWEB)

    Gallegos, A.; Rivera, T.; Diaz G, J. A. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Legaria 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Azorin, J. [Universidad Autonoma Metropolitana, Unidad Iztapalapa, San Rafael Atlixco No. 186, Col. Vicentina, 09340 Mexico D. F. (Mexico); Azorin, J. C. [Universidad de Guanajuato, Division de Ciencias e Ingenierias-Campus Leon, Lomas del Bosque No. 103, Col. Lomas del Campestre, 37000 Leon, Guanajuato (Mexico); Licona, R.; Rivas, F.; Hernandez C, G. [Benemerita Universidad Autonoma de Puebla, Facultad de Ciencias Quimicas, 14 Sur y San Claudio, Ciudad Universitaria, Puebla de Zaragoza, Puebla (Mexico); Khaidukov, N. [Institute of General and Inorganic Chemistry, Lenin SK 11 Prospect 31, Moscow 117907 (Russian Federation)

    2011-02-15

    This paper presents results of studying the thermo-transferred thermoluminescence (TTTl) phenomenon in potassium-yttrium double fluoride doped with terbium (K{sub 2}YF{sub 5:}Tb) at different impurity concentrations (0.8%, 0.95% and 0.99%). Previously to study the TTTl phenomenon, structural characterization and chemical composition of the materials were determined. The structural studies were conducted using a scanning electron microscope; meanwhile, chemical composition was analyzed using energy dispersive X-ray spectroscopy. Thermoluminescence kinetics was studied irradiating the samples with {sup 137}Cs gamma rays as well as with {sup 90}Sr/{sup 90}Y beta rays, analyzing the glow curves by the deconvolution method for obtaining the kinetic parameters. (Author)

  14. The influence of pressure on the photoluminescence properties of a terbium-adipate framework

    Science.gov (United States)

    Spencer, Elinor C.; Zhao, Jing; Ross, Nancy L.; Andrews, Michael B.; Surbella, Robert G.; Cahill, Christopher L.

    2013-06-01

    The influence of pressure (over the 0-4.7 GPa range) on the photoluminescence emissions and crystal structure of the known 3D terbium-adipate metal-organic framework material Tb-GWMOF6 has been evaluated by high-pressure single-crystal X-ray diffraction and spectroscopic techniques. The results from this study show that this complex lanthanide framework structure undergoes three phase transitions within the 0-4 GPa pressure range that involve alterations in the number of symmetry independent Tb3+ ion sites within the crystal lattice. These pressure induced modifications to the structure of Tb-GWMOF6 lead to pronounced changes in the profiles of the 5D4→7F5 emission spectra of this complex.

  15. Terbium Radionuclides for Theranostics Applications: A Focus On MEDICIS-PROMED

    Science.gov (United States)

    Cavaier, R. Formento; Haddad, F.; Sounalet, T.; Stora, T.; Zahi, I.

    A new facility, named CERN-MEDICIS, is under construction at CERN to produce radionuclides for medical applications. In parallel, the MEDICIS-PROMED, a Marie Sklodowska-Curie innovative training network of the Horizon 2020 European Commission's program, is being coordinated by CERN to train young scientists on the production and use of innovative radionuclides and develop a network of experts within Europe. One program within MEDICIS-PROMED is to determine the feasibility of producing innovative radioisotopes for theranostics using a commercial middle-sized high-current cyclotron and the mass separation technology developed at CERN-MEDICIS. This will allow the production of high specific activity radioisotopes not achievable with the common post-processing by chemical separation. Radioisotopes of scandium, copper, arsenic and terbium have been identified. Preliminary studies of activation yield and irradiation parameters optimization for the production of Tb-149 will be described.

  16. Dielectric and conducting behavior of gadolinium-terbium fumarate heptahydrate crystals

    Science.gov (United States)

    Shah, M. D.; Want, B.

    2015-07-01

    Gadolinium-terbium fumarate heptahydrate crystals were grown in silica gel by using single gel diffusion technique. The crystals were characterized by different physico-chemical techniques of characterization. Powder X-ray diffraction results showed that the grown material is purely crystalline in nature. Elemental analyses suggested the chemical formula of the compound to be Gd Tb (C4H2O4)3ṡ7H2O. Energy dispersive X-ray analysis confirmed the presence of Gd and Tb in the title compound. The dielectric and conductivity studies of the grown compound were carried as function of frequency of applied field and the temperature. The grown material showed a dielectric anomaly which was correlated with its thermal behavior. The ac conductivity of the material showed Jonscher's power law behavior: σ(ω)=σo+Aωs, with a temperature-dependent power exponent s(<1). The conductivity was found to be a function of temperature and frequency.

  17. Highly sensitive detection of dipicolinic acid with a water-dispersible terbium-metal organic framework.

    Science.gov (United States)

    Bhardwaj, Neha; Bhardwaj, Sanjeev; Mehta, Jyotsana; Kim, Ki-Hyun; Deep, Akash

    2016-12-15

    The sensitive detection of dipicolinic acid (DPA) is strongly associated with the sensing of bacterial organisms in food and many types of environmental samples. To date, the demand for a sensitive detection method for bacterial toxicity has increased remarkably. Herein, we investigated the DPA detection potential of a water-dispersible terbium-metal organic framework (Tb-MOF) based on the fluorescence quenching mechanism. The Tb-MOF showed a highly sensitive ability to detect DPA at a limit of detection of 0.04nM (linear range of detection: 1nM to 5µM) and also offered enhanced selectivity from other commonly associated organic molecules. The present study provides a basis for the application of Tb-MOF for direct, convenient, highly sensitive, and specific detection of DPA in the actual samples. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. A New Bis(phthalocyaninato) Terbium Single-Ion Magnet with an Overall Excellent Magnetic Performance.

    Science.gov (United States)

    Chen, Yuxiang; Ma, Fang; Chen, Xiaoxiang; Dong, Bowei; Wang, Kang; Jiang, Shangda; Wang, Chiming; Chen, Xin; Qi, Dongdong; Sun, Haoling; Wang, Bingwu; Gao, Song; Jiang, Jianzhuang

    2017-11-20

    Bulky and strong electron-donating dibutylamino groups were incorporated onto the peripheral positions of one of the two phthalocyanine ligands in the bis(phthalocyaninato) terbium complex, resulting in the isolation of heteroleptic double-decker (Pc)Tb{Pc[N(C4H9)2]8} {Pc = phthalocyaninate; Pc[N(C4H9)2]8 = 2,3,9,10,16,17,23,24-octakis(dibutylamino)phthalocyaninate} with the nature of an unsymmetrical molecular structure, a square-antiprismatic coordination geometry, an intensified coordination field strength, and the presence of organic radical-f interaction. As a total result of all these factors, this sandwich-type tetrapyrrole lanthanide single-ion magnet (SIM) exhibits an overall enhanced magnetic performance including a high blocking temperature (TB) of 30 K and large effective spin-reversal energy barrier of Ueff = 939 K, rendering it the best sandwich-type tetrapyrrole lanthanide SIM reported thus far.

  19. Ultralarge magneto-optic rotations and rotary dispersion in terbium gallium garnet single crystal.

    Science.gov (United States)

    Shaheen, Amrozia; Majeed, Hassaan; Anwar, Muhammad Sabieh

    2015-06-10

    We report systematically acquired data on the Verdet constant of terbium gallium garnet for wavelengths ranging from visible to near-infrared (405-830 nm) regime. Our experimental method of Stokes polarimetry is based on the Fourier decomposition of the received light intensity and allows unambiguous determination of both the Faraday rotation and the ellipticity of the emergent light. Temperature-dependent investigations in the range of 8-300 K extend earlier reports and verify the Verdet's constant direct dependence on the magnetization, whose first-order approximation is simply a manifestation of the Curie's law. Further, a least-squares fitting of the experimental data correlates well with theoretical predictions. At a wavelength of 405 nm and temperature of 8 K, the rotation is approximately 500°.

  20. Terbium fluorescence as a sensitive, inexpensive probe for UV-induced damage in nucleic acids

    Energy Technology Data Exchange (ETDEWEB)

    El-Yazbi, Amira F.; Loppnow, Glen R., E-mail: glen.loppnow@ualberta.ca

    2013-07-05

    Graphical abstract: -- Highlights: •Simple, inexpensive, mix-and-read assay for positive detection of DNA damage. •Recognition of undamaged DNA via hybridization to a hairpin probe. •Terbium(III) fluorescence reports the amount of damage by binding to ssDNA. •Tb/hairpin is a highly selective and sensitive fluorescent probe for DNA damage. -- Abstract: Much effort has been focused on developing methods for detecting damaged nucleic acids. However, almost all of the proposed methods consist of multi-step procedures, are limited, require expensive instruments, or suffer from a high level of interferences. In this paper, we present a novel simple, inexpensive, mix-and-read assay that is generally applicable to nucleic acid damage and uses the enhanced luminescence due to energy transfer from nucleic acids to terbium(III) (Tb{sup 3+}). Single-stranded oligonucleotides greatly enhance the Tb{sup 3+} emission, but duplex DNA does not. With the use of a DNA hairpin probe complementary to the oligonucleotide of interest, the Tb{sup 3+}/hairpin probe is applied to detect ultraviolet (UV)-induced DNA damage. The hairpin probe hybridizes only with the undamaged DNA. However, the damaged DNA remains single-stranded and enhances the intrinsic fluorescence of Tb{sup 3+}, producing a detectable signal directly proportional to the amount of DNA damage. This allows the Tb{sup 3+}/hairpin probe to be used for sensitive quantification of UV-induced DNA damage. The Tb{sup 3+}/hairpin probe showed superior selectivity to DNA damage compared to conventional molecular beacons probes (MBs) and its sensitivity is more than 2.5 times higher than MBs with a limit of detection of 4.36 ± 1.2 nM. In addition, this probe is easier to synthesize and more than eight times cheaper than MBs, which makes its use recommended for high-throughput, quantitative analysis of DNA damage.

  1. Fine- and hyperfine structure investigations of even configuration system of atomic terbium

    Science.gov (United States)

    Stefanska, D.; Elantkowska, M.; Ruczkowski, J.; Furmann, B.

    2017-03-01

    In this work a parametric study of the fine structure (fs) and the hyperfine structure (hfs) for the even-parity configurations of atomic terbium (Tb I) is presented, based in considerable part on the new experimental results. Measurements on 134 spectral lines were performed by laser induced fluorescence (LIF) in a hollow cathode discharge lamp; on this basis, the hyperfine structure constants A and B were determined for 52 even-parity levels belonging to the configurations 4f85d6s2, 4f85d26s or 4f96s6p; in all the cases those levels were involved in the transitions investigated as the lower levels. For 40 levels the hfs was examined for the first time, and for the remaining 12 levels the new measurements supplement our earlier results. As a by-product, also preliminary values of the hfs constants for 84 odd-parity levels were determined (the investigations of the odd-parity levels system in the terbium atom are still in progress). This huge amount of new experimental data, supplemented by our earlier published results, were considered for the fine and hyperfine structure analysis. A multi-configuration fit of 7 configurations was performed, taking into account second-order of perturbation theory, including the effects of closed shell-open shell excitations. Predicted values of the level energies, as well as of magnetic dipole and electric quadrupole hyperfine structure constants A and B, are quoted in cases when no experimental values are available. By combining our experimental data with our own semi-empirical procedure it was possible to identify correctly the lower and upper level of the line 544.1440 nm measured by Childs with the use of the atomic-beam laser-rf double-resonance technique (Childs, J Opt Soc Am B 9;1992:191-6).

  2. Spacecraft thermal control coatings (AO 138-6)

    Science.gov (United States)

    Paillous, Alain; Guillaumon, Jean Claude

    1991-01-01

    The experiment A0 138-6 was located on the trailing edge of LDEF as part of the Experiment FRECOPA. Material specimens 2 x 2 cm, independently mounted in sample-holders with their surface in the same reference plane, were exposed to space. Materials include paints (conductive or not), SSMs, polymeric films, surface coatings, composite materials, and metals. The results show that for some materials the degradation was higher for samples in the canister than for those directly mounted on the tray; contamination problems were ruled out, the higher temperature experienced by the samples inside the canister probably explains this phenomenon.

  3. Structural and optical characterization of terbium doped ZnGa2O4 thin films deposited by RF magnetron sputtering

    Science.gov (United States)

    Somasundaram, K.; Girija, K. G.; Sudarsan, V.; Selvin, P. Christopher; Vatsa, R. K.

    2016-05-01

    Tb3+ doped ZnGa2O4 nanophosphor (21 nm) has been synthesized via low temperature polyol route and subsequently thin films of the same were deposited on glass and ITO substrates by RF magnetron sputtering. The films were characterized by X-ray Diffraction and luminescence measurements. The XRD pattern showed that Tb3+ doped ZnGa2O4 nanophosphor has a cubic spinel phase. Luminescence behavior of the nanophosphor and as deposited sputtered film was investigated. The PL emission spectra of nanophosphor gave a broad ZnGa2O4 host emission band along with a strong terbium emission and the thin films showed only broad host emission band and there was no terbium ion emission.

  4. [Therapeutic effect of 138 imported falciparum malaria patients].

    Science.gov (United States)

    Yu, Zhen-Hua; Wang, Fu-Yong; Wei, Dong-Dong; Yin, Bin; Wei, Yan-Bin; Zhao, Gui-Hua; Zhang, Ben-Gang; Wang, Yong-Bin

    2014-12-01

    To summarize the clinical characteristics of imported falciparum malaria patients and the treatment, so as to provide the evidences for improving the diagnosis and treatment of the disease. A total of 138 imported falciparum malaria patients who received the treatment in Shandong Institute of Parasitic Diseases from January 2007 to February 2013 were adopted as the observation subjects, and their clinical data were collected and analyzed. All the 138 patients were back from African countries. The main manifestations were fever, headache, asthenia, and hepatosplenomegaly, and most of them were with decreased RBC, PLT levels and increased LDH levels, and 36.96% of them were misdiagnosed as respiratory diseases, nephritis, hepatitis and so on. Through antimalarial treatment of artemether or artesunate or dihydroartemisinin and primaquine, or dihydroartemisinin and piperaquine, and symptomatic treatment, the short-term and long-term cure rates were 98.55% and 94.93% respectively, with 1 case unrecovered and 1 died. Artemisinins are still the most effective antimalarial drugs for falciparum malaria. However, some patients recrudesce as the Plasmodium in their body is resistant or insensitive to these drugs. We should pay more attention to the antimalarial and symptomatic treatments in the early stage of severe malaria so as to improve the cure rate.

  5. Determination of fluoxetine in pharmaceutical and biological samples based on the silver nanoparticle enhanced fluorescence of fluoxetine-terbium complex.

    Science.gov (United States)

    Lotfi, Ali; Manzoori, Jamshid L

    2016-11-01

    In this study, a simple and sensitive spectrofluorimetric method is presented for the determination of fluoxetine based on the enhancing effect of silver nanoparticles (AgNPs) on the terbium-fluoxetine fluorescence emission. The AgNPs were prepared by a simple reduction method and characterized by UV-Vis spectroscopy and transmission electron microscopy. It was indicated that these AgNPs have a remarkable amplifying effect on the terbium-sensitized fluorescence of fluoxetine. The effects of various parameters such as AgNP and Tb(3+) concentration and the pH of the media were investigated. Under obtained optimal conditions, the fluorescence intensity of the terbium-fluoxetine-AgNP system was enhanced linearly by increasing the concentration of fluoxetine in the range of 0.008 to 19 mg/L. The limit of detection (b + 3s) was 8.3 × 10(-4) mg/L. The interference effects of common species found in real samples were also studied. The method had good linearity, recovery, reproducibility and sensitivity, and was satisfactorily applied for the determination of fluoxetine in tablet formulations, human urine and plasma samples. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  6. Neutron Diffraction and Electrical Transport Studies on Magnetic Transition in Terbium at High Pressures and Low Temperatures

    Science.gov (United States)

    Thomas, Sarah; Montgomery, Jeffrey; Tsoi, Georgiy; Vohra, Yogesh; Weir, Samuel; Tulk, Christopher; Moreira Dos Santos, Antonio

    2013-06-01

    Neutron diffraction and electrical transport measurements have been carried out on the heavy rare earth metal terbium at high pressures and low temperatures in order to elucidate its transition from a helical antiferromagnetic to a ferromagnetic ordered phase as a function of pressure. The electrical resistance measurements using designer diamonds show a change in slope as the temperature is lowered through the ferromagnetic Curie temperature. The temperature of the ferromagnetic transition decreases at a rate of -16.7 K/GPa till 3.6 GPa, where terbium undergoes a structural transition from hexagonal close packed (hcp) to an α-Sm phase. Above this pressure, the electrical resistance measurements no longer exhibit a change in slope. In order to confirm the change in magnetic phase suggested by the electrical resistance measurements, neutron diffraction measurements were conducted at the SNAP beamline at the Oak Ridge National Laboratory. Measurements were made at pressures to 5.3 GPa and temperatures as low as 90 K. An abrupt increase in peak intensity in the neutron diffraction spectra signaled the onset of magnetic order below the Curie temperature. A magnetic phase diagram of rare earth metal terbium will be presented to 5.3 GPa and 90 K based on these studies.

  7. Phenotypic, genomic and functional characterization reveals no differences between CD138++ and CD138low subpopulations in multiple myeloma cell lines.

    Science.gov (United States)

    Paíno, Teresa; Sarasquete, María E; Paiva, Bruno; Krzeminski, Patryk; San-Segundo, Laura; Corchete, Luis A; Redondo, Alba; Garayoa, Mercedes; García-Sanz, Ramón; Gutiérrez, Norma C; Ocio, Enrique M; San-Miguel, Jesús F

    2014-01-01

    Despite recent advances in the treatment of multiple myeloma (MM), it remains an incurable disease potentially due to the presence of resistant myeloma cancer stem cells (MM-CSC). Although the presence of clonogenic cells in MM was described three decades ago, the phenotype of MM-CSC is still controversial, especially with respect to the expression of syndecan-1 (CD138). Here, we demonstrate the presence of two subpopulations--CD138++ (95-99%) and CD138low (1-5%)--in eight MM cell lines. To find out possible stem-cell-like features, we have phenotypically, genomic and functionally characterized the two subpopulations. Our results show that the minor CD138low subpopulation is morphologically identical to the CD138++ fraction and does not represent a more immature B-cell compartment (with lack of CD19, CD20 and CD27 expression). Moreover, both subpopulations have similar gene expression and genomic profiles. Importantly, both CD138++ and CD138low subpopulations have similar sensitivity to bortezomib, melphalan and doxorubicin. Finally, serial engraftment in CB17-SCID mice shows that CD138++ as well as CD138low cells have self-renewal potential and they are phenotypically interconvertible. Overall, our results differ from previously published data in MM cell lines which attribute a B-cell phenotype to MM-CSC. Future characterization of clonal plasma cell subpopulations in MM patients' samples will guarantee the discovery of more reliable markers able to discriminate true clonogenic myeloma cells.

  8. Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

  9. MicroRNA-138 modulates metastasis and EMT in breast cancer cells by targeting vimentin.

    Science.gov (United States)

    Zhang, Jun; Liu, Dan; Feng, Zhuo; Mao, Jun; Zhang, Chunying; Lu, Ying; Li, Jiazhi; Zhang, Qingqing; Li, Qing; Li, Lianhong

    2016-02-01

    Increasing evidence indicates that dysregulation of microRNAs (miRNAs) plays critical roles in malignant transformation and tumor progression. In this study, in order to investigate the association of miR-138 with breast cancer we investigated the role of miR-138 in breast cancer metastasis. Levels of miR-138 were determined by qRT-PCR in 45 breast cancer samples. Cell migration and invasion assays were performed in a stably expressing miRNA-138 breast cancer cell line established using a lentivirus expression system. Epithelial-mesenchymal transition (EMT) was evaluated using qRT-PCR and Western Blots to detect epithelial marker E-cadherin and mesenchymal marker, vimentin. Luciferase reporter assays were used to identify downstream targets and biological function of miR-138. Breast cancer tissues had significantly lower expression of miR-138 compared to non-tumor tissues. Low miR-138 levels were associated with lymph node metastasis and invasion. miR-138 overexpression inhibited metastasis of breast cancer cells. miR-138 overexpression also down-regulated vimentin expression and upregulated E-cadherin expression, suggesting that miR-138 inhibited EMT. Our results support the involvement of miR-138 in breast tumorigenesis, especially lymph node metastasis. We propose that miR-138 might be used as therapeutic agent for breast cancer. Copyright © 2015. Published by Elsevier Masson SAS.

  10. Study of Silver Nanoparticles Sensitized Fluorescence and Second-Order Scattering of Terbium(III-Pefloxacin Mesylate Complex and Determination of Pefloxacin Mesylate

    Directory of Open Access Journals (Sweden)

    Aiyun Li

    2014-01-01

    Full Text Available α-Keto acid of pefloxacin mesylate (PFLX can form the complex with Terbium(III. The intramolecular energy from PFLX to Terbium(III ion takes place when excited, and thus Terbium(III excited state is formed and then emits the characteristic fluorescence of Terbium(III, locating at 490, 545, 580, and 620 nm. The second-order scattering (SOS peak at 545 nm also appears for the complex with the exciting wavelength of 273 nm. When the silver nanoparticles are added to the system, the luminescence intensity at 545 nm greatly increased. So, with the adding of nanoparticles to the Terbium(III-PFLX complex, not only is the intramolecular energy promoted but also the SOS intensity is enhanced. The experimental results show that it is the silver nanoparticles with certain size and certain concentration which can greatly enhance the fluorescence-SOS intensity, and the relative intensity at 545 nm is proportional to the amount of PFLX. Based on this phenomenon, a novel method for the determination of PFLX has been developed and applied to the determination of PFLX in capsule and serum samples.

  11. MiR-138 Suppresses Cell Proliferation by Targeting Bag-1 in Gallbladder Carcinoma

    Science.gov (United States)

    Gong, Wei; Weng, Mingzhe; Quan, Zhiwei

    2015-01-01

    Background MiR-138 is frequently downregulated in different cancer types and is thought to be involved in the progression of tumorigenesis. However, the molecular mechanism of miR-138 involvement in gallbladder carcinoma still remains unknown. Methods The expression of miR-138 in 49 gallbladder carcinoma samples and paired normal gallbladder samples was analyzed using quantitative reverse transcription–polymerase chain reaction. The biological functions of miR-138 and Bag-1 (Bcl-2-associated athanogene-1) on cell proliferation were examined using 3-(4, 5-dimethylthiazolyl-2)-2,5-diphenyltetrazolium bromide and apoptosis assays. Targets of miR-138 were predicted using bioinformatics and validated using luciferase reporter and Western blot analyses. The in vivo effects of miR-138 were examined using subcutaneous inoculation of gallbladder carcinoma cells in Balb/c nude mice. Results Compared with their paired normal gallbladder samples, the gallbladder carcinoma samples had decreased expression of miR-138 and increased expression of Bag-1. Overexpression of miR-138 inhibited the proliferation of gallbladder carcinoma cells. Bag-1 was defined as a novel target of miR-138. Both the inhibition of Bag-1 by miR-138 and the silencing of Bag-1 by siRNA led to alterations of apoptosis-related proteins such as Bcl-2 and Bax. Restoring expression of Bag-1 eliminates the effects of miR-138 on cell proliferation and apoptosis. Furthermore, overexpression of miR-138 markedly inhibited the growth of tumors in the gallbladder carcinoma xenograft model in nude mice. Conclusions Expression of miR-138 is frequently reduced in gallbladder carcinoma when compared to normal cells. Overexpression of miR-138 inhibited cell proliferation by directly suppressing the expression of Bag-1. These results suggest that miR-138 plays an important role in inhibiting the growth of gallbladder carcinoma. PMID:25962180

  12. Influence of crystalline structure on the luminescence properties of terbium orthotantalates

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Kisla P.F. [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil); Carmo, Alexandre P. [Instituto Federal Fluminense, Campus Cabo Frio, RJ 28909-971 (Brazil); Bell, Maria J.V. [Departamento de Física, Universidade Federal de Juiz de Fora, Juiz de Fora 36036-330, MG (Brazil); Dias, Anderson, E-mail: anderson_dias@iceb.ufop.br [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil)

    2013-06-15

    Terbium orthotantalate powders were produced with M-fergusonite type (I2/a) and M′-fergusonite type (P2/a) structures. The samples were studied by X-ray diffraction, Raman scattering, and photoluminescence measurements (emission and decay curves). The results showed that crystalline materials were obtained with all the 18 Raman-active modes predicted by group theory calculations. Also, it was observed through photoluminescence decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. Photoluminescence emission curves exhibited some variation in spectral shape, peak position, and relative intensity as a consequence of their different crystalline arrangements. The dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549.2 nm (M-type) and 543.0 nm (M′-type). Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively. M′-type materials seems to be the most suitable for luminescent devices and could be a potential green luminescent material due to the strongest emission if compared with the M-fergusonite type. -- Highlights: ► Terbium orthotantalates were prepared in two different crystalline structures: I2/a and P2/a. ► XRD and Raman scattering showed that the different space groups obtained were exhibited all the 18 Raman-active modes. ► PL decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. ► Dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549 nm (M-type) and 543 nm (M′-type). ► Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively.

  13. Laser control and temperature switching of luminescence intensity in photostable transparent film based on terbium(III) β-diketonate complex

    Science.gov (United States)

    Lapaev, Dmitry V.; Nikiforov, Victor G.; Safiullin, Georgy M.; Lobkov, Vladimir S.; Salikhov, Kev M.; Knyazev, Andrey A.; Galyametdinov, Yury G.

    2014-11-01

    The study of the terbium(III) and gadolinium(III) β-diketonate complexes by photoluminescence spectroscopy reveals considerable changes of the photophysical properties of the complexes under the UV laser irradiation. The measurements show the enhancement of the luminescence intensities in the vitrified transparent film of the terbium(III) complex as well as the gadolinium(III) complex under the 337 nm laser irradiation at room temperature. The irradiated film of the terbium(III) complex restores the initial photophysical properties after heating close to the melting temperature (∼353 K) and cooling. We observe no change of the luminescent properties of the irradiated film for months. These features can be used for the design of new lanthanide-based photostable systems with laser control of the luminescence intensity.

  14. Development of functionalized terbium fluorescent nanoparticles for antibody labeling and time-resolved fluoroimmunoassay application.

    Science.gov (United States)

    Ye, Zhiqiang; Tan, Mingqian; Wang, Guilan; Yuan, Jingli

    2005-01-15

    Silica-based functionalized terbium fluorescent nanoparticles were prepared, characterized and developed as a fluorescence probe for antibody labeling and time-resolved fluoroimmunoassay. The nanoparticles were prepared in a water-in-oil (W/O) microemulsion containing a strongly fluorescent Tb(3+) chelate, N,N,N(1),N(1)-[2,6-bis(3'-aminomethyl-1'-pyrazolyl)phenylpyridine] tetrakis(acetate)-Tb(3+) (BPTA-Tb(3+)), Triton X-100, octanol, and cyclohexane by controlling copolymerization of tetraethyl orthosilicate (TEOS) and 3-[2-(2-aminoethylamino)ethylamino]propyl-trimethoxysilane (AEPS) with ammonia water. The characterizations by transmission electron microscopy and fluorometric methods show that the nanoparticles are spherical and uniform in size, 45 +/- 3nm in diameter, strongly fluorescent with fluorescence quantum yield of 10% and a long fluorescence lifetime of 2.0ms. The amino groups directly introduced to the nanoparticle's surface by using AEPS in the preparation made the surface modification and bioconjugation of the nanoparticles easier. The nanoparticle-labeled anti-human alpha-fetoprotein antibody was prepared and used for time-resolved fluoroimmunoassay of alpha-fetoprotein (AFP) in human serum samples. The assay response is linear from 0.10ngml(-1) to about 100ngml(-1) with the detection limit of 0.10ngml(-1). The coefficient variations (CVs) of the method are less than 9.0%, and the recoveries are in the range of 84-98% for human serum sample measurements.

  15. Highly efficient precipitation of phosphoproteins using trivalent europium, terbium, and erbium ions

    Energy Technology Data Exchange (ETDEWEB)

    Guezel, Yueksel; Rainer, Matthias; Mirza, Munazza Raza; Bonn, Guenther K. [Leopold-Franzens University, Institute of Analytical Chemistry and Radiochemistry, Innsbruck (Austria)

    2012-05-15

    This study describes a highly efficient method for the selective precipitation of phosphoproteins by trivalent europium, terbium, and erbium metal ions. These metal cations belong to the group of lanthanides and are known to be hard acceptors with an overwhelming preference for oxygen-containing anions such as phosphates to which they form very tight ionic bonds. The method could be successfully applied to specifically precipitate phosphoproteins from complex samples including milk and egg white by forming solid metal-protein complexes. Owing to the low solubility product of the investigated lanthanide salts, the produced metal-protein complexes showed high stability. The protein pellets were extensively washed to remove nonphosphorylated proteins and contaminants. For the analysis of proteins the pellets were first dissolved in 30 % formic acid and subjected to matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) MS. For peptide mass-fingerprint analysis the precipitated phosphoproteins were enzymatically digested using microwave-assisted digestion. The method was found to be highly specific for the isolation and purification of phosphoproteins. Protein quantification was performed by colorimetric detection of total precipitated phosphoproteins and revealed more than 95 % protein recovery for each lanthanide salt. (orig.)

  16. A Terbium Sensitized Luminescence Method for the Assay of Flubiprofen in Pharmaceutical Formulations

    Directory of Open Access Journals (Sweden)

    Salma M.Z. Al-Kindy

    2014-12-01

    Full Text Available A sensitive time-resolved luminescence method for the determination of flubiprofen (FLP in methanol and in aqueous solution is described. The method is based on the luminescence sensitization of terbium (Tb3+ by the formation of a ternary complex with FLP in the presence of 4,7 diphenyl 1,10 phenanthroline (DPP as co-ligand, and Tween-20 as surfactant. The signal for Tb-FLP-DPP was monitored at λex  = 285 nm and λem  = 552 nm. Optimum conditions for the formation of the complex in an aqueous system were TRIS buffer, pH 8.0, DPP (2.5Å~10−7  M, Tween-20 (0.30% and 4Å~10-5  mol L-1  of Tb3+  which allowed the determination of 20–1000 ng mL-1  of FLP with a limit of detection (LOD of 10 ng mL-1 . The relative standard deviations of the method ranged between 0.6 and 1.4% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assays of FLP in pharmaceutical formulations and spiked tap water samples with average recoveries of 87% – 95%.

  17. Sensitization effects of supramolecular assemblies on the luminescence of terbium-ion prulifloxacin complexes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Hong; Yi Chongyue; Li Xue; Fang Fang [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Yang Yajiang, E-mail: yjyang@mail.hust.edu.c [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2011-04-15

    Luminescence enhancement of terbium-ion prulifloxacin complexes (Tb(III)-PUFX) in supramolecular hydrogels formed by assembly of 1,3:2,4-di-O-benzylidene-D-sorbitol (DBS) was investigated by steady-state fluorescence, varying temperature fluorescence and time-resolved fluorescence. The luminescence images show that Tb(III)-PUFX were dispersed in the DBS gels. The luminescence intensity of Tb(III)-PUFX in the DBS gels was significantly increased in comparison with that in corresponding aqueous solutions. The varying temperature fluorescent spectra show that the luminescence intensity of Tb(III)-PUFX decreased with an increase in the temperature. This implies that the luminescence enhancement of Tb(III)-PUFX is related to the dissociation and the formation of the DBS assemblies. Time-resolved fluorescence measurements show slower rotational motion in DBS gels in comparison with that in the corresponding aqueous solutions. This may be ascribed to a unique microstructure of three-dimensional network formed by DBC aggregates, resulting in deactivation of the nonradiative relaxation. The images of field emission scanning electron microscopy and polarized optical microscopy indicate that the morphology of the DBS assemblies was not influenced upon addition of Tb(III)-PUFX to the DBS gels.

  18. A Nanoscale Multiresponsive Luminescent Sensor Based on a Terbium(III) Metal-Organic Framework.

    Science.gov (United States)

    Dang, Song; Wang, Ting; Yi, Feiyan; Liu, Qinghui; Yang, Weiting; Sun, Zhong-Ming

    2015-08-01

    A nanoscale terbium-containing metal-organic framework (nTbL), with a layer-like structure and [H2 NMe2 ](+) cations located in the framework channels, was synthesized under hydrothermal conditions. The structure of the as-prepared sample was systematically confirmed by powder XRD and elemental analysis; the morphology was characterized by field-emission SEM and TEM. The photoluminescence studies revealed that rod-like nTbL exhibited bright-green emission, corresponding to (5)D4 →(7)FJ (J=6-3) transitions of the Tb(3+) ion under excitation. Further sensing measurements revealed that as-prepared nTbL could be utilized as a multiresponsive luminescent sensor, which showed significant and exclusive detection ability for Fe(3+) ions and phenylmethanol. These results highlight the practical applications of lanthanide-containing metal-organic frameworks as fluorescent probes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Terbium-Doped VO2 Thin Films: Reduced Phase Transition Temperature and Largely Enhanced Luminous Transmittance.

    Science.gov (United States)

    Wang, Ning; Duchamp, Martial; Dunin-Borkowski, Rafal E; Liu, Shiyu; Zeng, XianTing; Cao, Xun; Long, Yi

    2016-01-26

    Vanadium dioxide (VO2) is a well-known thermochromic material with large IR modulating ability, promising for energy-saving smart windows. The main drawbacks of VO2 are its high phase transition temperature (τ(c) = 68°C), low luminous transmission (T(lum)), and weak solar modulating ability (ΔT(sol)). In this paper, the terbium cation (Tb(3+)) doping was first reported to reduce τ(c) and increase T(lum) of VO2 thin films. Compared with pristine VO2, 2 at. % doping level gives both enhanced T(lum) and ΔT(sol) from 45.8% to 54.0% and 7.7% to 8.3%, respectively. The T(lum) increases with continuous Tb(3+) doping and reaches 79.4% at 6 at. % doping level, representing ∼73.4% relative increment compared with pure VO2. This has surpassed the best reported doped VO2 thin films. The enhanced thermochromic properties is meaningful for smart window applications of VO2 materials.

  20. Luminescent investigations of terbium(III) biosorption as a surrogate for heavy metals and radionuclides.

    Science.gov (United States)

    Achyuthan, Komandoor E; Arango, Dulce C; Carles, Elizabeth L; Cutler, Christopher E; Meyer, Lauren A; Brozik, Susan M

    2009-07-01

    We describe a metal transport system for investigating the interfacial interactions between the anionic surface charge of a gram-negative bacterium (Escherichia coli) and a trivalent cationic metal, Tb3+. We believe this is the first description of the uptake kinetics, sub- and intracellular distribution, and temporal fate of Tb3+ ion in E. coli. We used the luminescence of the terbium-dipicolinic acid chelate to study metal ion transport. The bacteria had a high tolerance for the metal (IC(50) = 4 mM Tb3+). Metal ion transport was passive and metabolism independent. The uptake kinetics rapidly reached a maximum within 15 min, followed by a stasis for 60 min, and declining thereafter between 120 and 240 min, resulting in a biphasic curve. During this period, greater than one-third of the metal ion was sequestered within the cell. Our choice of a safe Biosafety Level I E. coli bacteria and the relatively non-toxic Tb3+ metal represents a model system for luminescent investigations of biosorption, for studying bacterial-water interfacial chemistry and for the bioremediation of heavy metals and radionuclides.

  1. A prospective study of 138 arthroscopies of the temporomandibular joint

    Directory of Open Access Journals (Sweden)

    Paulo Alexandre da Silva

    2015-08-01

    Full Text Available INTRODUCTION: Internal derangements (ID of the temporomandibular joint (TMJ have a multifactorial etiology and are most often treated conservatively by splints, physical therapy and medications. Only in 2-5% of cases are the treatment surgical, either by arthroscopy or arthrotomy.OBJECTIVE: To evaluate improvement of mouth opening, pain relief during function, position of the articular disk and complications following Arthroscopic Lyse and Lavage (ALL.METHODS: A prospective study of 78 patients (138 TMJs with TMJ ID, 5 males and 73 females, mean age 29.7 years, treated between January 2010 and April 2013, who were refractory to conservative treatment, had limited mouth opening and pain localized to the TMJ during function, and who were submitted to TMJ ALL and followed for a period of 12 months, with periodic reviews.RESULTS: ALL was effective in 93.6% of cases, with 85.3% experiencing improvement in mouth opening and 91.2% in pain reduction during function, 63% improvement in disk position and a rate of complications of 6.2%.CONCLUSION: In this study the ALL exhibited a high rate of success with low morbidity in internal derangements of the TMJ.

  2. Yrast 6+ Seniority Isomers of 136,138Sn

    Science.gov (United States)

    Simpson, G. S.; Gey, G.; Jungclaus, A.; Taprogge, J.; Nishimura, S.; Sieja, K.; Doornenbal, P.; Lorusso, G.; Söderström, P.-A.; Sumikama, T.; Xu, Z. Y.; Baba, H.; Browne, F.; Fukuda, N.; Inabe, N.; Isobe, T.; Jung, H. S.; Kameda, D.; Kim, G. D.; Kim, Y.-K.; Kojouharov, I.; Kubo, T.; Kurz, N.; Kwon, Y. K.; Li, Z.; Sakurai, H.; Schaffner, H.; Shimizu, Y.; Suzuki, H.; Takeda, H.; Vajta, Z.; Watanabe, H.; Wu, J.; Yagi, A.; Yoshinaga, K.; Bönig, S.; Daugas, J.-M.; Drouet, F.; Gernhäuser, R.; Ilieva, S.; Kröll, T.; Montaner-Pizá, A.; Moschner, K.; Mücher, D.; Naïdja, H.; Nishibata, H.; Nowacki, F.; Odahara, A.; Orlandi, R.; Steiger, K.; Wendt, A.

    2014-09-01

    Delayed γ-ray cascades, originating from the decay of (6+) isomeric states, in the very neutron-rich, semimagic isotopes 136,138Sn have been observed following the projectile fission of a 238U beam at RIBF, RIKEN. The wave functions of these isomeric states are proposed to be predominantly a fully aligned pair of f7/2 neutrons. Shell-model calculations, performed using a realistic effective interaction, reproduce well the energies of the excited states of these nuclei and the measured transition rates, with the exception of the B(E2;6+→4+) rate of 136Sn, which deviates from a simple seniority scheme. Empirically reducing the νf7/22 orbit matrix elements produces a 41+ state with almost equal seniority 2 and 4 components, correctly reproducing the experimental B(E2;6+→4+) rate of 136Sn. These data provide a key benchmark for shell-model interactions far from stability.

  3. Stress-inducible alternative translation initiation of human cytomegalovirus latency protein pUL138.

    Science.gov (United States)

    Grainger, Lora; Cicchini, Louis; Rak, Michael; Petrucelli, Alex; Fitzgerald, Kerry D; Semler, Bert L; Goodrum, Felicia

    2010-09-01

    We have previously characterized a 21-kDa protein encoded by UL138 (pUL138) as a viral factor inherent to low-passage strains of human cytomegalovirus (HCMV) that is required for latent infection in vitro. pUL138 is encoded on 3.6-, 2.7-, and 1.4-kb 3' coterminal transcripts that are produced during productive and latent infections. pUL138 is encoded at the 3' end of each transcript and is preceded by an extensive 5' sequence (approximately 0.5 to 2.5 kb) containing several putative open reading frames (ORFs). We determined that three putative ORFs upstream of UL138 (UL133, UL135, and UL136) encode proteins. The UL138 transcripts are polycistronic, such that each transcript expresses pUL138 in addition to the most-5' ORF. The upstream coding sequences (CDS) present a significant challenge for the translation of pUL138 in mammalian cells. We hypothesized that sequences 5' of UL138 mediate translation initiation of pUL138 by alternative strategies. Accordingly, a 663-nucloetide (nt) sequence overlapping the UL136 CDS supported expression of a downstream cistron in a bicistronic reporter system. We did not detect cryptic promoter activity or RNA splicing events that could account for downstream cistron expression. These data are consistent with the sequence element functioning as an internal ribosome entry site (IRES). Interestingly, pUL138 expression from the 3.6- and 2.7-kb transcripts was induced by serum stress, which concomitantly inhibited normal cap-dependent translation. Our work suggests that an alternative and stress-inducible strategy of translation initiation ensures expression of pUL138 under a variety of cellular contexts. The UL138 polycistronic transcripts serve to coordinate the expression of multiple proteins, including a viral determinant of HCMV latency.

  4. Construction of the energy matrix for complex atoms. Part VIII: Hyperfine structure HPC calculations for terbium atom

    Science.gov (United States)

    Elantkowska, Magdalena; Ruczkowski, Jarosław; Sikorski, Andrzej; Dembczyński, Jerzy

    2017-11-01

    A parametric analysis of the hyperfine structure (hfs) for the even parity configurations of atomic terbium (Tb I) is presented in this work. We introduce the complete set of 4fN-core states in our high-performance computing (HPC) calculations. For calculations of the huge hyperfine structure matrix, requiring approximately 5000 hours when run on a single CPU, we propose the methods utilizing a personal computer cluster or, alternatively a cluster of Microsoft Azure virtual machines (VM). These methods give a factor 12 performance boost, enabling the calculations to complete in an acceptable time.

  5. 22 CFR Appendix B to Part 138 - Disclosure Form To Report Lobbying

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disclosure Form To Report Lobbying B Appendix B to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. B Appendix B to Part 138—Disclosure Form To Report Lobbying EC06OC91.000 EC06OC91.001 EC06OC91...

  6. Spectrofluorimetric determination of human serum albumin using terbium-danofloxacin probe.

    Science.gov (United States)

    Ramezani, Amir M; Manzoori, Jamshid L; Amjadi, Mohammad; Jouyban, Abolghasem

    2012-01-01

    A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb(3+)-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb(3+)-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb(3+)-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH = 7.8, [Tb(3+)] = 8.5 × 10(-5) mol L(-1), [Dano] = 1.5 × 10(-4) mol L(-1). The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2 × 10(-6) - 1.3 × 10(-6) mol L(-1), 0.2 × 10(-6) - 1.4 × 10(-6) mol L(-1), and 0.2 × 10(-6) - 1 × 10(-6) mol L(-1), respectively. The detection limits (S/N = 3) for BSA, HSA, and plasma sample of HSA were 8.7 × 10(-8) mol L(-1), 6.2 × 10(-8) mol L(-1), and 8.1 × 10(-8) mol L(-1), respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.

  7. Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe

    Directory of Open Access Journals (Sweden)

    Amir M. Ramezani

    2012-01-01

    Full Text Available A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA and bovine serum albumin (BSA using terbium-danofloxacin (Tb3+-Dano as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA. Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH=7.8, [Tb3+] =8.5×10−5 mol L−1, [Dano] =1.5×10−4 mol L−1. The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2×10−6−1.3×10−6 mol L−1, 0.2×10−6−1.4×10−6 mol L−1, and 0.2×10−6−1×10−6 mol L−1, respectively. The detection limits (S/N = 3 for BSA, HSA, and plasma sample of HSA were 8.7×10−8 mol L−1, 6.2×10−8 mol L−1, and 8.1×10−8 mol L−1, respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.

  8. Determination of flavonoids in pharmaceutical preparations using Terbium sensitized fluorescence method

    Directory of Open Access Journals (Sweden)

    M Shaghaghi

    2009-12-01

    Full Text Available "nBackground and the Purpose of the Study: The aim of this study was development and validation of a simple, rapid and sensitive spectrofluorimetric method for determination of total flavonoids in two topical formulations of Calendula officinalis, Ziziphus Spina-christi and an oral drop of Hypiran perforatum L. The proposed method is based on the formation of terbium (Tb3+ "n-flavonoids (quercetin as a reference standard complex at pH 7.0, which has fluorescence intensely with maximum emission at 545 nm when excited at 310 nm. "nMethod "n: For ointments masses of topical formulations were weighed and added to ethanol-aqueous buffer (pH 10.0 and the resulting mixtures were shaken and then two phases were separated by centrifugation. Aqueous phases were filtered and then diluted with water. For Hypiran drops an appropriate portion was diluted with ethanol and then aliquots of sample or standard solutions were determined according to the experimental procedure. "nResults "n: Under the optimum conditions, total concentrations of flavonoids (as quercetin equivalent in three tested formulations were found to be 0.204 mg/g (for Dermatin cream, 0.476 mg/g (for Calendula ointment and 13.50 μg/ml (for Hypiran drops. Analytical recoveries from samples spiked with different amounts of quercetin were 96.1-104.0 % with RSD % of less than 3.5. Conclusion : The proposed method which requires a simple dissolution step without any matrix interferences provided high sensitivity and selectivity and was easily applied to determine total flavonoids in real samples of three investigated formulations with excellent reproducibility.

  9. TOF SIMS analysis and generation of white photoluminescence from strontium silicate codoped with europium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Tshabalala, Modiehi A.; Swart, Hendrik C.; Ntwaeaborwa, Odireleng M., E-mail: ntwaeab@ufs.ac.za [Department of Physics, University of the Free State, P.O Box 339, Bloemfontein 9300 South Africa (South Africa)

    2014-03-15

    White light emitting terbium (Tb{sup 3+}) and europium (Eu{sup 3+}) codoped strontium silicate (Sr{sub 2}SiO{sub 4}) phosphors were prepared by a solid state reaction process. The structure, particle morphology, chemical composition, ion distribution, photoluminescence (PL), and decay characteristics of the phosphors were analyzed by x-ray diffraction (XRD), scanning electron microscopy (SEM), time-of-flight secondary ion mass spectrometry (TOF-SIMS), and PL spectroscopy, respectively. The XRD data showed that our Sr{sub 2}SiO{sub 4} composed of two phases, namely, β-Sr{sub 2}SiO{sub 4} and α′-Sr{sub 2}SiO{sub 4}, and the α′-Sr{sub 2}SiO{sub 4} phase was more prominent than the β-Sr{sub 2}SiO{sub 4} phase. The SEM micrographs showed that the particles were agglomerated together and they did not have definite shapes. All ions (i.e., negative and positive) present in our materials were identified by TOF-SIMS. In addition, the chemical imaging performed with the TOF-SIMS demonstrated how the individual ions including the dopants (Eu{sup 3+} and Tb{sup 3+}) were distributed in the host lattice. White photoluminescence was observed when the Sr{sub 2}SiO{sub 4}:Tb{sup 3+}, Eu{sup 3+} phosphor was excited at 239 nm using a monochromatized xenon lamp as the excitation source. The phosphor exhibited fast decay lifetimes implying that it is not a good candidate for long afterglow applications.

  10. Synthesis, crystal structure and photophysical properties of europium(III) and terbium(III) complexes with pyridine-2,6-dicarboxamide

    NARCIS (Netherlands)

    Tanase, S.; Gallego, P.M.; Gelder, R. de; Fu, W.T.

    2007-01-01

    The reactions of pyridine-2,6-dicarboxamide with europium(III) and terbium(III) triflates led to the formation of mononuclear complexes of formula [Ln(pcam)(3)](CF3SO3)(3) (Ln = Eu 1, Tb 2; pcam stands for pyridine-2,6-dicarboxamide). From single-crystal X-ray diffraction analysis, the complexes

  11. Zinc sulfide and terbium-doped zinc sulfide films grown by traveling wave reactor atomic layer epitaxy

    CERN Document Server

    Yun, S J; Nam, K S

    1998-01-01

    Zinc sulfide (ZnS) and terbium-doped ZnS (ZnS:Tb) thin films were grown by traveling wave reactor atomic layer epitaxy (ALE). In the present work, ZnCl sub 2 , H sub 2 S, and tris (2,2,6,6-tetramethyl-3,5-heptandionato) terbium (Tb(tmhd) sub 3) were used as the precursors. The dependence of crystallinity and Cl content of ZnS films was investigated on the growth temperature. ZnS and ZnS:Tb films grown at temperatures ranging from 400 to 500 .deg. C showed a hexagonal-2H crystalline structure. The crystallinity of ZnS film was greatly enhanced as the temperature increased. At growth temperatures higher than 450.deg.C, the films showed preferred orientation with mainly (002) diffraction peak. The Cl content decreased from approximately 9 to 1 at.% with the increase in growth temperature from 400 to 500 .deg. C. The segregation of Cl near the surface region and the incorporation of O from Tb(tmhd) sub 3 during ALE process were also observed using Auger electron spectroscopy. The ALE-grown ZnS and ZnS:Tb films re...

  12. Commercializing potassium terbium fluoride, KTF (KTb3F10) faraday crystals for high laser power optical isolator applications

    Science.gov (United States)

    Schlichting, Wolfgang; Stevens, Kevin; Foundos, Greg; Payne, Alexis

    2017-10-01

    Many scientific lasers and increasingly industrial laser systems operate in power regime, require high-performance optical isolators to prevent disruptive light feedback into the laser cavity. The optically active Faraday material is the key optical element inside the isolator. SYNOPTICS has been supplying the laser market with Terbium Gallium Garnet (TGG - Tb3Ga5O12) for many years. It is the most commonly used material for the 650-1100nm range and the key advantages for TGG include its cubic crystal structure for alignment free processing, little to no intrinsic birefringence, and ease of manufacture. However, for high-power laser applications TGG is limited by its absorption at 1064nm and its thermo-optic coefficient, dn/dT. Specifically, thermal lensing and depolarization effects become a limiting factor at high laser powers. While TGG absorption has improved significantly over the past few years, there is an intrinsic limit. Now, SYNOPTICS is commercializing the enhanced new crystal Potassium Terbium Fluoride KTF (KTb3F10) that exhibits much smaller nonlinear refractive index and thermo-optic coefficients, and still exhibits a Verdet constant near that of TGG. This cubic crystal has relatively low absorption and thermo-optic coefficients. It is now fully characterized and available for select production orders. At OPTIFAB in October 2017 we present recent results comparing the performance of KTF to TGG in optical isolators and show SYNOPTICS advances in large volume crystal growth and the production ramp up.

  13. Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

    Directory of Open Access Journals (Sweden)

    Devender Singh

    2016-12-01

    Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

  14. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    Fifteen putative targets of hcmv-miR-UL36 were identified using hybrid PCR, one being the HCMV UL138 gene that has previously been identified as a novel latency-associated determinant of HCMV infection. Down-regulation of UL138 expression by hcmv-miR-UL36 was validated using luciferase reporter assays and ...

  15. Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater

    Science.gov (United States)

    Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.

    2017-06-01

    HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

  16. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.

    Science.gov (United States)

    2010-07-01

    ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... every three years from the year the limits of liability were last adjusted for inflation, the Director...

  17. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can roads be built in roadless and wild areas? 170.138 Section 170.138 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and...

  18. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

    Science.gov (United States)

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

  19. Die kontekstuele funksie van Hebreërs 13:8

    African Journals Online (AJOL)

    29 Jul 2015 ... The contextual function of Hebrews 13:8. In this article the contextual function of Hebrews. 13:8 is investigated. This verse is rather enigmatic as regards its meaning and contextual function. Scholars usually find that verse 8 combines with the immediately preceding and following verses, that is, verses 7 ...

  20. 11 CFR 100.138 - Sale of food and beverages by vendor.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

  1. Site-directed mutagenesis of human immunodeficiency virus type 1 reverse transcriptase at amino acid position 138.

    Science.gov (United States)

    Pelemans, H; Aertsen, A; Van Laethem, K; Vandamme, A M; De Clercq, E; Pérez-Pérez, M J; San-Félix, A; Velázquez, S; Camarasa, M J; Balzarini, J

    2001-02-01

    TSAO derivatives represent a class of nonnucleoside reverse transcriptase inhibitors (NNRTIs) that consistently select for the Glu138Lys resistance mutation in HIV-1 reverse transcriptase (RT). Seven RT mutants (i.e., Ala, Asp, Gln, Gly, Lys, Phe, and Tyr) were constructed by site-directed mutagenesis. The mutant Glu138Asp, Glu138Lys, Glu138Gln, Glu138Ala, and Glu138Gly RTs retained marked catalytic activity. In contrast, the Glu138Phe and Glu138Tyr RT mutants showed poor RNA-dependent DNA polymerase activity (30 and 4% of wild-type, respectively). TSAO derivatives lost their inhibitory activity against all mutant enzymes, except against the closely related Glu138Asp RT mutant that remained as sensitive to TSAOs as did wild-type RT. Other NNRTIs, including delavirdine, emivirine, and UC-781, and the NRTI ddGTP retained pronounced inhibitory activity against all mutant enzymes. When the amino acid mutations at position 138 of RT were introduced in recombinant virus clones, the sensitivity/resistance spectrum obtained toward the TSAOs and other NNRTIs was similar to those observed for the isolated recombinant mutant enzymes. The Glu138Lys RT mutant virus had the most marked resistance to TSAOs, followed by the Glu138Gln, Glu138Phe, Glu138Gly, Glu138Tyr, and Glu138Ala virus mutants. The Glu138Asp RT mutant virus kept full sensitivity to the TSAO derivatives. Mixtures of Glu138Lys RT mutant virus with the other virus clones mutated at the 138 position resulted in all cases, except for the Glu138Asp and Glu138Gly RT mutant viruses, in an outgrowth of the Glu138Lys RT mutant virus. Since the Glu138Lys RT proved most resistant to TSAO derivatives, was among the most catalytically efficient enzymes, and resulted in highly replication-competent virus, our data explain why the Glu138Lys RT mutant virus strains but not virus strains containing other amino acids at position 138 invariably emerge in cell cultures under TSAO drug pressure. Copyright 2001 Academic Press.

  2. Synthesis and luminescent study of Ce{sup 3+}-doped terbium-yttrium aluminum garnet

    Energy Technology Data Exchange (ETDEWEB)

    Dotsenko, V.P., E-mail: ssclab@ukr.net [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Berezovskaya, I.V.; Zubar, E.V.; Efryushina, N.P. [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Poletaev, N.I.; Doroshenko, Yu.A. [Institute of Combustion and Advanced Technologies, Mechnikov Odessa National University, Dvoryanskaya 2, 65082 Odessa (Ukraine); Stryganyuk, G.B. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine); HASYLAB at DESY, Notkestrasse 85, 22607 Hamburg (Germany); Voloshinovskii, A.S. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine)

    2013-02-15

    Highlights: Black-Right-Pointing-Pointer Ce{sup 3+}-doped garnets (TYAG) were prepared using nanostructured reagents. Black-Right-Pointing-Pointer The Ce{sup 3+} ions cause a very efficient yellow emission of the samples. Black-Right-Pointing-Pointer The reasons for the long wavelength position of this emission are discussed. Black-Right-Pointing-Pointer Contribution from Al atoms to the conduction band of TYAG is quite essential. - Abstract: Terbium-yttrium aluminum garnets (TYAG) doped with Ce{sup 3+} ions have been prepared by solid state reactions between nanostructured oxides of aluminum and rare earths. The luminescent properties of Ce{sup 3+} ions in (Tb{sub 0.8}Y{sub 0.2}){sub 3(1-x)}Ce{sub 3x}Al{sub 5}O{sub 12} (x = 0.03) have been studied upon excitation in the 2-20 eV region. The substitution of Tb{sup 3+} for Y{sup 3+} in the garnet structure results in broadening the emission band and shifting its maximum towards the longer wavelengths. It was found that in addition to the 4f{sup n} {yields} 4f{sup n-1}5d excitation bands of Ce{sup 3+} and Tb{sup 3+} ions, the excitation spectra for the Ce{sup 3+} emission contain broad bands at 6.73 and {approx}9.5 eV. These bands are attributed to the Ce{sup 3+}-bound exciton formation and O 2p {yields} Al 3s, 3p transitions, respectively. In contrast to the predictions based on the results of electronic structure calculations on Y{sub 3}Al{sub 5}O{sub 12} and Tb{sub 4}Al{sub 2}O{sub 9}, the threshold of interband transitions in TYAG is at high energies ( Greater-Than-Or-Slanted-Equal-To 7.3 eV), and contributions from Al{sub tetr} and Al{sub oct} atoms to the conduction-band density of states are evaluated as quite essential.

  3. Flow Cytometry Assessment of In Vitro Generated CD138+ Human Plasma Cells

    Directory of Open Access Journals (Sweden)

    Rayelle Itoua Maïga

    2014-01-01

    Full Text Available The in vitro CD40-CD154 interaction promotes human B lymphocytes differentiation into plasma cells. Currently, CD138 is the hallmark marker enabling the detection of human plasma cells, both in vitro and in vivo; its presence can be monitored by flow cytometry using a specific antibody. We have developed a culture system allowing for the differentiation of memory B lymphocytes. In order to detect the newly formed plasma cells, we have compared their staining using five anti-CD138 monoclonal antibodies (mAbs. As a reference, we also tested human cell lines, peripheral blood mononuclear cells, and bone marrow samples. The five anti-CD138 mAbs stained RPMI-8226 cells (>98% with variable stain index (SI. The highest SI was obtained with B-A38 mAb while the lowest SI was obtained with DL-101 and 1D4 mAbs. However, the anti-CD138 mAbs were not showing equivalent CD138+ cells frequencies within the generated plasma cells. B-A38, B-B4, and MI-15 were similar (15–25% while DL-101 mAb stained a higher proportion of CD138-positive cells (38–42%. DL-101 and B-A38 mAbs stained similar populations in bone marrow samples but differed in their capacity to bind to CD138high and CD138lo cell lines. In conclusion, such cellular fluctuations suggest heterogeneity in human plasma cell populations and/or in CD138 molecules.

  4. Structural variations in terbium(III) complexes with 1,3-adamantanedicarboxylate and diverse co-ligands

    Energy Technology Data Exchange (ETDEWEB)

    Thuéry, Pierre, E-mail: pierre.thuery@cea.fr

    2015-07-15

    Terbium nitrate was reacted with 1,3-adamantanedicarboxylic acid (LH{sub 2}) under solvo-hydrothermal conditions with either N,N-dimethylformamide (DMF) or N,N-dimethylacetamide (DMA) as organic solvents. Hydrolysation of the latter co-solvents resulted in the formation of formate or acetate ions, which are present as co-ligands in the 1D coordination polymer [Tb(L)(HCOO)(H{sub 2}O){sub 2}] (1) and the 2D assembly [Tb(L)(CH{sub 3}COO)(H{sub 2}O)] (2). The increase in dimensionality in the latter arises from the higher connectivity provided by acetate versus formate, the L{sup 2−} ligand being bis-chelating in both cases. The complex [Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 5}][Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 4}]·3H{sub 2}O (3), another 1D species, crystallizes alongside crystals of 2. Further addition of cucurbit[6]uril (CB6), with DMF as co-solvent, gave the two complexes [Tb{sub 2}(L){sub 2}(CB6)(H{sub 2}O){sub 6}](NO{sub 3}){sub 2}·6H{sub 2}O (4) and [H{sub 2}NMe{sub 2}]{sub 2}[Tb(L)(HCOO){sub 2}]{sub 2}·CB6·3H{sub 2}O (5). Complex 4 crystallizes as a 3D framework in which Tb(L){sup +} chains are connected by tetradentate CB6 molecules, while 5 unites a carboxylate-bridged anionic 2D planar assembly and layers of CB6 molecules with counter-cations held at both portals. - Graphical abstract: One- to three-dimensional assemblies are formed in terbium(III) complexes with 1,3-adamantanedicarboxylate obtained under solvo-hydrothermal conditions, these species including formate or acetate co-ligands formed in situ, or additional cucurbit[6]uril molecules. - Highlights: • We report structures of terbium(III) complexes with 1,3-adamantanedicarboxylate. • Solvents able to generate co-ligands or counter-ions in situ have been used. • A 3D species including additional cucurbituril molecules is decribed. • One species displays an alternation of metal–organic and organic sheets.

  5. Complete Stokes polarimetry of magneto-optical Faraday effect in a terbium gallium garnet crystal at cryogenic temperatures.

    Science.gov (United States)

    Majeed, Hassaan; Shaheen, Amrozia; Anwar, Muhammad Sabieh

    2013-10-21

    We report the complete determination of the polarization changes caused in linearly polarized incident light due to propagation in a magneto-optically active terbium gallium garnet (TGG) single crystal, at temperatures ranging from 6.3 to 300 K. A 28-fold increase in the Verdet constant of the TGG crystal is seen as its temperature decreases to 6.3 K. In contrast with polarimetry of light emerging from a Faraday material at room temperature, polarimetry at cryogenic temperatures cannot be carried out using the conventional fixed polarizer-analyzer technique because the assumption that ellipticity is negligible becomes increasingly invalid as temperature is lowered. It is shown that complete determination of light polarization in such a case requires the determination of its Stokes parameters, otherwise inaccurate measurements will result with negative implications for practical devices.

  6. Development of Optical Isolators for Visible Light Using Terbium Aluminum Garnet (Tb3Al5O12) Single Crystals

    Science.gov (United States)

    Geho, Mikio; Takagi, Takashi; Chiku, Shinichiro; Fujii, Takashi

    2005-07-01

    We have recently reported the successful growth of incongruently melting terbium aluminum garnet (Tb3Al5O12; TAG) single crystals by the hybrid laser FZ (floating zone) method. Optical property evaluations confirmed a high transmittance and a larger Verdet constant than conventional Tb3Ga5O12 (TGG) crystals and/or Faraday glasses. In this study, we attempted to design, fabricate, and evaluate optical isolators in visible light through near-infrared (NIR) regions using TAG crystals. A finite element method (FEM) simulation of possible models led us to the preferable one based on a radially magnetized magnet. To realize this, we employed a pseudo-radially magnetized magnet. The target wavelengths of the prototype device were 408, 808, and 1064 nm. The typical extinction ratio was more than 30 dB and the insertion loss was less than 0.3 dB for AR-coated devices.

  7. A hydrometallurgical process for the recovery of terbium from fluorescent lamps: Experimental design, optimization of acid leaching process and process analysis.

    Science.gov (United States)

    Innocenzi, Valentina; Ippolito, Nicolò Maria; De Michelis, Ida; Medici, Franco; Vegliò, Francesco

    2016-12-15

    Terbium and rare earths recovery from fluorescent powders of exhausted lamps by acid leaching with hydrochloric acid was the objective of this study. In order to investigate the factors affecting leaching a series of experiments was performed in according to a full factorial plan with four variables and two levels (4 2 ). The factors studied were temperature, concentration of acid, pulp density and leaching time. Experimental conditions of terbium dissolution were optimized by statistical analysis. The results showed that temperature and pulp density were significant with a positive and negative effect, respectively. The empirical mathematical model deducted by experimental data demonstrated that terbium content was completely dissolved under the following conditions: 90 °C, 2 M hydrochloric acid and 5% of pulp density; while when the pulp density was 15% an extraction of 83% could be obtained at 90 °C and 5 M hydrochloric acid. Finally a flow sheet for the recovery of rare earth elements was proposed. The process was tested and simulated by commercial software for the chemical processes. The mass balance of the process was calculated: from 1 ton of initial powder it was possible to obtain around 160 kg of a concentrate of rare earths having a purity of 99%. The main rare earths elements in the final product was yttrium oxide (86.43%) following by cerium oxide (4.11%), lanthanum oxide (3.18%), europium oxide (3.08%) and terbium oxide (2.20%). The estimated total recovery of the rare earths elements was around 70% for yttrium and europium and 80% for the other rare earths. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Investigation of the luminescent properties of terbium-anthranilate complexes and application to the determination of anthranilic acid derivatives in aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Arnaud, N.; Georges, J

    2003-01-10

    The luminescent properties of terbium complexes with furosemide (FR), flufenamic (FF) acid, tolfenamic (TF) acid and mefenamic (MF) acid have been investigated in aqueous solutions. For all four compounds, complexation occurs when the carboxylic acid of the aminobenzoic group is dissociated and is greatly favoured in the presence of trioctylphosphine oxide as co-ligand and Triton X-100 as surfactant. Under optimum conditions, luminescence of the lanthanide ion is efficiently sensitised and the lifetime of the {sup 5}D{sub 4} resonance level of terbium in the complex is ranging between 1 and 1.9 ms, against 0.4 ms for the aqua ion. The sensitivity of the method for the determination of anthranilic acid derivatives is improved by one to two orders of magnitude with respect to that achieved using native fluorescence or terbium-sensitised luminescence in methanol. The limits of detection are 2x10{sup -10}, 5x10{sup -10} and 2x10{sup -9} mol l{sup -1} for flufenamic acid, furosemide and tolfenamic acid, and mefenamic acid, respectively, with within-run RSD values of less than 1%. The method has been applied to the determination of flufenamic acid in spiked calf sera with and without sample pretreatment. Depending on the method and the analyte concentration, the recovery was ranging between 83 and 113% and the lowest concentration attainable in serum samples was close to 1x10{sup -7} mol l{sup -1}.

  9. Soluble CD138/Syndecan-1 Increases in the Sera of Patients with Moderately Differentiated Bladder Cancer.

    Science.gov (United States)

    Sanaee, Mohammad Nabi; Malekzadeh, Mahyar; Khezri, Abdolaziz; Ghaderi, Abbas; Doroudchi, Mehrnoosh

    2015-01-01

    CD138/Syndecan-1 (Sdc-1) is expressed on the tumor and stromal cells of invasive bladder carcinoma. CD138/Sdc-1 shedding from the cell surface is associated with the invasive phenotype in lung and breast cancers. Soluble CD138/Sdc-1 was measured in the sera of 86 bladder cancer patients and 57 healthy individuals by a commercial ELISA assay. Soluble Sdc-1 was increased in the sera of patients with bladder cancer (138.42 ± 81.85 vs. 86.48 ± 82.58 ng/ml, p = 0.0003). Patients aged over 70 years had higher levels of CD138/Sdc-1 in their sera (159.7 ± 15.77 vs. 124.5 ± 9.99 ng/ml, p = 0.025), and soluble Sdc-1 levels were higher in the sera of patients with moderately differentiated tumors compared to poorly differentiated ones (170.47 ± 85.06 vs. 101.79 ± 68.24 ng/ml, p = 0.01). The soluble Sdc-1 level was higher in muscle-invasive (154.45 ± 83.60 vs. 89.9 ± 55.02 ng/ml) but not lymphatic-invasive (106.25 ± 52.10 vs. 123.43 ± 63.76 ng/ml) tumors (p = 0.027 and 0.45, respectively). A non-significant trend of soluble Sdc-1 increase in the sera of male patients compared to female patients was observed (145.38 ± 85.47 vs. 110.20 ± 59.04 ng/ml, p = 0.054). The elevated levels of soluble CD138/Sdc-1 in older bladder cancer patients and those with muscular invasion sheds some light on the mechanisms of the disease invasion. © 2015 S. Karger AG, Basel.

  10. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    DEFF Research Database (Denmark)

    Eskildsen, Tilde; Taipaleenmäki, H.; Stenvang, Jan

    2011-01-01

    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......, overexpression of miR-138 reduced ectopic bone formation in vivo by 85%, and conversely, in vivo bone formation was enhanced by 60% when miR-138 was antagonized. Target prediction analysis and experimental validation by luciferase 3' UTR reporter assay confirmed focal adhesion kinase, a kinase playing a central...

  11. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from disease Nile tilapia

    Science.gov (United States)

    The complete genome of a virulent Streptococcus agalactiae strain 138P is 1838701 bp in size, containing 1831 genes. The genome has 1593 coding sequences, 152 pseudo genes, 16 rRNAs, 69 tRNAs, and 1 non-coding RNA. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipel...

  12. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  13. Abundances of La 138 and Ta 180 Through ν-Nucleosynthesis in ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Abundances of La138 and Ta180 Through ν-Nucleosynthesis in 20 M ⊙ Type II Supernova Progenitor, Guided by Stellar Models for Seeds. N. Lahkar S. Kalita H. L. Duorah K. Duorah. Research Article Volume 38 Issue 1 March 2017 Article ID 8 ...

  14. Carbide precipitates in solution-quenched PH13-8 Mo stainless ...

    Indian Academy of Sciences (India)

    This paper deals with the small-angle neutron scattering (SANS) investigation on solution-quenched PH13-8 Mo stainless steel. From the nature of the variation of the functionality of the profiles for varying specimen thickness and also from the transmission electron microscopy (TEM), it has been established that the ...

  15. Structural investigation and photoluminescent properties of gadolinium(III), europium(III) and terbium(III) 3-mercaptopropionate complexes.

    Science.gov (United States)

    Souza, E R; Mazali, I O; Sigoli, F A

    2014-01-01

    This work reports on the synthesis, crystallographic determination and spectroscopic characterization of gadolinium(III), terbium(III) and europium(III) 3-mercaptopropionate complexes, aqua-tris(3-mercaptopropionate)lanthanide(III)--[Ln(mpa)3(H2O)]. The Judd-Ofelt intensity parameters were experimentally determined from emission spectrum of the [Eu(mpa)3(H2O)]complex and they were also calculated from crystallographic data. The complexes are coordination polymers, where the units of each complex are linked together by carboxylate groups leading to an unidimensional and parallel chains that by chemical interactions form a tridimensional framework. The emission spectrum profile of the [Eu(mpa)3(H2O)] complex is discussed based on point symmetry of the europium(III) ion, that explains the bands splitting observed in its emission spectrum. Photoluminescent analysis of the [Gd(mpa)3(H2O)] complex show no efficient ligand excitation but an intense charge transfer band. The excitation spectra of the [Eu(mpa)3(H2O)] and [Tb(mpa)3(H2O)] complexes do not show evidence of energy transfer from the ligand to the excited levels of these trivalent ions. Therefore the emission bands are originated only by direct f-f intraconfigurational excitation of the lantanide(III) ions.

  16. Fluorometric determination of proteins using the terbium (III)-2-thenoyltrifluoroacetone-sodium dodecyl benzene sulfonate-protein system

    Energy Technology Data Exchange (ETDEWEB)

    Jia Zhen [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Department of Chemistry, Dezhou University, Dezhou 253023 (China); Yang Jinghe [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)]. E-mail: yjh@sdu.edu.cn; Wu Xia [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Wang Fei [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Guo Changying [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Liu Shufang [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)

    2006-12-15

    It is found that in hexamethylene tetramine (HMTA)-HCl buffer of pH=8.00, proteins can enhance the fluorescence of terbium (III) (Tb{sup 3+})-2-thenoyltrifluoroacetone (TTA)-sodium dodecyl benzene sulfonate (SDBS) system. Based on this, a sensitive method for the determination of proteins is proposed. The experiments indicate that under the optimum conditions, the enhanced fluorescence intensity is in proportion to the concentration of proteins in the range of 4.0x10{sup -9}-7.5x10{sup -6}g/mL for bovine serum albumin (BSA), 5.0x10{sup -9}-1.5x10{sup -5}g/mL for human serum albumin (HSA), 1.0x10{sup -8}-7.5x10{sup -6}g/mL for egg albumin (EA). Their detection limits (S/N=3) are 0.5, 0.8 and 2.0ng/mL, respectively. The interaction mechanism is also studied.

  17. Terbium to Quantum Dot FRET Bioconjugates for Clinical Diagnostics: Influence of Human Plasma on Optical and Assembly Properties

    Directory of Open Access Journals (Sweden)

    Niko Hildebrandt

    2011-10-01

    Full Text Available Förster resonance energy transfer (FRET from luminescent terbium complexes (LTC as donors to semiconductor quantum dots (QDs as acceptors allows extraordinary large FRET efficiencies due to the long Förster distances afforded. Moreover, time-gated detection permits an efficient suppression of autofluorescent background leading to sub-picomolar detection limits even within multiplexed detection formats. These characteristics make FRET-systems with LTC and QDs excellent candidates for clinical diagnostics. So far, such proofs of principle for highly sensitive multiplexed biosensing have only been performed under optimized buffer conditions and interactions between real-life clinical media such as human serum or plasma and LTC-QD-FRET-systems have not yet been taken into account. Here we present an extensive spectroscopic analysis of absorption, excitation and emission spectra along with the luminescence decay times of both the single components as well as the assembled FRET-systems in TRIS-buffer, TRIS-buffer with 2% bovine serum albumin, and fresh human plasma. Moreover, we evaluated homogeneous LTC-QD FRET assays in QD conjugates assembled with either the well-known, specific biotin-streptavidin biological interaction or, alternatively, the metal-affinity coordination of histidine to zinc. In the case of conjugates assembled with biotin-streptavidin no significant interference with the optical and binding properties occurs whereas the histidine-zinc system appears to be affected by human plasma.

  18. Evidence of mass exchange between inside and outside of sonoluminescing bubble in aqueous solution of terbium chloride

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Jinfu, E-mail: liang.shi2007@163.com [School of Physics and Electronic Science, Guizhou Normal University, Guiyang 550001 (China); Chen, Weizhong, E-mail: wzchen@nju.edu.cn [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China); Wang, Xun; Yang, Jing; Chen, Zhan [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China)

    2016-12-16

    Highlights: • Time-resolved spectra of SBSL were obtained for Tb{sup 3+} ions emission lines. • Mass exchange between inside and outside of SL bubble was probed via Tb{sup 3+} ions lines. • The argon rectification hypothesis was tested by time-resolved spectra of SBSL. • The rate of mass exchange inside an SBSL bubble increases with increasing sound pressure. - Abstract: Spectra of single-bubble sonoluminescence (SBSL) were obtained for Tb{sup 3+} ions emission lines from bubbles in an aqueous solution of terbium chloride (TbCl{sub 3}). The spectra provide experimental evidence to prove that an air bubble driven by strong ultrasound will not eventually become a rectified pure argon bubble, which is not as predicted by the argon rectification hypothesis. The time-resolved spectra of SBSL show a mass exchange of material such as Tb{sup 3+} ions between the inside and outside of the bubble. With increasing sound pressure, the rate of mass exchange and the SBSL intensity increases.

  19. Optical properties and electrical transport of thin films of terbium(III bis(phthalocyanine on cobalt

    Directory of Open Access Journals (Sweden)

    Peter Robaschik

    2014-11-01

    Full Text Available The optical and electrical properties of terbium(III bis(phthalocyanine (TbPc2 films on cobalt substrates were studied using variable angle spectroscopic ellipsometry (VASE and current sensing atomic force microscopy (cs-AFM. Thin films of TbPc2 with a thickness between 18 nm and 87 nm were prepared by organic molecular beam deposition onto a cobalt layer grown by electron beam evaporation. The molecular orientation of the molecules on the metallic film was estimated from the analysis of the spectroscopic ellipsometry data. A detailed analysis of the AFM topography shows that the TbPc2 films consist of islands which increase in size with the thickness of the organic film. Furthermore, the cs-AFM technique allows local variations of the organic film topography to be correlated with electrical transport properties. Local current mapping as well as local I–V spectroscopy shows that despite the granular structure of the films, the electrical transport is uniform through the organic films on the microscale. The AFM-based electrical measurements allow the local charge carrier mobility of the TbPc2 thin films to be quantified with nanoscale resolution.

  20. Highly luminescent charge-neutral europium(iii) and terbium(iii) complexes with tridentate nitrogen ligands.

    Science.gov (United States)

    Senthil Kumar, Kuppusamy; Schäfer, Bernhard; Lebedkin, Sergei; Karmazin, Lydia; Kappes, Manfred M; Ruben, Mario

    2015-09-21

    We report on the synthesis of tridentate-nitrogen pyrazole-pyridine-tetrazole (L(1)H) and pyrazole-pyridine-triazole (L(2)H) ligands and their complexation with lanthanides (Ln = Gd(iii), Eu(iii) and Tb(iii)) resulting in stable, charge-neutral complexes Ln(L(1))3 and Ln(L(2))3, respectively. X-ray crystallographic analysis of the complexes with L(1) ligands revealed tricapped trigonal coordination geometry around the lanthanide ions. All complexes show bright photoluminescence (PL) in the solid state, indicating efficient sensitization of the lanthanide emission via the triplet states of the ligands. In particular, the terbium complexes show high PL quantum yields of 65 and 59% for L(1) and L(2), respectively. Lower PL efficiencies of the europium complexes (7.5 and 9%, respectively) are attributed to large energy gaps between the triplet states of the ligands and accepting levels of Eu(iii). The triplet state energy can be reduced by introducing an electron withdrawing (EW) group at the 4 position of the pyridine ring. Such substitution of L(1)H with a carboxylic ester (COOMe) EW group leads to a europium complex with increased PL quantum yield of 31%. A comparatively efficient PL of the complexes dissolved in ethanol indicates that the lanthanide ions are shielded against nonradiative deactivation via solvent molecules.

  1. Micelle enhanced and terbium sensitized spectrofluorimetric determination of danofloxacin in milk using molecularly imprinted solid phase extraction

    Science.gov (United States)

    Kaur, Kuldeep; Saini, Shivender Singh; Malik, Ashok Kumar; Singh, Baldev

    2012-10-01

    An efficient molecularly imprinted solid phase extraction (MISPE)-spectrofluorimetric method was developed to sensitively determine danofloxacin (DAN) in milk samples. Solid phase extraction procedure using MISPE cartridges was first performed on milk samples and then spectrofluorimetric determination was done at 546 nm using an excitation wavelength of 285 nm in presence of terbium and sodium dodecyl benzene sulfonate (SDBS). It was found that SDBS significantly enhanced the fluorescence intensity of the DAN-Tb3+ complex. Various factors affecting the fluorescence intensity of DAN-Tb3+-SDBS system were studied and conditions were optimized. The enhanced fluorescence intensity of the system (ΔF) showed a good linear relationship with the concentration of DAN over the range of 8.4 × 10-9-3.4 × 10-7 mol L-1 with a correlation coefficient of 0.9996. The detection limit was determined as 2.0 × 10-9 mol L-1 and the limit of quantification was determined as 6.5 × 10-9 mol L-1. The MISPE-spectrofluorimetric procedure was successfully applied to the determination of DAN in milk samples. The method is simple, rapid, sensitive and allows interference free determination of DAN in complex fluorescent matrices like milk. The method can be used to determine whether the DAN residues in milk exceed MRLs or not.

  2. Study of quantum dot based on tin/yttrium mixed oxide doped with terbium to be used as biomarker

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b, E-mail: claudiakodaira@yahoo.co [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f; Nunes, Luiz Antonio O., E-mail: luizant@ifsc.usp.b [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica. Dept. de Fisica e Informatica

    2009-07-01

    Quantum dots (semiconductors nanocrystals) have brought a promising field to develop a new generation of luminescent biomarkers. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. These luminescent dots are functionalized with biomolecules. For the luminophore particle to be connect with biologicals molecules (for example covalent antibody) is necessary a previous chemical treatment to modify luminophore particle surface and this process is called functionalization. A prior chemical treatment with changes on the surface luminophore particle is necessary to couple the luminophore to biological molecules. This process can be used as coating which can protect these particles from being dissolved by acid as well as provide functional groups for biological conjugation. This work presents a photoluminescence study of nanoparticles based on tin/yttrium mixed oxides doped with terbium (SnO{sub 2}/Y{sub 2}O{sub 3}:Tb{sup 3+}), synthesized by coprecipitation method. The nanoparticles were submitted to thermal treatment and characterized by X-Ray Powder Diffraction (XRD) that showed cassiterite phase formation and the influence of thermal treatment on nanoparticles structures. These nanoparticles going to be functionalized with a natural polysaccharide (chitosan) in order to form microspheres. These microspheres going to be irradiated with gamma radiation to sterilization and it can be evaluated if the nanoparticles are resistant to irradiation and they do not lose functionality with this process. (author)

  3. MiR-138 Inhibits Tumor Growth Through Repression of EZH2 in Non-Small Cell Lung Cancer

    Directory of Open Access Journals (Sweden)

    Huijun Zhang

    2013-01-01

    Full Text Available Background/Aims: MicroRNAs (miRNAs play important roles in tumorigenesis. We investigated the roles and mechanisms of miR-138 in human non-small cell lung cancer (NSCLC. Methods: The expression of miR-138 was first examined in NSCLC cell lines and tumourtissues by real-time PCR The in vitro and in vivo functional effect of miR-138 was examined further. A luciferase reporter assay was conducted to confirm target association between miR-138 and the enhancer of zeste homolog 2 (EZH2. Results: miR-138 was frequently downregulated in NSCLC cells and tissues. Overexpression of miR-138 inhibited proliferation of NSCLC cells in vitro and tumor growth in vivo. The EZH2 oncogene, which is often overexpressed in various human cancers and acts as an important regulator of cell growth and tumor invasion, was identified as a novel target of miR-138. miR-138 can bind to the 3′ untranslated region (3′ UTR of EZH2 and suppress the expression of EZH2 at both mRNA and protein levels. Furthermore, knockdown of EZH2 phenocopied the tumor suppressive effects of miR-138 in cell models, whereas ectopic expression of EZH2 rescued the suppressive effects of miR-138. Conclusion: These findings define a tumor suppressor function for miR-138 in NSCLC and further suggest that miR-138 may represent a potential therapeutic target for NSCLC patients.

  4. MicroRNA-138 is a potential regulator of memory performance in humans

    Directory of Open Access Journals (Sweden)

    Julia eSchröder

    2014-07-01

    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  5. Terbium-doped gadolinium oxysulfide (Gd2O2S:Tb) scintillation-based polymer optical fibre sensor for real time monitoring of radiation dose in oncology

    Science.gov (United States)

    Lewis, E.; O'Keeffe, S.; Grattan, M.; Hounsell, A.; McCarthy, D.; Woulfe, P.; Cronin, J.; Mihai, L.; Sporea, D.; Santhanam, A.; Agazaryan, N.

    2014-05-01

    A PMMA based plastic optical fibre sensor for use in real time radiotherapy dosimetry is presented. The optical fibre tip is coated with a scintillation material, terbium-doped gadolinium oxysulfide (Gd2O2S:Tb), which fluoresces when exposed to ionising radiation (X-Ray). The emitted visible light signal penetrates the sensor optical fibre and propagates along the transmitting fibre at the end of which it is remotely monitored using a fluorescence spectrometer. The results demonstrate good repeatability, with a maximum percentage error of 0.5% and the response is independent of dose rate.

  6. Precipitate modification in PH13-8 Mo type maraging steel

    Energy Technology Data Exchange (ETDEWEB)

    Leitner, H., E-mail: harald.leitner@unileoben.ac.at [Department of Physical Metallurgy and Materials Testing, Montanuniversitaet Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Christian Doppler Laboratory for Early Stages of Precipitation, Montanuniversitaet Leoben, Franz-Josef-Strsse 18, A-8700 Leoben (Austria); Schnitzer, R. [Department of Physical Metallurgy and Materials Testing, Montanuniversitaet Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Christian Doppler Laboratory for Early Stages of Precipitation, Montanuniversitaet Leoben, Franz-Josef-Strsse 18, A-8700 Leoben (Austria); Schober, M. [Department of Physical Metallurgy and Materials Testing, Montanuniversitaet Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zinner, S. [Boehler Edelstahl GmbH, Mariazellerstrasse 25, A-8605 Kapfenberg (Austria)

    2011-07-15

    The evolution of precipitates in PH13-8 Mo type stainless maraging steel alloyed with Cu was investigated during aging at 525 {sup o}C. Atom probe tomography was used to follow the evolution of precipitates with respect to type and chemical composition. It was found that Cu modifies the precipitation sequence in such alloys. Instead of Ni{sub 3}(Ti,Al) and G-phase the formation of NiAl and G-phase occurred. The modification of the precipitation sequence is due to the incorporation of Cu in NiAl precipitates. However, both types of precipitates develop out of an undefined precursor phase, in contrast to other Cu-alloyed PH13-8 Mo maraging steel grades.

  7. C/EBPβ mediates RNA polymerase III-driven transcription of oncomiR-138 in malignant gliomas

    Science.gov (United States)

    Di Pascale, Federica; Nama, Srikanth; Muhuri, Manish; Quah, Shan; Ismail, Hisyam M; Chan, Xin Hui Derryn; Sundaram, Gopinath M; Ramalingam, Rajkumar; Burke, Brian

    2018-01-01

    Abstract MicroRNA-138 (miR-138) is a pro-survival oncomiR for glioma stem cells. In malignant gliomas, dysregulated expression of microRNAs, such as miR-138, promotes Tumour initiation and progression. Here, we identify the ancillary role of the CCAAT/enhancer binding protein β (C/EBPβ) as a transcriptional activator of miR-138. We demonstrate that a short 158 bp DNA sequence encoding the precursor of miR-138-2 is essential and sufficient for transcription of miR-138. This short sequence includes the A-box and B-box elements characteristic of RNA Polymerase III (Pol III) promoters, and is also directly bound by C/EBPβ via an embedded ‘C/EBPβ responsive element’ (CRE). CRE and the Pol III B-box element overlap, suggesting that C/EBPβ and transcription factor 3C (TFIIIC) interact at the miR-138-2 locus. We propose that this interaction is essential for the recruitment of the RNA Pol III initiation complex and associated transcription of the oncomiR, miR-138 in malignant gliomas. PMID:29136251

  8. 14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii.

    Science.gov (United States)

    2010-01-01

    ... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

  9. Compact all-fiber optical Faraday components using 65-wt%-terbium-doped fiber with a record Verdet constant of -32 rad/(Tm).

    Science.gov (United States)

    Sun, L; Jiang, S; Marciante, J R

    2010-06-07

    A compact all-fiber Faraday isolator and a Faraday mirror are demonstrated. At the core of each of these components is an all-fiber Faraday rotator made of a 4-cm-long, 65-wt%-terbium-doped silicate fiber. The effective Verdet constant of the terbium-doped fiber is measured to be -32 rad/(Tm), which is 27 x larger than that of silica fiber. This effective Verdet constant is the largest value measured to date in any fiber and is 83% of the Verdet constant of commercially available crystal used in bulk optics-based isolators. Combining the all-fiber Faraday rotator with fiber polarizers results in a fully fusion spliced all-fiber isolator whose isolation is measured to be 19 dB. Combining the all-fiber Faraday rotator with a fiber Bragg grating results in an all-fiber Faraday mirror that rotates the polarization state of the reflected light by 88 +/- 4 degrees .

  10. Picomolar Traces of Americium(III) Introduce Drastic Changes in the Structural Chemistry of Terbium(III): A Break in the "Gadolinium Break".

    Science.gov (United States)

    Welch, Jan M; Müller, Danny; Knoll, Christian; Wilkovitsch, Martin; Giester, Gerald; Ofner, Johannes; Lendl, Bernhard; Weinberger, Peter; Steinhauser, Georg

    2017-10-16

    The crystallization of terbium 5,5'-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H 2 O) 7 ZT] 2 ZT⋅10 H 2 O is isostructural to light lanthanide (Ce-Gd) 5,5'-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5'-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H 2 O) 8 ] 2 ZT 3 ⋅6 H 2 O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10 8 -fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microcopy. In addition, the inclusion properties of terbium 5,5'-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail: xiaoyb@vip.sina.com

    2013-11-29

    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  12. Targeting Glioma Stem Cells by Functional Inhibition of a Prosurvival OncomiR-138 in Malignant Gliomas

    Directory of Open Access Journals (Sweden)

    Xin Hui Derryn Chan

    2012-09-01

    Full Text Available Malignant gliomas are the most aggressive forms of brain tumors, associated with high rates of morbidity and mortality. Recurrence and tumorigenesis are attributed to a subpopulation of tumor-initiating glioma stem cells (GSCs that are intrinsically resistant to therapy. Initiation and progression of gliomas have been linked to alterations in microRNA expression. Here, we report the identification of microRNA-138 (miR-138 as a molecular signature of GSCs and demonstrate a vital role for miR-138 in promoting growth and survival of bona fide tumor-initiating cells with self-renewal potential. Sequence-specific functional inhibition of miR-138 prevents tumorsphere formation in vitro and impedes tumorigenesis in vivo. We delineate the components of the miR-138 regulatory network by loss-of-function analysis to identify specific regulators of apoptosis. Finally, the higher expression of miR-138 in GSCs compared to non-neoplastic tissue and association with tumor recurrence and survival highlights the clinical significance of miR-138 as a prognostic biomarker and a therapeutic target for treatment of malignant gliomas.

  13. The mass of the Mars-sized exoplanet Kepler-138 b from transit timing.

    Science.gov (United States)

    Jontof-Hutter, Daniel; Rowe, Jason F; Lissauer, Jack J; Fabrycky, Daniel C; Ford, Eric B

    2015-06-18

    Extrasolar planets that pass in front of their host star (transit) cause a temporary decrease in the apparent brightness of the star, providing a direct measure of the planet's size and orbital period. In some systems with multiple transiting planets, the times of the transits are measurably affected by the gravitational interactions between neighbouring planets. In favourable cases, the departures from Keplerian orbits (that is, unaffected by gravitational effects) implied by the observed transit times permit the planetary masses to be measured, which is key to determining their bulk densities. Characterizing rocky planets is particularly difficult, because they are generally smaller and less massive than gaseous planets. Therefore, few exoplanets near the size of Earth have had their masses measured. Here we report the sizes and masses of three planets orbiting Kepler-138, a star much fainter and cooler than the Sun. We determine that the mass of the Mars-sized inner planet, Kepler-138 b, is 0.066(+0.059)(-0.037) Earth masses. Its density is 2.6(+2.4)(-1.5) grams per cubic centimetre. The middle and outer planets are both slightly larger than Earth. The middle planet's density (6.2(+5.8)(-3.4) grams per cubic centimetre) is similar to that of Earth, and the outer planet is less than half as dense at 2.1(+2.2)(-1.2) grams per cubic centimetre, implying that it contains a greater portion of low-density components such as water and hydrogen.

  14. Long and Short Isoforms of the Human Cytomegalovirus UL138 Protein Silence IE Transcription and Promote Latency.

    Science.gov (United States)

    Lee, Song Hee; Caviness, Katie; Albright, Emily R; Lee, Jeong-Hee; Gelbmann, Christopher B; Rak, Mike; Goodrum, Felicia; Kalejta, Robert F

    2016-10-15

    The UL133-138 locus present in clinical strains of human cytomegalovirus (HCMV) encodes proteins required for latency and reactivation in CD34(+) hematopoietic progenitor cells and virion maturation in endothelial cells. The encoded proteins form multiple homo- and hetero-interactions and localize within secretory membranes. One of these genes, UL136 gene, is expressed as at least five different protein isoforms with overlapping and unique functions. Here we show that another gene from this locus, the UL138 gene, also generates more than one protein isoform. A long form of UL138 (pUL138-L) initiates translation from codon 1, possesses an amino-terminal signal sequence, and is a type one integral membrane protein. Here we identify a short protein isoform (pUL138-S) initiating from codon 16 that displays a subcellular localization similar to that of pUL138-L. Reporter, short-term transcription, and long-term virus production assays revealed that both pUL138-L and pUL138-S are able to suppress major immediate early (IE) gene transcription and the generation of infectious virions in cells in which HCMV latency is studied. The long form appears to be more potent at silencing IE transcription shortly after infection, while the short form seems more potent at restricting progeny virion production at later times, indicating that both isoforms of UL138 likely cooperate to promote HCMV latency. Latency allows herpesviruses to persist for the lives of their hosts in the face of effective immune control measures for productively infected cells. Controlling latent reservoirs is an attractive antiviral approach complicated by knowledge deficits for how latently infected cells are established, maintained, and reactivated. This is especially true for betaherpesviruses. The functional consequences of HCMV UL138 protein expression during latency include repression of viral IE1 transcription and suppression of virus replication. Here we show that short and long isoforms of UL138

  15. Crystal structures of two mononuclear complexes of terbium(III) nitrate with the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane.

    Science.gov (United States)

    Gregório, Thaiane; Giese, Siddhartha O K; Nunes, Giovana G; Soares, Jaísa F; Hughes, David L

    2017-02-01

    Two new mononuclear cationic complexes in which the TbIII ion is bis-chelated by the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane (H3LEt, C6H14O3) were prepared from Tb(NO3)3·5H2O and had their crystal and mol-ecular structures solved by single-crystal X-ray diffraction analysis after data collection at 100 K. Both products were isolated in reasonable yields from the same reaction mixture by using different crystallization conditions. The higher-symmetry complex dinitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) nitrate di-meth-oxy-ethane hemisolvate, [Tb(NO3)2(H3LEt)2]NO3·0.5C4H10O2, 1, in which the lanthanide ion is 10-coordinate and adopts an s-bicapped square-anti-prismatic coordination geometry, contains two bidentate nitrate ions bound to the metal atom; another nitrate ion functions as a counter-ion and a half-mol-ecule of di-meth-oxy-ethane (completed by a crystallographic twofold rotation axis) is also present. In product aqua-nitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) dinitrate, [Tb(NO3)(H3LEt)2(H2O)](NO3)2, 2, one bidentate nitrate ion and one water mol-ecule are bound to the nine-coordinate terbium(III) centre, while two free nitrate ions contribute to charge balance outside the tricapped trigonal-prismatic coordination polyhedron. No free water mol-ecule was found in either of the crystal structures and, only in the case of 1, di-meth-oxy-ethane acts as a crystallizing solvent. In both mol-ecular structures, the two tripodal ligands are bent to one side of the coordination sphere, leaving room for the anionic and water ligands. In complex 2, the methyl group of one of the H3LEt ligands is disordered over two alternative orientations. Strong hydrogen bonds, both intra- and inter-molecular, are found in the crystal structures due to the number of different donor and acceptor groups present.

  16. Heat stress attenuates new cell generation in the hypothalamus: a role for miR-138.

    Science.gov (United States)

    Kisliouk, T; Cramer, T; Meiri, N

    2014-09-26

    The anterior hypothalamus (Ant Hyp) of the brain serves as the main regulator of numerous homeostatic functions, among them body temperature. Fine-tuning of the thermal-response set point during the critical postnatal sensory-developmental period involves neuronal network remodeling which might also be accompanied by alterations in hypothalamic cell populations. Here we demonstrate that heat stress during the critical period of thermal-control establishment interferes with generation of new cells in the chick hypothalamus. Whereas conditioning of the 3-day-old chicks under high ambient temperatures for 24h diminished the number of newborn cells in anterior hypothalamic structures 1 week after the treatment, mild heat stress did not influence the amount of new cells. Phenotypic analysis of these newborn cells indicated a predominant decrease in non-neuronal cell precursors, i.e. cells that do not express doublecortin (DCX). Furthermore, heat challenge of 10-day-old previously high-temperature-conditioned chicks abolished hypothalamic neurogenesis and significantly decreased the number of cells of non-neural origin. As a potential regulatory mechanism for the underlying generation of new cells in the hypothalamus, we investigated the role of the microRNA (miRNA) miR-138, previously reported by us to promote hypothalamic cell migration in vitro and whose levels are reduced during heat stress. Intracranial injection into the third ventricle of miR-138 led to an increase in the number of newborn cells in the Ant Hyp, an effect which might be partially mediated by inhibition of its direct target reelin. These data demonstrate the role of ambient temperature on the generation of new cells in the hypothalamus during the critical period of thermal-control establishment and highlight the long-term effect of severe heat stress on hypothalamic cell population. Moreover, miRNAs, miR-138 in particular, can regulate new cell generation in the hypothalamus. Copyright © 2014 IBRO

  17. The response behavior of PPy-DB18C6 electrode to terbium(III in acetonitrile and its thermodynamic application

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Arbab Zavar

    2016-11-01

    Full Text Available Polypyrrole modified electrode prepared by electropolymerization of pyrrole in the presence of a complexing ligand, dibenzo-18-crown-6(DB18C6, was prepared and investigated as a Tb3+-selective electrode in acetonitrile. The potentiometric response of the electrode was linear within the Tb3+ concentration range 1 × 10−5–1 × 10−2 M with a Nernstian slope of 20.9 mVdecade−1 in AN. The electrode was applied to study the complexation of the terbium(III ion in acetonitrile with such other basic aprotic solvent molecules (D as dimethyl sulfoxide, N,N-dimethyl formamide, propylene carbonate and pyridine. The successive complex formation constant (βi and Gibbs energies of transfer (ΔGtr of Tb3+ in AN in relation to such D were obtained.

  18. Luminescence and Magnetic Properties of Two Three-Dimensional Terbium and Dysprosium MOFs Based on Azobenzene-4,4′-Dicarboxylic Linker

    Directory of Open Access Journals (Sweden)

    Belén Fernández

    2016-02-01

    Full Text Available We report the in situ formation of two novel metal-organic frameworks based on terbium and dysprosium ions using azobenzene-4,4′-dicarboxylic acid (H2abd as ligand, synthesized by soft hydrothermal routes. Both materials show isostructural three-dimensional networks with channels along a axis and display intense photoluminescence properties in the solid state at room temperature. Textural properties of the metal-organic frameworks (MOFs have been fully characterized although no appreciable porosity was obtained. Magnetic properties of these materials were studied, highlighting the dysprosium material displays slightly frequency-dependent out of phase signals when measured under zero external field and under an applied field of 1000 Oe.

  19. Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

    Energy Technology Data Exchange (ETDEWEB)

    Marley, J.L.

    1987-12-01

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs.

  20. HH137 and 138: Discovering New Knots and a Molecular Outflow with Gemini and APEX

    Science.gov (United States)

    Ferrero, L. V.; Cappa, C. E.; Gomez, M.

    2017-07-01

    We present a multi-frequency study of HH 137 and HH 138 using Gemini images and APEX molecular line data, as well as Spitzer images. Several 2.12 micron knots linked to HH137 are identified in the Gemini image. 12^CO(3-2), 13^CO(3-2), and C18^O(3-2) line data reveal the molecular counterpart of HH 137. Spitzer combined images suggest the location of the exciting source of HH 137, almost coincident with a high-density molecular clump detected in C18^O. We derive the main physical parameters of the molecular clump and the molecular outflow, and propose a simple scenario for the whole complex.

  1. Role of laccase from Coriolus versicolor MTCC-138 in selective oxidation of aromatic methyl group.

    Science.gov (United States)

    Chaurasia, Pankaj Kumar; Singh, Sunil Kumar; Bharati, Shashi Lata

    2014-01-01

    Now a day, laccases are the most promising enzymes in the area of biotechnology and synthesis. One of the best applications of laccases is the selective oxidation of aromatic methyl group to aldehyde group. Such transformations are valuable because it is difficult to stop the reaction at aldehyde stage. Chemical methods used for such biotransformations areexpensive and give poor yields. But, the laccase-catalyzed biotransformations of such type are non-expensive and yield is excellent. Authors have used crude laccase obtained from the liquid culture growth medium of fungal strain Coriolus versicolor MTCC-138 for the biotransformations of toluene, 3-nitrotoluene, and 4-chlorotoluene to benzaldehyde, 3-nitrobenzaldehyde, and 4-chlorobenzaldehyde, respectively, instead of purified laccase because purification process requires much time and cost. This communication reports that crude laccase can also be used in the place of purified laccase as effective biocatalyst.

  2. The postconcussion syndrome in sports and recreation: clinical features and demography in 138 athletes.

    Science.gov (United States)

    Tator, Charles H; Davis, Hannah

    2014-10-01

    There are still many unanswered questions about postconcussion syndrome (PCS) in sports and recreation. The predictors of PCS are unknown, although a history of previous concussion has been suspected. To explore the clinical features and demography of PCS in athletes. A retrospective cohort study was performed by chart review of clinical and demographic data of 285 consecutive concussed patients, 138 of whom had sports-related PCS based on ≥ 3 postconcussion symptoms lasting ≥ 1 month. The 138 athletes with PCS averaged 22.8 years of age, and 70 (50.7%) were ≤ 18 years of age. They averaged 3.4 concussions (range, 1 to > 12). Only 19.6% had no previous concussion. There was a history of previous psychiatric condition, attention-deficit disorder or attention-deficit/hyperactive disorder, learning disability, or previous migraine headaches in 21.0%. Ice hockey caused the highest number of the most recent concussions at 72 cases (52.2%). Soccer, snow skiing, equestrian sports, and basketball were less frequent causes. The average number of persistent symptoms was 7.6, and the median duration of PCS was 6 months at the first examination. More than 80% of PCS cases had at least 1 other previous concussion. Half of the athletes with PCS were ≤ 18 years of age. PCS was associated with 7.6 symptoms per athlete. The duration of PCS and the number of symptoms were not related to the number of previous concussions, loss of consciousness, or return to play. Further research on treatment and prevention of PCS is required.

  3. Assessment of bone marrow plasma cell infiltrates in multiple myeloma: the added value of CD138 immunohistochemistry

    Science.gov (United States)

    Al-Quran, Samer Z.; Yang, Lijun; Magill, James M.; Braylan, Raul C.; Douglas-Nikitin, Vonda K.

    2012-01-01

    Summary Assessment of bone marrow involvement by malignant plasma cells is an important element in the diagnosis and follow-up of patients with multiple myeloma and other plasma cell dyscrasias. Microscope-based differential counts of bone marrow aspirates are used as the primary method to evaluate bone marrow plasma cell percentages. However, multiple myeloma is often a focal process, a fact that impacts the accuracy and reliability of the results of bone marrow plasma cell percentages obtained by differential counts of bone marrow aspirate smears. Moreover, the interobserver and intraobserver reproducibility of counting bone marrow plasma cells microscopically has not been adequately tested. CD138 allows excellent assessment of plasma cell numbers and distribution in bone marrow biopsies. We compared estimates of plasma cell percentages in bone marrow aspirates and in hematoxylin-eosin– and CD138-stained bone marrow biopsy sections (CD138 sections) in 79 bone marrows from patients with multiple myeloma. There was a notable discrepancy in bone marrow plasma cell percentages using the different methods of observation. In particular, there was a relatively poor concordance of plasma cell percentage estimation between aspirate smears and CD138 sections. Estimates of plasma cell percentage using CD138 sections demonstrated the highest interobserver concordance. This observation was supported by computer-assisted image analysis. In addition, CD138 expression highlighted patterns of plasma cell infiltration indicative of neoplasia even in the absence of plasmacytosis. We conclude that examination of CD138 sections should be considered for routine use in the estimation of plasma cell load in the bone marrow. PMID:17714757

  4. Luminescent europium and terbium complexes of dipyridoquinoxaline and dipyridophenazine ligands as photosensitizing antennae: structures and biological perspectives.

    Science.gov (United States)

    Dasari, Srikanth; Patra, Ashis K

    2015-12-14

    The europium(III) and terbium(III) complexes, namely [Eu(dpq)(DMF)2(NO3)3] (1), [Eu(dppz)2(NO3)3] (2), [Tb(dpq)(DMF)2Cl3] (3), and [Tb(dppz)(DMF)2Cl3] (4), where dipyrido[3,2-d:2',3'-f]quinoxaline (dpq in 1 and 3), dipyrido[3,2-a:2',3'-c]phenazine (dppz in 2 and 4) and N,N'-dimethylformamide (DMF) have been isolated, characterized from their physicochemical data, luminescence studies and their interaction with DNA, serum albumin protein and photo-induced DNA cleavage activity are studied. The X-ray crystal structures of complexes 1-4 show discrete mononuclear Ln(3+)-based structures. The Eu(3+) in [Eu(dpq)(DMF)2(NO3)3] (1) and [Eu(dppz)2(NO3)3] (2) as [Eu(dppz)2(NO3)3]·dppz (2a) adopts a ten-coordinated bicapped dodecahedron structure with a bidentate N,N-donor dpq ligand, two DMF and three NO3(-) anions in 1 and two bidentate N,N-donor dppz ligands and three NO3(-) anions in 2. Complexes 3 and 4 show a seven-coordinated mono-capped octahedron structure where Tb(3+) contains bidentate dpq/dppz ligands, two DMF and three Cl(-) anions. The complexes are highly luminescent in nature indicating efficient photo-excited energy transfer from the dpq/dppz antenna to Ln(3+) to generate long-lived emissive excited states for characteristic f → f transitions. The time-resolved luminescence spectra of complexes 1-4 show typical narrow emission bands attributed to the (5)D0 → (7)F(J) and (5)D4 → (7)F(J) f-f transitions of Eu(3+) and Tb(3+) ions respectively. The number of inner-sphere water molecules (q) was determined from luminescence lifetime measurements in H2O and D2O confirming ligand-exchange reactions with water in solution. The complexes display significant binding propensity to the CT-DNA giving binding constant values in the range of 1.0 × 10(4)-6.1 × 10(4) M(-1) in the order 2, 4 (dppz) > 1, 3 (dpq). DNA binding data suggest DNA groove binding with the partial intercalation nature of the complexes. All the complexes also show binding propensity (K(BSA)

  5. Processing of ovine PrP(ARQ)C-EGFP chimeras containing Asn138 and Cys151 polymorphisms.

    Science.gov (United States)

    Bragason, Birkir Thor; Palsdottir, Astridur

    2005-10-21

    Polymorphisms in the prion protein, PrP(C), affect the susceptibility of sheep to scrapie. Three rare polymorphisms, M137T, S138N, and R151C, have been found in Icelandic sheep. Observations suggest that R151C may be associated with lower scrapie susceptibility, whereas S138N is neutral. The effects of the S138N and R151C polymorphisms on the cellular processing of PrP(C) were examined in a model system consisting of the expression of ovine PrP(C)-EGFP (green fluorescent protein) chimeras in the mouse neuroblastoma cell line N2a. Chimeras with the haplotypes A136R154Q171 (ARQ), AN138RQ, and AC151RQ were compared. The chimeras did not differ regarding their translocation into the secretory system, glycosylation, and transport to the cell surface. However, the AC151RQ chimera differed from the other chimeras regarding disulfide bonding characteristics; furthermore, a slight difference was detected between AC151RQ and the other chimeras by limited proteolysis. The processing of the ARQ and AN138RQ chimeras was identical in the experiments performed consistent with observations that it is neutral.

  6. Effect of floor space allowances on growth performance of finishing pigs marketed at 138 kilograms.

    Science.gov (United States)

    Johnston, L J; Rozeboom, D W; Goodband, R D; Moeller, S J; Shannon, M C; Schieck, S J

    2017-11-01

    Current floor space allowances were determined in research studies conducted 10 to 20 yr ago using pigs that were marketed at a BW of about 113 kg or less. Currently, pork producers are regularly marketing pigs that weigh over 128 kg. Given this precipitous increase in market weight, we conducted 2 experiments to determine if floor space allowances previously determined apply to pigs marketed at greater than 128 kg. Experiment 1 was conducted at 5 university research stations throughout the Upper Midwest region. In this experiment, we evaluated the growth performance, salivary cortisol concentrations, and lesion scores of pigs weighing between 27 and 138 kg provided 0.71, 0.80, 0.89, 0.98, or 1.07 m/pig of floor space. Within each station, group size (range = 6 to 19 pigs) remained constant across floor space treatments but pen size was altered to achieve the desired space allocations. There were 14 replicate pens for each treatment. Overall, increasing floor space allowance increased final BW (linear, = 0.04) and tended (linear, space allocation. Salivary cortisol concentrations and lesion scores were not affected by floor space allowances. Experiment 2 focused on floor space needs of pigs nearing market weight and was conducted at 4 research stations. Pigs weighing about 130 kg were assigned to pens that provided 0.71, 0.80, 0.89, 0.98, or 1.07 m/pig of floor space. Group size ranged from 4 to 11 pigs per pen but was constant across floor space treatments within station. The study lasted 2 wk and there were 8 replicate pens per treatment. As floor space allowance increased, ADG (0.86, 0.95, 0.95, 1.10, and 1.06 kg; linear, < 0.01), ADFI (3.03, 3.26, 3.22, 3.49, and 3.25 kg; quadratic, < 0.05), and final BW (145.6, 145.7, 146.4, 148.3, and 147.9 kg; linear, < 0.01) increased. Based on the results of these 2 experiments, pigs marketed at about 138 kg require at least 0.89 m/pig to support optimal growth performance. However, heavier pigs (about 148 kg) at the end

  7. Anle138b partly ameliorates motor deficits despite failure of neuroprotection in a model of advanced multiple system atrophy

    Directory of Open Access Journals (Sweden)

    Lisa eFellner

    2016-03-01

    Full Text Available The neurodegenerative disorder multiple system atrophy (MSA is characterized by autonomic failure, cerebellar ataxia and parkinsonism in any combination associated with predominantly oligodendroglial α-synuclein (α-syn aggregates (glial cytoplasmic inclusions=GCIs. To date, there is no effective disease modifying therapy. Previous experiments have shown that the aggregation inhibitor anle138b reduces neurodegeneration, as well as behavioral deficits in both transgenic and toxin mouse models of Parkinson’s disease (PD. Here we analyzed whether anle138b improves motor skills and reduces neuronal loss, as well as oligodendroglial α-syn aggregation in the PLP-α-syn transgenic mouse challenged with the mitochondrial toxin 3-nitropropionic acid (3-NP to model full-blown MSA. Following one month of treatment with anle138b, MSA mice showed signs of motor improvement affecting stride length, but not pole, grip strength and beam test performance. Loss of dopaminergic nigral neurons and Purkinje cells was not attenuated and GCI density remained unchanged. These data suggest that the pathology in transgenic PLP-α-syn mice receiving 3-NP might be too advanced to detect significant effects of anle138b treatment on neuronal loss and intracytoplasmic α-syn inclusion bodies. However, the partial motor amelioration may indicate potential efficacy of anle138b treatment that may be mediated by its actions on α-syn oligomers or may reflect improvement of neuronal dysfunction in neural at risk populations. Further studies are required to address the efficacy of anle138b in transgenic α-syn models of early-stage MSA and in the absence of additional toxin application.

  8. Genome-Wide Analysis of CCA1-Like Proteins in Soybean and Functional Characterization of GmMYB138a

    Directory of Open Access Journals (Sweden)

    Shaomin Bian

    2017-09-01

    Full Text Available Plant CIRCADIAN CLOCK ASSOCIATED1 (CCA1-like proteins are a class of single-repeat MYELOBLASTOSIS ONCOGENE (MYB transcription factors generally featured by a highly conserved motif SHAQK(Y/FF, which play important roles in multiple biological processes. Soybean is an important grain legume for seed protein and edible vegetable oil. However, essential understandings regarding CCA1-like proteins are very limited in soybean. In this study, 54 CCA1-like proteins were identified by data mining of soybean genome. Phylogenetic analysis indicated that soybean CCA1-like subfamily showed evolutionary conservation and diversification. These CCA1-like genes displayed tissue-specific expression patterns, and analysis of genomic organization and evolution revealed 23 duplicated gene pairs. Among them, GmMYB138a was chosen for further investigation. Our protein–protein interaction studies revealed that GmMYB138a, but not its alternatively spliced isoform, interacts with a 14-3-3 protein (GmSGF14l. Although GmMYB138a was predominately localized in nucleus, the resulting complex of GmMYB138a and GmSGF14l was almost evenly distributed in nucleus and cytoplasm, supporting that 14-3-3s interact with their clients to alter their subcellular localization. Additionally, qPCR analysis suggested that GmMYB138a and GmSGF14l synergistically or antagonistically respond to drought, cold and salt stresses. Our findings will contribute to future research in regard to functions of soybean CCA1-like subfamily, especially regulatory mechanisms of GmMYB138a in response to abiotic stresses.

  9. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden

    1975-01-01

    The selection rules for the linear couplings between magnons and phonons propagating in the c direction of a simple basal-plane hcp ferromagnet are determined by general symmetry considerations. The acoustic-optical magnon-phonon interactions observed in the heavy-rare-earth metals have been expl...... by Liu. The coupled magnon—transverse-phonon system for the c direction of Tb is analyzed in detail, and the strengths of the couplings are deduced as a function of wave vector by combining the experimental studies with the theory....

  10. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden; Bjerrum Møller, Hans

    1975-01-01

    The energies of spin waves propagating in the c direction of Tb have been studied by inelastic neutron scattering, as a function of a magnetic field applied along the easy and hard directions in the basal plane, and as a function of temperature. From a general spin Hamiltonian, consistent...... with the symmetry, we deduce the dispersion relation for the spin waves in a basal-plane ferromagnet. This phenomenological spin-wave theory accounts for the observed behavior of the magnon energies in Tb. The two q⃗-dependent Bogoliubov components of the magnon energies are derived from the experimental results...

  11. Isolation of Circulating Plasma Cells in Multiple Myeloma Using CD138 Antibody-Based Capture in a Microfluidic Device

    Science.gov (United States)

    Qasaimeh, Mohammad A.; Wu, Yichao C.; Bose, Suman; Menachery, Anoop; Talluri, Srikanth; Gonzalez, Gabriel; Fulciniti, Mariateresa; Karp, Jeffrey M.; Prabhala, Rao H.; Karnik, Rohit

    2017-04-01

    The necessity for bone marrow aspiration and the lack of highly sensitive assays to detect residual disease present challenges for effective management of multiple myeloma (MM), a plasma cell cancer. We show that a microfluidic cell capture based on CD138 antigen, which is highly expressed on plasma cells, permits quantitation of rare circulating plasma cells (CPCs) in blood and subsequent fluorescence-based assays. The microfluidic device is based on a herringbone channel design, and exhibits an estimated cell capture efficiency of ~40-70%, permitting detection of numbers in blood samples of MM patients in remission (20-24 CD138+ cells/mL), and yet higher numbers in MM patients exhibiting disease (45-184 CD138+ cells/mL). Analysis of CPCs isolated using the device was consistent with serum immunoglobulin assays that are commonly used in MM diagnostics. These results indicate the potential of CD138-based microfluidic CPC capture as a useful ‘liquid biopsy’ that may complement or partially replace bone marrow aspiration.

  12. Crystal structure and tautomerism of Pigment Yellow 138 determined by X-ray powder diffraction and solid-state NMR

    DEFF Research Database (Denmark)

    Gumbert, Silke D.; Körbitzer, Meike; Alig, Edith

    2016-01-01

    The crystal structure of C.I. Pigment Yellow 138 was determined from X-ray powder diffraction data using real-space methods with subsequent Rietveld refinements. The tautomeric state was investigated by solid-state 1D and 2D multinuclear NMR experiments. In the crystals, the compound exhibits...... is not a packing effect, but caused by intramolecular steric hindrance....

  13. The Lateral Thigh Perforator Flap for Autologous Breast Reconstruction: A Prospective Analysis of 138 Flaps.

    Science.gov (United States)

    Tuinder, Stefania M H; Beugels, Jop; Lataster, Arno; de Haan, Michiel W; Piatkowski, Andrzej; Saint-Cyr, Michel; van der Hulst, René R W J; Allen, Robert J

    2018-02-01

    The septocutaneous tensor fasciae latae or lateral thigh perforator flap was previously introduced by the authors' group as an alternative flap for autologous breast reconstruction when the abdomen is not suitable as a donor site. The authors analyzed their experience with the lateral thigh perforator flap and present the surgical refinements that were introduced. A prospective study was conducted of all lateral thigh perforator flap breast reconstructions performed since September of 2012. Patient demographics, operative details, complications, and flap reexplorations were recorded. Preoperative imaging with magnetic resonance angiography was performed in all patients. Surgical refinements introduced during this study included limitation of the flap width and the use of quilting sutures at the donor site. A total of 138 lateral thigh perforator flap breast reconstructions were performed in 86 consecutive patients. Median operative times were 277 minutes (range, 196 to 561 minutes) for unilateral procedures and 451 minutes (range, 335 to 710 minutes) for bilateral. Median flap weight was 348 g (range, 175 to 814 g). Two total flap losses (1.4 percent) were recorded, and 11 flaps (8.0 percent) required reexploration, which resulted in viable flaps. The incidence of donor-site complications was reduced significantly after the surgical refinements were introduced. Wound problems decreased from 40.0 percent to 6.3 percent, seroma decreased from 25.0 percent to 9.5 percent, and infection decreased from 27.5 percent to 9.5 percent. The lateral thigh perforator flap is an excellent option for autologous breast reconstruction, with minimal recipient-site complications. The surgical refinements resulted in a significant reduction of donor-site complications. Therefore, the lateral thigh perforator flap is currently the authors' second choice after the deep inferior epigastric artery perforator flap. Therapeutic, IV.

  14. MicroRNA-138 enhances TRAIL-induced apoptosis through interferon-stimulated gene 15 downregulation in hepatocellular carcinoma cells.

    Science.gov (United States)

    Zuo, Chaohui; Sheng, Xinyi; Liu, Zhuo; Ma, Min; Xiong, Shuhan; Deng, Hongyu; Li, Sha; Yang, Darong; Wang, Xiaohong; Xiao, Hua; Quan, Hu; Xia, Man

    2017-06-01

    Hepatocellular carcinoma is a leading cause of cancer-related mortality worldwide. TRAIL (tumor necrosis factor-related apoptosis-inducing ligand) is a potential target for cancer therapy. However, many cancer cells are resistant to TRAIL-induced apoptosis and its mechanism is not well understood. In this study, to identify potential therapeutic targets for TRAIL-resistant cancer cells, we compared the expression levels of interferon-stimulated gene 15 in TRAIL-sensitive and TRAIL-resistant hepatocellular carcinoma cell lines. Western blot analysis showed that interferon-stimulated gene 15 expression levels were significantly higher in resistant HLCZ01and Huh7 cells than in sensitive LH86 and SMMC-7721 cells. Interferon-stimulated gene 15 knockdown in resistance cells led to TRAIL sensitivity. Conversely, interferon-stimulated gene 15 overexpression in sensitive cells resulted in TRAIL resistance. Our bioinformatics search detected a putative target sequence for microRNA miR-138 in the 3' untranslated region of the interferon-stimulated gene 15. Real-time quantitative polymerase chain reaction analysis demonstrated that miR-138 was significantly downregulated in TRAIL-resistant cells compared to TRAIL-sensitive cells. Forced expression of miR-138 in resistant cells decreased both messenger RNA and protein levels of interferon-stimulated gene 15, and when exposed to TRAIL, activated poly(adenosine diphosphate-ribose) polymerase, indicating sensitization to TRAIL. The results suggested that miR-138 regulates the interferon-stimulated gene 15 expression by directly targeting the 3' untranslated region of interferon-stimulated gene 15 and modulates the sensitivity to TRAIL-induced apoptosis. MiR-138 may be a target for therapeutic intervention in TRAIL-based drug treatments of resistant hepatocellular carcinoma or could be a biomarker to select patients who may benefit from the treatment.

  15. Synthesis and crystal structure of terbium(III) meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}); Synthese und Kristallstruktur von Terbium(III)-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6})

    Energy Technology Data Exchange (ETDEWEB)

    Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)

    2003-06-01

    The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus

  16. An integrated logic system for time-resolved fluorescent "turn-on" detection of cysteine and histidine base on terbium (III) coordination polymer-copper (II) ensemble.

    Science.gov (United States)

    Xue, Shi-Fan; Lu, Ling-Fei; Wang, Qi-Xian; Zhang, Shengqiang; Zhang, Min; Shi, Guoyue

    2016-09-01

    Cysteine (Cys) and histidine (His) both play indispensable roles in many important biological activities. An enhanced Cys level can result in Alzheimer's and cardiovascular diseases. Likewise, His plays a significant role in the growth and repair of tissues as well as in controlling the transmission of metal elements in biological bases. Therefore, it is meaningful to detect Cys and His simultaneously. In this work, a novel terbium (III) coordination polymer-Cu (II) ensemble (Tb(3+)/GMP-Cu(2+)) was proposed. Guanosine monophosphate (GMP) can self-assemble with Tb(3+) to form a supramolecular Tb(3+) coordination polymer (Tb(3+)/GMP), which can be suited as a time-resolved probe. The fluorescence of Tb(3+)/GMP would be quenched upon the addition of Cu(2+), and then the fluorescence of the as-prepared Tb(3+)/GMP-Cu(2+) ensemble would be restored again in the presence of Cys or His. By incorporating N-Ethylmaleimide and Ni(2+) as masking agents, Tb(3+)/GMP-Cu(2+) was further exploited as an integrated logic system and a specific time-resolved fluorescent "turn-on" assay for simultaneously sensing His and Cys was designed. Meanwhile it can also be used in plasma samples, showing great potential to meet the need of practical application. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. Synthesis and photoluminescence properties of cerium-doped terbium-yttrium aluminum garnet phosphor for white light-emitting diodes applications

    Science.gov (United States)

    Wang, Jun; Han, Tao; Lang, Tianchun; Tu, Mingjing; Peng, Lingling

    2015-11-01

    Cerium-doped terbium-yttrium aluminum garnet phosphors were synthesized using the solid-state reaction method. The crystalline phase, morphology, and photoluminescence properties were characterized by x-ray diffraction (XRD), scanning electron microscope (SEM), and fluorescence spectrophotometer, respectively. The XRD results indicate that with an increase of the amount of x (Tb3+), all of the samples have a pure garnet crystal structure without secondary phases. The SEM images reveal that the samples are composed of sphere-like crystallites, which exhibit different degrees of agglomeration. The luminescent properties of Ce ions in )Al5O12∶Ce0.1 have been studied, and it was found that the emission band shifted toward a longer wavelength. The redshift is attributed to the lowering of the 5d energy level centroid of Ce, which can be explained by the nephelauxetic effect and compression effect. These phosphors were coated on blue light-emitting diode (LED) chips to fabricate white light-emitting diodes (WLEDs), and their color-rendering indices, color temperatures, and luminous efficiencies were measured. As a consequence of the addition of Tb, the blue LED pumped )Al5O12∶Ce0.1 phosphors WLEDs showed good optical properties.

  18. Study on the fluorescent enhancement effect in terbium-gadolinium-protein-sodium dodecyl benzene sulfonate system and its application on sensitive detection of protein at nanogram level.

    Science.gov (United States)

    Sun, Changxia; Yang, Jinghe; Wu, Xia; Liu, Shufang; Su, Benyu

    2004-08-01

    The co-luminescence effect in a terbium-gadolinium-protein-sodium dodecyl benzene sulfonate (SDBS) system is reported here. Based on it, the sensitive quantitative analysis of protein at nanogram levels is established. The co-luminescence mechanism is studied using fluorescence, resonance light scattering (RLS), absorption spectroscopy and NMR measurement. It is considered that protein could be unfolded by SDBS, then a efficacious intramolecular fluorescent energy transfer occurs from unfolded protein to rare earth ions through SDBS acting as a "transfer bridge" to enhance the emission fluorescence of Tb3+ in this ternary complex of Tb-SDBS-BSA, where energy transfer from protein to SDBS by aromatic ring stacking is the most important step. Cooperating with the intramolecular energy transfer above is the intermolecular energy transfer between the simultaneous existing complexes of both Tb3+ and Gd3+. The fluorescence quantum yield is increased by an energy-insulating sheath, which is considered to be another reason for the resulting enhancement of the fluorescence. Förster theory is used to calculate the distribution of enhancing factors and has led to a greater understanding of the mechanisms of energy transfer.

  19. [Studies on luminescence properties of seven ternary complexes of terbium with 1,10-phenanthroline and benzoic acid and its derivatives].

    Science.gov (United States)

    Gao, Zhi-hua; Wang, Shu-ping; Liu, Cui-ge; Ma, Rui-xia; Wang, Rui-fen

    2006-04-01

    Seven ternary complexes of Tb(III) were synthesized with benzoic acid (BA), o-, m-, p-methylbenzoic acid (o-MBA, m-MBA, p-MBA), and o-, m-, p-methoxybenzoic acid (o-MOBA, m-MOBA, p-MOBA) as the first ligand, and 1,10-phenanthroline (phen) as the second ligand. The content of C, H and N were measured by using a Flash-EA model 1112 elemental analyzer. Excitation and luminescence spectra of the title solid complexes were recorded by using a Hitachi F-4500 fluorescence spectrophotometer at room temperature. The effects of different varieties and different positions of replacing benzoic acid as the first ligand on fluorescence properties of the ternary complexes of terbium were discussed. The results indicated that the intensity of 5D4-->7F6 (489 nm) and 5D4-->7F5 (545 nm) of substituting benzoic acid complexes was stronger than benzoic acid. Three ternary complexes of Tb(III) with o-, m-, p-methylbenzoic acid showed emission intensity in the consecution: Tb(o-MBA)3 phenMOBA)3phen x H2O>Tb(m-MOBA)3phen x H2O>Tb(p-MOBA)3 phen.

  20. La prise en charge du pneumothorax spontané: à propos de 138 cas

    Science.gov (United States)

    Habibi, Bouchra; Achachi, Leila; Hayoun, Sohaib; Raoufi, Mohammed; Herrak, Laila; Ftouh, Mustapha El

    2017-01-01

    Le pneumothorax est définit par la présence d’air dans la cavité pleurale. L’objectif de notre étude rétrospective du pneumothorax spontanés au servie de pneumologie à l’hôpital Ibn Sina rabat (2009-2011) est de déterminer le profil épidémiologique, clinique, radiologique, thérapeutique et évolutif. Il s’agit de 138 patients: 128 hommes et 10 femmes (17 à 83 ans), un âge moyen de 44,5 +/- 17,4 ans; sexe ratio 12/8. Le tabagisme est noté chez 81,2%. La symptomatologie clinique est la douleur thoracique (92%), la dyspnée (60%). Et sur la radiographie thoracique: on trouve un PNO (pneumothorax) unilatéral total (110 cas); partiel (10 cas); localisé (6 cas); bilatéral (4 cas); à droite dans 51,4% et à gauche dans 45,7%. On a recensé 70% de pneumothorax spontanés primitifs et 30% de PNO secondaire à (BPCO 44%, et tuberculose pulmonaire 39%). La prise en charge initiale est l’hospitalisation de tous les patients : le drainage thoracique (95%), l’exsufflation à l’aiguille (1%). Le repos et l’O2 (4%). Le retour du poumon à la paroi a été obtenu avant 10 jours chez 63%. L’évolution est favorable chez 89%. Et les complications immédiates: l’emphysème sous cutané (5 cas); une infection (6 cas) et 3 décès (arrêt cardio-respiratoire); les complications à distance sont les récidives dans 11,6%; une 1ère récidive chez 13 cas (drainage thoracique chez 11 cas et oxygénothérapie chez 2 cas) et une 2ème récidive chez 3 cas (recours à la chirurgie). Ce travail montre l’intérêt du drainage thoracique et la surveillance dans la prise en charge du pneumothorax pour éviter les complications et surtout pour éviter les récidives avec un éventuel recours à la chirurgie. PMID:28533875

  1. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    Directory of Open Access Journals (Sweden)

    Maurilo Monteiro Terra

    1990-01-01

    Full Text Available Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. Todos os outros porta-enxertos apresentaram desempenho inferior.A long term experiment was conducted at Monte Alegre do Sul, State of São Paulo, Brazil, to study the behaviour of wine grape cultivar IAC 138-22 Máximo on five rootstocks: RR 101 14, 'Golia', "Ripária do Traviú', IAC 313 and IAC 572 The yields of eight consecutive annual harvests (from 1974 to 1981 were analysed. The results indicated that IAC 572 was the best rootstock. IAC 313 can also be used but with fair results. "Ripária do Traviú', RR 101-14 and 'Golia' are not recommended as rootstocks for IAC 138-22. Considering the row spacing (2 x 1m which allows 5,000 plants/ha, the difference between average yields of the best and the worst rootstock was 8,475kg/ha of grapes, a considerable figure for the grape grower.

  2. A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

    DEFF Research Database (Denmark)

    Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto

    2009-01-01

    of acyl protein thioesterase 1 (APT1), an enzyme regulating the palmitoylation status of proteins that are known to function at the synapse, including the alpha(13) subunits of G proteins (Galpha(13)). RNA-interference-mediated knockdown of APT1 and the expression of membrane-localized Galpha(13) both......The microRNA pathway has been implicated in the regulation of synaptic protein synthesis and ultimately in dendritic spine morphogenesis, a phenomenon associated with long-lasting forms of memory. However, the particular microRNAs (miRNAs) involved are largely unknown. Here we identify specific miRNAs...... that function at synapses to control dendritic spine structure by performing a functional screen. One of the identified miRNAs, miR-138, is highly enriched in the brain, localized within dendrites and negatively regulates the size of dendritic spines in rat hippocampal neurons. miR-138 controls the expression...

  3. Genome sequence of the flexirubin-pigmented soil bacterium Niabella soli type strain (JS13-8(T)).

    Science.gov (United States)

    Anderson, Iain; Munk, Christine; Lapidus, Alla; Nolan, Matt; Lucas, Susan; Tice, Hope; Del Rio, Tijana Glavina; Cheng, Jan-Fang; Han, Cliff; Tapia, Roxanne; Goodwin, Lynne; Pitluck, Sam; Liolios, Konstantinos; Mavromatis, Konstantinos; Pagani, Ioanna; Mikhailova, Natalia; Pati, Amrita; Chen, Amy; Palaniappan, Krishna; Land, Miriam; Rohde, Manfred; Tindall, Brian J; Göker, Markus; Detter, John C; Woyke, Tanja; Bristow, James; Eisen, Jonathan A; Markowitz, Victor; Hugenholtz, Philip; Kyrpides, Nikos C; Klenk, Hans-Peter; Ivanova, Natalia

    2012-12-19

    Niabella soli Weon et al. 2008 is a member of the Chitinophagaceae, a family within the class Sphingobacteriia that is poorly characterized at the genome level, thus far. N. soli strain JS13-8(T) is of interest for its ability to produce a variety of glycosyl hydrolases. The genome of N. soli strain JS13-8(T) is only the second genome sequence of a type strain from the family Chitinophagaceae to be published, and the first one from the genus Niabella. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 4,697,343 bp long chromosome with its 3,931 protein-coding and 49 RNA genes is a part of the Genomic Encyclopedia ofBacteria andArchaea project.

  4. Genome sequence of the flexirubin-pigmented soil bacterium Niabella soli type strain (JS13-8T)

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, Iain [U.S. Department of Energy, Joint Genome Institute; Munk, Christine [U.S. Department of Energy, Joint Genome Institute; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Han, Cliff [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Tindall, Brian [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Ivanova, N [U.S. Department of Energy, Joint Genome Institute

    2012-01-01

    Niabella soli Weon et al. 2008 is a member of the Chitinophagaceae, a family within the class Sphingobacteriia that is poorly characterized at the genome level, thus far. N. soli strain JS13-8T is of interest for its ability to produce a variety of glycosyl hydrolases. The ge- nome of N. soli strain JS13-8T is only the second genome sequence of a type strain from the family Chitinophagaceae to be published, and the first one from the genus Niabella. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 4,697,343 bp long chromosome with its 3,931 protein-coding and 49 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  5. α-Solanine Modulates the Radiosensitivity of Esophageal Cancer Cells by Inducing MicroRNA 138 Expression

    Directory of Open Access Journals (Sweden)

    Yuanyuan Wang

    2016-08-01

    Full Text Available Background: Esophageal cancer (EC is one of the most common malignant tumors in the world. Due to difficulties with performing the operation, most patients choose to have palliative treatment instead. Radiotherapy is one of the main palliative treatments of EC. However, the clinical efficacy of radiotherapy is not satisfactory α-Solanine is a bioactive component of steroidal glycoalkaloids which has been demonstrated to exhibit anti-metastasis activity in different cancers. In the present study, we determined the effect of α-solanine on the radiosensitivity of EC cells and priliminarily explored the underlying molecular mechanisms. Methods: Cell Counting Kit-8 (CCK-8 assay was conducted to found the cytotoxic effect of α-solanine on EC cells. CCK-8 assay and colony-forming survival assays were performed to explore the effect of α-solanine on cell viability and proliferation of EC cells after irradiation. Immunofluorescence and comet assays were used to detect the effect of α-solanine on DNA repair capacity of EC cells after irradiation. The flow cytometry (FCM and Hoechst/PI staining were conductd to study the effect of α-solanine on apoptosis of EC cells after irradiation. Results: The cytotoxic effect of α-solanine to EC cells was dose-dependent. The results of CCK-8, colony-forming survival assay, immunofluorescence, comet assay, FCM and Hoechst/PI staining showed that α-solanine could enhance the radiosensitivity of EC cells. α-Solanine could downregulate Survivin expression level by upregulating miR-138 expression in EC cells. Upregulation of miR-138 and knock down Survivin both enhanced the radiosensitivity of EC cells. Moreover, Survivin could restore the effect of α-solanine and miR-138 on radiosensitivity of EC cells. Conclusions: α-solanine could enhance the radiosensitivity of esophageal cancer cells by inducing microRNA-138 expression, and probably be an effective radiosensitizer in treating EC.

  6. α-Solanine Modulates the Radiosensitivity of Esophageal Cancer Cells by Inducing MicroRNA 138 Expression.

    Science.gov (United States)

    Wang, Yuanyuan; Wu, Jianbo; Guo, Wei; Sun, Qianqian; Chen, Xiaonan; Zang, Wenqiao; Dong, Ziming; Zhao, Guoqiang

    2016-01-01

    Esophageal cancer (EC) is one of the most common malignant tumors in the world. Due to difficulties with performing the operation, most patients choose to have palliative treatment instead. Radiotherapy is one of the main palliative treatments of EC. However, the clinical efficacy of radiotherapy is not satisfactory α-Solanine is a bioactive component of steroidal glycoalkaloids which has been demonstrated to exhibit anti-metastasis activity in different cancers. In the present study, we determined the effect of α-solanine on the radiosensitivity of EC cells and priliminarily explored the underlying molecular mechanisms. Cell Counting Kit-8 (CCK-8) assay was conducted to found the cytotoxic effect of α-solanine on EC cells. CCK-8 assay and colony-forming survival assays were performed to explore the effect of α-solanine on cell viability and proliferation of EC cells after irradiation. Immunofluorescence and comet assays were used to detect the effect of α-solanine on DNA repair capacity of EC cells after irradiation. The flow cytometry (FCM) and Hoechst/PI staining were conductd to study the effect of α-solanine on apoptosis of EC cells after irradiation. The cytotoxic effect of α-solanine to EC cells was dose-dependent. The results of CCK-8, colony-forming survival assay, immunofluorescence, comet assay, FCM and Hoechst/PI staining showed that α-solanine could enhance the radiosensitivity of EC cells. α-Solanine could downregulate Survivin expression level by upregulating miR-138 expression in EC cells. Upregulation of miR-138 and knock down Survivin both enhanced the radiosensitivity of EC cells. Moreover, Survivin could restore the effect of α-solanine and miR-138 on radiosensitivity of EC cells. α-solanine could enhance the radiosensitivity of esophageal cancer cells by inducing microRNA-138 expression, and probably be an effective radiosensitizer in treating EC. © 2016 The Author(s) Published by S. Karger AG, Basel.

  7. 42 CFR 435.138 - Disabled widows and widowers aged 60 through 64 who would be eligible for SSI except for early...

    Science.gov (United States)

    2010-10-01

    ... would be eligible for SSI except for early receipt of social security benefits. 435.138 Section 435.138... SSI except for early receipt of social security benefits. (a) If the agency provides Medicaid to aged... disabled widows and widowers who— (1) Are at least age 60; (2) Are not entitled to hospital insurance...

  8. Influence of a low calcium and phosphorus diet on the anabolic effect of human parathyroid hormone (1-38) in female rats

    DEFF Research Database (Denmark)

    Steiner, P.D.; Forrer, R.; Kneissel, Michaela

    2001-01-01

    Parathyroid hormone (PTH) or synthetic N-terminal PTH fragments administered intermittently have been established as anabolic agents in animal and human bones. In the present study, the influence of a low calcium diet on the anabolic effect of human PTH(1-38) [hPTH(1-38)] was investigated. Forty...

  9. 40 CFR 125.138 - As an owner or operator of a new offshore oil and gas extraction facility, must I keep records...

    Science.gov (United States)

    2010-07-01

    ... offshore oil and gas extraction facility, must I keep records and report? 125.138 Section 125.138... and report? As an owner or operator of a new offshore oil and gas extraction facility you are required... Intake Structures for New Offshore Oil and Gas Extraction Facilities Under Section 316(b) of the Act...

  10. Stress corrosion study of PH13-8Mo stainless steel using the Slow Strain Rate Technique

    Science.gov (United States)

    Torres, Pablo D.

    1989-01-01

    The need for a fast and reliable method to study stress corrosion in metals has caused increased interest in the Slow Strain Rate Technique (SSRT) during the last few decades. PH13-8MoH950 and H1000 round tensile specimens were studied by this method. Percent reduction-in-area, time-to-failure, elongation at fracture, and fracture energy were used to express the loss in ductility, which has been used to indicate susceptibility to stress corrosion cracking (SCC). Results from a 3.5 percent salt solution (corrosive medium) were compared to those in air (inert medium). A tendency to early failure was found when testing in the vicinity of 1.0 x 10(-6) mm/mm/sec in the 3.5 percent salt solution. PH13-8Mo H1000 was found to be less likely to suffer SCC than PH13-8Mo H950. This program showed that the SSRT is promising for the SCC characterization of metals and results can be obtained in much shorter times (18 hr for PH steels) than those required using conventional techniques.

  11. Anticancer function of α-solanine in lung adenocarcinoma cells by inducing microRNA-138 expression.

    Science.gov (United States)

    Zhang, Furui; Yang, Rui; Zhang, Guojun; Cheng, Ruirui; Bai, Yong; Zhao, Huasi; Lu, Xinhua; Li, Hui; Chen, Shanshan; Li, Juan; Wu, Shujun; Li, Ping; Chen, Xiaonan; Sun, Qianqian; Zhao, Guoqiang

    2016-05-01

    Currently, lung cancer is still a main cause of malignancy-associated death worldwide. Even though various methods for prevention and treatment of lung cancer have been improved in recent decades, the 5-year survival rate has remained very low. Insights into the anticancer function of small-molecule anticancer compounds have opened our visual field about cancer therapy. α-Solanine has been well studied for its antitumor properties, but its effect in lung cancer and associated molecular mechanisms have not yet been evaluated. To explore the anticancer function of α-solanine, we performed an MTT assay, Transwell arrays, colony-forming survival assay, quantitative reverse transcription PCR (qRT-PCR), Western blotting, and dual luciferase reporter assays in A549 and H1299 cells. We found that α-solanine not only inhibited cell migration and invasion ability but also enhanced the chemosensitivity and radiosensitivity of A549 and H1299 cells. Moreover, we discovered that α-solanine could affect the expression of miR-138 and focal adhesion kinase (FAK), both of which were also found to affect the chemosensitivity and radiosensitivity of A549 and H1299 cells. In conclusion, α-solanine could affect miR-138 and FAK expression to restrict cell migration and invasion and enhance the chemosensitivity and radiosensitivity of A549 and H1299 cells. The α-solanine/miR-138/FAK cascade can probably be a potential therapy target against lung adenocarcinoma.

  12. Self-diffusion coefficients of the trivalent f-element ion series in dilute and moderately dilute aqueous solutions: A comparative study between europium, gadolinium, terbium and berkelium

    Science.gov (United States)

    Rafik, Besbes; Noureddine, Ouerfelli; Abderabbou, Abdelmanef; Habib, Latrous

    2010-03-01

    We have continued the studies on the trivalent ions of the 4f and 5f elements. In this paper, we compare the transport properties (self-diffusion coefficient) of the trivalent aquo ions over two ranges of concentrations (0 — 2×10-3M) and (2×10-3 — 1.5M). Self-diffusion coefficients, D, of the trivalent f-element aquo ion series have been determined in aqueous background electrolytes of Gd(NO3)3 and Nd(ClO4)3, at pH=2.5 (HNO3, HClO4) and at 25°C using the open-end capillary method (O.E.C.M.). This method measures the transportation time of ions across a fixed distance. In this paper, we complete a measurement of self-diffusion coefficient for terbium. We optimized the pH to avoid hydrolysis, ion-pairing and complexation of the trivalent 4f and 5f ions. The variation of D versus √C is not linear for dilute solutions (0 — 2×10-3M) and quasi-linear in moderate concentrations (C<=1.5 M). Similar behavior was observed for Tb, as compared with those for Bk, Eu and Gd. We complete the comparison variation of D/D° versus √C for all studied 4f and 5f elements from concentration 0 to 1.5M and we obtained the same variation with √C for all studied elements. All 4f and 5f elements studied follow the Nernst-Hartley expression.

  13. Terbium-based time-gated Förster resonance energy transfer imaging for evaluating protein-protein interactions on cell membranes.

    Science.gov (United States)

    Lindén, Stina; Singh, Manish Kumar; Wegner, K David; Regairaz, Marie; Dautry, François; Treussart, François; Hildebrandt, Niko

    2015-03-21

    Fluorescence imaging of cells and subcellular compartments is an essential tool to investigate biological processes and to evaluate the development and progression of diseases. In particular, protein-protein interactions can be monitored by Förster resonance energy transfer (FRET) between two proximal fluorophores that are attached to specific recognition biomolecules such as antibodies. We investigated the membrane expression of E- and N-cadherins in three different cell lines used as model systems to study epithelial to mesenchymal transition (EMT) and a possible detection of circulating tumour cells (CTCs). EMT is a key process in cancer metastasis, during which epithelial markers (such as E-cadherin) are down-regulated in the primary tumour whereas mesenchymal markers (such as N-cadherin) are up-regulated, leading to enhanced cell motility, intravasation, and appearance of CTCs. Various FRET donor-acceptor pairs and protein recognition strategies were utilized, in which Lumi4-Tb terbium complexes (Tb) and different organic dyes were conjugated to several distinct E- and N-cadherin-specific antibodies. Pulsed excitation of Tb at low repetition rates (100 Hz) and time-gated (TG) imaging of both the Tb-donor and the dye-acceptor photoluminescence (PL) allowed efficient detection of the EMT markers as well as FRET in the case of sufficient donor-acceptor proximity. Efficient FRET was observed only between two E-cadherin-specific antibodies and further experiments indicated that these antibodies recognized the same E-cadherin molecule, suggesting a limited accessibility of cadherins when they are clustered at adherens junctions. The investigated Tb-to-dye FRET systems provided reduced photobleaching compared to the AlexaFluor 488-568 donor-acceptor pair. Our results demonstrate the applicability and advantages of Tb-based TG FRET for efficient and stable imaging of antibody-antibody interactions on different cell lines. They also reveal the limitations of

  14. A broad G protein-coupled receptor internalization assay that combines SNAP-tag labeling, diffusion-enhanced resonance energy transfer, and a highly emissive terbium cryptate acceptor

    Directory of Open Access Journals (Sweden)

    Angélique eLEVOYE

    2015-11-01

    Full Text Available Although G protein-coupled receptor (GPCR internalization has long been considered a major aspect of the desensitization process that tunes ligand responsiveness, internalization is also involved in receptor resensitization and signaling, as well as the ligand scavenging function of some atypical receptors. Internalization thus contributes to the diversity of GPCR-dependent signaling, and its dynamics and quantification in living cells has generated considerable interest. We developed a robust and sensitive assay to follow and quantify ligand-induced and constitutive GPCR internalization but also receptor recycling in living cells. This assay is based on diffusion-enhanced resonance energy transfer (DERET between cell surface GPCRs labeled with a luminescent terbium cryptate donor and a fluorescein acceptor present in the culture medium. GPCR internalization results in a quantifiable reduction of energy transfer. This method yields a high signal-to-noise ratio due to time-resolved measurements. For various GPCRs belonging to different classes, we demonstrated that constitutive and ligand-induced internalization could be monitored as a function of time and ligand concentration, thus allowing accurate quantitative determination of kinetics of receptor internalization but also half-maximal effective or inhibitory concentrations of compounds. In addition to its selectivity and sensitivity, we provided evidence that DERET-based internalization assay is particularly suitable for characterizing biased ligands. Furthermore, the determination of a Z’-factor value of 0.45 indicates the quality and suitability of DERET-based internalization assay for high-throughput screening (HTS of compounds that may modulate GPCRs internalization.

  15. Circulating sCD138 and Some Angiogenesis-Involved Cytokines Help to Anticipate the Disease Progression of Early-Stage B-Cell Chronic Lymphocytic Leukemia

    Directory of Open Access Journals (Sweden)

    2006-01-01

    Full Text Available Syndecan-1 (CD138 is a transmembrane heparin sulfate proteoglycan expressed on distinct stages of differentiation of B-lymphoid cells. Its prognostic value in B-cell chronic lymphocytic leukemia (B-CLL has not been evaluated so far. The serum concentration of sCD138 and some angiogenesis-involved cytokines: vascular endothelial growth factor (VEGF, basis fibroblast growth factor (bFGF, and endostatin were studied in 52 previously untreated patients with B-CLL. We found that bFGF and sCD138 levels were significantly higher in B-CLL patients than in controls. In patients with sCD138 level or endostatin level below the median value the lymphocyte count was higher than in patients with serum level of those cytokines above the median value. In patients with progressive disease bFGF level was significantly higher and sCD138 level significantly lower than in patients with stable one. Moreover, high sCD138 level was associated with longer lymphocyte doubling-free survival, and, on the limit of statistical significance, a high endostatin level was associated with shorter progression-free survival. We conclude that serum sCD138 level is increased in early stage B-CLL patients and may have a positive prognostic value as to the dynamics of the disease.

  16. ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

    Directory of Open Access Journals (Sweden)

    MARLON JOCIMAR RODRIGUES DA SILVA

    2017-09-01

    Full Text Available ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and soluble solids/acidity ratio. The wines were evaluated for density, alcohol content; total, volatile and fixed acidity; pH, dry extract, reducing sugars, reduced dry extract, alcohol in weight/reduced dry extract; free and total sulfur dioxide; anthocyanins, polyphenols index (I 280; polyphenols and total flavonoids and antioxidant activity. The ‘Bordô’, ‘Isabel’ and IAC 138-22 ‘Máximo’ musts had low soluble solids for winemaking. The ‘106-8 Mgt’ rootstock promoted higher dry extract content and reduced dry extract in Bordô wine, and lower total and fixed acidity in IAC 138-22 Máximo wine. In Isabel wine, higher pH was promoted by the ‘IAC 766’ rootstock. Aside from low total acidity of the Bordô wine, all the physicochemical characteristics of the wines studied are in accordance with Brazilian law. There was no effect of rootstocks in the phenolics content and antioxidant activity of wines.

  17. miR-138 suppresses the proliferation, metastasis and autophagy of non-small cell lung cancer by targeting Sirt1.

    Science.gov (United States)

    Ye, Zaiting; Fang, Bingmu; Pan, Jiongwei; Zhang, Ning; Huang, Jinwei; Xie, Congying; Lou, Tianzheng; Cao, Zhuo

    2017-06-01

    The present study determined the role and mechanism of miR-138 in non-small cell lung cancer (NSCLC). In total, 45 freshly resected clinical NSCLC tissues were collected. The expression of miR-138 in tissues and cell lines were determined by real-time quantitative PCR. miR-138 mimics were transfected into A549 and Calu-3 cells in vitro, and then the effects of miR-138 on lung cancer cell proliferation, cell cycle, invasion and metastasis were investigated by CCK-8 assay, Transwell and flow cytometry, respectively. The protein expression of the potential target gene Sirt1 in lung cancer cells were determined by western blot analysis. Dual-luciferase reporter assay was performed to further confirm whether Sirt1 was the target gene of miR-138. The expression of miR-138 was significantly lower in lung cancer tissues and was negatively correlated to the differentiation degree and lymph node metastasis of lung cancer. In vitro experiment results showed that miR-138 inhibited lung cancer cell proliferation, invasion and migration. It was verified that miR-138 could downregulate Sirt1 protein expression, inhibit epithelial-mesenchymal transition (EMT), decrease the activity of AMPK signaling pathway and elevate mTOR phosphorylation level. Dual-luciferase reporter assay demonstrated that miR-138 could directly regulate Sirt1. Downregulation of Sirt1 alone can also cause the same molecular and biological function changes. Western blot analysis and confocal microscopy results indicated that overexpression of miR-138 or interference of Sirt1 expression could inhibit lung cancer cell autophagy activity possibly through AMPK-mTOR signaling pathway. miR-138 plays a tumor suppressor function in lung cancer. It may inhibit the proliferation, invasion and migration of lung cancer through downregulation of Sirt1 expression and activation of cell autophagy. The downregulation of miR-138 is closely related to the development of lung cancer.

  18. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

    2015-08-07

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

  19. Crystal structure of an eight-coordinate terbium(III ion chelated by N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (bbpen2− and nitrate

    Directory of Open Access Journals (Sweden)

    Thaiane Gregório

    2015-01-01

    Full Text Available The reaction of terbium(III nitrate pentahydrate in acetonitrile with N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (H2bbpen, previously deprotonated with triethylamine, produced the mononuclear compound [N,N′-bis(2-oxidobenzyl-κO-N,N′-bis(pyridin-2-ylmethyl-κNethylenediamine-κ2N,N′](nitrato-κ2O,O′terbium(III, [Tb(C28H28N4O2(NO3]. The molecule lies on a twofold rotation axis and the TbIII ion is eight-coordinate with a slightly distorted dodecahedral coordination geometry. In the symmetry-unique part of the molecule, the pyridine and benzene rings are both essentially planar and form a dihedral angle of 61.42 (7°. In the molecular structure, the N4O4 coordination environment is defined by the hexadentate bbpen ligand and the bidentate nitrate anion. In the crystal, a weak C—H...O hydrogen bond links molecules into a two-dimensional network parallel to (001.

  20. Study of 138 Neisseria meningitidis strains isolated from blood or cerebrospinal fluid in Lombardy between 2007 and 2010

    Directory of Open Access Journals (Sweden)

    Laura Daprai

    2012-06-01

    Full Text Available Neisseria meningitidis, Streptococcus pneumoniae, and Haemophilus influenzae type b cause the majority of cases of bacterial septicaemia in children and young adults. Disease epidemiology is evolving rapidly due to the introduction of vaccines and changing in bacterial antibiotic-resistance patterns. (Asymptomatic nasopharyngeal colonization with Neisseria meningitides occurs in 5-10% of adult. The aim of this study was to calculate the frequency of each serogroup of this pathogens involved in invasive infection and to study susceptibility to antibiotics of these strains. Between March 2007 and June 2010 we received, from 43 hospitals of Lombardy, 138 strains of Neisseria meningitidis, from 138 patients aged (2-80yrs. The most frequent serogroup was B (58%, followed by serogroup C (34%, serogroup G (4% and W 135 (2%. Serogroup A end X accounted for 1% of invasive infection, each. We observed a decrease in susceptibility towards penicillin in 38% of strains. In addition we studied, by REP- PCR, genotype of 9 strains selected on the basis of epidemiological data.Among these strains, 3 different clusters according to the 3 small epidemic outbreaks occurred between June and September 2009, were recognised. Seven of these strains, although belonged to the same serogroup, brought about two different clusters. The present findings demonstrated that phenotypic data are not sufficient to define epidemic clusters, therefore molecular genotyping is required.

  1. 47 CFR 25.138 - Blanket Licensing provisions of GSO FSS Earth Stations in the 18.3-18.8 GHz (space-to-Earth), 19...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Blanket Licensing provisions of GSO FSS Earth Stations in the 18.3-18.8 GHz (space-to-Earth), 19.7-20.2 GHz (space-to-Earth), 28.35-28.6 GHz (Earth-to-space), and 29.25-30.0 GHz (Earth-to-space) bands. 25.138 Section 25.138 Telecommunication FEDERAL...

  2. COMPETITION BEETWEN DYNAMIC RECUPERATION AND RECRYSTALLIZATION OF ASTM F 138 AUSTENITIC STAINLESS STEEL UTILIZED IN MEDICAL DEVICES

    Directory of Open Access Journals (Sweden)

    Fabio Henrique Casarini Geronimo

    2013-06-01

    Full Text Available ASTM F 138 austenitic stainless steel has being used in the manufacture of orthopedical devices by hot forging. In this work, the flow stress curves are determined by hot torsion tests in a wide range of temperatures and strain rates. With the observed microestrutural evolution by optical microscopy in different hot forming conditions in addiction with EBSD (Electron Backscatter Diffraction techniques it is possible to obtained the recrystallized volume fraction and the misorientation angles of the samples. Due to the intermediate level of stacking fault energy of this material, during the dynamic softening occurs a competition between recrystallization and recovery. The aim of this work is to identify the softening mechanisms in this stainless steel, as well as in which hot work conditions they become more active.

  3. InP nanowire array solar cells achieving 13.8% efficiency by exceeding the ray optics limit.

    Science.gov (United States)

    Wallentin, Jesper; Anttu, Nicklas; Asoli, Damir; Huffman, Maria; Aberg, Ingvar; Magnusson, Martin H; Siefer, Gerald; Fuss-Kailuweit, Peter; Dimroth, Frank; Witzigmann, Bernd; Xu, H Q; Samuelson, Lars; Deppert, Knut; Borgström, Magnus T

    2013-03-01

    Photovoltaics based on nanowire arrays could reduce cost and materials consumption compared with planar devices but have exhibited low efficiency of light absorption and carrier collection. We fabricated a variety of millimeter-sized arrays of p-type/intrinsic/n-type (p-i-n) doped InP nanowires and found that the nanowire diameter and the length of the top n-segment were critical for cell performance. Efficiencies up to 13.8% (comparable to the record planar InP cell) were achieved by using resonant light trapping in 180-nanometer-diameter nanowires that only covered 12% of the surface. The share of sunlight converted into photocurrent (71%) was six times the limit in a simple ray optics description. Furthermore, the highest open-circuit voltage of 0.906 volt exceeds that of its planar counterpart, despite about 30 times higher surface-to-volume ratio of the nanowire cell.

  4. Validation of interphase fluorescence in situ hybridization (iFISH for multiple myeloma using CD138 positive cells

    Directory of Open Access Journals (Sweden)

    Renata Kiyomi Kishimoto

    2016-06-01

    Full Text Available ABSTRACT BACKGROUND: Multiple myeloma is a plasma cell neoplasm with acquired genetic abnormalities of clinical and prognostic importance. Multiple myeloma differs from other hematologic malignancies due to a high fraction of low proliferating malignant plasma cells and the paucity of plasma cells in bone marrow aspiration samples, making cytogenetic analysis a challenge. An abnormal karyotype is found in only one-third of patients with multiple myeloma and interphase fluorescence in situ hybridization is the most useful test for studying the chromosomal abnormalities present in almost 90% of cases. However, it is necessary to study the genetic abnormalities in plasma cells after their identification or selection by morphology, immunophenotyping or sorting. Other challenges are the selection of the most informative FISH panel and determining cut-off levels for FISH probes. This study reports the validation of interphase fluorescence in situ hybridization using CD138 positive cells, according to proposed guidelines published by the European Myeloma Network (EMN in 2012. METHOD: Bone marrow samples from patients with multiple myeloma were used to standardize a panel of five probes [1q amplification, 13q14 deletion, 17p deletion, t(4;14, and t(14;16] in CD138+ cells purified by magnetic cell sorting. RESULTS: This test was validated with a low turnaround time and good reproducibility. Five of six samples showed genetic abnormalities. Monosomy/deletion 13 plus t(4;14 were found in two cases. CONCLUSION: This technique together with magnetic cell sorting is effective and can be used in the routine laboratory practice. In addition, magnetic cell sorting provides a pure plasma cell population that allows other molecular and genomic studies.

  5. Anticonvulsant efficacy of the low-affinity partial benzodiazepine receptor agonist ELB 138 in a dog seizure model and in epileptic dogs with spontaneously recurrent seizures.

    Science.gov (United States)

    Löscher, Wolfgang; Potschka, Heidrun; Rieck, Susanne; Tipold, Andrea; Rundfeldt, Chris

    2004-10-01

    Ataxia, sedation, amnesia, ethanol and barbiturate potentiation, loss of efficacy (tolerance), development of dependence, and the potential for drug abuse limit the clinical use of benzodiazepines (BZDs) for long-term treatment of epilepsy or anxiety. BZD ligands that are in current use act as full allosteric modulators of gamma-aminobutyric acid (GABA)-gated chloride channels and, on long-term administration, trigger a functional uncoupling between the GABAA and BZD recognition sites. Partial allosteric modulators, which have a low intrinsic activity at the BZD recognition site of the GABAA receptor, might eventually overcome the limitations of full agonists such as diazepam (DZP). In the present study, the new low-affinity partial BZD-receptor agonist ELB 138 [former name AWD 131-138; 1-(4-chlorophenyl)-4-morpholino-imidazolin-2-one] was evaluated in a dog seizure model and in epileptic dogs with spontaneously recurrent seizures. ELB 138 was shown to increase potently the pentylenetetrazole (PTZ) seizure threshold in dogs. Prolonged oral administration with twice-daily dosing of ELB 138 with either 5 or 40 mg/kg over a 5-week period was not associated with loss of anticonvulsant efficacy in the PTZ dog model. To study whether physical dependence developed during long-term treatment, the BZD antagonist flumazenil was injected after 5 weeks of treatment with ELB 138. Compared with prolonged treatment with DZP, only relatively mild abstinence symptoms were precipitated in dogs treated with ELB 138, particularly at the lower dosage (5 mg/kg, b.i.d.). In a prospective trial in dogs with newly diagnosed epilepsy, ELB 138 markedly reduced seizure frequency and severity without significant difference to standard treatments (phenobarbital or primidone) but was much better tolerated than the standard drugs. In dogs with chronic epilepsy, most dogs exhibited a reduction in seizure frequency and severity during add-on treatment with ELB 138. The data demonstrate that the

  6. Selective Sensing of Fe(3+) and Al(3+) Ions and Detection of 2,4,6-Trinitrophenol by a Water-Stable Terbium-Based Metal-Organic Framework.

    Science.gov (United States)

    Cao, Li-Hui; Shi, Fang; Zhang, Wen-Min; Zang, Shuang-Quan; Mak, Thomas C W

    2015-10-26

    A water-stable luminescent terbium-based metal-organic framework (MOF), {[Tb(L1 )1.5 (H2 O)]⋅3 H2 O}n (Tb-MOF), with rod-shaped secondary building units (SBUs) and honeycomb-type tubular channels has been synthesized and structurally characterized by single-crystal X-ray diffraction. The high green emission intensity and the microporous nature of the Tb-MOF indicate that it can potentially be used as a luminescent sensor. In this work, we show that Tb-MOF can selectively sense Fe(3+) and Al(3+) ions from mixed metal ions in water through different detection mechanisms. In addition, it also exhibits high sensitivity for 2,4,6-trinitrophenol (TNP) in the presence of other nitro aromatic compounds in aqueous solution by luminescence quenching experiments. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Human CD38hiCD138+ Plasma Cells Can Be Generated In Vitro from CD40-Activated Switched-Memory B Lymphocytes

    Directory of Open Access Journals (Sweden)

    Rayelle Itoua Maïga

    2014-01-01

    Full Text Available B lymphocyte differentiation into long-lived plasma cells is the keystone event for the production of long-term protective antibodies. CD40-CD154 and CD27-CD70 interactions are involved in human B lymphocyte differentiation into CD38hiCD138+ cells in vivo as well as in vitro. In this study, we have compared these interactions in their capacity to drive switched-memory B lymphocytes differentiation into CD38hiCD138+ plasma cells. The targeted B lymphocytes were isolated from human peripheral blood, expanded for 19 days, and then submitted to CD70 or CD154 interactions for 14 days. The expanded B lymphocytes were constitutively expressing CD39, whereas CD31’s expression was noticed only following the in vitro differentiation step (day 5 and was exclusively present on the CD38hi cell population. Furthermore, the generated CD38hiCD138+ cells showed a higher proportion of CD31+ cells than the CD38hiCD138- cells. Besides, analyses done with human blood and bone marrow plasma cells showed that in vivo and de novo generated CD38hiCD138+ cells have a similar CD31 expression profile but are distinct according to their reduced CD39 expression level. Overall, we have evidences that in vitro generated plasma cells are heterogeneous and appear as CD39+ precursors to the ones present in bone marrow niches.

  8. Picomolar traces of americium(III) introduce drastic changes in the structural chemistry of terbium(III). A break in the ''gadolinium break''

    Energy Technology Data Exchange (ETDEWEB)

    Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)

    2017-10-16

    The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. errata 137..138

    Indian Academy of Sciences (India)

    uz: 2. On page 454, a typographical error has been found out in eq. (48). The expression for. ∆0 should read as: ∆0 ¼ b. 02. 2 $2$1$2$0. 3рq2 А q1Ю А f 0. 3р f 0. 1$2q2 А f 0. 2$1q1Ю: All the analytical expressions and numerical results do not change due to these errors. Proc. Indian Acad. Sci. (Math. Sci.), Vol. 111, No.

  10. Carrageenan-based semi-IPN nanocomposite hydrogels: Swelling kinetic and slow release of sequestrene Fe 138 fertilizer

    Directory of Open Access Journals (Sweden)

    Mohammad Kazem Bahrami

    2016-09-01

    Full Text Available Nanocomposite hydrogels based on kappa-carrageenan were synthesized by incorporating natural sodium montmorillonite (Cloisite nanoclay. Acrylamide (AAm and methylenebisacrylamide (MBA were used as a monomer and a crosslinker, respectively. Effects of reaction variables on the swelling kinetics were studied. The results revealed that the rate of swelling for nanocomposites with high content of MBA was higher than those of nanocomposites consisting of low content of MBA. Similar to the effect of MBA, the rate of swelling enhanced as the carrageenan content was decreased. The influence of clay content on swelling rate was not remarkable. The experimental swelling data were evaluated by pseudo-first-order and pseudo-second-order kinetic models. The swelling data described well by pseudo-second-order kinetic model. Sequestrene Fe 138 (Sq as an agrochemical was loaded into nanocomposites and releasing of this active agent from nanocomposites was studied. The clay-free hydrogel released the whole loaded Sq; whereas the presence of clay restricted the release of Sq.

  11. Gross karyotypic and phenotypic alterations among different progenies of the Candida glabrata CBS138/ATCC2001 reference strain.

    Directory of Open Access Journals (Sweden)

    Oliver Bader

    Full Text Available Genomic plasticity is a mechanism for adaptation to environmental cues such as host responses and antifungal drug pressure in many fungi including the human pathogenic yeast Candida glabrata. In this study we evaluated the phenotypic and genotypic stability of the world-wide used C. glabrata reference strain CBS138/ATCC2001 under laboratory conditions. A set of ten lineages of this wild type strain and genetically modified progenies were obtained from different scientific laboratories, and analyzed for genotypic and phenotypic alterations. Even though the derivates were indistinguishable by multi locus sequence typing, different phenotypic groups that correlated with specific karyotypic changes were observed. In addition, modifications in the adherence capacity to plastic surface emerged that were shown to correlate with quantitative changes in adhesin gene expression rather than subtelomeric gene loss or differences in the number of macrosatellite repeats within adhesin genes. These results confirm the genomic plasticity of C. glabrata and show that chromosomal aberrations and functional adaptations may occur not only during infection and under antimicrobial therapy, but also under laboratory conditions without extreme selective pressures. These alterations can significantly affect phenotypic properties such as cell surface attributes including adhesion and the cell wall carbohydrate composition and therefore, if unnoticed, may adulterate the outcome of genetic studies.

  12. Advances in the molecular functions of syndecan-1 (SDC1/CD138) in the pathogenesis of malignancies.

    Science.gov (United States)

    Gharbaran, Rajendra

    2015-04-01

    Syndecan-1 (SDC1, synd, CD138) is the most widely studied member of four structurally related cell surface heparan sulfate proteoglycans (HSPG). Although SDC1 has been implicated in a wide range of biological functions, its altered expression often produces malignant phenotypes, which arise from increased cell proliferation and cell growth, cell survival, cell invasion and metastasis, and angiogenesis. Recent studies revealed much about the underlying molecular roles of SDC1 in these processes. The changes in SDC1 expression also have a direct impact on the clinical course of cancers, as evident by its prognostic significance. Accumulating evidence suggest that SDC1 is involved in stimulation of cancer stem cells (CSC) or tumor initiating cells (TIC) and this may affect disease relapse, and resistance to therapy. This review discusses the progress on the pro-tumorigenic role(s) of SDC1 and how these roles may impact the clinical aspect of the disease. Also discussed, are the current strategies for targeting SDC1 or its related signaling. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  13. Sodium terbium(III polyphosphate

    Directory of Open Access Journals (Sweden)

    Abdelghani Oudahmane

    2010-04-01

    Full Text Available Single crystals of the title compound, NaTb(PO34, were obtained by solid-state reaction. This compound belongs to type II of long-chain polyphosphates with the general formula AIBIII(PO34. It is isotypic with the NaNd(PO34 and NaEr(PO34 homologues. The crystal structure is built up of infinite crenelated chains of corner-sharing PO4 tetrahedra with a repeating unit of four tetrahedra. These chains, extending parallel to [100], are linked by isolated TbO8 square antiprisms, forming a three-dimensional framework. The Na+ ions are located in channels running along [010] and are surrounded by six oxygen atoms in a distorted octahedral environment within a cut-off distance <2.9 Å.

  14. Enzymatic properties and sensitivity to inhibitors of human immunodeficiency virus type 1 (HIV-1) reverse transcriptase with Glu-138-->Arg and Tyr-188-->His mutations.

    Science.gov (United States)

    Zhang, H; Vrang, L; Bäckbro, K; Unge, T; Noréen, R; Oberg, B

    1994-05-01

    Two mutants of HIV-1 reverse transcriptase (RT), Tyr-188-->His and Glu-138-->Arg have been prepared and their catalytic properties and sensitivities to inhibitors studied. As compared to wild type RT, a reduction in catalytic efficiency and turn over number was observed, especially for the Tyr-188-->His mutant. The non-nucleoside inhibitors nevirapine, L-697,661 and 9-Cl-TIBO caused a mixed type of inhibition of RT (Arg-138) with respect to substrate, and with the exception of a non-competitive inhibition by nevirapine, also a mixed type of inhibition of RT (His-188). Foscarnet (PFA) caused a non-competitive type of inhibition of RT (Arg-138) and a mixed inhibition of RT (His-188). The inhibition by ddG-TP was competitive with both mutant RTs. Inhibition by nevirapine gave IC50 values of 0.15, 0.23 and 0.72 microM; by 9-Cl-TIBO of 0.20, 2.50 and 10.3 microM; by L-697,661 of 0.064, 0.28 and 0.60 microM; by ddGTP of 0.13, 0.14 and 0.02 microM; by PFA of 17.0, 48.0 and 15.0 microM for RT wt, RT (Arg-138) and RT (His-188), respectively.

  15. Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl

    2000-01-01

    The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation....

  16. Radiographic Predictors for Mechanical Failure After Adult Spinal Deformity Surgery: A Retrospective Cohort Study in 138 Patients.

    Science.gov (United States)

    Hallager, Dennis W; Karstensen, Sven; Bukhari, Naeem; Gehrchen, Martin; Dahl, Benny

    2017-07-15

    Retrospective cohort study at a single institution. We aimed at estimating the rate of revision procedures and identify radiographic predictors of mechanical failure after adult spinal deformity surgery. Mechanical failure rates after adult spinal deformity surgery range 12% to 37% in literature. Although the importance of spinal and spino-pelvic alignment is well documented for surgical outcome and ideal alignment has been proposed as sagittal vertical axis (SVA) spinal deformity patients who underwent corrective surgery with at least 5 levels of instrumentation between January 2008 and December 2012 at a single tertiary spine unit were followed for at least 2 years. Time to death or failure was recorded and cause-specific Cox regressions were applied to evaluate predictors for mechanical failure or death. A total of 138 patients with median age of 61 years were included for analysis. Follow up ranged 2.1 to 6.8 years. In total 47% had revision and estimated failure rates were 16% at 1 year increasing to 56% at 5 years. A multivariate analysis adjusting for age at surgery showed increased hazard of failure from LL change > 30°, postoperative TK > 50°, and SS ≤30°. LL change was mostly because of 3-column osteotomy and ending the instrumentation at L5 or S1 increased the hazard of failure more than 6 fold compared with more cranial lumbar levels. Mechanical failure rate was 47% after adult spinal deformity corrective surgery. LL change > 30°, postoperative TK > 50°, and postoperative SS ≤30° were independent radiographic predictors associated with increased hazard of failure. 4.

  17. Association between gender inequality index and child mortality rates: a cross-national study of 138 countries.

    Science.gov (United States)

    Brinda, Ethel Mary; Rajkumar, Anto P; Enemark, Ulrika

    2015-03-09

    Gender inequality weakens maternal health and harms children through many direct and indirect pathways. Allied biological disadvantage and psychosocial adversities challenge the survival of children of both genders. United Nations Development Programme (UNDP) has recently developed a Gender Inequality Index to measure the multidimensional nature of gender inequality. The global impact of Gender Inequality Index on the child mortality rates remains uncertain. We employed an ecological study to investigate the association between child mortality rates and Gender Inequality Indices of 138 countries for which UNDP has published the Gender Inequality Index. Data on child mortality rates and on potential confounders, such as, per capita gross domestic product and immunization coverage, were obtained from the official World Health Organization and World Bank sources. We employed multivariate non-parametric robust regression models to study the relationship between these variables. Women in low and middle income countries (LMICs) suffer significantly more gender inequality (p infant (β = 70.28; 95% CI 51.93-88.64) and under five mortality rates (β = 68.14; 95% CI 49.71-86.58), after adjusting for the effects of potential confounders (p mortality rates. Our results suggest that the initiatives to curtail child mortality rates should extend beyond medical interventions and should prioritize women's rights and autonomy. We discuss major pathways connecting gender inequality and child mortality. We present the socio-economic problems, which sustain higher gender inequality and child mortality in LMICs. We further discuss the potential solutions pertinent to LMICs. Dissipating gender barriers and focusing on social well-being of women may augment the survival of children of both genders.

  18. Circular RNA Atp9b, a competing endogenous RNA, regulates the progression of osteoarthritis by targeting miR-138-5p.

    Science.gov (United States)

    Zhou, Zhi-Bin; Du, Di; Huang, Gao-Xiang; Chen, Aimin; Zhu, Lei

    2018-03-10

    Osteoarthritis (OA) is the most common joint disease and is mainly characterized by degradation of the articular cartilage. Recently, circular RNAs (circRNAs), novel noncoding RNAs with different biological functions and pathological implications, have been reported to be closely associated with various diseases. Growing evidence indicates that circRNAs act as competing endogenous RNAs (ceRNAs) that bind with microRNAs (miRNAs) and regulate their downstream functions. Here, we identified a new circRNA, circRNA_Atp9b, and further investigated its function in OA using a well-established mouse chondrocyte model. We demonstrated that circRNA_Atp9b expression was significantly up-regulated in mouse chondrocytes after stimulation with interleukin-1 beta (IL-1β), and that knockdown of circRNA_Atp9b promoted the expression of type II collagen while inhibiting the generation of MMP13, COX-2 and IL-6. Moreover, there was a negative correlation between the expression levels of circRNA_Atp9b and microRNA (miR)-138-5p, indicating that miR-138-5p also played a role in IL-1β-induced chondrocytes. Bioinformatics analysis predicted circRNA_Atp9b directly target miR-138-5p, which was validated by dual-luciferase assay. Further functional experiments revealed that down-regulation of miR-138-5p partly reversed the effects of circRNA_Atp9b on extracellular matrix (ECM) catabolism and inflammation. Taken together, these results suggest that circRNA_Atp9b regulates OA progression by modulating ECM catabolism and inflammation in chondrocytes via sponging miR-138-5p. Our findings provide novel insight into the regulatory mechanism of circRNA_Atp9b in OA and may contribute to establishing potential therapeutic strategies. Copyright © 2018 Elsevier B.V. All rights reserved.

  19. Envelope Protein Mutations L107F and E138K Are Important for Neurovirulence Attenuation for Japanese Encephalitis Virus SA14-14-2 Strain.

    Science.gov (United States)

    Yang, Jian; Yang, Huiqiang; Li, Zhushi; Wang, Wei; Lin, Hua; Liu, Lina; Ni, Qianzhi; Liu, Xinyu; Zeng, Xianwu; Wu, Yonglin; Li, Yuhua

    2017-01-21

    The attenuated Japanese encephalitis virus (JEV) strain SA14-14-2 has been successfully utilized to prevent JEV infection; however, the attenuation determinants have not been fully elucidated. The envelope (E) protein of the attenuated JEV SA14-14-2 strain differs from that of the virulent parental SA14 strain at eight amino acid positions (E107, E138, E176, E177, E264, E279, E315, and E439). Here, we investigated the SA14-14-2-attenuation determinants by mutating E107, E138, E176, E177, and E279 in SA14-14-2 to their status in the parental virulent strain and tested the replication capacity, neurovirulence, neuroinvasiveness, and mortality associated with the mutated viruses in mice, as compared with those of JEV SA14-14-2 and SA14. Our findings indicated that revertant mutations at the E138 or E107 position significantly increased SA14-14-2 virulence, whereas other revertant mutations exhibited significant increases in neurovirulence only when combined with E138, E107, and other mutations. Revertant mutations at all eight positions in the E protein resulted in the highest degree of SA14-14-2 virulence, although this was still lower than that observed in SA14. These results demonstrated the critical role of the viral E protein in controlling JEV virulence and identified the amino acids at the E107 and E138 positions as the key determinants of SA14-14-2 neurovirulence.

  20. Single-dose anti-CD138 radioimmunotherapy: bismuth-213 is more efficient than lutetium-177 for treatment of multiple myeloma in a preclinical model

    Directory of Open Access Journals (Sweden)

    Nolwenn eFichou

    2015-11-01

    Full Text Available Objectives: Radioimmunotherapy (RIT has emerged as a potential treatment option for multiple myeloma (MM. In humans, a dosimetry study recently showed the relevance of RIT using an antibody targeting the CD138 antigen. The therapeutic efficacy of RIT using an anti-CD138 antibody coupled to 213Bi, an α-emitter, was also demonstrated in a preclinical MM model. Since then, RIT with β-emitters has shown efficacy in treating hematologic cancer. In this paper, we investigate the therapeutic efficacy of RIT in the 5T33 murine MM model using a new anti-CD138 monoclonal antibody labeled either with 213Bi for α-RIT or 177Lu for β-RIT.Methods: A new monoclonal anti-CD138 antibody, 9E7.4, was generated by immunizing a rat with a murine CD138-derived peptide. Antibody specificity was validated by flow cytometry, biodistribution and α-RIT studies. Then, a β-RIT dose-escalation assay with the 177Lu-radiolabeled 9E7.4 mAb was performed in KalwRij C57/BL6 mice 10 days after i.v. engraftment with 5T33 MM cells. Animal survival and toxicological parameters were assessed to define the optimal activity.Results: α-RIT performed with 3.7 MBq of 213Bi-labeled 9E7.4 anti-CD138 mAb increased median survival to 80 days compared to 37 days for the untreated control and effected cure in 45% of animals. β-RIT performed with 18.5 MBq of 177Lu-labeled 9E7.4 mAb was well tolerated and significantly increased mouse survival (54 versus 37 days in the control group; however, no mice were cured with this treatment.Conclusion: This study revealed the advantages of α-RIT in the treatment of MM in a preclinical model where β-RIT shows almost no efficacy.

  1. Food Insecurity Is Associated with Subjective Well-Being among Individuals from 138 Countries in the 2014 Gallup World Poll.

    Science.gov (United States)

    Frongillo, Edward A; Nguyen, Hoa T; Smith, Michael D; Coleman-Jensen, Alisha

    2017-04-01

    Background: Food insecurity is an aspect of living conditions that is particularly important for quality of life, health, and subjective well-being. The implementation of the 8-item Food Insecurity Experience Scale in 147 countries in the 2014 Gallup World Poll provided an unprecedented opportunity to understand the association of food insecurity with subjective well-being.Objective: We examined how food insecurity relates with measures of living conditions and how food insecurity and other living conditions relate with physical health and, in turn, subjective well-being.Methods: Data were collected from individuals aged ≥15 y by telephone in 38 countries and via face-to-face interviews in 111 others. The available sample was 132,618 (138 countries) and 122,137 (137 countries) for the daily experience and life evaluation indexes of subjective well-being, respectively. Daily experience was a continuous measure and life evaluation was categorized into thriving, struggling, and suffering. We estimated 6 linear or logistic regression models for each index controlling for country as a fixed effect.Results: Food insecurity was associated with the other 3 measures of living conditions: household income, shelter and housing, and employment. Food insecurity explained poor physical health and lower subjective well-being beyond other measures of living conditions. Instrumental and emotional support was associated with higher subjective well-being. The associations of food insecurity with subjective well-being were larger than with other explanatory variables. Food insecurity was associated with subjective well-being within each of the 4 World Bank income classes of countries, with a larger magnitude of differences for the higher-income classes.Conclusions: Food insecurity was strongly and negatively associated with subjective well-being in a large global sample of individuals aged ≥15 y. These results demonstrate the consistency of goal 2 of the Sustainable Development

  2. Sleep duration and mortality: a prospective study of 113 138 middle-aged and elderly Chinese men and women.

    Science.gov (United States)

    Cai, Hui; Shu, Xiao-Ou; Xiang, Yong-Bing; Yang, Gong; Li, Honglan; Ji, Bu-Tian; Gao, Jing; Gao, Yu-Tang; Zheng, Wei

    2015-04-01

    To evaluate associations of sleep duration with total mortality and disease-specific mortality in a Chinese population. Prospective study conducted from 1996 (for women)/2002 (for men) to 2010. A population-based cohort study in Shanghai, China. None. A total of 113,138 participants (68,548 women and 44,590 men) of the Shanghai Women's and Men's Health Studies, aged 44-79 y and 40-75 y (women and men, respectively) at sleep duration assessment, were included in the study. In-person interviews were conducted to collect information on sleep duration, socioeconomic status, living conditions, history of chronic disease, participation in regular exercise, and family history of disease. The cohort has been followed using a combination of biannual in-person interviews and record linkages with Shanghai's population-based death registry. Survival status of participants on December 31, 2010 was included as the study outcome. Relative risks were calculated using a Cox proportional model stratified by sex and comorbidity score. There were 4,277 deaths (2,356 among women; 1,921 among men) during a median follow-up time of 7.12 y for women and 6.07 y for men. Among both women and men, sleep duration showed a J-shaped association with total mortality. Hazard ratios (95% confidence intervals) were 1.15 (1.01-1.32), 1.06 (0.94-1.20), 1.17 (1.04-1.32), 1.36 (1.13-1.64), and 2.11 (1.77-2.52) for women and 1.06 (0.90-1.25), 1.07 (0.94-1.23), 1.13 (1.00-1.28), 1.34 (1.10-1.62), and 1.55 (1.29-1.86) for men who slept 4-5, 6, 8, 9, and ≥ 10 h per day, respectively, compared with those who slept 7 h per day. Associations for disease-specific mortality, including cardiovascular disease, stroke, diabetes, and cancer, also generally followed the same J-shaped pattern. The sleep duration-mortality association was more evident among participants with comorbidities, but varied little by sex. In our study population of Chinese adults, shorter and longer sleep durations were independently

  3. Risk factors for surgical site infection in a teaching hospital: a prospective study of 1,138 patients

    Directory of Open Access Journals (Sweden)

    Cheng K

    2015-08-01

    Full Text Available Keping Cheng, Jiawei Li, Qingfang Kong, Changxian Wang, Nanyuan Ye, Guohua Xia Department of Infection Control, Zhongda Hospital, School of Medicine, Southeast University, Nanjing, Jiangsu Province, People’s Republic of China Background: The purpose of this study was to identify risk factors for surgical site infection (SSI in a teaching hospital.Methods: A prospective study was initiated to investigate risk factors for SSI at a university-affiliated tertiary care center from July 2013 to December 2014. The chi-square test for categorical variables was used to determine the significance of association, whereas the multivariate logistic regression model was used to examine independent risk factors for SSI.Results: A total of 1,138 patients met the inclusion criteria, in whom 36 cases of infection occurred during the hospitalization period and two cases occurred after discharge. Univariate analysis showed that SSI was associated with the type of operation, wound classification, volume of blood loss, blood transfusion, American Society of Anesthesiology score before surgery, risk index, duration of surgery, diabetes, cancer, gastrointestinal catheter, urinary catheter, postoperative drainage, and preprocedural white blood cell count. Multivariate analysis identified six independent parameters correlating with the occurrence of SSI: diabetes (odds ratio [OR] 6.400; 95% confidence interval [CI] 2.582–15.866; P=0.000; cancer (OR 2.427; 95% CI 1.028–5.732; P=0.043; preprocedural white blood cell count more than 10×109/L (OR 6.988; CI 3.165–15.425; P=0.000; wound classification (clean contaminated [OR: 7.893; CI: 2.244–27.762; P=0.001]; contaminated [OR: 7.031; CI: 1.652–29.922; P=0.008]; dirty [OR: 48.778; CI: 5.418–439.164; P=0.001]; operative duration more than 120 minutes (OR 4.289; CI 1.773–10.378; P=0.001; and postoperative drainage (OR 3.957; CI 1.422–11.008; P=0.008.Conclusion: Our data suggest that all these risk factors

  4. New limits on 2ε, εβ{sup +} and 2β{sup +} decay of {sup 136}Ce and {sup 138}Ce with deeply purified cerium sample

    Energy Technology Data Exchange (ETDEWEB)

    Belli, P.; Bernabei, R. [INFN Sezione Roma ' ' Tor Vergata' ' , Rome (Italy); Universita di Roma ' ' Tor Vergata' ' , Dipartimento di Fisica, Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, Kyiv (Ukraine); National University of Life and Environmental Sciences of Ukraine, Kyiv (Ukraine); Cappella, F. [INFN Sezione Roma, Rome (Italy); Cerulli, R.; Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Danevich, F.A.; Kropivyansky, B.N.; Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, Kyiv (Ukraine); Incicchitti, A. [INFN Sezione Roma, Rome (Italy); Universita di Roma ' ' La Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Mokina, V.M. [Institute for Nuclear Research, Kyiv (Ukraine); INFN Sezione Roma, Rome (Italy)

    2017-08-15

    A search for double electron capture (2ε), electron capture with positron emission (εβ{sup +}), and double positron emission (2β{sup +}) in {sup 136}Ce and {sup 138}Ce was realized with a 465 cm{sup 3} ultra-low background HP Ge γ spectrometer over 2299 h at the Gran Sasso underground laboratory. A 627 g sample of cerium oxide deeply purified by liquid-liquid extraction method was used as a source of γ quanta expected in double β decay of the cerium isotopes. New improved half-life limits were set on different modes and channels of double β decay of {sup 136}Ce and {sup 138}Ce at the level of T{sub 1/2} > 10{sup 17}-10{sup 18} yr. (orig.)

  5. Lipopolysaccharide-induced activation of NF-{kappa}B non-canonical pathway requires BCL10 serine 138 and NIK phosphorylations

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharyya, Sumit; Borthakur, Alip; Dudeja, Pradeep K. [Department of Medicine, University of Illinois at Chicago and Jesse Brown VA Medical Center, Chicago, IL 60612-7227 (United States); Tobacman, Joanne K., E-mail: jkt@uic.edu [Department of Medicine, University of Illinois at Chicago and Jesse Brown VA Medical Center, Chicago, IL 60612-7227 (United States)

    2010-11-15

    Background and aims: B-cell lymphoma/leukemia (BCL)-10 and reactive oxygen species mediate two pathways of NF-{kappa}B (RelA) activation by lipopolysaccharide (LPS) in human colonic epithelial cells. The pathway for LPS activation of RelB by the non-canonical pathway (RelB) in non-myeloid cells was not yet reported, but important for understanding the range of potential microbial LPS-induced effects in inflammatory bowel disease. Methods: Experiments were performed in human colonic epithelial cells and in mouse embryonic fibroblasts deficient in components of the IkappaB kinase (IKK) signalosome, in order to detect mediators of the non-canonical pathway of NF-{kappa}B activation, including nuclear RelB and p52 and phospho- and total NF-{kappa}B inducing kinase (NIK). BCL10 was silenced by siRNA and effects of mutations of specific phosphorylation sites of BCL10 (Ser138Gly and Ser218Gly) were determined. Results: By the non-canonical pathway, LPS exposure increased nuclear RelB and p52, and phospho-NIK, with no change in total NIK. Phosphorylation of BCL10 serine 138 was required for NIK phosphorylation, since mutation of this residue eliminated the increases in phospho-NIK and nuclear RelB and p52. Mutations of either serine 138 or serine 218 reduced RelA, p50, and phospho-I{kappa}B{alpha} of the canonical pathway. Effects of LPS stimulation and BCL10 silencing on NIK phosphorylation were demonstrated in confocal images. Conclusions: LPS induces activation of both canonical and non-canonical pathways of NF-{kappa}B in human colonic epithelial cells, and the non-canonical pathway requires phosphorylations of BCL10 (serine 138) and NIK. These findings demonstrate the important role of BCL10 in mediating LPS-induced inflammation in human colonic epithelial cells and may open new avenues for therapeutic interventions.

  6. Phosphate ytterbium-doped single-mode all-solid photonic crystal fiber with output power of 13.8 W

    Science.gov (United States)

    Wang, Longfei; He, Dongbing; Feng, Suya; Yu, Chunlei; Hu, Lili; Qiu, Jianrong; Chen, Danping

    2015-01-01

    Single-mode ytterbium-doped phosphate all-solid photonic crystal fiber (AS-PCF) with 13.8 W output power and 32% slope efficiency was reported. By altering the diameter of the rods around the doped core and thus breaking the symmetry of the fiber, a polarization-maintaining AS-PCF with degree of polarization of >85% was also achieved, for the first time to knowledge, in a phosphate PCF. PMID:25684731

  7. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Aleixandre, J. L.

    1967-07-01

    145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

  8. The K2-138 System: A Near-resonant Chain of Five Sub-Neptune Planets Discovered by Citizen Scientists

    Science.gov (United States)

    Christiansen, Jessie L.; Crossfield, Ian J. M.; Barentsen, Geert; Lintott, Chris J.; Barclay, Thomas; Simmons, Brooke. D.; Petigura, Erik; Schlieder, Joshua E.; Dressing, Courtney D.; Vanderburg, Andrew; Allen, Campbell; McMaster, Adam; Miller, Grant; Veldthuis, Martin; Allen, Sarah; Wolfenbarger, Zach; Cox, Brian; Zemiro, Julia; Howard, Andrew W.; Livingston, John; Sinukoff, Evan; Catron, Timothy; Grey, Andrew; Kusch, Joshua J. E.; Terentev, Ivan; Vales, Martin; Kristiansen, Martti H.

    2018-02-01

    K2-138 is a moderately bright (V = 12.2, K = 10.3) main-sequence K star observed in Campaign 12 of the NASA K2 mission. It hosts five small (1.6–3.3 {R}\\oplus ) transiting planets in a compact architecture. The periods of the five planets are 2.35, 3.56, 5.40, 8.26, and 12.76 days, forming an unbroken chain of near 3:2 resonances. Although we do not detect the predicted 2–5 minute transit timing variations (TTVs) with the K2 timing precision, they may be observable by higher-cadence observations with, for example, Spitzer or CHEOPS. The planets are amenable to mass measurement by precision radial velocity measurements, and therefore K2-138 could represent a new benchmark system for comparing radial velocity and TTV masses. K2-138 is the first exoplanet discovery by citizen scientists participating in the Exoplanet Explorers project on the Zooniverse platform.

  9. Thermal-neutron cross sections and resonance integrals of {sup 138}Ba and {sup 141}Pr using Am-Be neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Panikkath, Priyada; Mohanakrishnan, P. [Manipal University, Manipal Centre for Natural Sciences, Karnataka (India)

    2016-09-15

    The thermal-neutron capture cross sections and resonance integrals of {sup 138}Ba(n, γ){sup 139}Ba and {sup 141}Pr(n, γ){sup 142}Pr were measured by activation method using an isotopic Am-Be neutron source. The estimations were with respect to that of {sup 55}Mn(n, γ){sup 56}Mn and {sup 197}Au(n, γ){sup 198}Au reference monitors. The measured thermal-capture cross section of {sup 138}Ba with respect to {sup 55}Mn is 0.410±0.023 b and with respect to {sup 197}Au is 0.386±0.019 b. The measured thermal-capture cross section of {sup 141}Pr with respect to {sup 55}Mn is 11.36±1.29 b and with respect to {sup 197}Au is 10.43±1.14 b. The resonance integrals for {sup 138}Ba are 0.380±0.033 b ({sup 55}Mn) and 0.364±0.027 b ({sup 197}Au) and for {sup 141}Pr are 21.05±2.88 b ({sup 55}Mn) and 15.27±1.87 b ({sup 197}Au). The comparison between the present measurements and various reported values are discussed. The cross sections corresponding to the selected isotopes are measured using an Am-Be source facility for the first time. (orig.)

  10. MiR-26a and miR-138 block the G1/S transition by targeting the cell cycle regulating network in prostate cancer cells.

    Science.gov (United States)

    Erdmann, Kati; Kaulke, Knut; Rieger, Christiane; Salomo, Karsten; Wirth, Manfred P; Fuessel, Susanne

    2016-11-01

    The tumor-suppressive microRNAs miR-26a and miR-138 are significantly down-regulated in prostate cancer (PCa) and have been identified as direct regulators of enhancer of zeste homolog 2 (EZH2), which is a known oncogene in PCa. In the present study, the influence of miR-26a and miR-138 on EZH2 and cellular function including the impact on the cell cycle regulating network was evaluated in PCa cells. PC-3 and DU-145 PCa cells were transfected with 100 nM of miRNA mimics, siRNA against EZH2 (siR-EZH2) or control constructs for 4 h. Analyses of gene expression and cellular function were conducted 48 h after transfection. Both miRNAs influenced the EZH2 expression and activity only marginally, whereas siR-EZH2 led to a notable decrease of the EZH2 expression and activity. Both miRNAs inhibited short- and/or long-term proliferation of PCa cells but showed no effect on viability and apoptosis. In PC-3 cells, miR-26a and miR-138 caused a significant surplus of cells in the G0/G1 phase of 6 and 12 %, respectively, thus blocking the G1/S-phase transition. Treatment with siR-EZH2 was without substantial influence on cellular function and cell cycle. Therefore, alternative target genes involved in cell cycle regulation were identified in silico. MiR-26a significantly diminished the expression of its targets CCNE1, CCNE2 and CDK6, whereas CCND1, CCND3 and CDK6 were suppressed by their regulator miR-138. The present findings suggest an anti-proliferative role for miR-26a and miR-138 in PCa by blocking the G1/S-phase transition independent of EZH2 but via a concerted inhibition of crucial cell cycle regulators.

  11. Experimental determinations of the enthalpy of a coal-derived (138/sup 0/)-373(/sup 0/F) naphtha fraction produced by the solvent-refined coal process

    Energy Technology Data Exchange (ETDEWEB)

    Yesavage, V.F.; Andrew, J.R.; Sharma, R.; Kidnay, A.J.

    1978-01-01

    Experimental determinations of the enthalpy of a coal-derived 138/sup 0/-373/sup 0/F naphtha fraction produced by the solvent refined coal process were made with a Freon 11 reference fluid boiloff calorimeter at inlet temperatures of 160/sup 0/-719/sup 0/F, pressures of 30-1500 psia, and an outlet temperature of 65/sup 0/F; 145 measurements were obtained over the liquid, vapor, two-phase, and critical regions. The estimated accuracy of the data was (PLUS OF MINUS)0.5%. Although the experimental data for this particular system were in fair agreement with prediction methods developed for petroleum fractions.

  12. Experimental determinations of the enthalpy of a coal-derived (138-373 F) naphtha fraction produced by the solvent-refined coal process

    Energy Technology Data Exchange (ETDEWEB)

    Yesavage, V.F; Andrew, J.R.; Sharma, R.; Kidnay, A.J.

    1978-01-01

    Experimental determination of the enthalpy of a coal-derived 138-373 F naphtha fraction produced by the solvent refined coal process were made with a Freon 11 reference fluid boiloff calorimeter at inlet temperatures of 160-719 F, pressures of 30-1500 psia, and an outlet temperature of 65 F; 145 measurements were obtained over the liquid, vapor, two-phase, and critical regions. The estimated accuracy of the data was (plus or minus) 0.5%. Although the experimental data for this particular system were in fair agreement with prediction methods developed for petroleum fractions.

  13. A europium- and terbium-coated magnetic nanocomposite as sorbent in dispersive solid phase extraction coupled with ultra-high performance liquid chromatography for antibiotic determination in meat samples.

    Science.gov (United States)

    Castillo-García, M L; Aguilar-Caballos, M P; Gómez-Hens, A

    2015-12-18

    A new magnetic dispersive solid-phase extraction approach based on Eu- and Tb-coated magnetic nanocomposites, combined with ultra-high performance liquid chromatography with fluorometric detection, is reported for the extraction and simultaneous determination of veterinary antibiotics. The method is aimed at monitoring of potential residues of three tetracyclines, namely oxytetracycline, tetracycline, chlortetracycline and three acidic quinolones, such as oxolinic acid, nalidixic acid and flumequine, chosen as model analytes, in animal muscle samples. The nanocomposites were obtained by synthesizing magnetic nanoparticles by a co-precipitation method and their coating with terbium and europium ions. The limits of detection obtained using standard solutions were: 1.0, 1.5, 3.8, 0.25, 0.7 and 1.2ngmL(-1), which corresponds to 3.3, 5.0, 12.7, 0.8, 2.3 and 4.0μgkg(-1) for oxytetracycline, tetracycline, chlortetracycline, oxolinic acid, nalidixic acid and flumequine, respectively, in meat samples. The precision values, obtained in the presence of the sample matrix, were in the ranges 0.12-2.0% and 2.6-15.4% for retention times and areas, respectively. The selectivity of the method was checked by assaying different veterinary drugs, finding that most of them did not interfere at the same concentration levels as that of analytes. A recovery study was performed in the presence of chicken and pork muscle samples, which provided values in the range of 61.5-102.6%. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. A limited plasma cell flow cytometry panel with reflex CD138 immunohistochemistry is an optimal workflow process for evaluating plasma cell neoplasms in bone marrow specimens.

    Science.gov (United States)

    Chen, Zhongchuan Will; Perkins, Sherrie L; Weiss, Ronald L; Bahler, David W; Hussong, Jerry W; Salama, Mohamed E

    2015-01-01

    To determine the optimal workflow combination of flow cytometry (FC) and immunohistochemistry tests for efficient and cost-effective evaluation of plasma cell (PC) neoplasms (PCNs) in bone marrow (BM) specimens. Various workflow combinations of immunohistochemistry and FC for 4,031 BM specimens worked up for PCNs were compared. Turnaround time (TAT), immunohistochemistry usage, technical charges, and addendum/amendment rates were compared between periods to determine the optimal workflow combination. Five distinct workflow periods were identified, with varying combinations of full or limited FC panels for assessing PC clonality and CD138/κ/λ immunohistochemistry for PC quantification. Replacement of full FC with limited FC was associated with significant reductions in TAT and number of immunostains performed per case. Elimination of immunohistochemistry on cases determined to be polyclonal by FC also resulted in significant reductions in immunohistochemistry usage and significant cost savings. Assessment of PC clonality using a limited FC panel followed by reflex CD138 immunohistochemistry on cases that are monoclonal by FC provides an optimal and cost-effective workflow for evaluating PCNs in BM samples. Copyright© by the American Society for Clinical Pathology.

  15. M184I/V substitutions and E138K/M184I/V double substitutions in HIV reverse transcriptase do not significantly affect the antiviral activity of EFdA.

    Science.gov (United States)

    Oliveira, Maureen; Brenner, Bluma G; Xu, Hongtao; Ibanescu, Ruxandra-Ilinca; Mesplède, Thibault; Wainberg, Mark A

    2017-11-01

    4'-Ethynyl-2-fluoro-2'-deoxyadenosine (EFdA) is a potent nucleoside analogue inhibitor of HIV that has an unusually long half-life. Cell culture selections with either EFdA or lamivudine using both subtype B and non-B clinical isolates selected the M184I/V substitutions in reverse transcriptase (RT). Unlike lamivudine, however, EFdA retained significant activity against viruses containing the M184I/V substitutions. In other clinical trials that evaluated rilpivirine together with emtricitabine in first-line therapy, the emergence of both the M184I/V and E138K mutations in RT was demonstrated. Moreover, the M184I/V and E138K substitutions were shown to be compensatory for each other with regard to both efficiency of RT activity and viral replicative capacity. This creates concern that E138K might emerge as a compensatory mutation for M184I/V in the aftermath of the use of EFdA. We wished to determine whether the E138K mutation in HIV RT together with M184I/V would compromise the activity of EFdA. Recombinant viruses containing the M184I/V and/or E138K substitutions were generated by site-directed mutagenesis and evaluated in tissue culture for susceptibility to various nucleoside compounds, including EFdA. Susceptibility to EFdA was retained in M184I/V viruses that also contained the E138K substitution. Moreover, the E138K substitution was not generated in these studies under selection pressure with EFdA. These findings help to alleviate concern that EFdA may not be active against viruses that contain both the M184I/V and E138K substitutions in RT.

  16. From dense hot Jupiter to low-density Neptune: The discovery of WASP-127b, WASP-136b, and WASP-138b

    Science.gov (United States)

    Lam, K. W. F.; Faedi, F.; Brown, D. J. A.; Anderson, D. R.; Delrez, L.; Gillon, M.; Hébrard, G.; Lendl, M.; Mancini, L.; Southworth, J.; Smalley, B.; Triaud, A. H. M.; Turner, O. D.; Hay, K. L.; Armstrong, D. J.; Barros, S. C. C.; Bonomo, A. S.; Bouchy, F.; Boumis, P.; Collier Cameron, A.; Doyle, A. P.; Hellier, C.; Henning, T.; Jehin, E.; King, G.; Kirk, J.; Louden, T.; Maxted, P. F. L.; McCormac, J. J.; Osborn, H. P.; Palle, E.; Pepe, F.; Pollacco, D.; Prieto-Arranz, J.; Queloz, D.; Rey, J.; Ségransan, D.; Udry, S.; Walker, S.; West, R. G.; Wheatley, P. J.

    2017-03-01

    We report three newly discovered exoplanets from the SuperWASP survey. WASP-127b is a heavily inflated super-Neptune of mass 0.18±0.02 MJ and radius 1.37±0.04 RJ. This is one of the least massive planets discovered by the WASP project. It orbits a bright host star (Vmag = 10.16) of spectral type G5 with a period of 4.17 days. WASP-127b is a low-density planet that has an extended atmosphere with a scale height of 2500 ± 400 km, making it an ideal candidate for transmission spectroscopy. WASP-136b and WASP-138b are both hot Jupiters with mass and radii of 1.51 ± 0.08 MJ and 1.38 ± 0.16 RJ, and 1.22 ± 0.08 MJ and 1.09 ± 0.05 RJ, respectively. WASP-136b is in a 5.22-day orbit around an F9 subgiant star with a mass of 1.41 ± 0.07 M⊙ and a radius of 2.21 ± 0.22 R⊙. The discovery of WASP-136b could help constrain the characteristics of the giant planet population around evolved stars. WASP-138b orbits an F7 star with a period of 3.63 days. Its radius agrees with theoretical values from standard models, suggesting the presence of a heavy element core with a mass of 10 M⊕. The discovery of these new planets helps in exploring the diverse compositional range of short-period planets, and will aid our understanding of the physical characteristics of both gas giants and low-density planets. Radial velocity and photometry tables are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/599/A3

  17. Association between the porcine Escherichia coli F18 receptor genotype and phenotype and susceptibility to colonisation and postweaning diarrhoea caused by E-coli O138 : F18

    DEFF Research Database (Denmark)

    Frydendahl, K.; Jensen, Tim Kåre; Andersen, Jens Strodl

    2003-01-01

    Porcine postweaning Escherichia coli enteritis is a cause of significant morbidity and mortality in pigs worldwide, and effective prevention remains an unsolved problem. This study examined the correlation between susceptibility of pigs to experimental infection with an E. coli F18 strain...... and the porcine intestinal F18 receptor genotypes. Thirty-one pigs classified as either belonging to the susceptible or the resistant genotype were inoculated with cultures of an E. coli 0138:F18 isolated from a pig with postweaning diarrhoea. Susceptibility to colonisation and diarrhoea was assessed by clinical...... and heterozygotic susceptible pigs. Faecal shedding of the challenge strain correlated with the genetic receptor profile. Twenty pigs examined immunohistochemically revealed focal to extensive small intestinal mucosal colonisation by E. coli O138:F18 in nine of 10 susceptible and three of 10 resistant pigs. Results...

  18. A de novo 1.38 Mb duplication of 1q31.1 in a boy with hemifacial microsomia, anophthalmia, anotia, macrostomia, and cleft lip and palate.

    Science.gov (United States)

    Huang, Xue-shuang; Zhu, Bao; Jiang, Hai-ou; Wu, Su-fan; Zhang, Zai-qi; Xiao, Lin; Yi, Li-lan; Zhang, Jian-xiang

    2013-04-01

    We reported a 2-year-old boy with developmental delay, mild mental retardation, and severe craniofacial malformation, including facial asymmetry with hypoplasia of the left zygoma, maxilla, and mandible, and left anophthalmia and anotia. A genome-wide screen revealed a 1.38 Mb duplication on chromosome 1q31.1, which was absent in his parents and 27 healthy controls. The duplication region contains two Refseq genes, PLA2G4A and C1orf99, which have not been reported to be implicated in craniofacial malformation. Functional studies of these genes and additional clinical analysis are necessary to elucidate the pathogenesis of craniofacial malformation. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  19. Letter - X-ray diffraction and Mossbauer spectroscopy of Fe{sup 3+}-bearing Mg-silicate post-perovskite at 128-138 GPa.

    Energy Technology Data Exchange (ETDEWEB)

    Catalli, K.; Shim, S. H.; Prakapenka, V. B.; Zhao, J.; Sturhahn, W. (X-Ray Science Division); (Massachusetts Inst. of Tech.); (Univ. of Chicago)

    2010-01-01

    The effect of ferric iron on the properties of Mg-silicate post-perovskite (PPv) were studied up to 138 GPa using synchrotron X-ray diffraction and Moessbauer spectroscopy. Our diffraction measurements revealed that the incorporation of Fe{sup 3+} has virtually no effect on the volume of PPv, in contrast to Fe{sup 2+}, which increases the volume. Therefore, incorporation of Fe{sup 3+} increases the density of PPv much more effectively than Fe{sup 2+}. Moessbauer spectroscopy suggests that Fe{sup 3+} enters PPv through charge-coupled substitution and is high spin in the bipolar prismatic site and low spin in the octahedral site (i.e., mixed spin state). Our results may have important implications for the gravitational stability of lower-mantle heterogeneities.

  20. Perioperative mortality after non-hepatic general surgery in patients with liver cirrhosis: an analysis of 138 operations in the 2000s using Child and MELD scores.

    Science.gov (United States)

    Neeff, Hannes; Mariaskin, Dimitri; Spangenberg, Hans-Christian; Hopt, Ulrich T; Makowiec, Frank

    2011-01-01

    Despite of advances in modern surgical and intensive care treatment, perioperative mortality remains high in patients with liver cirrhosis undergoing nonhepatic general surgery. In the few existing articles, mortality was reported to be as high as 70% in patients with poor liver function (high Child or model for end-stage liver disease (MELD) score). Since data are limited, we analyzed our recent experience with cirrhotic patients undergoing emergent or elective nonhepatic general surgery at a German university hospital. Since 2000, 138 nonhepatic general surgical procedures (99 intra-abdominal, 39 abdominal wall) were performed in patients with liver cirrhosis. Liver cirrhosis was preoperatively classified according to the Child (41 Child A, 59 B, 38 C) and the MELD score (MELD median 13). Sixty-eight (49%) of the patients underwent emergent operations. Most abdominal wall operations were for hernias. Intra-abdominal operations consisted of GI tract procedures (n=53), cholecystectomies (n=15), and various others (n=31). Perioperative data were gained by retrospective analysis. Overall perioperative mortality in all 138 cases was 28% (9% in elective surgery, 47% in emergent surgery; pabdominal than after abdominal wall operations (35% vs. 8%; p=0.001) or in patients requiring transfusions (43% vs. 5% without transfusions; p15; phigh in patients with liver cirrhosisundergoing general surgery, especially in emergent situations. Patients with poor liver function and/or need for blood transfusions even had a very high mortality. In our experience, the Child score (together with other variables) independently correlates with perioperative mortality in emergent operations whereas the MELD score was inferior in predicting the outcome.

  1. Leu138 in bovine prion peptide fibrils is involved in seeding discrimination related to codon 129 M/V polymorphism in the prion peptide seeding experiment.

    Science.gov (United States)

    Liao, Tai-Yan; Lee, Lily Y-L; Chen, Rita P-Y

    2011-11-01

    The risk of acquiring variant Creutzfeldt-Jakob disease is closely related to polymorphism at codon 129 of the human prion gene, because almost all variant Creutzfeldt-Jakob disease patients are Met/Met homozygotes. Although animal transmission experiments corroborated this seeding discrimination, the origin of the differential seeding efficiency of the bovine prion seed for human codon 129 polymorphism remained elusive. Here, we used a short prion protein (PrP) peptide as a model system to test whether seeding discrimination can be found in this simple system. We used a previously developed 'seed-titration method' and time-resolved CD spectroscopy to compare sequence-dependent seeding efficiency regarding codon 129 polymorphism. Our results showed that the Met→Val substitution on the human PrP (huPrP) peptide decreased seeding efficiency by 10 times when fibrils formed from bovine PrP (bPrP) peptide were used as the seed. To explore whether the different seeding barrier is due to the chemical and structural properties of Met and Val or whether another residue is involved in this peptide model, we constructed three bPrP mutants, V112M, L138I and N143S, in each of which one residue was replaced by the corresponding human residue. Our data showed that Leu138 in the bPrP seed might be the key residue causing the different seeding efficiencies related to 129M/V polymorphism and the interference effect of huPrP129V in the huPrP129M/V mixture. We propose a 'surface competition hypothesis' to explain the big seeding barrier caused by 129V in the PrP peptide seeding experiment. © 2011 The Authors Journal compilation © 2011 FEBS.

  2. 136 - 138_Gumel et al.

    African Journals Online (AJOL)

    USER

    Thoracic Cavity and Its Contents. Meat inspection at Hadejia abattoir was carried out by the officials of Veterinary division of Jigawa State. Ministry of Agriculture. All operation in the abattoir were manual and records are kept by the management. Postmortem inspection was carried out according to the method describe by ...

  3. Avaliação da resistência à corrosão de implantes em aços inoxidáveis ISO 5832-9 e F138 removidos de pacientes

    Directory of Open Access Journals (Sweden)

    Elison da Fonseca e Silva

    2012-01-01

    Full Text Available This work has compared the surfaces of two different steel samples used as orthopedical implants, classified as ASTM F138 and ISO5832-9, through optical emission spectroscopy, by means of SEM and EDS. The samples (implants were also submitted to potentiodynamic cyclic polarization in Ringer lactate and NaCl 0.9 M L-1 solutions; ISO5832-9 sample did not show any kind of localized corrosion, but in the case of F138 steel was observed a pit localized corrosion in both solutions. In Ringer lactate solution it was observed a loss of about 63% for nickel and 26% for iron for F138 stell, compared to the initial composition.

  4. Achados neuropatológicos na síndrome da imunodeficiência adquirida (sida: revisão de 138 casos

    Directory of Open Access Journals (Sweden)

    Marco V. Wainstein

    1992-06-01

    Full Text Available Com o objetivo de determinar a incidência das direrentes afecções que podem atingir o Sistema Nervoso Central (SNC na Síndrome da Imunodeficiência Adquirida (SIDA realizou- se um estudo retrospectivo através de necrópsias realizadas no Hospital de Clínicas de Porto Alegre. Para tanto, foram examinadas 138 necrópsias de pacientes portadores de SIDA que haviam morrido entre janeiro de 1985 e dezembo de 1990. Todos os cérebrosforam analisados macroscópica e microscopicamente através da hematoxilina-eosina e, quando necessário, colorações, especiais como Grocott, PAS, Giemsa e Ziehl-Nielsen, foram empregadas. As principais lesões encontradas foram: toxoplasmose cerebral em 29 casos (21 %; criptococose em 17 (12%; tuberculose em dois (1% e um (0,7% de candidíase. Além destas lesões inflamatórias foram observados 15 casos (10% com lesões vasculares; oito (6% com gliose e sete (5% com achados sugestivos de encefalopatia pelo HIV. Podemos concluir que o SNC é um dos principais órgãos-alvo da SIDA e que a toxoplasmose cerebral é a principal forma de acometimento do SNC nestes pacientes.This is an autopsy s study performed in a retrospective fashion to determine the incidence of diseases that could affect the Central Nervous System in AIDS. For this purpose, 138 autopsies of patients with AIDS performed at the "Hospital de Clinicas de Porto Alegre ", Brazil, between january/85 and december/90 were studied. All the brains were evaluated macroscopically and microscopically mainly through hematoxylin-eosin staining and if necessary special tecniques like PAS,Grocott, Giemsa and Ziehl-Nielsen were done. Results have revealed 29 (21% cases with cerebral toxoplasmosis; cryptococosis in 17 (12%; tuberculosis in two (1% and one case (0,7% of candidiasis. Besides these inflammatory lesions, 15 (10%presented vascular lesion; 8(6% had gliosis and 7(5% cases had suggestive findings ofHTV-encephalopath. We can conclude that the CNS is a

  5. Fate of pathological prion (PrP(sc)92-138) in soil and water: prion-clay nanoparticle molecular dynamics.

    Science.gov (United States)

    Chapron, Yves; Charlet, Laurent; Sahai, Nita

    2014-01-01

    Pathogenic prion protein scrapie (PrP(sc)) may contaminate soils for decades and remain in water in colloidal suspension, providing infection pathways for animals through the inhalation of ingested dust and soil particles, and drinking water. We used molecular dynamics simulations to understand the strong binding mechanism of this pathogenic peptide with clay mineral surfaces and compared our results to experimental works. We restricted our model to the moiety PrP(92-138), which is a portion of the whole PrP(sc) molecule responsible for infectivity and modeled it using explicit solvating water molecules in contact with a pyrophyllite cleavage plane. Pyrophyllite is taken as a model for common soil clay, but it has no permanent structural charge. However, partial residual negative charges occur on the cleavage plane slab surface due to a slab charge unbalance. The charge is isotropic in 2D and it was balanced with K(+) ions. After partially removing potassium ions, the peptide anchors to the clay surface via up to 10 hydrogen bonds, between protonated lysine or histidine residues and the oxygen atoms of the siloxane cavities. Our results provide insight to the mechanism responsible for the strong association between the PrP(sc) peptide and clay nanoparticles and the associations present in contaminated soil and water which may lead to the infection of animals.

  6. Decay of the $r$-process nuclides $^{137, 138, 139}$Sb, and the A=130 solar $r$-process abundance peak

    CERN Document Server

    Arndt, O; Farouqi, K; Koester, U; Kratz, K-L; Pfeiffer, B; Walters, W B; Hoteling, N; Fedosseev, V; Hennrich, S; Woehr, A; Shergur, J; Hecht, A A

    2011-01-01

    Half-life (T(1/2)) and beta-delayed neutron branching (P(n)) values of 492(25) ms and 49(8)\\%, 350(15) ms and 72(8)\\%, and 93(13) ms and 90(10)\\% for the r-process nuclei (137,138,139)Sb, respectively, have been measured at the CERN On-Line Isotope Mass Separator (ISOLDE) facility by counting beta-delayed neutrons. More precise T(1/2) and P(n) values of 300(15) ms and 27(4)\\%, and 273(7) ms and 50(8)\\% for (136,137)Sn, respectively, have also been measured. The sources were prepared by using the selective ionization of Sb or Sn with the Resonance Ionization Laser Ion Source and the high-resolution mass separator. The new data for Sb isotopes are compared with calculated T(1/2) and P(n) values for both spherical and nonspherical shapes. The data have been incorporated into parametrized nucleosynthesis calculations of the r process in high-entropy winds of core-collapse supernovae in order to study the properties of the A = 130 solar-system r-process abundance peak.

  7. A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

    CERN Multimedia

    Walters, W

    2002-01-01

    The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

  8. Application of an immune-magnetic cell sorting method for CD138-positive plasma cells in FISH analysis of multiple myeloma.

    Science.gov (United States)

    Shin, S Y; Jang, S; Park, C-J; Chi, H-S; Lee, J-H; Lee, J H; Lee, K H; Suh, C; Lim, S E; Seo, E-J

    2012-10-01

    Interphase fluorescence in situ hybridization (FISH) analysis of multiple myeloma (MM) may indiscriminately count signals of nonplasma cells, thus decreasing specificity and sensitivity. We aimed to evaluate the usefulness of an immune-magnetic sorting method for plasma cells in FISH analysis of MM and define optimal sample preparation conditions. Plasma cells were purified using EasySep(®) CD138 Positive Selection Cocktail and Magnetic Nanoparticles (Invitrogen). We compared FISH results with and without plasma cell purification for three sample preparation methods: direct harvest, 24-h culture, and 96-h culture with interleukin-4 in five newly diagnosed MM patients. Archived fixed bone marrow cells of 17 MM patients were also studied. The percentage of abnormal cells identified was significantly higher with plasma cell purification than without purification (median, 88.0%; range, 84.0-100.0%vs. 15.0%, 12.5-29.5%, respectively). The three sample preparation methods showed comparable results. Immune-magnetic sorting also significantly increased the percentage of abnormal cells identified in FISH analysis of archived fixed bone marrow cells (P cell sorting significantly increased the percentage of abnormal cells identified in FISH analysis of MM samples for all sample preparation methods. This method could also be applied for retrospective FISH analysis of archived fixed bone marrow cells. © 2012 Blackwell Publishing Ltd.

  9. Cigarette smoking, binge drinking, physical activity, and diet in 138 Asian American and Pacific Islander community college students in Brooklyn, New York.

    Science.gov (United States)

    Arliss, Rebecca M

    2007-02-01

    Assessment of cigarette smoking, alcohol consumption, physical activity, and diet in the Asian American and Pacific Islander (AAPI) community has been neglected. A questionnaire was used to investigate these health risk behaviors in 466 students at an urban community college and results for the 138 AAPI study participants were compared to the 328 non-Asians. Results for AAPI study participants showed that twenty percent (20.3%) were current cigarette smokers and 7.7% smoked eleven or more cigarettes per day. Ten percent (10.7%) reported binge drinking on one to two days per month and 17.3% reported binge drinking on three or more days per month. With regard to physical activity, 28.8% participated in stretching, 23.6% in strength and toning, 29.4% in moderate exercise, and 25.4% in vigorous exercise. Results indicated that on the day preceding the survey, only 11.9% consumed five or more servings of fruits and vegetables, 88.4% ate no more than two servings of high-fat foods, and 37.6% consumed tofu, soymilk, or other soy food. AAPI study participants were more likely to frequently binge drink (p < .05), less likely to participate in strength and toning exercises (p < .05), and more likely to consume soy foods daily (p < .01) than non-Asian study participants. Recommendations are presented for health promotion program planning.

  10. Cytotoxic CD8+ T cells and CD138+ plasma cells prevail in cerebrospinal fluid in non-paraneoplastic cerebellar ataxia with contactin-associated protein-2 antibodies

    Directory of Open Access Journals (Sweden)

    Melzer Nico

    2012-07-01

    Full Text Available Abstract Objective The purpose of this paper is to report a patient with otherwise unexplained cerebellar ataxia with serum antibodies against contactin-associated protein-2 (CASPR-2 and provide a detailed description of the composition of cellular infiltrates in the cerebrospinal fluid (CSF compared to the peripheral blood (PB. CASPR-2 antibodies strongly labeling axons of cerebellar granule neurons have recently been identified in sera from nine patients with otherwise unexplained progressive cerebellar ataxia with mild to severe cerebellar atrophy. Design This is a report of a single case. Methods The study methods used were neurologic examination, magnetic resonance imaging, fluorodeoxyglucose positron emisson tomography, lumbar puncture and multicolor flow-cytometry. Results A 23-year-old Caucasian male presented with a two-year history of a progressive cerebellar and brainstem syndrome. Magnetic resonance imaging (MRI showed pronounced cerebellar atrophy, especially of the medial parts of the hemispheres and the vermis. Cerebral fluorodeoxyglucose positron emission tomography (FDG-PET showed pronounced hypometabolism of the whole cerebellum. CASPR-2 antibodies were detected in the serum but not the CSF, and none of the staging and laboratory assessments revealed other causes of progressive cerebellar degeneration. Interestingly, flow-cytometry of the CSF as compared to the PB showed increased fractions of CD138+ plasma cells as well as human leukocyte antigen (HLA-DR+ CD8+ T cells suggesting that both B cells and CD8+ T cells were preferentially recruited to and activated within the CSF- (and putatively central nervous system (CNS- compartment. Conclusion We confirm the association of CASPR-2 serum antibodies with cerebellar ataxia and provide the first evidence for a combined humoral and cellular immune response in this novel antibody-associated inflammatory CNS disease.

  11. Electronic structure and magneto-optical Kerr spectra of an epitaxial Ni54.3Mn31.9Sn13.8 Heusler alloy film

    Science.gov (United States)

    Uba, L.; Bonda, A.; Uba, S.; Bekenov, L. V.; Antonov, V. N.

    2017-07-01

    In this joint experimental and ab initio study, we investigated the influence of chemical composition and martensitic phase transition on the electronic, magnetic, optical and magneto-optical properties of ferromagnetic shape-memory Ni-Mn-Sn alloys. Optical properties and polar magneto-optical Kerr effect (MOKE) spectra for Ni-Mn-Sn alloy film of composition Ni54.3Mn31.9Sn13.8 deposited epitaxially on MgO(0 0 1) substrate were measured over the photon energy range 0.8≤slant hν ≤slant 5.8 eV, and the complete set of optical conductivity tensor elements were determined. To explain the microscopic origin of the optical and magneto-optical spectra, extensive first-principles calculations were made, using the spin-polarized fully relativistic linear-muffin-tin-orbital method. The electronic, magnetic and magneto-optical properties of Ni-Mn-Sn Heusler alloys were investigated for the cubic austenitic and 4O orthorhombic martensitic phases, in stoichiometric and off-stoichiometric compositions. The MOKE properties of Ni-Mn-Sn systems are very sensitive to deviation from stoichiometry. It was shown that the ab initio calculations reproduce experimental spectra well, and help to explain the microscopic origin of Ni-Mn-Sn optical and magneto-optical responses. The interband transitions responsible for the prominent structures in the Ni-Mn-Sn MOKE spectra have been identified—they come from relatively narrow energy intervals at several well-defined vicinities of high-symmetry directions of the Brillouin zone. Significant modification of the MOKE spectra can be considered as a fingerprint of martensitic phase transition in Ni-Mn-Sn alloys.

  12. The interactions of 2,3,7,8-tetrachlorodibenzo-p-dioxin(TCDD) and 6-methyl-1,3,8-trichlorodibenzofuran (MCDF) in TCDD-induced porphyria

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Cheng Catsby.

    1989-01-01

    Halogenated aryl hydrocarbon(HAH)-induced porphyria is caused by alteration of porphyrin metabolism and results in the accumulation of hepatic and urinary porphyrins. 2,3,7,8-Tetrachlorodibenzo-p-dioxin (75 {mu}/kg) caused significant increases of hepatic porphyrin levels in C57BL/6 male, female and ovariectomized female, and C57BL/10 male mice 3 weeks after treatment. In contrast, 6-methyl-1,3,8-trichlorodibenzofuran (MCDF) was inactive at a dose of 750 {mu}mol/kg. Cotreatment with MCDF (750 {mu}mol/kg) and 2,3,7,8-TCDD (75 {mu}g/kg) resulted in partial antagonism of 2,3,7,8-TCDD-induced porphyrin accumulation in female but not in male mice. In female C57BL/6 mice, 2,3,7,8-TCDD-induced porphyria was accompanied by the induction of hepatic microsomal aryl hydrocarbon hydroxylase (AHH) and ethoxyresorufin O-deethylase (EROD) activities and the inhibition of uroporphyrinogen decarboxylase (UROD) activity. MCDF (750 {mu}mol/kg) did not significantly affect these enzyme activities. In coadministration studies, MCDF partially antagonized 2,3,7,8-TCDD-induced hepatic porphyrin accumulation but did not affect the activities of hepatic AHH, EROD or UROD. These results demonstrate that the induction of the monooxygenase enzyme activities and the inhibition of UROD activity by 2,3,7,8-TCDD and the development of porphyria are not coordinately regulated in C57BL/6 female mice. In cultured chick embryo hepatocytes, 2,3,7,8-TCDD caused a significant increase in porphyrin levels and induced AHH and EROD activities. MCDF and Aroclor 1254 partially antagonized the 2,3,7,8-TCDD induced AHH and EROD activities but not the porphyrin accumulation.

  13. Spectroscopic analysis of lithium terbium tetrafluoride

    DEFF Research Database (Denmark)

    Christensen, H.P.

    1978-01-01

    . The rare-earth site in LiTbF4 possesses S4 symmetry, which allows six crystal-field parameters. ζ and the six Bim were varied to obtain the best agreement with the experimentally observed levels. Keeping F2=434 cm-1 fixed, a fit with a standard deviation of 12 cm-1 was obtained at 10 K with the following...... were calculated by diagonalizing an effective spin-orbit and crystal-field Hamiltonian in an LS basis. H=Σλi(L→·S→)i+ΣαiΣBimOim, where the parameters λi are functions of the spin-orbit parameter ζ and the Slater parameter F2. The Oim and αi are Racah operators and reduced matrix elements, respectively...

  14. Inelastic critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1967-01-01

    We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition.......We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition....

  15. Low temperature ductile shear failure of Zr41.2Ti13.8Ni10Cu12.5Be22.5 and Cu50Zr35Ti8Hf5Ni2 bulk amorphous alloys

    NARCIS (Netherlands)

    Tabachnikova, E; Bengus, V.Z.; Miskuf, J; Csach, K; Johnson, W; Molokanov, VV; Ocelik, Vaclav; Eckert, J; Schlorb, H; Schultz, L

    2000-01-01

    Fractographic study of ductile shear failure under uniaxial compression of rod-like samples of the Zr41.2Ti13.8Ni10Cu12.5Be22.5 and Cu50Zr35Ti8Hf5Ni2 bulk amorphous alloys at temperatures of 300 and 77 K is presented. Although the mechanisms of shear deformation and fracture appeared the same as in

  16. MiR-9-5p, miR-675-5p and miR-138-5p Damages the Strontium and LRP5-Mediated Skeletal Cell Proliferation, Differentiation, and Adhesion.

    Science.gov (United States)

    Sun, Tianhao; Leung, Frankie; Lu, William W

    2016-02-15

    This study was designed to evaluate the effects of strontium on the expression levels of microRNAs (miRNAs) and to explore their effects on skeletal cell proliferation, differentiation, adhesion, and apoptosis. The targets of these miRNAs were also studied. Molecular cloning, cell proliferation assay, cell apoptosis assay, quantitative real-time PCR, and luciferase reporter assay were used. Strontium altered the expression levels of miRNAs in vitro and in vivo. miR-9-5p, miR-675-5p, and miR-138-5p impaired skeletal cell proliferation, cell differentiation and cell adhesion. miR-9-5p and miR-675-5p induced MC3T3-E1 cell apoptosis more specifically than miR-138-5p. miR-9-5p, miR-675-5p, and miR-138-5p targeted glycogen synthase kinase 3 β (GSK3β), ATPase Aminophospholipid Transporter Class I Type 8A Member 2 (ATP8A2), and Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1), respectively. Low-density lipoprotein receptor-related protein 5 (LRP5) played a positive role in skeletal development. miR-9-5p, miR-675-5p, and miR-138-5p damage strontium and LRP5-mediated skeletal cell proliferation, differentiation, and adhesion, and induce cell apoptosis by targeting GSK3β, ATP8A2, and EIF4EBP1, respectively.

  17. miR-9-5p, miR-675-5p and miR-138-5p Damages the Strontium and LRP5-Mediated Skeletal Cell Proliferation, Differentiation, and Adhesion

    Directory of Open Access Journals (Sweden)

    Tianhao Sun

    2016-02-01

    Full Text Available This study was designed to evaluate the effects of strontium on the expression levels of microRNAs (miRNAs and to explore their effects on skeletal cell proliferation, differentiation, adhesion, and apoptosis. The targets of these miRNAs were also studied. Molecular cloning, cell proliferation assay, cell apoptosis assay, quantitative real-time PCR, and luciferase reporter assay were used. Strontium altered the expression levels of miRNAs in vitro and in vivo. miR-9-5p, miR-675-5p, and miR-138-5p impaired skeletal cell proliferation, cell differentiation and cell adhesion. miR-9-5p and miR-675-5p induced MC3T3-E1 cell apoptosis more specifically than miR-138-5p. miR-9-5p, miR-675-5p, and miR-138-5p targeted glycogen synthase kinase 3 β (GSK3β, ATPase Aminophospholipid Transporter Class I Type 8A Member 2 (ATP8A2, and Eukaryotic Translation Initiation Factor 4E Binding Protein 1 (EIF4EBP1, respectively. Low-density lipoprotein receptor-related protein 5 (LRP5 played a positive role in skeletal development. miR-9-5p, miR-675-5p, and miR-138-5p damage strontium and LRP5-mediated skeletal cell proliferation, differentiation, and adhesion, and induce cell apoptosis by targeting GSK3β, ATP8A2, and EIF4EBP1, respectively.

  18. Metallic glass formation in highly undercooled Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 during containerless electrostatic levitation processing

    Science.gov (United States)

    Kim, Y. J.; Busch, R.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1994-10-01

    Various sample sizes of Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 with masses up to 80 mg were undercooled below Tg (the glass transition temperature) while electrostatically levitated. The final solidification product of the sample was determined by x-ray diffraction to have an amorphous phase. Differential scanning calorimetry was used to confirm the absence of crystallinity in the processes sample. The amorphous phase could be formed only after heating the samples above the melting temperature for extended periods of time in order to break down and dissolve oxides or other contaminants which would otherwise initiate heterogeneous nucleation of crystals. Noncontact pyrometry was used to monitor the sample temperature throughout processing. The critical cooling rate required to avoid crystallization during solidification of the Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 alloy fell between 0.9 and 1.2 K/s.

  19. Establishment and antitumor effects of dasatinib and PKI-587 in BD-138T, a patient-derived muscle invasive bladder cancer preclinical platform with concomitant EGFR amplification and PTEN deletion.

    Science.gov (United States)

    Chang, Nakho; Lee, Hye Won; Lim, Joung Eun; Jeong, Da Eun; Song, Hye Jin; Kim, Sudong; Nam, Do-Hyun; Sung, Hyun Hwan; Jeong, Byong Chang; Seo, Seong Il; Jeon, Seong Soo; Lee, Hyun Moo; Choi, Han-Yong; Jeon, Hwang Gyun

    2016-08-09

    Muscle-invasive bladder cancer (MIBC) consists of a heterogeneous group of tumors with a high rate of metastasis and mortality. To facilitate the in-depth investigation and validation of tailored strategies for MIBC treatment, we have developed an integrated approach using advanced high-throughput drug screening and a clinically relevant patient-derived preclinical platform. We isolated patient-derived tumor cells (PDCs) from a rare MIBC case (BD-138T) that harbors concomitant epidermal growth factor receptor (EGFR) amplification and phosphatase and tensin homolog (PTEN) deletion. High-throughput in vitro drug screening demonstrated that dasatinib, a SRC inhibitor, and PKI-587, a dual PI3K/mTOR inhibitor, exhibited targeted anti-proliferative and pro-apoptotic effects against BD-138T PDCs. Using established patient-derived xenograft models that successfully retain the genomic and molecular characteristics of the parental tumor, we confirmed that these anti-tumor responses occurred through the inhibition of SRC and PI3K/AKT/mTOR signaling pathways. Taken together, these experimental results demonstrate that dasatinib and PKI-587 might serve as promising anticancer drug candidates for treating MIBC with combined EGFR gene amplification and PTEN deletion.

  20. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  1. Cloning and characterization of a beta-1,4-mannanase 5C possessing a family 27 carbohydrate-binding module from a marine bacterium, Vibrio sp. strain MA-138.

    Science.gov (United States)

    Tanaka, Megumi; Umemoto, Yoshiaki; Okamura, Hidenori; Nakano, Daiichirou; Tamaru, Yutaka; Araki, Toshiyoshi

    2009-01-01

    The beta-1,4-mannanase 5C gene (man5C) of Vibrio sp. strain MA-138 was cloned and expressed in Escherichia coli. The man5C gene consisted of 2,010 bp nucleotides encoding a protein of 669 amino acids with a predicted molecular weight of 76,309. beta-1,4-Mannanase (Man5C) is a modular enzyme composed of a catalytic module belonging to glycoside hydrolase family 5, a linker region, and a putative carbohydrate-binding module (CBM) belonging to family 27. Recombinant Man5C exhibited maximal activity at 50 degrees C at pH 7.0, and it had a K(m) of 0.6 mg ml(-1) and a V(max) of 556.2 micromol min(-1) mumol(-1) for glucomannan. Binding studies revealed that the C-terminal putative CBM27 had the ability to bind soluble beta-mannans and contributed to increasing the rate of depolymerization by binding to the polymeric substrate. Man5C of Vibrio sp. MA-138 is the first non-extremophile enzyme to be identified as a beta-mannanase possessing CBM27.

  2. Experimental determination of a time-temperature-transformation diagram of the undercooled Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 alloy using the containerless electrostatic levitation processing technique

    Science.gov (United States)

    Kim, Y. J.; Busch, R.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1996-02-01

    High temperature high vacuum electrostatic levitation was used to determine the complete time-temperature-transformation (TTT) diagram of the Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 bulk metallic glass forming alloy in the undercooled liquid state. This is the first report of experimental data on the crystallization kinetics of a metallic system covering the entire temperature range of the undercooled melt down to the glass transition temperature. The measured TTT diagram exhibits the expected ``C'' shape. Existing models that assume polymorphic crystallization cannot satisfactorily explain the experimentally obtained TTT diagram. This originates from the complex crystallization mechanisms that occur in this bulk glass-forming system, involving large composition fluctuations prior to crystallization as well as phase separation in the undercooled liquid state below 800 K.

  3. A new crystal form of human histidine triad nucleotide-binding protein 1 (hHINT1) in complex with adenosine 5′-monophosphate at 1.38 Å resolution

    Science.gov (United States)

    Dolot, Rafał; Ozga, Magdalena; Włodarczyk, Artur; Krakowiak, Agnieszka; Nawrot, Barbara

    2012-01-01

    Histidine triad nucleotide-binding protein 1 (HINT1) represents the most ancient and widespread branch of the histidine triad protein superfamily. HINT1 plays an important role in various biological processes and has been found in many species. Here, the structure of the human HINT1–adenosine 5′-monophosphate (AMP) complex at 1.38 Å resolution obtained from a new monoclinic crystal form is reported. The final structure has R cryst = 0.1207 (R free = 0.1615) and the model exhibits good stereochemical quality. Detailed analysis of the high-resolution data allowed the details of the protein structure to be updated in comparison to the previously published data. PMID:22869114

  4. A new crystal form of human histidine triad nucleotide-binding protein 1 (hHINT1) in complex with adenosine 5'-monophosphate at 1.38 Å resolution.

    Science.gov (United States)

    Dolot, Rafał; Ozga, Magdalena; Włodarczyk, Artur; Krakowiak, Agnieszka; Nawrot, Barbara

    2012-08-01

    Histidine triad nucleotide-binding protein 1 (HINT1) represents the most ancient and widespread branch of the histidine triad protein superfamily. HINT1 plays an important role in various biological processes and has been found in many species. Here, the structure of the human HINT1-adenosine 5'-monophosphate (AMP) complex at 1.38 Å resolution obtained from a new monoclinic crystal form is reported. The final structure has R(cryst) = 0.1207 (R(free) = 0.1615) and the model exhibits good stereochemical quality. Detailed analysis of the high-resolution data allowed the details of the protein structure to be updated in comparison to the previously published data.

  5. Altered levels of miR-21, miR-125b-2*, miR-138, miR-155, miR-184, and miR-205 in oral squamous cell carcinoma and association with clinicopathological characteristics.

    Science.gov (United States)

    Manikandan, Mayakannan; Deva Magendhra Rao, Arunagiri K; Rajkumar, Kottayasamy Seenivasagam; Rajaraman, Ramamurthy; Munirajan, Arasambattu K

    2015-11-01

    Previous studies have described the aberrantly expressed microRNAs (miRNAs) in oral squamous cell carcinoma (OSCC), and we reasoned that studying frequently deregulated candidate miRNAs in OSCC of Indian ethnicity could aid in better understanding of the genetic/environmental impact on the expression statuses of these miRNAs. Therefore, we evaluated the differential expression of six selected miRNAs namely hsa-miR-21, hsa-miR-125b2*, hsa-miR-138, hsa-miR-155, hsa-miR-184, and hsa-miR-205 in OSCC specimens of Indian ethnicity. Two-step Reverse transcriptase quantitative PCR using inventoried TaqMan single miRNA assays was employed to study the expression of the selected miRNAs in 42 OSCC tumors and eight adjacent normal specimens. The expression levels of the miRNAs were tested for any association with clinicopathological parameters. miR-21 was significantly elevated while miR-125b-2* was significantly downregulated in tumors compared to controls (P 184 were observed to be predominantly downregulated in the tumor samples. High levels of miR-155 were associated with the habit of chewing tobacco/betel quid. Our results corroborate the previous findings on the overexpression of mir-21 and downregulation of miR-138 in OSCC. As the expression of miR-184 is controversial in tongue/oral cancer, the downregulation may be specific to tumor anatomical localization. On the other hand, to the best of our knowledge, this is the first report to show the association of miR-155 with tobacco chewing and the downregulation of miR-125b-2* in OSCC. Computational predictions suggest that miR-125b-2* may have a role in alternative splicing. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  6. Citotoxic activity evaluation of essential oils and nanoemulsions of Drimys angustifolia and D. brasiliensis on human glioblastoma (U-138 MG and human bladder carcinoma (T24 cell lines in vitro

    Directory of Open Access Journals (Sweden)

    Madson R. F. Gomes

    2012-11-01

    Full Text Available The species Drimys angustifolia Miers and D. brasiliensis Miers, commonly known as "casca-de-anta", have in their leaves essential oils that can confer cytotoxic effects. In this study, we evaluated the citotoxic effects of the volatile oils from these two species. We also proposed a nanoemulsion formulation for each of the species and assessed the in vitro cytotoxicity on U-138 MG (human glioblastoma and T24 (human bladder carcinoma cell lines. The plant chemical composition was evaluated by gas chromatography coupled to mass spectrometer. Furthermore, the nanoemulsions were prepared and characterized. Our results showed that; bicyclogermacrene (19.6% and cyclocolorenone (18.2% were the most abundant for the D angustifolia oil and D brasiliensis oil, respectively. Both nanoemulsions, D angustifolia and D brasiliensis appeared macroscopically homogeneous and opalescent bluish liquids, with nanometric mean diameters of 168 nm for D brasiliensis and 181 nm for D angustifolia. The polydispersity indices were below 0.10, with an acid pH of 4.7-6.3, and negative zeta potentials about -34 mV. The results of transmission electron microscopy showed that droplets are present in the nanometer range. Only the D brasiliensis oil was efficient in reducing the cell viability of both U-138 MG (42.5%±7.0 and 67.8%±7.8 and T24 (33.2%±2.8, 60.3%±1.6 and 80.5%±8.8 cell lines, as assessed by MTT assay. Noteworthy, similar results were obtained with cell counting. Finally, D brasiliensis oil incubation caused an increase of annexin-V and propidium iodite population, according to evaluation by cytometry analysis, what is characteristic of late apoptosis. The results presented herein lead us to consider the potential therapeutic effects of the essential oils and nanoformulations as novel strategies to inhibit tumor growth.

  7. Citotoxic activity evaluation of essential oils and nanoemulsions of Drimys angustifolia and D. brasiliensis on human glioblastoma (U-138 MG and human bladder carcinoma (T24 cell lines in vitro

    Directory of Open Access Journals (Sweden)

    Madson R. F. Gomes

    2013-04-01

    Full Text Available The species Drimys angustifolia Miers and D. brasiliensis Miers, commonly known as "casca-de-anta", have in their leaves essential oils that can confer cytotoxic effects. In this study, we evaluated the citotoxic effects of the volatile oils from these two species. We also proposed a nanoemulsion formulation for each of the species and assessed the in vitro cytotoxicity on U-138 MG (human glioblastoma and T24 (human bladder carcinoma cell lines. The plant chemical composition was evaluated by gas chromatography coupled to mass spectrometer. Furthermore, the nanoemulsions were prepared and characterized. Our results showed that; bicyclogermacrene (19.6% and cyclocolorenone (18.2% were the most abundant for the D angustifolia oil and D brasiliensis oil, respectively. Both nanoemulsions, D angustifolia and D brasiliensis appeared macroscopically homogeneous and opalescent bluish liquids, with nanometric mean diameters of 168 nm for D brasiliensis and 181 nm for D angustifolia. The polydispersity indices were below 0.10, with an acid pH of 4.7-6.3, and negative zeta potentials about -34 mV. The results of transmission electron microscopy showed that droplets are present in the nanometer range. Only the D brasiliensis oil was efficient in reducing the cell viability of both U-138 MG (42.5%±7.0 and 67.8%±7.8 and T24 (33.2%±2.8, 60.3%±1.6 and 80.5%±8.8 cell lines, as assessed by MTT assay. Noteworthy, similar results were obtained with cell counting. Finally, D brasiliensis oil incubation caused an increase of annexin-V and propidium iodite population, according to evaluation by cytometry analysis, what is characteristic of late apoptosis. The results presented herein lead us to consider the potential therapeutic effects of the essential oils and nanoformulations as novel strategies to inhibit tumor growth.

  8. Publications | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    December 2011 and February, 2013) (restricted access). Knowledge management is about identifying critical knowledge areas that makes a ''big difference or big change in target groups/trainees through ''…capturing and synthesizing new ...

  9. 33 CFR 138.20 - Definitions.

    Science.gov (United States)

    2010-07-01

    ....20 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE..., damages, environment, hazardous substance, liable, liability, navigable waters, natural resources..., facilities, or any combination thereof, resulting in the discharge or substantial threat of discharge of oil...

  10. 19__138 - 147_Hamidu_Groundwater

    African Journals Online (AJOL)

    pc

    2-Department of Geology, Faculty of Earth a. Correspondence author: ABSTRACT. The Sedimentary (Chad formation) and Ba investigated for groundwater suitability for using aquifer properties derived from pump method for single well tests. The mean valu capacity recorded for the area are 4.06×10. Boreholes yield ranges ...

  11. Reference: 138 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ishi et al. 2004 Dec. Proc. Natl. Acad. Sci. U.S.A. 101(49):17306-11. Protein phosphorylation/dephosphorylation are... major signaling events induced by osmotic stress in higher plants. Here, we showed that a SNF1-relat...ed protein kinase 2 (SnRK2), SRK2C, is an osmotic-stress-activated protein kinase...ants of SRK2C exhibited drought hypersensitivity in their roots, suggesting that SRK2C is a positive regulat...h CaMV35S promoter::SRK2C-GFP displayed higher overall drought tolerance than control plants. Whereas stomatal re

  12. 22 CFR 138.105 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... the Federal Acquisition Regulation (FAR), and any other acquisition contract for real or personal... tribes in that Act. (h) Influencing or attempting to influence means making, with the intent to influence...

  13. Publications | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Econometric analysis reveals that education level, age and gender of the household head, family size, land holding size, and access to information influence ... The network meeting in London was an opportunity for project leaders to explore shared research issues in understanding emerging impacts of open data.

  14. Hemispherical total emissivity and specific heat capacity of deeply undercooled Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 melts

    Science.gov (United States)

    Busch, R.; Kim, Y. J.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.; Isheim, D.

    1995-06-01

    High-temperature high-vacuum electrostatic levitation (HTHVESL) and differential scanning calorimetry (DSC) were combined to determine the hemispherical total emissivity ɛT, and the specific heat capacity cp, of the undercooled liquid and throughout the glass transition of the Zr41.2Ti13.8Cu12.5Ni10.0Be22.5 bulk metallic glass forming alloy. The ratio of cp/ɛT as a function of undercooling was determining from radiative cooling curves measured in the HTHVESL. Using specific heat capacity data obtained by DSC investigations close to the glass transition and above the melting point, ɛT and cp were separated and the specific heat capacity of the whole undercooled liquid region was determined. Furthermore, the hemispherical total emissivity of the liquid was found to be about 0.22 at 980 K. On undercooling the liquid, the emissivity decreases to approximately 0.18 at about 670 K, where the undercooled liquid starts to freeze to a glass. No significant changes of the emissivity are observed as the alloy undergoes the glass transition.

  15. Atomic structure of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass alloy

    Energy Technology Data Exchange (ETDEWEB)

    Hui, X. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China)], E-mail: huixd01@hotmail.com; Fang, H.Z.; Chen, G.L. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Shang, S.L.; Wang, Y. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Qin, J.Y. [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University - Southern Campus, Jinan 250061 (China); Liu, Z.K. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States)

    2009-01-15

    Ab initio molecular dynamics (AIMD) calculations were performed on the atomic configuration of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass. The local structures were characterized in terms of structure factors (SF), pair correlation functions (PCF), coordinate numbers, bond pairs and Voronoi polyhedra. The glass transition temperature, generalized PCF and SF predicated by AIMD are in good agreement with the experimental data. Icosahedral short-range orders (ISRO) are found to be the most dominant, in view of the presence of the majority of bond pairs with 1551, 1541 and 1431, and Voronoi polyhedra with <0,3,6,1>, <0,2,8,1>, <0,0,12,0> and <0,2,8,4>. Icosahedral medium range orders (IMROs) are formed from icosahedra via the linkage of vertex-, edge-, face- and intercross-shared atoms. The glass structure on the nanometer scale is accumulated by polyhedra through an efficient packing mode. It is suggested that the extraordinary glass-forming ability of this alloy is essentially attributable to the formation of ISRO and IMRO, and the dense packing of atoms.

  16. Current data on the background burden to the persistent organochlorine pollutants HCB, p,p'-DDE as well as PCB 138, PCB 153 and PCB 180 in plasma of the general population in Germany.

    Science.gov (United States)

    Schettgen, Thomas; Alt, Anne; Esser, Andre; Kraus, Thomas

    2015-06-01

    Despite their long-term ban, persistent organochlorine compounds like hexachlorobenzene (HCB), p,p'-dichlorodiphenylethylene (DDE) as well as polychlorinated biphenyls (PCBs) are still of environmental concern. For the evaluation of potential occupational or environmental exposures to these substances, it is essential to know the current background burden of the general population. As representative and up-to-date information is missing for Germany, we have analysed a large dataset generated in studies on potential exposure to lower chlorinated PCBs to fill this gap for the levels of HCB, DDE as well as PCB 138, PCB 153 and PCB 180. We have investigated n=2750 plasma samples of persons of the general population living in North Rhine-Westfalia and Hesse aged 6-65 years and sampled between September 2010 and March 2014. For evaluation of the age-dependent accumulation in the general population we have generated seven age groups in the collective. Our laboratory used a validated and quality controlled procedure using GC/MS for quantification of the organochlorine compounds in plasma (LOQ: 0.01μg/L). The median (95th percentile) levels for ∑ PCB 138+PCB 153+PCB 180 were 0.14 (0.73); 0.30 (0.82); 0.38 (0.88); 0.50 (1.14); 0.92; 1.58 (3.54) and 2.41 (4.82)μg/L plasma in the age groups 6-10 years (n=102), 11-17 years (n=499), 18-25 years (n=157), 26-35 years (n=710), 36-45 years (n=400), 46-55 years (n=525) and 56-65 years (n=357), respectively. Similarly, the median (95th percentile) levels of p,p'-DDE were 0.18 (1.24); 0.18 (0.74); 0.24 (0.85); 0.30 (1.20); 0.45 (1.74); 0.64 (3.25) and 0.94 (4.7)μg/L plasma. Finally, the median (95th percentile) of HCB in plasma in these age groups was 0.05 (0.10); 0.06 (0.11); 0.08 (0.15); 0.08 (0.15); 0.11 (0.22); 0.14 (0.42) and 0.20 (0.68)μg/L plasma. Our results prove an overall substantial reduction in the body burden to organochlorine compounds in Germany compared to earlier studies. However, 15% and 3.6% of the examined

  17. 49 CFR 571.138 - Standard No. 138; Tire pressure monitoring systems.

    Science.gov (United States)

    2010-10-01

    ... mph). For vehicles equipped with cruise control, cruise control is not to be engaged during testing... of control or response signals in the vehicle's tire pressure monitoring system. The vehicle's TPMS...

  18. Inelastic scattering of neutrons by spin waves in terbium

    DEFF Research Database (Denmark)

    Bjerrum Møller, Hans; Houmann, Jens Christian Gylden

    1966-01-01

    Measurements of spin-wave dispersion relations for magnons propagating in symmetry directions in ferromagnetic Tb; it is first experiment to give detailed information on magnetic excitations in heavy rare earths; Tb was chosen for these measurements because it is one of few rare-earth metals whic...... does not have very high thermal-neutron capture cross section, so that inelastic neutron scattering experiments can give satisfactory information on magnon dispersion relations....

  19. Coherent magnetic structures in terbium/holmium superlattices

    DEFF Research Database (Denmark)

    Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

    1997-01-01

    Neutron-scattering techniques have been used to investigate the magnetic properties of three Tb/Ho superlattices grown by molecular-beam epitaxy. It is revealed that for temperatures in the range T = 10 to T-N(Ho)approximate to 130 K, there is a basal-plane ferromagnetic alignment of Tb moments w...

  20. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gil Perez, D.

    1967-07-01

    We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

  1. Resistance of HIV-1 reverse transcriptase against [2',5'-bis-O-(tert-butyldimethylsilyl)-3'-spiro-5''-(4''-amino-1'',2''- oxathiole-2'',2''-dioxide)] (TSAO) derivatives is determined by the mutation Glu138-->Lys on the p51 subunit.

    Science.gov (United States)

    Jonckheere, H; Taymans, J M; Balzarini, J; Velázquez, S; Camarasa, M J; Desmyter, J; De Clercq, E; Anné, J

    1994-10-14

    Determination of the three-dimensional structure of the human immunodeficiency virus type-1 (HIV-1) reverse transcriptase (RT) has indicated a totally different folding for the 51-kDa subunit (p51) than for the 66-kDa subunit (p66). The polymerase catalytic site is located on the p66 subunit. Moreover, the HIV-1-specific RT inhibitors, also designated as the non-nucleoside RT inhibitors (NNRTIs), select for amino acid mutations that afford resistance to these compounds and are clustered in the palm domain of the HIV-1 RT p66 subunit. This pocket is located in the vicinity of, but clearly distinct from, the polymerase active site. However, for the NNRTIs that belong to the class of the [2',5'-bis-O-(tert-butyldimethylsilyl)-3'-spiro-5''-(4''-amino-1'',2''- oxathiole- 2'',2''-dioxide)] (TSAO) derivatives, the resistance mutation is located at position Glu138. On the p66 subunit, this amino acid is distant from the binding site of the HIV-1-specific RT inhibitors. When the TSAO-specific resistance mutation Glu138-->Lys was introduced solely in the p51 subunit of the RT p66/p51 heterodimer, the enzyme proved completely resistant to TSAO-m3T but retained full sensitivity to TIBO R82150 and ddGTP. On the other hand, when the mutation was introduced only in the p66 subunit the enzyme remained equally sensitive to the inhibitory effects of TSAO-m3T, TIBO R82150, and ddGTP. Our data provide compelling evidence for a structural and functional role of the p51 subunit in the sensitivity and/or resistance of the enzyme to the NNRTIs.

  2. Dicty_cDB: VSK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sq27g07.y1 Gm-c1046 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1046-2101 5' similar to WP:D1005...sad75f02.y1 Gm-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-6028 5' similar to TR:Q9XFY7...sc93f08.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-928 5' similar to WP:D1005.1...sm51c09.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-7433 5' similar to SW:ACLY_RAT...sk39d02.y1 Gm-c1028 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1028-4540 5' similar to WP:D1005

  3. 1/38 GEBEURLIKHEDE EN DIE BEWYSLAS IN DIE DELIKTUELE ...

    African Journals Online (AJOL)

    tduplessis

    Gebeurlikhede1 in die deliktuele skadevergoedingsreg2 kan omskryf word as onsekere3 omstandighede4 van positiewe of negatiewe aard wat, onafhanklik van die verweerder se optrede5 en indien dit sou realiseer,6 waarskynlik7 'n persoon se gesondheid, inkomste, verdienvermoë, lewenskwaliteit, lewens- verwagting ...

  4. 29 CFR 452.138 - Application of other laws.

    Science.gov (United States)

    2010-07-01

    ..., 1959. H. Rept. No. 741, p. 17; S. Rept. No. 187, pp. 21-22, 101, 104. Hearings, House Comm. on Education and Labor, 86th Cong., 1st sess., pt. 1, p. 1611. See also Furniture Store Drivers Local 82 v...

  5. Publications | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  6. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Breaking barriers to Internet access. Internet search engines are the most efficient method of acquiring information. This poses three problems in China: 1.3 billion people cannot read English; 16 million are visually impaired and cannot use traditional search engines; and only 163 million Chinese use the Internet, although ...

  7. Dicty_cDB: AFA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CWPTGKINYFFYLHYIQFNFINFLMAKLKIIIYIVIIFCSSIQFSFGYEKAIASFYPPPG DLHPTTHNFWACNSVINQNGGFGPLECNNAGIYAIFSTANEIIDGNEYMLPLFYIG---...CWPTGKINYFFYLHYIQFNFINFLMAKLKIIIYIVIIFCSSIQFSFGYEKAIASFYPPPG DLHPTTHNFWACNSVINQNGGFGPLECNNAGIYAIFSTANEIIDGNEYMLPLFYIG---

  8. Computed tomographic features of lymphangioleiomyomatosis: Evaluation in 138 patients

    Energy Technology Data Exchange (ETDEWEB)

    Tobino, Kazunori, E-mail: tobino@juntendo.ac.jp [Department of Respiratory Medicine, Iizuka Hospital, 3-83 Yoshiomachi, Iizuka, Fukuoka 820-0018 (Japan); Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Johkoh, Takeshi [Department of Radiology, Kinki Central Hospital of Mutual Aid Association of Public School Teachers, Kurumazuka 3-1, Itami, Hyogo 664-0872 (Japan); Fujimoto, Kiminori [Department of Radiology, Kurume University School of Medicine and Center for Diagnostic Imaging, Kurume University Hospital, 67 Asahi-machi, Kurume, Fukuoka 830-0011 (Japan); Sakai, Fumikazu [Department of Diagnostic Radiology, Saitama International Medical Center, Saitama Medical University, 1397-1 Yamane, Hidaka, Saitama 350-1298 (Japan); Arakawa, Hiroaki [Department of Radiology, Dokkyo Medical University, 880 Kita-Kobayashi, Mibu, Tochigi 321-0293 (Japan); Kurihara, Masatoshi [The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Pneumothorax Center, Nissan Tamagawa Hospital, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Kumasaka, Toshio [The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Department of Pathology, Japanese Red Cross Medical Center, 4-1-22 Hiroo, Shibuya-Ku, Tokyo 150-0012 (Japan); Koike, Kengo; Takahashi, Kazuhisa [Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); Seyama, Kuniaki [Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan)

    2015-03-15

    Highlights: •In our series, the frequency of pulmonary nodules was higher than in the previous reports. •Our sporadic LAM patients had a lower frequency of renal AML than in that of previous reports. •LAM patients may have a high incidence of renal and hepatic cysts. •LAM cells may originate in the pelvis then spread via the axial lymphatic system. -- Abstract: Purpose: The aim was to characterize the computed tomographic (CT) findings from Japanese patients with lymphangioleiomyomatosis (LAM). Materials and methods: CT scans of the chest, abdomen, and pelvis from 124 patients with sporadic LAM (S-LAM, mean age, 37.4 years) and 14 patients with tuberous sclerosis complex (TSC)-LAM (mean age, 35.6 years) were analyzed. Results: Pulmonary nodules (18.8%) and hepatic angiomyolipoma (AML, 24.3%) were more common in our patients than those in previous reports. Compared with TSC-LAM, S-LAM group had a higher frequency of pulmonary nodules (28.6% vs 32.3%, P < 0.01) and lower frequencies of air-space consolidation (21.4% vs 2.4%, P < 0.01), pneumothorax (28.6% vs 8.1%, P = 0.02), pulmonary hilar lymphadenopathy (14.3% vs 0.8%, P < 0.01), renal AML (85.7% vs 17.4%, P < 0.01), hepatic AML (71.4% vs 17.4%, P < 0.01), and retrocrural lymphadenopathy (14.3% vs 1.4%, P = 0.04). Axial lymphatic abnormalities (i.e., thoracic duct dilatation, lymphadenopathy, and lymphangioleiomyoma) were most common in the pelvis and tended to decrease in incidence with increased distance from the pelvis. Conclusion: The incidence of some CT findings in Japanese patients differed from those in previous reports. Axial lymphatic abnormalities noted here suggest that the origin of LAM cells may be the pelvis.

  9. 138 PUSHING THE FRONTIERS OF EQUITY AS A MEANS FOR ...

    African Journals Online (AJOL)

    Fr. Ikenga

    For the first time we must be concerned as members of the human species with the condition of the natural and cultural heritage of our planet that we pass to future generations and with our own ability to enjoy the legacy from past generations…1. The concept of development aims at enlarging the opportunities people have ...

  10. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... waste produced by the mining industry. Failing to do so magnifies the problem. Morocco is not the only country that is facing this challenge. Unfortunately, the lack of adapted technologies and resources to reclaim land, in semi-arid countries, has been a major reason for inaction. Morocco, Canada, France. PROJECT ...

  11. Reverted austenite in PH 13-8 Mo maraging steels

    Energy Technology Data Exchange (ETDEWEB)

    Schnitzer, Ronald, E-mail: ronald.schnitzer@unileoben.ac.at [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Radis, Rene [Christian Doppler Laboratory for Early Stages of Precipitation, Vienna University of Technology, Favoritenstrasse 9-11, A-1040 Vienna (Austria); Institute for Materials Science and Welding, Graz University of Technology, Kopernikusgasse 24, A-8010 Graz (Austria); Noehrer, Matthias [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Schober, Michael [Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Hochfellner, Rainer [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zinner, Silvia [Boehler Edelstahl GmbH and Co KG, Mariazeller Strasse 25, A-8605 Kapfenberg (Austria); Povoden-Karadeniz, E.; Kozeschnik, Ernst [Christian Doppler Laboratory for Early Stages of Precipitation, Vienna University of Technology, Favoritenstrasse 9-11, A-1040 Vienna (Austria); Leitner, Harald [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria)

    2010-07-01

    The mechanical properties of maraging steels are strongly influenced by the presence of reverted austenite. In this study, the morphology and chemical composition of reverted austenite in a corrosion resistant maraging steel was characterized using transmission electron microscopy (TEM) and atom probe tomography (APT). Two types of austenite, i.e. granular and elongated, are present after aging at 575 {sup o}C, whereby the content of the latter increases during aging. The investigations revealed that the austenite phase is enriched in Ni, which prevents the transformation to martensite during cooling. Inside and next to the austenitc areas, Mo and Cr-rich carbides, which form during the aging treatment, were found. Various aging treatments were performed to obtain the activation energy for the formation of reverted austenite. Additionally, the experimental data are compared with thermodynamic and kinetic simulations. Based on these results and the chemical composition changes of the phases, a model for the formation of reverted austenite is presented. It is concluded that precipitation of B2-ordered NiAl and formation of reverted austenite take place simultaneously during aging and that dissolution of precipitates is not essential for the initial formation of reverted austenite.

  12. GPCR sequence information: 001_005_138 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available MENITNISEFILMGFPTAPWLQILLFSIFFITYVFVLLENLVIILTVWVTGSLHKPMYYF LSTMSFLEAWYISVTVPKMLAGFLFRPNTISFLGCMTQLYFFMSLACTECVLLAAMAYDR...LNHFFCDVS PILKLACMNLSMAETVDFALAIVILIFPLSATVLSYGFIVSTVLQIPSATGQRKAFSTCA SHLTVVVIFYTAVIFMYVRPRAIASFNSN

  13. 32 CFR 719.138 - Fees of civilian witnesses.

    Science.gov (United States)

    2010-07-01

    ... board to redress injuries to property, or (5) Military or civil officer before whom a deposition is taken. The public voucher must be accompanied by a subpoena or invitational orders (Joint Travel... authorized by Joint Travel Regulations. (j) Supplemental construction of section. Nothing in this paragraph...

  14. Dicty_cDB: VHA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...4 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine...ering clone MHPP142o16. 50 0.17 1 CR044130 |CR044130.1 Forward strand read from ins

  15. Dicty_cDB: SHC138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 5...neering clone MHPP142o16. 50 0.13 1 CR034434 |CR034434.1... clone MHPP186g09. 50 0.13 1 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engi

  16. South of Sahara | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    South of Sahara. Sud du Sahara. Read more about Savoir émergent - suivi de la progression vers la société de l'information. Language French. Read more about Monitoring Progress Toward the Information Society : Digital Divide Index. Language English. Read more about Lake Naivasha Sustainability : Ecosystem ...

  17. 7 CFR 457.138 - Grape crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... have a share; (b) That are grown for wine, juice, raisins, or canning (if such grapes are put to... multiplying the number of tons of raisin production by 4.5. (ii) Grapes grown for wine, juice, raisins or... paid by usual marketing outlets for the area during the week in which the damaged grapes were valued...

  18. Dicty_cDB: CHC138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfseenisik*is*kiis**nq*slli...SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfseenisik*is*kiis**nq*slli

  19. Quadrupole collectivity in {sup 138,140,142}Xe

    Energy Technology Data Exchange (ETDEWEB)

    Henrich, Corinna; Kroell, Thorsten; Ilieva, Stoyanka [Institut fuer Kernphysik, TU Darmstadt (Germany); Collaboration: IS411 and EXILL-FATIMA-Collaboration

    2016-07-01

    The region around the doubly magic nucleus {sup 132}Sn is of special interest as both single-particle and mean-field approaches can be applied by theory. In order to gain further understanding on the nuclear structure in this region, a 'safe' Coulomb excitation experiment was carried out at REX-ISOLDE (CERN, Geneva) using the MINIBALL spectrometer (IS411 campaign). As only a small center-of-mass range on the particle detector was accessible, the sensitivity on the quadrupole moments of the first 2{sup +} and 4{sup +} state using just that data is relatively small. Therefore, additional information provided by the direct lifetime measurement at ILL (Grenoble, France) using the EXILL and FATIMA spectrometer was crucial for the analysis. The final results of the analysis along with a comparison to predictions of several theoretical models are presented.

  20. All projects related to | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-03-07

    Technology can be a crucial catalyst for improving people's lives in the developing world. End Date: March 7, 2017. Topic: INFORMATION TECHNOLOGY, RESEARCH CAPACITY, RESEARCH METHODS, METHODOLOGY, SOUTH ASIA, Evaluation. Region: North of Sahara, South of Sahara, Central Asia, Far East Asia, ...

  1. Dicty_cDB: VFJ138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ksrsmwwllvilnhwfn*rcslyciwnkkrfsfii*tkldrlfkiir *qwl--- ---nxiliiir*sxxxxirqsxixiiir*nxixcfinlwfsirxpir*pirpiprxxirs nlcxwssisxrf...wxwxrfrfrxrfrxrxclgxiwxxldr*kxmgxfmgxgwlxfyeqxxk xxxwxrnxgffpxcxxklkfyf*l Homology vs C

  2. Dicty_cDB: SSI138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YRGNIIQMFKQIVREEGWRGL YRGMGVNLLRVTPSCVITFTSYEYIKKFLSQNQNHF***yvgeldvmrwsamqcpksknn tkikkkkkrkkkk Translated ...KNKNKELGI VEIMIASSVSKIIASVVAYPHEVLRARSQDSSPDSPNRTYRGNIIQMFKQIVREEGWRGL YRGMGVNLLRVTPSCVITFTSYEYIKKFLSQNQNHF***yvgeldvmrwsamqcp

  3. Dicty_cDB: VHL138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK150126_1( AK150126 |pid:none) Mus musculus bone marrow macrophag... 99 4e-20 BC066817_1( BC066817 |pid:none)...AK150101_1( AK150101 |pid:none) Mus musculus bone marrow macrophag... 97 2e-19 AK168195_1( AK168195 |pid:none)

  4. Dicty_cDB: AFK138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available diagnosing malaria and immune antigen for suppressing growth of plasmodium. 76 3...e-58 9 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  5. The "Cairo hoard" (1895) = CH VII A138

    DEFF Research Database (Denmark)

    Christiansen, Erik

    2010-01-01

    Based on his own handwritten list - partly also present coins in the Ashmolean - this is the first full publication of the hoard (actually two hoards mixed together) of 822 Alexandrian tetradrachms which Milne bought in Cairo in 1895.......Based on his own handwritten list - partly also present coins in the Ashmolean - this is the first full publication of the hoard (actually two hoards mixed together) of 822 Alexandrian tetradrachms which Milne bought in Cairo in 1895....

  6. 33 CFR 138.80 - Financial responsibility, how established.

    Science.gov (United States)

    2010-07-01

    ... must submit annual, current, and audited non-consolidated financial statements prepared in accordance... certificant, apart from any other affiliated entity, and identify the consolidated financial statement to...-insurance. By filing with the Director, NPFC, the financial statements specified in paragraph (b)(3)(i) of...

  7. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Brazil's coastal areas are threatened by organic and inorganic pollution stemming from population growth and industrialization. More specifically, pollution is suspected of jeopardizing the health of aquatic species in natural and commercial settings. When pollution affects the reproduction of species, the local economy is ...

  8. Dicty_cDB: VSF138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d_seedlings Descurainia sophia cDNA clone Ds01_15g02, mRNA sequence. 44 0.006 3 dna update 2003. 8.23 Homolo...genase mRNA, partial cds. 46 0.003 2 BU238367 |BU238367.1 Ds01_15g02_A Ds01_AAFC_ECORC_cold_stressed_Flixwee

  9. Dicty_cDB: VSD138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ti*tas*rairskwlsss*stlrl*w*k*w*sffqrr*yhynfrsk*srwlvariftnr* trflpi*frttivrklrypnnmlmvftniqilii*id*kk*NKIKCHNKLFPFVFLKKK-...ti*tas*rairskwlsss*stlrl*w*k*w*sffqrr*yhynfrsk*srwlvariftnr* trflpi*frttivrklrypnnmlmvftniqilii*id*kk*NKIKCHNKLFPFVFLKKK-...---ti*tas*rairskwlsss*stlrl*w*k*w*sffqrr*yhynfrsk*srwlvarift nr*trflpi*frttivrklrypnnmlmvftniqilii*xikknkik*nvtinyfh

  10. (abstract) Undercooling Studies of the Bulk Metallic Glass Forming Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) Alloy During Containerless Electrostatic Levitation Processing

    Science.gov (United States)

    Kim, Y. J.; Busch, R.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1995-01-01

    Bulk glass forming metallic alloys have long been desired for technological applications and for investigation into liquid undercooling, solidification processes, and thermophysical properties. A glass forming alloy Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) was used to investigate the thermal treatments affecting undercooling and vitrification. The experiments were performed using the high temperature high vacuum electrostatic levitator at JPL. A sample approximately 3 mm in diameter was melted, superheated, undercooled, and solidified while levitated in high vacuum. The results show that when the sample was held above its melting temperature for a sufficient period of time to dissolve oxides and then cooled faster than a critical cooling rate, it undercooled to the glass transition temperature, T(sub g), and formed a glassy alloy. The required critical cooling rate for metallic glass formation was obtained to be between 0.9 K per second and 1.2 K per second for the 42.4 mg sample.

  11. Hemispherical total emissivity and specific heat capacity of deeply undercooled Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10.0}Be{sub 22.5} melts

    Energy Technology Data Exchange (ETDEWEB)

    Busch, R.; Kim, Y.J.; Johnson, W.L. [W. M. Keck Laboratory of Engineering Materials, California Institute of Technology, Pasadena, California 91125 (United States); Rulison, A.J.; Rhim, W.K. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109 (United States); Isheim, D. [Institut fuer Metallphysik der Universitaet Goettingen, Hospitalstrasse 3-7, 37073 Goettingen (Germany)

    1995-06-05

    High-temperature high-vacuum electrostatic levitation (HTHVESL) and differential scanning calorimetry (DSC) were combined to determine the hemispherical total emissivity {epsilon}{sub {ital T}}, and the specific heat capacity {ital c}{sub {ital p}}, of the undercooled liquid and throughout the glass transition of the Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10.0}Be{sub 22.5} bulk metallic glass forming alloy. The ratio of {ital c}{sub {ital p}}/{epsilon}{sub {ital T}} as a function of undercooling was determining from radiative cooling curves measured in the HTHVESL. Using specific heat capacity data obtained by DSC investigations close to the glass transition and above the melting point, {epsilon}{sub {ital T}} and {ital c}{sub {ital p}} were separated and the specific heat capacity of the whole undercooled liquid region was determined. Furthermore, the hemispherical total emissivity of the liquid was found to be about 0.22 at 980 K. On undercooling the liquid, the emissivity decreases to approximately 0.18 at about 670 K, where the undercooled liquid starts to freeze to a glass. No significant changes of the emissivity are observed as the alloy undergoes the glass transition. {copyright} {ital 1995} {ital American} {ital Institute} {ital of} {ital Physics}.

  12. A Novel β-Globin Chain Hemoglobin Variant, Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp], Associated with Low Oxygen Saturation, Intermittent Aplastic Crises and Splenomegaly.

    Science.gov (United States)

    Collier, Anderson B; Coon, Lea M; Monteleone, Philip; Umaru, Samuel; Swanson, Kenneth C; Hoyer, James D; Oliveira, Jennifer L

    2016-01-01

    Hemoglobin (Hb) variants may be associated with low oxygen saturation and exacerbated episodes of anemia from common stressors such as viral infections. These attributes frequently cause increased clinical concern and unnecessary and expensive testing if not considered early in the evaluation of the patient. Some clinically significant Hb variants result in a normal Hb electrophoresis result, which can be method-dependent. Herein we describe a patient with low oxygen saturation and a history of hemolytic anemia who was subsequently found to carry a novel, unstable β-globin variant that we have named Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp] for the place of identification of the variant. Hb Allentown is formed by a rare double nucleotide substitution within the same codon. Additionally, positive identification of rare Hb variants characterized by a single method is discouraged, as the Hb variant was misclassified as Hb S-South End or β6(A3)Glu→Val;β132(H10)Lys→Asn (HBB: c.[20A > T;399A > C]) by the initial laboratory.

  13. (abstract) Determination of the Specific Heat and Total Hemispherical Total Emissivity of the Highly Undercooled Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) Alloy

    Science.gov (United States)

    Busch, R.; Kim, Y. J.; Johnson, W. L.; Rulison, A. J.; Rhim, W. K.

    1995-01-01

    High temperature high vacuum electrostatic levitation was combined with DSC experiments to determine the specific heat C(sub p) of the undercooled Zr(sub 41.2)Ti(sub 13.8)Cu(sub 12.5)Ni(sub 10.0)Be(sub 22.5) liquid as a function of temperature. The containerless approach made it possible to undercool the melt to the glass transition temperature without inducing nucleation. Because the cooling process was purely radiative, noncontact temperature measurement techniques could be used to determine the specific heat to total hemispherical emissivity ratio, C(sub p)/epsilon(sub t), for the undercooled liquid region. Using C(sub p) values which were independently obtained by DSC, epsilon(sub t) could be determined. With knowledge of C(sub p) of the undercooled liquid it was possible to determine other thermodynamic properties such as Gibbs free energy and entropy as a function of undercooling.

  14. Photoluminescence studies of a Terbium(III) complex as a fluorescent probe for DNA detection

    Energy Technology Data Exchange (ETDEWEB)

    Khorasani-Motlagh, Mozhgan, E-mail: mkhorasani@chem.usb.ac.ir; Noroozifar, Meissam; Niroomand, Sona; Moodi, Asieh

    2013-11-15

    The photoluminescence properties of a Tb(III) complex of the form [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] (phen=1,10-phenanthroline) in different solvents are presented. It shows the characteristic luminescence of the corresponding Ln{sup 3+} ion in the visible region. The emission intensity of this complex in coordinating solvent is higher than non-coordinating one. The suggested mechanism for the energy transfer between the ligand and Tb{sup 3+} ion is the intramolecular energy transfer mechanism. The interactions of the Tb(III) complex with fish salmon DNA are studied by fluorescence spectroscopy, circular dichroism study and viscosity measurements. The results of fluorescence titration reveal that DNA strongly quenches the intrinsic fluorescence of the complex through a static quenching procedure. The binding constant (K{sub b}) of the above metal complex at 25 °C is determined by the fluorescence titration method and it is found to be (8.06±0.01)×10{sup 3} M{sup −1}. The thermodynamic parameters (ΔH{sup 0}>0, ΔS{sup 0}>0 and ΔG{sup 0}<0) indicate that the hydrophobic interactions play a major role in DNA–Tb complex association. The results support the claim that the title complex bonds to FS-DNA by a groove mode. -- Highlights: • Photoluminescence of [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] in different solvents are studied. • Tb(III) complex shows good binding affinity to FS DNA with K{sub b}=(8.06±0.01)×10{sup 3} M{sup −1}. • Viscosity of DNA almost unchanged by increasing amount of Tb complex. • CD spectrum of DNA has a little change with increasing amount of Tb complex. • Thermodynamic parameters indicate that the binding reaction is entropically driven.

  15. Lanthanides in Nuclear Medicine. The Production of Terbium-149 by Heavy Ion Beams

    CERN Document Server

    Dmitriev, S N; Zaitseva, N G; Maslov, O D; Molokanova, L G; Starodub, G Ya; Shishkin, S V; Shishkina, T V

    2001-01-01

    Among radioactive isotopes of lanthanide series elements, finding the increasing using in nuclear medicine, alpha-emitter {149}Tb (T_{1/2} = 4.118 h; EC 76.2 %; beta^+ 7.1 %; alpha 16.7 %) is considered as a perspective radionuclide for radioimmunotherapy. The aim of the present work is to study experimental conditions of the {149}Tb production in reactions Nd({12}C, xn){149}Dy (4.23 min; beta^+, EC)\\to {149}Tb when the Nd targets have been irradiated by heavy ions of carbon. On the basis of results of formation and decay of {149}Dy\\to{149}Tb evaluation of the {149}Tb activity, is made which can be received under optimum conditions (enriched {142}Nd target, {12}C ions with the energy 120 MeV and up to current 100 mu A, time of irradiating 8-10 hours). Under these conditions {149}Tb can be obtained up to 30 GBq (up to 0.8 Ci).

  16. Poly[[aqua-?3-picolinato-?2-picolinato-dipicolinatopotassium(I)terbium(III)] 2.5-hydrate

    OpenAIRE

    Filipe A. Almeida Paz; João Rocha; Jacek Klinowski; Tito Trindade; Nogueira,Helena I. S.; Soares-Santos, Paula C. R.; Cunha-Silva, Lu?s

    2008-01-01

    In the title compound, [KTb(C6H4NO2)4(H2O)]·2.5H2O, each Tb3+ centre is coordinated by four N and five O atoms from five distinct picolinate ligands in a geometry resembling a highly distorted tricapped trigonal prism. One of the ligands establishes a skew bridge between neighbouring Tb3+ centres, leading to the formation of one-dimensional anionic polymeric chains, {[(C6H4NO2)4Tb]−}n, running along the direction [010]. Each K+ cation is seven-coordinated by six O atoms from one an...

  17. Spin waves in terbium. III. Magnetic anisotropy at zero wave vector

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden; Jensen, J.; Touborg, P.

    1975-01-01

    The energy gap at zero wave vector in the spin-wave dispersion relation of ferromagnetic. Tb has been studied by inelastic neutron scattering. The energy was measured as a function of temperature and applied magnetic field, and the dynamic anisotropy parameters were deduced from the results....... The axial anisotropy is found to depend sensitively on the orientation of the magnetic moments in the basal plane. This behavior is shown to be a convincing indication of considerable two-ion contributions to the magnetic anisotropy at zero wave vector. With the exception of the sixfold basal...... the effects of zero-point deviations from the fully aligned ground state, and we tentatively propose polarization-dependent two-ion couplings as their origin....

  18. Structural and Magnetic Anisotropy in Amorphous Terbium-Iron Thin Films

    Science.gov (United States)

    Hufnagel, Todd Clayton

    1995-01-01

    High density, removable media magnetooptic disk drives have recently begun to make significant gains in the information mass storage market. The media in these disks are amorphous rare-earth/transition-metal (RE-TM) alloys. One vital property of these materials is a large perpendicular magnetic anisotropy; that is, an easy axis of magnetization which is perpendicular to the plane of the film. A variety of theories, sometimes contradictory, have been proposed to account for this surprising presence of an anisotropic property in an amorphous material. Recent research indicates that there is an underlying atomic-scale structural anisotropy which is responsible for the observed magnetic anisotropy. Several different types of structural anisotropy have been proposed to account for the observed magnetic anisotropy, including pair-ordering anisotropy (anisotropic chemical short-range order) and bond orientation anisotropy (an anisotropy in coordination number or distances independent of chemical ordering). We have studied the structural origins of perpendicular magnetic anisotropy in amorphous Tb-Fe thin films by employing high-energy and anomalous dispersion x-ray scattering. The as-deposited films show a clear structural anisotropy, with a preference for Tb-Fe near neighbors to align in the out-of-plane direction. These films also have a large perpendicular magnetic anisotropy. Upon annealing, the magnetic anisotropy energy drops significantly, and we see a corresponding reduction in the structural anisotropy. The radial distribution functions indicate that the number of Tb-Fe near-neighbors increases in the in-plane direction, but does not change in the out-of-plane direction. Therefore, the distribution of Tb-Fe near-neighbors becomes more uniform upon annealing. We propose that the observed reduction in perpendicular magnetic anisotropy energy is a result of this change in structure. Our results support the pair -ordering anisotropy model of the structural anisotropy in amorphous Tb-Fe thin films. We see no evidence to support the bond orientation anisotropy model.

  19. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    Antonov-Romanovskii et al [2] firstly suggested applications of OSL for personal dosime- try. This technique got momentum for personnel dosime- try after the development of α-Al2O3:C. OSL properties of α-Al2O3:C have been investigated for personnel dosimetry, environmental dosimetry, medical dosimetry and space.

  20. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    The powder X-ray diffraction (PXRD), photoluminescence (PL) emission and excitation spectra, thermoluminescence (TL) and optically stimulated luminescence (OSL) were measured. The particle size was calculated using the Debye Scherrer formula and found to be 79.42 nm. PL emission spectra of Li 3 PO 4 :Tb 3 + ...

  1. Charge-transfer-based terbium MOF nanoparticles as fluorescent pH sensor for extreme acidity.

    Science.gov (United States)

    Qi, Zewan; Chen, Yang

    2017-01-15

    Newly emerged metal organic frameworks (MOFs) have aroused the great interest in designing functional materials by means of its flexible structure and component. In this study, we used lanthanide Tb 3+ ions and small molecular ligands to design and assemble a kind of pH-sensitive MOF nanoparticle based on intramolecular-charge-transfer effect. This kind of made-to-order MOF nanoparticle for H + is highly specific and sensitive and could be used to fluorescently indicate pH value of strong acidic solution via preset mechanism through luminescence of Tb 3+ . The long luminescence lifetime of Tb 3+ allows eliminating concomitant non-specific fluorescence by time-revised fluorescence techniques, processing an advantage in sensing H + in biological media with strong autofluorescence. Our method showed a great potential of MOF structures in designing and constructing sensitive sensing materials for specific analytes directly via the assembly of functional ions/ligands. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Assessment of terbium (III) as a luminescent probe for the detection of tuberculosis biomarkers

    Energy Technology Data Exchange (ETDEWEB)

    Bamogo, W. [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Mugherli, L. [CEA, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Banyasz, A. [CNRS, IRAMIS, LIDyL/Laboratoire Francis Perrin, URA 2453, F-91191 Gif-sur-Yvette (France); Novelli-Rousseau, A.; Mallard, F. [BioMérieux SA, F-38000 Grenoble (France); Tran-Thi, T.-H., E-mail: thu-hoa.tran-thi@cea.fr [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France)

    2015-10-08

    A detection method for nicotinic acid, a specific metabolite marker of Mycobacterium tuberculosis present in cultures and patients' breath, is studied in complex solutions containing other metabolites and in biological media such as urine, saliva and breath condensate. The method is based on the analysis of the luminescence increase of Tb{sup 3+} complexes in the presence of nicotinic acid due to the energy transfer from the excited ligand to the lanthanide ion. It is shown that other potential markers found in M. tuberculosis culture supernatant, such as methyl phenylacetate, p-methyl anisate, methyl nicotinate and 2-methoxy biphenyl, can interfere with nicotinic acid via a competitive absorption of the excitation photons. A new strategy to circumvent these interferences is proposed with an upstream trapping of volatile markers preceding the detection of nicotinic acid in the liquid phase via the luminescence of Tb{sup 3+} complexes. The cost of the method is evaluated and compared with the Xpert MTB/RIF test endorsed by the World Health Organization. - Highlights: • Nicotinic acid, a specific marker of M. tuberculosis, can be detected via luminescence. • The detection limit with a commercial phosphorimeter is 0.4 µmol·L{sup -1}. • Other metabolites of M. tuberculosis can interfere via absorbed excitation light. • The interference can be removed via trapping of the most volatile metabolites. • A breath analysis procedure's cost is compared with the Xpert TBM/RIF test.

  3. A highly porous luminescent terbium-organic framework for reversible anion sensing

    Energy Technology Data Exchange (ETDEWEB)

    Wong, K.L.; Law, G.L.; Wong, W.T. [Department of Chemistry, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Yang, Y.Y. [School of Chemistry and Chemical Engineering, Sun Yat-Sen University, Guangzhou 510275 (China)

    2006-04-18

    Unique tailored porous frameworks incorporating a lanthanide metal center have been designed to function as chemical detectors. A flexible multidentate ligand, mucic acid, is used to differentiate between several anions, thus creating an organic framework that is ideally suited for applications in gas separation, sensors, and chemical switches. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  4. Synthesis and characterization of wide bandgap semiconductors doped with terbium for electroluminescent devices

    OpenAIRE

    Montañez Huamán, Liz Margarita

    2016-01-01

    En el presente trabajo de investigación se ha estudiado propiedades estequiometrias, estructurales y de emisión de luz de semiconductor de amplio ancho de banda dopados con terbio. La difracción de rayos-X en ángulo rasante confirma el estado amorfo de las películas. Los espectros de absorción infrarroja muestran la formación de óxidos en las películas y la espectroscopia de foto-electrones de rayos-X revela la formación de oxinitruro de aluminio y oxicarburo de silicio. Las pe...

  5. Synthesis and characterization of terbium-doped SrSnO3 pigments

    Czech Academy of Sciences Publication Activity Database

    Dohnalová, Ž.; Gorodylova, N.; Šulcová, P.; Vlček, Milan

    2014-01-01

    Roč. 40, č. 8 (2014), s. 12637-12645 ISSN 0272-8842 Institutional support: RVO:61389013 Keywords : pigments * solid state reaction * perovskites Subject RIV: CA - Inorganic Chemistry Impact factor: 2.605, year: 2014

  6. An optical material for the detection of β-hydroxybutyrate based on a terbium complex

    Science.gov (United States)

    Wang, Xiaomiao; Chen, Huili; Li, Hua

    2014-02-01

    A novel Tb3+ complex (Tb(C14H10O4)ṡCl, TbL2) based on benzoic acid (L+H) was successfully synthesized, and gave a weak green emission in methanol-water (V:V, 4:1, pH 4.49). With the addition of β-hydroxybutyrate (β-HB) to a semi-aqueous solution of TbL2, an increment of the luminescent intensity at 545 nm assigned to 5D4 → 7F5 transition of Tb3+ was measured, which was evident to the naked eye. The response showed high selectivity for β-HB compared with other common anions including Cl-, NO3-, CO32-, PO43-, HPO42-, HPO4-, CO42-, PO74-, SO42-, lactate, AcO-, citrate, malate therefore it has the potential to be applied as a luminescent sensor for β-HB.

  7. Microstructural characterization of PH 13-8 Mo maraging steels; Mikrostrukturelle Charakterisierung von PH 13-8 Mo Maraging-Staehlen

    Energy Technology Data Exchange (ETDEWEB)

    Schnitzer, Ronald; Hochfellner, Rainer; Noehrer, Matthias [Christian Doppler Lab. for Early Stages of Precipitation, Leoben (Austria); Schober, Michael; Clemens, Helmut [Dept. Metallkunde und Werkstoffpruefung, Montanuniversitaet Leoben (Austria); Zinner, Silvia [Boehler Edelstahl GmbH und Co. KG, Kapfenberg (Austria); Leitner, Harald [Christian Doppler Lab. for Early Stages of Precipitation, Leoben (Austria); Dept. Metallkunde und Werkstoffpruefung, Montanuniversitaet Leoben (Austria)

    2009-10-15

    Maraging steels are characterized by an excellent combination of high strength coupled with an acceptable level of ductility. Its microstructure consists of a martensitic matrix with intermetallic precipitates and a low amount of austenite, the latter varying according to heat treatment and the composition of the alloy. In this paper methods and processes for comprehensively characterizing the microstructure of maraging steels are set out. Apart from the prior austenite grain size, the martensite and the intermetallic phases these also relate to the reverted austenite formed during heat treatment. In addition to the description of the growth of austenite grains, with the aid of the law of isothermal grain growth, high-resolution methods such as electron back-scattered diffraction (EBSD), transmission electron microscopy (TEM) and atom probe tomography (APT) are employed. (orig.)

  8. Registration of PR1146-138 yellow dry bean germplasm line

    Science.gov (United States)

    The yellow bean (Phaseolus vulgaris L.) is an important market class in Haiti. However, there have been no previous attempts to genetically improve this seed type for the Caribbean. Landrace varieties of yellow beans in Haiti are susceptible to Bean golden yellow mosaic virus (BGYMV) and bean common...

  9. Development of the yellow common bean germplasm PR1146-138

    Science.gov (United States)

    The yellow bean (Phaseolus vulgaris L.) is an important market class in Haiti. There have been, however, no previous attempts to genetically improve this seed type for the Caribbean. Landrace varieties of yellow beans in Haiti are susceptible to Bean golden yellow mosaic virus (BGYMV) and bean commo...

  10. Hanford Engineer Works technical progress letter No. 138, February 16--22, [1947

    Energy Technology Data Exchange (ETDEWEB)

    Greninger, A.B.

    1947-02-27

    This technical progress letter contains reports from six Technical Department divisions at the Hanford Engineer Works for February 16 through February 22, 1947. The six reporting divisions are: 100 Areas, 300 Area, 200 Areas, Chemical Development, Laboratories, and Statistical Studies. (JL)

  11. PS1-38: Catalyzing Innovation at the Front Lines of Health Care

    Science.gov (United States)

    Tuzzio, Leah; Schaefer, Judith; McCulloch, David; Greene, Sarah M.; Bennett, Susan; Clark, Adele; Austin, Brian

    2010-01-01

    Background/Aims: To find new ways for Group Health, its research center and its community foundation to work together, we pilot tested the Partnership for Innovation, a grant program to encourage and seed organization wide innovation. Innovation is defined as new ideas or approaches that have the potential to add value and change the way the organization works. The program gives staff funding to develop, implement, and evaluate innovations within the healthcare system. Evaluations assess the effect of the innovations in terms of costs, patient satisfaction, organizational readiness, and other aspects. These results inform decisions about adopting the innovation organization wide. Methods: We disseminated an initial call for proposals to medical center leaders, and developed a two-step selection process in which we first reviewed brief concept proposals for their innovativeness, likely effectiveness, impact, feasibility, congruence with strategic priorities, and overlap with other efforts. We next invited selected applicants to expand their proposals for review by the program’s steering committee. In step three, the Partnership program itself was refined and improved through Plan-Do- Check-Act cycles after each of the two funding rounds in 2008. Results: We received 19 proposals in 2008 (12 in the first round). Funded proposal topics included nasal flu vaccine for children, an online chronic disease self-management program, infectious disease management for long-term care facilities, and enhancing medication safety for patients with complex medication regimens. The first round of four pilots are currently underway and the second round of two funded pilots will begin in 2009. Viable but unfunded proposals were rerouted to other departments to encourage discussion about whether the idea could be developed through other channels. Conclusions: Offering a pilot grant program to frontline staff may enhance engagement, empowerment, and creativity. Evaluating the pilot programs is an essential component of this initiative, both to improve the pilots themselves, and the innovation program as a whole. The partners found the collaboration promising and worth continued funding in 2009.

  12. Ce que nous faisons | Page 138 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet(s): Climate change, WEATHER FORECASTS, FORECASTING TECHNIQUES, ADAPTATION TO CHANGE, SMALLHOLDERS. Région(s): Africa, South of Sahara, Zambia, Zimbabwe. Programme(s): Changements climatiques. Ce projet vise à améliorer les mesures incitatives et les possibilités qui s'offrent aux ...

  13. Ce que nous faisons | Page 138 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Institut pour la connectivité dans les Amériques (ICA) - phase II. Sujet(s): Société De L'information, Technologie De L'information, Réseaux De Télécommunications, Démocratisation. Région(s): Amériques. Le potentiel des technologies de l'information et de la communication à titre d'outils pouvant servir au développement ...

  14. A Critical Assessment of The Minimum Age Convention 138 of 1973 ...

    African Journals Online (AJOL)

    NWUuser

    with 65,1 million, and Latin America and the Caribbean with 14,1 million.10 In terms of relative extent ... 5.6 percent, and 6.7 percent in Latin America are exposed to hazards.13 Between the period of 2004 and 2008 the ...... geography, the multiplicity of ethnic groups, languages and systems of socialisation and education.

  15. 138 Etude de la variabilité agromorphologique de quarante-cinq ...

    African Journals Online (AJOL)

    ITRAD

    Résumé. Le niébé est la seconde légumineuse de rente après l'arachide au Tchad mais les cultivars locaux ne sont pas valorisés et le risque de leur disparition est réel. L'objectif de ce travail, est d'étudier la variabilité agromorphologique de quarante-cinq cultivars et sa structuration sur la base de dix-huit descripteurs. Les.

  16. 9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine).

    Science.gov (United States)

    2010-01-01

    ..., Care, Treatment, and Transportation of Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters... transporting live animals shall be designed and constructed to protect the health, and ensure the safety and...

  17. Onychomycosis in the elderly. A 2-year retrospective study of 138 cases

    Directory of Open Access Journals (Sweden)

    J. Araiza-Santibáñez

    2016-01-01

    Conclusions: Approximately 9 out of 10 nail disorders in the elderly were onychomycosis; many of these patients may present with comorbidities such as hypertension or diabetes mellitus, which often complicate treatment outcomes, affecting quality of life. Elderly patients should receive adequate health education and monitoring. This will improve their quality of life.

  18. 138 Caractérisation physico-chimique et microbiologique du mulet ...

    African Journals Online (AJOL)

    SETNORD

    contamination fécale sont de 0,74 102 et 3,66 ufc/g respectivement pour les coliformes totaux et fécaux. La flore fongique est de 1,70 103 ufc/g. Cependant, aucun germe pathogène n'a été détecté dans les produits analysés. Mots-clés : Imraguen, mulet jaune, Lekhlia, qualité, Mauritanie. Abstract. Physicochemical and ...

  19. 138th International School of Physics "Enrico Fermi" : Unfolding the Matter of Nuclei

    CERN Document Server

    Ricci, R A

    1998-01-01

    The nucleus and its constituents are a challenging problem. The lectures collected in this book present a broad and comprehensive review of the current knowledge about nuclei.They cover topics such as searching for signatures of the quarks in nuclei with electromagnetic probes and, at much higher energies, for signatures of the quark-gluon plasma in ultrarelativistic nuclear collisions. The attempts to obtain new nuclei in the laboratory are also discussed, as well as the central role played by nuclear physics in the development of weak interactions. Progress in all these areas rests on a deeper theoretical handling of the nuclear and nucleon’s structure. The latter can also be addressed by relying on numerical solutions of QCD on a discrete space-time lattice. The advancement of computational capabilities has spurred a growing interest in this approach. Finally, the book deals with different paths toward solving non-perturbative QCD.

  20. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    DEFF Research Database (Denmark)

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie

    2000-01-01

    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all ...

  1. 75 FR 45096 - Foreign-Trade Zone 138 - Columbus, Ohio Area, Application for Reorganization under Alternative...

    Science.gov (United States)

    2010-08-02

    ... context of the Board's standard 2,000-acre activation limit for a general-purpose zone project. The... - includes certain acreage within the Rickenbacker International Airport and Air Industrial Park, Alum Creek...; Site 2 (136 acres) -- Gateway Business Park, McClain Road, Lima, Allen County; Site 3 (42 acres...

  2. 33 CFR 157.138 - Crude Oil Washing Operations and Equipment Manual.

    Science.gov (United States)

    2010-07-01

    ... tank. (6) The design oxygen content of the gas or mixture of gases that is supplied by the inert gas... VESSELS CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Design, Equipment, and... inspection of the COW system during COW operations. (5) Design characteristic information of the COW system...

  3. FCJ-138 This is not a Bit-Pipe: A Political Economy of the Substrate Network

    Directory of Open Access Journals (Sweden)

    Rachel O’Dwyer

    2012-07-01

    Full Text Available Critiquing ‘free culture’ as a utopian gesture that fails to engage with the material circuits of cognitive capitalism, this paper proposes a political economy attendant to the circulation of capital at all layers of the communications network. Applying the newly invigorated theories of ‘rent’ to the shifting commons/property dialectics of the information economy, we explore the role of network infrastructure in the extraction of surplus. How is surplus from the digital commons channelled through a material substrate? How is network infrastructure transforming in response to the fluid and fluctuating dynamics of cognitive capitalism? Finally, what possibilities for political engagement and material exploit are emerging?

  4. 138 the quest to find the true age of the Universe and the Theory of Everything

    CERN Document Server

    Gribbin, John

    2017-01-01

    A celebrated astronomer makes a powerful case for the harmony between two of physics' most important and seemingly contradictory theories The twentieth century gave us two great theories of physics. The general theory of relativity describes the behavior of very large things, and quantum theory the behavior of very small things. In this landmark book, John Gribbin--one of the best-known science writers of the past thirty years--presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified "Theory of Everything" that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe, and everything. With his inimitable mixture of science, history, and biography, Gribbin shows how--despite skepticism among many physicists--these two great theories are very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age o...

  5. Sud du Sahara | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Despite the success of research and development activities in integrating crop and livestock production, few West African communities are adopting these ... areas of sub-Saharan, particularly East Africa, are vulnerable to the long-term consequences of climate change and the short-term increase in climate variability.

  6. Bu11.cnem.s<>¢.sihiop.,3(2).135-138 (19391

    African Journals Online (AJOL)

    Birkhauser Verlag, Basel und Stuttgart, pp. 860 (1976). W. Karrer, E. Ch-erbuliez and C.H. Eugster, "Konstitution und Vorkommen der organischen Pflanzenstoffe, Ergaenzungsband 1", Birkhauser Verlag,. Basel und Stuttgart. pp. 243 (19'?'i'). W. Karrer, E. Cherbuliez and C.H. Eugster, "K0118-titutifiil und Vorkommen.

  7. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    2013-07-12

    Jul 12, 2013 ... (Takara, Dalian, China). The recombinant products were then transformed into E. coli to produce a pool which should contain specific sequences of putative target mRNAs that hcmv-miR-. UL36 can bind to. Fifty-seven clones were randomly selected. Corresponding products inserted into the plasmids were ...

  8. : tous les projets | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région: Bangladesh, Japan. Programme: Employment and Growth. Financement total : CA$ 584,200.00. Évolution des marchés du travail au Bangladesh - interaction entre croissance et inclusion dans un pays à faible revenu. Projet. Le Bangladesh, dont l'économie et la population sont en croissance, a surtout réussi à ...

  9. A Critical Assessment of The Minimum Age Convention 138 of 1973 ...

    African Journals Online (AJOL)

    NWUuser

    school. Social protection instruments can serve to prevent vulnerable households from having to resort to child labour. He alleges36 that the most important thing should be ... school and are most likely not able to read and write. Written ..... children in schools and institutions of learning is, however, critical if children are to.

  10. 75 FR 29722 - Foreign-Trade Zone 138-Columbus, OH Area; Site Renumbering Notice

    Science.gov (United States)

    2010-05-27

    ... purposes. (Note: Sites 7 through 11 have expired and those numbers will not be reused.) Under this revision...; and, Site 19 (1 acre, expires 9/1/2010)--located at 330 Oak Street, Columbus. For further information...

  11. Yeast Interacting Proteins Database: YKL186C, YPL138C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA Rows with this bait...essential nuclear protein; Mex67p and Mtr2p form a mRNA export complex which binds to RNA Rows with this bait

  12. Syndecan-1 (CD138) contributes to prostate cancer progression by stabilizing tumour-initiating cells.

    Science.gov (United States)

    Shimada, Keiji; Anai, Satoshi; Fujii, Tomomi; Tanaka, Nobumichi; Fujimoto, Kiyohide; Konishi, Noboru

    2013-12-01

    Increasing evidence suggests that tumour-initiating cells (TICs) contribute to the development of prostate cancer. Here, we identified syndecan-1 as a key molecule maintaining the stability of prostate cancer TICs. Holoclones harbouring the biological properties of stemness were derived from single-cell cultures of the PC3 human prostate cancer cell line. These holoclones over-expressed syndecan-1, but showed reduced expression of NADPH oxidase (NOX) and synthesis of hydrogen peroxide and oxygen radicals. Stable RNA-mediated silencing of syndecan-1 gene expression up-regulated NOX-dependent generation of reactive oxygen species and reduced the survival of holoclones in vitro. Syndecan-1 down-regulation also strongly reduced the number of CD133(+)/CD44(+) primitive cancer cells and tumour growth in vivo. Interestingly, syndecan-1 gene knockdown significantly enhanced the tumour-suppressive effects of docetaxel by inhibiting the docetaxel-induced increase in CD133(+)/CD44(+) cells in vivo. In the transgenic adenocarcinoma of the mouse prostate (TRAMP) mouse model of prostate cancer, early intervention with a syndecan-1 inhibitor (OGT2115) or syndecan-1 RNAi reduced the incidence of adenocarcinoma and the number of c-kit(+)/CD44(+) cells in cancer foci. Finally, we found that syndecan-1 immunopositivity in prostate cancer cells was significantly associated with biochemical recurrence after radical prostatectomy. Taken together, our results show that syndecan-1 contributes to prostatic carcinogenesis by maintaining TICs and may be a target molecule for therapy. Copyright © 2013 Pathological Society of Great Britain and Ireland. Published by John Wiley & Sons, Ltd.

  13. Die kontekstuele funksie van Hebreërs 13:8 | van Zyl | HTS ...

    African Journals Online (AJOL)

    This article attempts to address this deficiency. It is proposed that verse 8 plays the following role in Chapter 13: It supports the teaching and life of the spiritual leaders, counteracts false teachings, provides stability for the readers' pilgrimage in this life, and serves as the Christological basis of the community's worship.

  14. Die kontekstuele funksie van Hebreërs 13:8

    African Journals Online (AJOL)

    29 Jul 2015 ... daar nie formele aanwysings in vers 8 (of v. 9) is (bv 'n γάρ, οὖν, ὥστε, ens) wat 'n aanduiding gee van hoe hierdie vers met sy konteks skakel nie. Verder pas vers 8 met die eerste oogopslag ook nie inhoudelik by verse 7 en 9 nie. Die leser moet gevolglik sy eie afleidings uit die argument van Hebreërs 13 ...

  15. Significant decrease in yield under future climate conditions: Stability and production of 138 spring barley accessions

    DEFF Research Database (Denmark)

    Ingvordsen, Cathrine Heinz; Backes, Gunter; Lyngkjær, Michael Foged

    2015-01-01

    to a two-factor treat-ment of combined elevated temperature (+5◦C day/night) and [CO2] (700 ppm), as well as single-factortreatments of elevated temperature (+5◦C day/night), [CO2] (700 ppm), and [O3] (100–150 ppb). Thecontrol treatment was equivalent to present average South Scandinavian climate...

  16. Page 1 138 S. V. PUNTAMBEKAR AND R. M. BERI The resinol has ...

    Indian Academy of Sciences (India)

    yº Tetrahydro laccol Diacetyl tetra hydrolacco,. Phenyl isocyanate N | N. A Acetylation Oxidation N. 2^ \\ W Benzoylation. Cat H.1804N2 Cash400s C17Has COOH \\. (III) (II) (VI) Cat Has04. Diphenyl laccol urathene Diacetyl laccol Stearic acid (VIII). N Dibenzyl tetrahydro Iaccol. Oxidation and hydrolysis. OH. OH. (IV). 2COOH.

  17. 32 CFR 536.138 - Claims not payable under the Foreign Claims Act.

    Science.gov (United States)

    2010-07-01

    ... death arising incident to service, or pursuant to combined military operations. Combined military operations include exercises and United Nations and North Atlantic Treaty Association (NATO) peacekeeping and...

  18. 29 CFR 784.138 - Perishable state of the aquatic product as affecting exemption.

    Science.gov (United States)

    2010-07-01

    ... with the performance of exempt operations on the aquatic forms of animal and vegetable life mentioned... 29 Labor 3 2010-07-01 2010-07-01 false Perishable state of the aquatic product as affecting... PROVISIONS OF THE FAIR LABOR STANDARDS ACT APPLICABLE TO FISHING AND OPERATIONS ON AQUATIC PRODUCTS...

  19. pH dependent photophysical studies of new europium and terbium complexes of tripodal ligand: Experimental and semiempirical approach

    Energy Technology Data Exchange (ETDEWEB)

    Akbar, Rifat [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India); Baral, Minati [Department of Chemistry, National Institute of Technology Kurukshetra, Haryana 136119 (India); Kanungo, B K, E-mail: b.kanungo@gmail.com [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India)

    2015-11-15

    The photophysical properties of adduct of a novel nonadentate tripodal ligand, 5,5′-(2-(((8-hydroxyquinolin-5-yl)methylamino)methyl)-2-methylpropane-1, 3-diyl)bis(azanediyl)bis(methylene diquinolin-8-ol, (TAME5OX), with Eu{sup 3+} and Tb{sup 3+} metal ions have been probed for photonics applications. The absorption spectroscopy of these complexes show remarkable spectral changes due to characteristic lanthanide transitions, which support the use of TAME5OX as a sensitive optical pH based sensor to detect Ln{sup 3+} metal ions in biological systems. In addition, these complexes have also been shown to exhibit strong green fluorescence allowing simultaneous sensing within the visible region under physiological pH in competitive medium for both Eu{sup 3+} and Tb{sup 3+} ions. The intense fluorescence from these compounds were revealed to intermittently get quenched under acidic as well as basic conditions due to the photoinduced intramolecular electron transfer from excited 8-hydroxyquinoline (8-HQ) moiety to metal ion, just an opposite process. This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensor. The thermodynamic stability and aqueous coordination chemistry of the chelator with the said lanthanide ions have also been probed by potentiometric, UV–visible and fluorescence spectrophotometric method. TAME5OX has been found to form two protonated complexes [Ln(H{sub 5}L)]{sup 5+} and [Ln(H{sub 4}L)]{sup 4+} below pH 2.5 with both metal ions, which consecutively deprotonates through one proton process with rise of pH. The formation constants (log β{sub 11n}) of neutral complexes have been determined to be 33.51 and 32.16 with pLn (pLn=−log[Ln{sup 3+}]) values of 16.14 and 19.48 for Eu{sup 3+} and Tb{sup 3+} ions, respectively, calculated at pH 7.4, indicating TAME5OX is a good lanthanide synthetic chelator. The emission lifetimes of the Eu{sup 3+} and Tb{sup 3+} complexes recorded in D{sub 2}O and H{sub 2}O suggest the presence of water molecules in the first coordination sphere of the metal ions. NMR titrations were carried out to determine the stoichiometry of chelates. The complexe's coordination geometries were optimized by using PM7 as sparkle/PM7 model. The theoretical electronic behavior was evaluated to support the experimental findings, based on ZINDO/S methodology at configuration interaction with single excitations (CIS) level. These results emphasize the capability of the use of the theoretical models in prediction of geometries and all other calculations of compounds containing lanthanide ions and create new interesting possibilities for the design in-silico of novel and highly efficient lanthanide–organic edifice. - Highlights: • Photophysical behavior of Eu{sup 3+} and Tb{sup 3+} complexes of TAME5OX has been investigated. • This tripodal ligand forms thermodynamically stable Ln{sup 3+} complexes. • These compounds exhibit strong green fluorescence under physiological pH. • Green fluorescence gets quenched under acidic and basic conditions, due to PET process. • This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensors.

  20. Visible photoluminescence in polycrystalline terbium doped aluminum nitride (Tb:AlN) ceramics with high thermal conductivity

    Science.gov (United States)

    Wieg, A. T.; Kodera, Y.; Wang, Z.; Imai, T.; Dames, C.; Garay, J. E.

    2012-09-01

    Thermal management continues to be one of the major challenges in the development of high powered light sources such as solid state lasers. In particular, the relatively low thermal conductivity of standard photoluminescent (PL) materials limits the overall power output and/or duty cycle. We present a method based on current activated pressure assisted densification for the fabrication of high thermal conductivity PL materials: rare earth doped polycrystalline bulk aluminum nitride. Specifically, the ceramics are translucent and are doped with Tb3+, allowing for emission in the visible. Remarkably, the ceramics have a room temperature thermal conductivity of 94 W/(m K) which is almost seven times higher than that of the state of the art host material, Nd-doped yttrium aluminum garnet. These light emitting properties coupled with very high thermal conductivity should enable the development of a wide variety of more powerful light sources.

  1. Preparation of extractive resins for producing terbium-161; Preparacion de resinas extractivas para produccion de terbio-161

    Energy Technology Data Exchange (ETDEWEB)

    De la Cruz B, C. C.; Monroy G, F. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)], e-mail: fabiola.monroy@inin.gob.mx

    2009-10-15

    This paper presents the development of a methodology for extractive resins preparation to base of HDEHP, which allows to separation of Tb from Gd generating an own technology of preparation of these resins. The study included the extractive resins preparation from 6 different supports: kieselguhr Dg, alumina, red volcanic rock, chiluca, quarry and fluorite; two treatment types of of supports and varied concentrations of HDEHP extractant (di(2-etil hexyl) orthophosphoric acid), in order to determine which resin has improved efficiency of Gd and Tb separation, and radionuclide purity of {sup 161}Tb. Resins were prepared to base of kieselguhr to determine the most appropriate silicon deposition process. Two silicon deposition treatments were realized: treatment I , by contact with silicon deposition solution (dimethyldichlorosilane / heptane 1:30) and treatment II by contact with vapors of dimethyldichlorosilane in vacuum. The extractant retention was carried out to different concentrations of HDEHP / acetone: 1:4, 1:8, 1:15, 1:20, 1:30 and 1:40. According to the results, there is not direct relation of HDEHP concentration used in extractive resins preparation to base of kieselguhr over the efficiency of Gd and Tb separation and of radionuclide purity of {sup 161}Tb. The effect of support in the efficiency of Gd and Tb separation was studied to prepare resins with the supports kieselguhr, alumina, quarry, chiluca, volcanic rock and fluorite, using the silicon deposition treatment II for the supports and a concentration of HDEHP / acetone 1:20, for extractant retention. Only resins based on kieselguhr could separate to Gd from Tb quantitatively, the resin at a concentration of HDEHP / Acetone 1:20 was the best results obtained in Gd and Tb separation, achieving a separation efficiency greater than 90% and a radionuclide purity higher than 99%. (Author)

  2. Synthesis and Characterization of Europium(III) and Terbium(III) Complexes: An Advanced Undergraduate Inorganic Chemistry Experiment

    Science.gov (United States)

    Swavey, Shawn

    2010-01-01

    Undergraduate laboratories rarely involve lanthanide coordination chemistry. This is unfortunate in light of the ease with which many of these complexes are made and the interesting and instructive photophysical properties they entail. The forbidden nature of the 4f transitions associated with the lanthanides is overcome by incorporation of…

  3. Sensitized green emission of terbium with dibenzoylmethane and 1, 10 phenanthroline in polyvinyl alcohol and polyvinyl pyrrolidone blends

    Science.gov (United States)

    Kumar, Brijesh; Kaur, Gagandeep; Rai, S. B.

    2017-12-01

    Tb doped polyvinyl alcohol: polyvinyl pyrrolidone blends with dibenzoylmethane (DBM) and 1, 10 Phenanthroline (Phen) have been prepared by solution cast technique. Bond formation amongst the ligands and Tb3 + ions in the doped polymer has been confirmed employing Fourier Transform Infrared (FTIR) techniques. Optical properties of the Tb3 + ions have been investigated using UV-Vis absorption, excitation and fluorescence studies excited by different radiations. Addition of dimethylbenzoate and 1, 10 Phenanthroline to the polymer blend increases the luminescence from Tb3 + ions along with energy transfer from the polymer blend itself. Luminescence decay curve analysis affirms the non-radiative energy transfer from DBM and Phen to Tb3 + ions, which is identified as the reason behind this enhancement. The fluorescence decay time of PVA-PVP host decreases from 6.02 ns to 2.31 ns showing an evidence of energy transfer from the host blend to the complexed Tb ions. Similarly the lifetime of DBM and Phen and both in the blend reduces in the complexed system showing the feasibility of energy transfer from these excited DBM and Phen to Tb3 + and is proposed as the cause of the above observations. These entire phenomena have been explained by the energy level diagram.

  4. A Terbium Metal-Organic Framework for Highly Selective and Sensitive Luminescence Sensing of Hg2+Ions in Aqueous Solution.

    Science.gov (United States)

    Xia, Tifeng; Song, Tao; Zhang, Gege; Cui, Yuanjing; Yang, Yu; Wang, Zhiyu; Qian, Guodong

    2016-12-19

    A series of isomorphic lanthanide metal-organic frameworks (MOFs) Ln(TATAB)⋅(DMF) 4 (H 2 O)(MeOH) 0.5 (LnTATAB, Ln=Eu, Tb, Sm, Dy, Gd; H 3 TATAB=4,4',4''-s-triazine-1,3,5-triyltri-p-aminobenzoic acid) have been solvothermally synthesized and structurally characterized. Among these MOFs, TbTATAB exhibits good water stability and a high fluorescence quantum yield. Because mercury ions (Hg 2+ ) have a high affinity to nitrogen atoms, and the space between multiple nitrogen atoms from triazine and imino groups is suitable for interacting with Hg 2+ ions, TbTATAB shows highly selective and sensitive detection of Hg 2+ in aqueous solution with a detection limit of 4.4 nm. Furthermore, it was successfully applied to detect Hg 2+ ions in natural water samples. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. أثر العلماء في الحياة الرسمية والاجتماعية في عهد الإمارة الأموية (138 هـ-316 هـ (755 م-928م

    Directory of Open Access Journals (Sweden)

    شخوم سعدي

    2010-03-01

    Full Text Available بدأت تظهر أولى الملامح الاستقلالية عن المشرق من الناحية الثقافية والعلمية، بتأسيس الدولة الأموية بالأندلس، ويذهب بعض الباحثين إلى أنّ الروابط التي كانت تربط الأندلس بالخلافة الأموية كانت قد انقطعت قبل ذلك في عهد واليها الصميل بن حاتم (129 هـ-138هـ(746م-755م الذي كان له نفوذ كبير جعله يتحكم في عزل الولاة واختيارهم ولهذا لم يكن لسقوط الدولة الأموية أثر مباشر يذكر على الولاية واستقرار الحكم بها، وتتضح هذه الاستقلالية في الجانب الديني فقد بدأ الأندلسيون يتجهون شيئا فشيئا من الأوزاعية إلى المالكية رغم أنّ المذهب السائد بالمشرق هو الحنفي، وهكذا وبمرور الوقت أصبح المذهب المالكي هو المذهب الرسمي للدولة الأندلسية، فكان فقهاء الجماعة من أتباع الإمام مالك يدرؤون أية محاولة للانحياز عنه، وفي ميدان الأدب والشعر عرف هذا الجانب نشاطا واضحا. حيث بدأت الأندلس تعرف جيلا جديدا من الشعراء أكثر تفرعا للشعر من غيره، وقد تعرض ابن حيان لهؤلاء وامتلأ المقتبس بشعرهم ومواقفهم، وفي الميادين العلمية الأخرى بدأت الأندلس تعرف جيلا جديدا من العلماء أكثر طموحا وبذلا للجهد العلمي وبذلك بدأ يغلب الجانب العلمي والثقافي على الأندلس أكثر من أي فترة سابقة وبدأت تظهر خصائص جديدة للحياة العلمية في هذه الفترة.

  6. SU-E-J-138: On the Ion Beam Range and Dose Verification in Hadron Therapy Using Sound Waves

    Energy Technology Data Exchange (ETDEWEB)

    Fourkal, E [Fox Chase Cancer Center, Philadelphia, PA (United States); Allegheny General Hospital, Pittsburgh, PA (United States); Veltchev, I [Fox Chase Cancer Center, Philadelphia, PA (United States); Gayou, O [Allegheny General Hospital, Pittsburgh, PA (United States); Nahirnyak, V [Bukovinian State Medical University, Chernivtsi (Ukraine)

    2015-06-15

    Purpose: Accurate range verification is of great importance to fully exploit the potential benefits of ion beam therapies. Current research efforts on this topic include the use of PET imaging of induced activity, detection of emerging prompt gamma rays or secondary particles. It has also been suggested recently to detect the ultrasound waves emitted through the ion energy absorption process. The energy absorbed in a medium is dissipated as heat, followed by thermal expansion that leads to generation of acoustic waves. By using an array of ultrasound transducers the precise spatial location of the Bragg peak can be obtained. The shape and intensity of the emitted ultrasound pulse depend on several variables including the absorbed energy and the pulse length. The main objective of this work is to understand how the ultrasound wave amplitude and shape depend on the initial ion energy and intensity. This would help guide future experiments in ionoacoustic imaging. Methods: The absorbed energy density for protons and carbon ions of different energy and field sizes were obtained using Fluka Monte Carlo code. Subsequently, the system of coupled equations for temperature and pressure is solved for different ion pulse intensities and lengths to obtain the pressure wave shape, amplitude and spectral distribution. Results: The proposed calculations show that the excited pressure wave amplitude is proportional to the absorbed energy density and for longer ion pulses inversely proportional to the ion pulse duration. It is also shown that the resulting ionoacoustic pressure distribution depends on both ion pulse duration and time between the pulses. Conclusion: The Bragg peak localization using ionoacoustic signal may eventually lead to the development of an alternative imaging method with sub-millimeter resolution. It may also open a way for in-vivo dose verification from the measured acoustic signal.

  7. SU-F-J-138: An Extension of PCA-Based Respiratory Deformation Modeling Via Multi-Linear Decomposition

    Energy Technology Data Exchange (ETDEWEB)

    Iliopoulos, AS; Sun, X [Duke University, Durham, North Carolina (United States); Pitsianis, N [Aristotle University of Thessaloniki (Greece); Duke University, Durham, North Carolina (United States); Yin, FF; Ren, L

    2016-06-15

    Purpose: To address and lift the limited degree of freedom (DoF) of globally bilinear motion components such as those based on principal components analysis (PCA), for encoding and modeling volumetric deformation motion. Methods: We provide a systematic approach to obtaining a multi-linear decomposition (MLD) and associated motion model from deformation vector field (DVF) data. We had previously introduced MLD for capturing multi-way relationships between DVF variables, without being restricted by the bilinear component format of PCA-based models. PCA-based modeling is commonly used for encoding patient-specific deformation as per planning 4D-CT images, and aiding on-board motion estimation during radiotherapy. However, the bilinear space-time decomposition inherently limits the DoF of such models by the small number of respiratory phases. While this limit is not reached in model studies using analytical or digital phantoms with low-rank motion, it compromises modeling power in the presence of relative motion, asymmetries and hysteresis, etc, which are often observed in patient data. Specifically, a low-DoF model will spuriously couple incoherent motion components, compromising its adaptability to on-board deformation changes. By the multi-linear format of extracted motion components, MLD-based models can encode higher-DoF deformation structure. Results: We conduct mathematical and experimental comparisons between PCA- and MLD-based models. A set of temporally-sampled analytical trajectories provides a synthetic, high-rank DVF; trajectories correspond to respiratory and cardiac motion factors, including different relative frequencies and spatial variations. Additionally, a digital XCAT phantom is used to simulate a lung lesion deforming incoherently with respect to the body, which adheres to a simple respiratory trend. In both cases, coupling of incoherent motion components due to a low model DoF is clearly demonstrated. Conclusion: Multi-linear decomposition can enable decoupling of distinct motion factors in high-rank DVF measurements. This may improve motion model expressiveness and adaptability to on-board deformation, aiding model-based image reconstruction for target verification. NIH Grant No. R01-184173.

  8. Working Paper 138 - Economic Policy and Institutional Factors in the Development of Domestic Bond Markets in the CFA Zone

    OpenAIRE

    Cédric Achille Mbeng Mezui

    2011-01-01

    L'objectif principal de ce papier est de mettre en évidence le rôle de la politique économique et des facteurs institutionnels dans le développement des marchés obligataires en monnaie locale dans les pays de la zone Franc CFA. Nous constatons d’une part que ces pays ne remplissent pas la plupart des préconditions macroéconomiques et microéconomiques, d’autre part que l’état actuel des facteurs institutionnels est un frein au développement de leurs marchés. L’analyse économétrique par la méth...

  9. Complex biallelic IGH rearrangements in IgM-expressing Z-138 cell line : Involvement of downstream immunoglobulin class switch recombination

    NARCIS (Netherlands)

    Guikema, JEJ; Fenton, JAL; de Boer, C; Kleiverda, K; Brink, AATP; Raap, AK; Estrov, Z; Schuuring, E; Kluin, PM

    Chromosomal translocations involving the immunoglobulin (Ig) receptor loci usually disrupt and silence these loci. On the basis of observations in follicular lymphoma (FL) with downstream Ig heavy chain (IGH) class switch recombination (CSR), we hypothesized that downstream CSR-mediated chromosomal

  10. 40 CFR 49.138 - Rule for the registration of air pollution sources and the reporting of emissions.

    Science.gov (United States)

    2010-07-01

    ... residential buildings with four or fewer dwelling units; (4) Air conditioning units used for human comfort...) Ventilating units used for human comfort that do not exhaust air pollutants into the atmosphere from any... heat input capacity of less than 400,000 British thermal units (Btu) per hour; (7) Cooking of food...

  11. 76 FR 19744 - Final Tropic to Hatch 138 kV Transmission Line Project Environmental Impact Statement and...

    Science.gov (United States)

    2011-04-08

    ... School and Institutional Trust Lands Administration; and potentially the National Park Service, Bryce..., potential Bryce Canyon National Park issuance of a special park permit for a right-of-way, and Utah School... approximate three and three-quarter mile path through an area currently designated as Primitive Zone in the...

  12. Influence of reverted austenite on static and dynamic mechanical properties of a PH 13-8 Mo maraging steel

    Energy Technology Data Exchange (ETDEWEB)

    Schnitzer, Ronald, E-mail: ronald.schnitzer@unileoben.ac.at [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zickler, Gerald A. [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Lach, Erhardt [ISL, French-German Research Institute of Saint-Louis, P.O. Box 70034, F-68301 Saint-Louis (France); Clemens, Helmut [Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Zinner, Silvia [Boehler Edelstahl GmbH and Co KG, Mariazeller Strasse 25, A-8605 Kapfenberg (Austria); Lippmann, Thomas [GKSS Research Center Geesthacht, Max-Planck-Strasse 1, D-21502 Geesthacht (Germany); Leitner, Harald [Christian Doppler Laboratory for Early Stages of Precipitation, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria); Department of Physical Metallurgy and Materials Testing, University of Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria)

    2010-03-25

    Maraging steels are martensitic hardenable steels exhibiting an excellent combination of high strength and adequate toughness. Beside the intermetallic precipitates, reverted austenite, formed during aging, is a decisive microstructural constituent. Static tensile tests showed a pronounced influence of its phase fraction on mechanical properties. Reverted austenite also exhibits a distinctive effect on dynamic properties which were investigated on a split-Hopkinson-pressure-bar. However, reverted austenite is not mechanically stable during external loading and transforms back to martensite. This behavior was investigated by in situ X-ray diffraction using synchrotron radiation. Here, a decreasing phase fraction of austenite with increasing strain was observed. Furthermore, a change of the stability of revered austenite with aging time was noticed.

  13. Research and Development of 2-frequency (110/138 GHz FADIS for JT-60SA ECHCD system

    Directory of Open Access Journals (Sweden)

    Idei H.

    2015-01-01

    Full Text Available A FAst DIrectional Switch (FADIS of 2-frequency (2-ƒ gyrotron system for the JT-60SA project is being developed under collaboration between Japan Atomic Energy Agency (JAEA and Kyushu University. At first, the frequency drift and dip in the gyrotron operation were measured to consider which kind of FADIS is preferred for application in the Electron Cyclotron Heating and Current Drive (ECHCD system for the JT- 60SA. Various types of the FADIS have been considered. A square corrugated waveguide diplexer system with double resonant rings was considered as one of the most attractive FADIS systems for stable high-power and long-pulse operations in the 2-ƒ JT-60SA ECHCD system.

  14. InP nanowire array solar cells achieving 13.8% efficiency by exceeding the ray optics limit

    National Research Council Canada - National Science Library

    Wallentin, Jesper; Anttu, Nicklas; Asoli, Damir; Huffman, Maria; Aberg, Ingvar; Magnusson, Martin H; Siefer, Gerald; Fuss-Kailuweit, Peter; Dimroth, Frank; Witzigmann, Bernd; Xu, H Q; Samuelson, Lars; Deppert, Knut; Borgström, Magnus T

    2013-01-01

    .... We fabricated a variety of millimeter-sized arrays of p-type/intrinsic/n-type (p-i-n) doped InP nanowires and found that the nanowire diameter and the length of the top n-segment were critical for cell performance...

  15. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116

    Science.gov (United States)

    2010-09-09

    ....38 endorses the American Society of Mechanical Engineers (ASME) American National Standard Institute... endorses the ASME/ANSI Standard N45.2.5-- 1974, ``Supplementary Quality Assurance Requirements for... ASME/ANSI Standard N45.2--1975, ``Supplementary Quality Assurance Requirements for Installation...

  16. Pierre Bourdieu. Sobre la televisión : Editorial Anagrama, Barcelona, 1997, 138 págs.

    OpenAIRE

    Agüero, Luciana; Ferrandi, María Laura

    1999-01-01

    Este libro consta de dos conferencias televisadas dadas por Pierre Bourdieu en el Collège de France en 1996 y retransmitidas por París Première en el mismo año. En los anexos, aparecen dos artículos que presentan de forma más rigurosa los temas desarrollados en las conferencias. Bourdieu enmarca este trabajo Sobre la Televisión en su teoría social, en la que sustituye la noción hueca de sociedad por las de campo y espacio social que no consiste en una totalidad única integrada sino que, más b...

  17. Danish singles have a twofold risk of acute coronary syndrome: data from a cohort of 138 290 persons

    DEFF Research Database (Denmark)

    Nielsen, Kirsten Melgaard; Færgeman, Ole; Larsen, Mogens Lytken

    2006-01-01

    STUDY OBJECTIVE: Atherosclerosis of the coronary and other arteries is an important health problem in virtually all countries of the world, and thus there is a persisting need for the development of preventive programmes including population risk group identification. The aim of the study......-69 years. Information on population members' individual age, sex, social background, and eventual death was obtained from Danish Population Registers. SETTING: University hospital. PATIENTS: The study prospectively identified 646 victims of ACS from 1 April 2000 to 31 March 2002. MAIN RESULTS: Based......, but they accounted for 34.3% and 62.4% of ACS patients dying within 30 days. CONCLUSIONS: Single living is associated with an increased risk of ACS. Thus, risk groups identified by use of information on their age and family structure may be targets for future more focused and cost effective preventive strategies...

  18. Laboratory analysis of naturally aged silicone rubber polymer insulators from contaminated environments, 138 to 765 kV

    Energy Technology Data Exchange (ETDEWEB)

    Hill, R.J. [Reliable Power Products, Franklin Park, IL (United States)

    1994-12-31

    Silicone rubber housed non-ceramic insulators were studied after field aging in various service environments for periods of from 7 years to more than 10 years. The condition of the aged silicone rubber was compared to that of new material, focusing on the characteristics of hydrophobicity recovery and contaminant encapsulation by low molecular weight polymer. The field aged materials are shown to exhibit hydrophobicity characteristics comparable to those of new, unaged silicone rubber.

  19. Gross karyotypic and phenotypic alterations among different progenies of the Candida glabrata CBS138/ATCC2001 reference strain

    NARCIS (Netherlands)

    Bader, O.; Schwarz, A.; Kraneveld, E.A.; Tangwattanchuleeporn, M.; Schmidt, P.; Jacobsen, M.D.; Gross, U.; de Groot, P.J.W.; Weig, M.

    2012-01-01

    Genomic plasticity is a mechanism for adaptation to environmental cues such as host responses and antifungal drug pressure in many fungi including the human pathogenic yeast Candida glabrata. In this study we evaluated the phenotypic and genotypic stability of the world-wide used C. glabrata

  20. Quantification of bone marrow plasma cell infiltration in multiple myeloma : Usefulness of bone marrow aspirate clot with CD138 immunohistochemistry

    NARCIS (Netherlands)

    Matsue, Kosei; Matsue, Yuya; Kumata, Kaoru; Usui, Yoshiaki; Suehara, Yasuhito; Fukumoto, Kota; Fujisawa, Manabu; Narita, Kentaro; Takeuchi, Masami

    Accurate quantification of plasma cells (PCs) in bone marrow (BM) is critical for diagnosis and assessment of treatment response in patients with multiple myeloma (MM). We compared the % of BM PC quantified by 250 cell differential count on May–Giemsa-stained BM smears, by counting 500 – 2500 cells

  1. Estimating the incidence of the acute coronary syndrome: data from a Danish cohort of 138 290 persons

    DEFF Research Database (Denmark)

    Nielsen, Kirsten Melgaard; Foldspang, Anders; Larsen, Mogens Lytken

    2007-01-01

    BACKGROUND: Estimates of incidence are crucial to the planning of public health measures, but most studies of incidence of, for example, acute myocardial infarction (MI) are troubled by methodological problems such as; (i) selection biases of the patients being included for study, (ii) lack...

  2. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  3. CCDC 954774: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4'-(tetrazol-2-id-5-yl)biphenyl-4-carboxylate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  4. CCDC 959634: Experimental Crystal Structure Determination : octakis(mu~3~-Hydroxo)-undecakis(mu~2~-2-fluorobenzoato)-(N,N-dimethylformamide)-nitrato-hexa-aqua-hexa-terbium

    KAUST Repository

    Guillerm, Vincent

    2014-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  5. CCDC 954773: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4-(tetrazol-2-id-5-yl)benzoate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  6. CCDC 954775: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(2-fluoro-4-(1H-tetrazol-5-yl)benzoate) tetrahydroxide tetradecahydrate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  7. CCDC 1411423: Experimental Crystal Structure Determination : catena-[dimethylammonium hexakis(mu-fumarato)-octakis(mu-hydroxo)-hexa-terbium N,N-dimethylformamide solvate hexahydrate

    KAUST Repository

    Assen, Ayalew H.

    2016-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  8. CCDC 1410946: Experimental Crystal Structure Determination : catena-[dimethylammonium tris(mu-naphthalene-1,4-dicarboxylato)-tetrakis(mu-hydroxo)-triaqua-tri-terbium(iii) unknown solvate

    KAUST Repository

    Xue, Dongxu

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  9. Phthalimides: Supramolecular Interactions in Crystals, Hypersensitive Solution 1H-NMR Dynamics and Energy Transfer to Europium(III and Terbium(III States

    Directory of Open Access Journals (Sweden)

    David J. Williams

    2003-07-01

    Full Text Available Detailed crystal structures and 1H-NMR characteristics of some alkylaminephthalimides, including dendritic polyphthalimides, are reported. These investigations were undertaken in order to obtain a better understanding of the relationship between solid-state supramolecular interactions, their persistence in solution and associated dynamics of magnetically hypersensitive phthalimide aromatic AA'BB'-AA'XX' proton NMR resonances. Some alkylamine phthalimides feature folded molecular geometries, which we attribute to n-π interactions among proximal amine-phthalimide sites; those alkylamine-phthalimides that have no possibility for such interactions feature fully extended phthalimide functionalities. Accordingly, alkylamine phthalimide compounds with folded solid-state geometries feature solvent and temperature dependent hypersensitive AA'BB'-AA'XX' 1H-NMR line profiles, which we attribute to the n-π interactions. Luminescence of Eu3+(5D0 and Tb3+(5D4 states show well defined metal ion environments in their complexes with dendritic phthalimides, as well as relatively weak phthalimide-lanthanide(III interactions.

  10. Analysis of tryptophan at nmoll(-1) level based on the fluorescence enhancement of terbium-gadolinium-tryptophan-sodium dodecyl benzene sulfonate system.

    Science.gov (United States)

    Liu, Shufang; Yang, Jinghe; Wu, Xia; Su, Benyu; Sun, Changxia; Wang, Feng

    2004-10-08

    It is found that Tb(3+) can react with tryptophan (Trp) and sodium dodecyl benzene sulfonate (SDBS), and emits the intrinsic fluoresence of Tb(3+). The fluorescence intensity can be enhanced by La(3+), Gd(3+), Lu(3+), Sc(3+) and Y(3+), among which Gd(3+) has the greatest enhancement. This is a new co-luminescence system. The studies indicate that in the Tb-Gd-Trp-SDBS system, there is both Tb-Trp-SDBS and Gd-Trp-SDBS complexes, and they aggregate together and form a large congeries. The fluorescence enhancement of the Tb-Gd-Trp-SDBS system is considered to originate from intramolecular and intermolecular energy transfers, and the energy-insulating sheath effect of Gd-Trp-SDBS complex. Under the optimum conditions, the enhanced intensity of fluorescence is in proportion to the concentration of Trp in the range from 4x10(-8) to 4x10(-5)moll(-1). The detection limit is 10(-9)moll(-1). The proposed method is one of the most sensitive fluoremetries of Trp.

  11. Preparation, characterization, and properties of PMMA-doped polymer film materials: a study on the effect of terbium ions on luminescence and lifetime enhancement.

    Science.gov (United States)

    Zhang, Hui-Jie; Fan, Rui-Qing; Wang, Xin-Ming; Wang, Ping; Wang, Yu-Lei; Yang, Yu-Lin

    2015-02-14

    Poly(methylmethacrylate) (PMMA) doped with Tb-based imidazole derivative coordination polymer {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) (1) (L = N,N'-bis(acetoxy)biimidazole) was synthesized and its photophysical properties were studied. The L'(L' = N,N'-bis(ethylacetate)biimidazole) ligand was synthesized by an N-alkylation reaction process followed by ester hydrolysis to produce ligand L. Polymer 1 and ligand L' have been characterized by (1)H NMR and IR spectroscopy, elemental analysis, PXRD and X-ray single-crystal diffraction. Coordination polymer 1 is the first observation of a CdCl(2) structure constructed with hydroxy groups and decorated by ligand L in lanthanide N-heterocyclic coordination polymers. In the 2D layered structure of 1, each Tb3 metal center is connected with three Tb1 and three Tb2 metal centers by seven hydroxyl groups in different directions, resulting in a six-membered ring. After doping, not only the luminescence intensity and lifetime enhanced, but also their thermal stability was increased in comparison with 1. When 1 was doped into poly(methylmethacrylate) (1@PMMA), polymer film materials were formed with the PMMA polymer matrix (w/w = 2.5%-12.5%) acting as a co-sensitizer for Tb(3+) ions. The luminescence intensity of the Tb(3+) emission at 544 nm increases when the content of Tb(3+) was 10%. The lifetime of 1@PMMA (914.88 μs) is more than four times longer than that of 1 (196.24 μs). All τ values for the doped polymer systems are higher than coordination polymer 1, indicating that radiative processes are operative in all the doped polymer films. This is because PMMA coupling with the O-H oscillators from {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) can suppress multiphonon relaxation. According to the variable-temperature luminescence (VT-luminescence) investigation, 1@PMMA was confirmed to be a stable green luminescent polymer film material.

  12. Changing Single-Molecule Magnet Properties of a Windmill-Like Distorted Terbium(III) α-Butoxy-Substituted Phthalocyaninato Double-Decker Complex by Protonation/Deprotonation.

    Science.gov (United States)

    Horii, Yoji; Horie, Yusuke; Katoh, Keiichi; Breedlove, Brian K; Yamashita, Masahiro

    2018-01-16

    Synthesis, structures, and magnetic properties of α-butoxy-substituted phthalocyaninato double-decker complexes Tb(α-obPc)2 (1-) (α-obPc: dianion of 1,4,8,11,15,18,22,25-octa(n-butoxy)phthalocyaninato) with protonated (1H), deprotonated (1[HDBU]), and diprotonated forms (1H2+) are discussed. X-ray analysis was used to confirm the position of the proton in 1H, and it was revealed that the protonation induced asymmetric distortion in 1H. In contrast, 1[HDBU] was distorted in a highly symmetric windmill-like fashion. 1H is arranged in a slipped column array in the crystal packing, whereas 1[HDBU] is arranged in a one-dimensional fashion, in which the magnetic easy axes of 1[HDBU] lie along the same line. From direct-current (dc) magnetic measurements, ferromagnetic Tb-Tb interactions occur in both 1H and 1[HDBU], and magnetic hysteresis was observed. However, the area of the magnetic hysteresis in 1[HDBU] is larger than that in 1H, meaning that magnetic relaxation time (τ) is longer in 1[HDBU]. In addition, the results of alternating-current magnetic measurements in a zero dc magnetic field indicate that τ of 1[HDBU] is longer as compared to 1H. In other words, protonation/deprotonation affects not only the molecular structures and crystal packing but also the single-molecule magnet properties.

  13. A Water-Stable Dual-Channel Luminescence Sensor for UO22+Ions Based on an Anionic Terbium(III) Metal-Organic Framework.

    Science.gov (United States)

    Ye, Junwei; Bogale, Raji F; Shi, Yangwei; Chen, Yanzhen; Liu, Xigang; Zhang, Siqi; Yang, Yaoyao; Zhao, Jianzhang; Ning, Guiling

    2017-06-07

    A stable 3D Tb III -based metal-organic framework [Tb(BPDC) 2 ]⋅(CH 3 ) 2 NH 2 (DUT-101) was synthesized, and it is the first efficient dual-channel luminescence sensor for aqueous UO 2 2+ ions. DUT-101 contains an anionic three-dimensional framework and protonated dimethylamine molecules embedded within the channels. The intense green emission of DUT-101 could be highly selectively and sensitively quenched by UO 2 2+ ions even in the presence of other competing metal ions. A possible sensing mechanism was proposed based on both suppression of luminescence resonance energy transfer and enhancement of intermolecular electron transfer. Furthermore, visual green fluorescent test papers based on DUT-101 were fabricated and could be used to discriminate UO 2 2+ ions among various metal ions. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. [?-N,N?-Bis(3-meth?oxy-2-oxidobenzyl?idene)propane-1,3-diamine]trinitratocopper(II)terbium(III) acetone solvate

    OpenAIRE

    Zhang Fang; Liu Fei

    2008-01-01

    In the title complex, [CuTb(C19H20N2O4)(NO3)3]·CH3COCH3, the CuII atom is four-coordinated by two O atoms and two N atoms from the deprotonated Schiff base in a square-planar geometry, while the TbIII atom is ten-coordinated by four O atoms from the deprotonated Schiff base and six O atoms from three bidentate nitrate anions. The compound is isostructural with the previously reported GdIII analogue [Elmali & Elerman (2004). Z. Naturforsch. Teil B, 59, 535–540], which was described ...

  15. Crystal structure of a mixed-ligand terbium(III coordination polymer containing oxalate and formate ligands, having a three-dimensional fcu topology

    Directory of Open Access Journals (Sweden)

    Chainok Kittipong

    2016-01-01

    Full Text Available The title compound, poly[(μ3-formato(μ4-oxalatoterbium(III], [Tb(CHO2(C2O4]n, is a three-dimensional coordination polymer, and is isotypic with the LaIII, CeIII and SmIII analogues. The asymmetric unit contains one TbIII ion, one formate anion (CHO2− and half of an oxalate anion (C2O42−, the latter being completed by application of inversion symmetry. The TbIII ion is nine-coordinated in a distorted tricapped trigonal–prismatic manner by two chelating carboxylate groups from two C2O42− ligands, two carboxylate oxygen atoms from another two C2O42− ligands and three oxygen atoms from three CHO2− ligands, with the Tb—O bond lengths and the O—Tb—O bond angles ranging from 2.4165 (19 to 2.478 (3 Å and 64.53 (6 to 144.49 (4°, respectively. The CHO2− and C2O42− anions adopt μ3-bridging and μ4-chelating-bridging coordination modes, respectively, linking adjacent TbIII ions into a three-dimensional 12-connected fcu topology with point symbol (324.436.56. The title compound exhibits thermal stability up to 623 K, and also displays strong green photoluminescence in the solid state at room temperature.

  16. CCDC 1410822: Experimental Crystal Structure Determination : heptakis(dimethylammonium) dodecakis(mu-hydroxo)-bis(mu-oxo)-nonaaqua-nona-terbium tris(octakis(mu-hydroxo)-triaqua-bis(2-fluorobenzoato)-bis(formato)-hexa-terbium) dodecakis(5-[(4-carboxylatophenyl)methoxy]benzene-1,3-dicarboxylate) unknown solvate

    KAUST Repository

    Alezi, Dalal

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  17. The Biopolitics of Lifestyle: Foucault, Ethics and Healthy Choices : Christopher Mayes, 2016, Routledge (Oxford and New York, 978-1-138-93386-6, 156 pp.).

    Science.gov (United States)

    Cooper, Andrew

    2017-03-01

    Unlike many recent studies on the notion of lifestyle, Christopher Mayes' The Biopolitics of Lifestyle balances theoretical rigour with empirical investigation to problematize the use of lifestyle in public health strategies. Not only does Mayes' book expose the unjustified emphasis on individual autonomy undergirding neoliberal strategies of governance and contemporary ethical theory, it also marks a significant step forward in enhancing our understanding of one of Foucault's most underappreciated concepts, the dispositif. In clearly framing the import of Foucaultian analysis and placing it against the backdrop of the obesity epidemic, Mayes continues his contributions towards a productive space wherein practitioners, social theorists, and ethicists can genuinely and self-reflectively exchange knowledges in order to respond to living issues of ethical import.

  18. Towards Understanding Life Cycle Saving Of Boundedly Rational Agents : A Model With Feasibility Goals - Replaced by CentER Discussion Paper 2010-138

    NARCIS (Netherlands)

    Binswanger, J.

    2008-01-01

    This paper develops a new life cycle model that aims to describe the savings and asset allocation decisions of boundedly rational agents. The paper’s main theoretical contribution is the provision of a simple, tractable and parsimonious framework within which agents make forward looking decisions in

  19. An assessment of the most reliable method to estimate the sagittal alignment of the cervical spine: analysis of a prospective cohort of 138 cases

    NARCIS (Netherlands)

    Donk, R.D.; Fehlings, M.G.; Verhagen, W.I.; Arnts, H.; Groenewoud, H.; Verbeek, A.L.M.; Bartels, R.H.M.A.

    2017-01-01

    OBJECTIVE Although there is increasing recognition of the importance of cervical spinal sagittal balance, there is a lack of consensus as to the optimal method to accurately assess the cervical sagittal alignment. Cervical alignment is important for surgical decision making. Sagittal balance of the

  20. Magnetic Moments of Coulomb Excited $2^{+}_{1}$ States for Radioactive Beams of $^{132,134,136}$Te and $^{138}$Xe Isotopes at REX-ISOLDE

    CERN Multimedia

    Kroell, T; Leske, J

    2002-01-01

    Magnetic moments are an indispensable source of information on the microscopic structure of atomic nuclei. It results from the fundamental difference of the spin $g$ factors of protons and neutrons, in $sign$ and $magnitude$, $\\textit{g}_{s}(\\pi)$ = +5.586 and $g_s(\

  1. The effect of calcium ions on adhesion and competitive exclusion of Lactobacillus ssp. and E. coli O138

    DEFF Research Database (Denmark)

    Larsen, Nadja; Nissen, Peter; Willats, William G.T.

    2007-01-01

    The adhesion abilities of 11 strains of Lactobacillus were determined in vitro using the IPEC-J2 cell line as a model system. Bacteria cultures included the probiotic strains L. rhamnosus GG, L. reuteri ATCC 55730, L. johnsonii NCC 533 and L. reuteri DSM 12246, and new isolates of Lactobacillus ssp....... Adhesion was quantified by scintillation counting of radiolabelled bound bacteria. The highest adhesion of 38%, was determined for L. reuteri DSM 12246 followed by L. plantarum Q47 with an adhesion level of 24%. Other strains showed moderate to low binding of less than 16%. Competitive adhesion experiments...... on IPEC-J2 cells demonstrated that strongly adhesive strains, as L. reuteri DSM 12246 and L. plantarum Q47, significantly reduced the attachment of the less adhesive strains, such as L. rhamnosus GG and L. johnsonii NCC 533, both under condition of co-incubation and in displacement assays, indicating...

  2. National and regional estimates of term and preterm babies born small for gestational age in 138 low-income and middle-income countries in 2010

    DEFF Research Database (Denmark)

    Lee, Anne C C; Katz, Joanne; Blencowe, Hannah

    2013-01-01

    BACKGROUND: National estimates for the numbers of babies born small for gestational age and the comorbidity with preterm birth are unavailable. We aimed to estimate the prevalence of term and preterm babies born small for gestational age (term-SGA and preterm-SGA), and the relation to low birthwe...... to increase survival and reduce disability, stunting, and non-communicable diseases. FUNDING: Bill & Melinda Gates Foundation by a grant to the US Fund for UNICEF to support the activities of the Child Health Epidemiology Reference Group (CHERG)....

  3. Promotion of cone production on field-grown grafts of eastern white pine by gibberellin a4/7 injection. Forest research report No. 138

    Energy Technology Data Exchange (ETDEWEB)

    Ho, R.H.

    1996-11-01

    Because of the periodicity, fecundity, and asynchronsation in white pine pollen- and seed-cone production, methods need to be developed to produce both pollen and seed cones, thereby shortening the breeding cycle in advanced generation breeding. This paper presents a study designed to examine previous research on gibberellin treatments for pollen-cone production. Experiments were conducted on a breeding orchard of eastern white pine in Ontario, using clones of 6- or 11-year-old grafts in each of three treatment periods (May-June, June-August, and August-September 1994). Data were collected the following year when pollen and seed cones had emerged from the bud scales. Results presented include comparison of pollen cone and seed cone production between treated and untreated control grafts, and the differences in production among the three treatment periods.

  4. Level of athlete satisfaction and group cohesion in adult indoor soccer teams. DOI: 10.5007/1980-0037.2011v13n2p138

    Directory of Open Access Journals (Sweden)

    José Roberto Andrade do Nascimento Junior

    2011-03-01

    Full Text Available This descriptive study investigated the levels of athlete satisfaction and group cohesion in adult indoor soccer teams. Fifty-eight male athletes of the Parana indoor soccer. Championship participated in the study. The Athlete Satisfaction Questionnaire and the Group Environment Questionnaire were used for assessment. The Kolmogorov-Smirnov test, Cronbach’s alpha, Spearman’s correlation coefficient, Manova, and the post hoc Scheffe test were used for data analysis (p < 0.05. The results showed that teams with higher levels of athlete satisfaction had higher perception of group cohesion. Teams with low levels of personal satisfaction had lower perception of group cohesion. Comparison of the teams showed differences in three dimensions of satisfaction (training-education, team performance, and strategy and in all dimensions of cohesion. The more satisfied the athletes were with the instruction of the coach, personal treatment and strategies, the more cohesive were the teams for the task. It was concluded that the level of athlete satisfaction plays a key role in the perception of cohesion in sport teams, with a predominance of aspects related to the group-task dimensions over social-group dimensions.

  5. Level of athlete satisfaction and group cohesion in adult indoor soccer teams. DOI: 10.5007/1980-0037.2011v13n2p138

    Directory of Open Access Journals (Sweden)

    José Roberto Andrade do Nascimento Junior

    2011-02-01

    Full Text Available This descriptive study investigated the levels of athlete satisfaction and group cohesion in adult indoor soccer teams. Fifty-eight male athletes of the Parana indoor soccer. Championship participated in the study. The Athlete Satisfaction Questionnaire and the Group Environment Questionnaire were used for assessment. The Kolmogorov-Smirnov test, Cronbach’s alpha, Spearman’s correlation coefficient, Manova, and the post hoc Scheffe test were used for data analysis (p < 0.05. The results showed that teams with higher levels of athlete satisfaction had higher perception of group cohesion. Teams with low levels of personal satisfaction had lower perception of group cohesion. Comparison of the teams showed differences in three dimensions of satisfaction (training-education, team performance, and strategy and in all dimensions of cohesion. The more satisfied the athletes were with the instruction of the coach, personal treatment and strategies, the more cohesive were the teams for the task. It was concluded that the level of athlete satisfaction plays a key role in the perception of cohesion in sport teams, with a predominance of aspects related to the group-task dimensions over social-group dimensions.

  6. SU-E-T-138: Automated Chart Review Module Including Cross-Vendor Data Transfer Verification Developed for IHE-RO Initiative

    Energy Technology Data Exchange (ETDEWEB)

    Brewer, M; Gordon, C [Franciscan St Margaret Health, Hammond, IN (United States); Tien, C [Community Hospital, Munster, IN (United States)

    2015-06-15

    Purpose: To follow the Integrating Healthcare Enterprise - Radiation Oncology (IHE-RO) initiative of proper cross-vendor technology integration, an automated chart checker (ACC) was developed. ACC compares extracted data from an approved patient plan in the Eclipse treatment planning system (TPS) against data existing in the Mosaiq treatment management system (TMS). ACC automatically analyzes these parameters using built-in quality checklists to provide further aid in chart review. Methods: Eclipse TPS data are obtained using Eclipse scripting API (ESAPI) while Mosaiq TMS data are obtained from a radiotherapy-treatment-planning (RTP) file. Using this information, ACC identifies TPS-TMS discrepancies in 18 primary beam parameters including MU, energy, jaw positions, gantry angle, table angle, accessories, and bolus for up to 31 beams. Next, approximately 40 items from traditional quality checklists are evaluated such as prescription consistency, DRR graticule placement, plan approval status, global max dose, and dose tracking coefficients. Parameters were artificially modified to determine if ACC would detect an error in data transfer and to test each component of quality checklists. Results: Using ESAPI scripting and RTP file-processing, ACC was able to properly aggregate data from TPS and TMS for up to 31 beams. Errors were artificially introduced into each plan parameter, and ACC was able to successfully detect all of them within seconds. Next, ACC was able to successfully detect mistakes in the chart by identifying deviations with its quality checklists, within seconds. Conclusion: ACC effectively addresses the potential issue of faulty cross-vendor data transfer, as described by IHE-RO. In addition, ACC was also able to detect deviations from its built-in quality checklists. ACC is already an invaluable tool for efficient and standardized chart review and will continue to improve as its incorporated checklists become more comprehensive.

  7. Isolation and Screening of Thermophilic Bacilli from Compost for Electrotransformation and Fermentation: Characterization of Bacillus smithii ET 138 as a New Biocatalyst

    NARCIS (Netherlands)

    Bosma, E.F.; Weijer, van de A.H.P.; Daas, M.J.A.; Oost, van der J.; Vos, de W.M.; Kranenburg, van R.

    2015-01-01

    Thermophilic bacteria are regarded as attractive production organisms for cost-efficient conversion of renewable resources to green chemicals, but their genetic accessibility is a major bottleneck in developing them into versatile platform organisms. In this study, we aimed to isolate thermophilic,

  8. A multiepitope of XBP1, CD138 and CS1 peptides induces myeloma-specific cytotoxic T lymphocytes in T cells of smoldering myeloma patients.

    Science.gov (United States)

    Bae, J; Prabhala, R; Voskertchian, A; Brown, A; Maguire, C; Richardson, P; Dranoff, G; Anderson, K C; Munshi, N C

    2015-01-01

    We evaluated a cocktail of HLA-A2-specific peptides including heteroclitic XBP1 US184-192 (YISPWILAV), heteroclitic XBP1 SP367-375 (YLFPQLISV), native CD138260-268 (GLVGLIFAV) and native CS1239-247 (SLFVLGLFL), for their ability to elicit multipeptide-specific cytotoxic T lymphocytes (MP-CTLs) using T cells from smoldering multiple myeloma (SMM) patients. Our results demonstrate that MP-CTLs generated from SMM patients' T cells show effective anti-MM responses including CD137 (4-1BB) upregulation, CTL proliferation, interferon-γ production and degranulation (CD107a) in an HLA-A2-restricted and peptide-specific manner. Phenotypically, we observed increased total CD3(+)CD8(+) T cells (>80%) and cellular activation (CD69(+)) within the memory SMM MP-CTL (CD45RO(+)/CD3(+)CD8(+)) subset after repeated multipeptide stimulation. Importantly, SMM patients could be categorized into distinct groups by their level of MP-CTL expansion and antitumor activity. In high responders, the effector memory (CCR7(-)CD45RO(+)/CD3(+)CD8(+)) T-cell subset was enriched, whereas the remaining responders' CTL contained a higher frequency of the terminal effector (CCR7(-)CD45RO(-)/CD3(+)CD8(+)) subset. These results suggest that this multipeptide cocktail has the potential to induce effective and durable memory MP-CTL in SMM patients. Therefore, our findings provide the rationale for clinical evaluation of a therapeutic vaccine to prevent or delay progression of SMM to active disease.

  9. Pituitary Adenylate Cyclase Activating Peptide (1-38 and its analog (Acetyl-[Ala15, Ala20] PACAP 38-polyamide reverse methacholine airway hyperresponsiveness in rats

    Directory of Open Access Journals (Sweden)

    Mounira Tlili

    2015-09-01

    Full Text Available The aim of this study was to investigate both functionally and structurally bronchodilator effects of Pituitary adenylate cyclase activating peptide (PACAP38 and acetyl-[Ala15, Ala20] PACAP38-polyamide, a potent PACAP38 analog, in rats challenged by methacholine (MeCh. Male Wistar rats were divided randomly into five groups. Groups 1 and 2 inhaled respectively aerosols of saline or increasing doses of MeCh (0.5, 1, 2.12, 4.25, 8.5, 17, 34 and 68mg/L. The other groups received terbutaline (Terb (250 µg/rat (10-6 M, PACAP38 (50 µg/rat (0.1 mM or PACAP38 analog (50 µg/rat associated to MeCh from the dose of 4.25 mg/L. Total lung resistances (RL were recorded before and 2 min after MeCh administration by pneumomultitest equipment. MeCh administration induced a significant and a dose-dependent increase (p<0.05 of RL compared to control rats. Terb, PACAP38 and PACAP38 analog reversed significantly the MeCh-induced bronchial constriction, smooth muscle (SM layer thickness and bronchial lumen mucus abundance. PACAP38 analog prevents effectively bronchial smooth muscle layer thickness, mucus hypersecretion and lumen decrease. Therefore, it may constitute a potent therapeutic bronchodilator.

  10. BASIC RESEARCH ON THE SEPARATION OF SCANDIUM YTTRIUM, AND THE RARE EARTHS BY SOLVENT EXTRACTION.

    Science.gov (United States)

    RARE EARTH ELEMENTS, * SOLVENT EXTRACTION ), (*CHELATE COMPOUNDS, RARE EARTH ELEMENTS), PURIFICATION, ATOMIC SPECTROSCOPY, SCANDIUM, YTTRIUM, PRASEODYMIUM, SAMARIUM, EUROPIUM, GADOLINIUM, TERBIUM, FLUORINE COMPOUNDS, KETONES

  11. Diferenciação precoce entre distrofia muscular de duchenne e de becker estudo clínico, laboratorial, eletrofisiológico, histoquímico e imuno-histoquímico de 138 casos: clinical, laboratory, electrophysiologic, histochemical and immunohistochemical study of 138 cases

    Directory of Open Access Journals (Sweden)

    Lineu C. Werneck

    1992-12-01

    Full Text Available Foram estudados por análise estatística 194 parâmetros clínicos, laboratoriais, eletrofisiológicos, histoquímicos e imuno-histoquímicos de 112 casos de distrofia muscular de Duchenne (DMD e de 26 casos de distrofia muscular de Becker (DMB. Houve diferença significante (p < 0,05 entre as duas doenças com respeito a época de início de diversos sintomas, dados do exame neurológico e alterações específicas na biópsia muscular. A biópsia muscular (BM isolada foi diagnóstica em 52,7% dos casos de DMD e em 69,2% dos de DMB. Por imunofluorescência (60 casos a distrofina estava ausente em 87% dos casos de DMD e apresentava falhas focais em todos os casos de DMB. A BM foi concordante com a imunofluorescência para distrofina em 82,6% dos casos de DMD e 71,4% dos de DMB. São feitos comentários a respeito dos dados encontrados e os da literatura, bem como sobre a dificuldade diagnóstica para diferenciação precoce das duas entidades.

  12. A validated spectrofluorimetric method for the determination of citalopram in bulk and pharmaceutical preparations based on the measurement of the silver nanoparticles-enhanced fluorescence of citalopram/terbium complexes.

    Science.gov (United States)

    Khan, Muhammad Naeem; Shah, Jasmin; Jan, Muhammad Rasul; Lee, Sang Hak

    2013-01-01

    A simple, sensitive, and accurate spectrofluorimetric method was developed for the determination of citalopram in bulk and pharmaceutical preparations. The method is based on the enhancement of the weak fluorescence signal (FL) of the Tb (III)-citalopram system in the presence of silver nanoparticles. Fluorescence intensities were measured at 555 nm after excitation at 281 nm. Prepared silver nanoparticles (AgNPs) were characterized by UV-Visible spectra and transmission electron microscopy (TEM). Various factors affecting the formation of citalopram-Tb (III)-AgNPs complexes were studied and optimized. The fluorescence intensity versus concentration plot was linear over the range 0.02-14 μg mL(-1), with an excellent correlation coefficient of 0.9978. The limit of detection (LOD) and limit of quantification (LOQ) were found to be 7.15 × 10(-6) μg mL(-1) and 2.38 × 10(-5) μg mL(-1) respectively. The proposed method was found to have good reproducibility with a relative standard deviation of 3.66% (n = 6). The interference effects of common excipients found in pharmaceutical preparations were studied. The developed method was validated statistically by performing recoveries studies and successfully applied for the assay of citalopram in bulk powder and pharmaceutical preparations. Percent recoveries were found to range from 98.98% to 100.97% for bulk powder and from 96.57% to 101.77% for pharmaceutical preparations.

  13. A "plug-and-play" approach to the preparation of transparent luminescent hybrid materials based on poly(methyl methacrylate), a calix[4]arene cross-linking agent, and terbium ions.

    Science.gov (United States)

    Driscoll, Christopher R; Reid, Brodie L; McIldowie, Matthew J; Muzzioli, Sara; Nealon, Gareth L; Skelton, Brian W; Stagni, Stefano; Brown, David H; Massi, Massimiliano; Ogden, Mark I

    2011-04-07

    A novel methodology to prepare transparent luminescent hybrid materials is reported. Using a calixarene ionophore as a PMMA cross-linker avoids problems, such as phase segregation, and produces a polymer monolith that can be loaded with the metal ion required for luminescence post-synthesis. This approach is versatile and will simplify the production of such materials.

  14. CCDC 954772: Experimental Crystal Structure Determination : catena-(Dimethylammonium tris(mu~4~-3-fluorobiphenyl-4,4'-dicarboxylato)-tetrakis(mu~3~-hydroxo)-triaqua-tri-terbium unknown solvate)

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  15. CCDC 1410820: Experimental Crystal Structure Determination : heptakis(dimethylammonium) heptacosa-terbium dodecakis((1,1'-biphenyl)-3,4',5-tricarboxylate) hexakis(2-fluorobenzoate) hexakis(formate) hexatriacontakis(hydroxide) bis(oxide) unknown solvate hydrate

    KAUST Repository

    Alezi, Dalal

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  16. Terbium doped SnO2 nanoparticles as white emitters and SnO2:5Tb/Fe3O4 magnetic luminescent nanohybrids for hyperthermia application and biocompatibility with HeLa cancer cells.

    Science.gov (United States)

    Singh, Laishram Priyobarta; Singh, Ningthoujam Premananda; Srivastava, Sri Krishna

    2015-04-14

    SnO2:5Tb (SnO2 doped with 5 at% Tb(3+)) nanoparticles were synthesised by a polyol method and their luminescence properties at different annealing temperatures were studied. Characterization of nanomaterials was done by X-ray diffraction (XRD), Fourier transformation infrared spectroscopy (FTIR), transmission electron microscopy (TEM) and vibrating sample magnetometry (VSM). XRD studies indicate that the prepared nanoparticles were of tetragonal structures. Upon Tb(3+) ion incorporation into SnO2, Sn(4+) changes to Sn(2+) and, on annealing again at higher temperature, Sn(2+) changes to Sn(4+). The prepared nanoparticles were spherical in shape. Sn-O vibrations were found from the FTIR studies. In photoluminescence studies, the intensity of the emission peaks of Tb(3+) ions increases with the increase of annealing temperature, and emission spectra lie in the region of white emission in the CIE diagram. CCT calculations show that the SnO2:5Tb emission lies in cold white emission. Quantum yields up to 38% can be obtained for 900 °C annealed samples. SnO2:5Tb nanoparticles were well incorporated into the PVA polymer and such a material incorporated into the polymer can be used for display devices. The SnO2:5Tb/Fe3O4 nanohybrid was prepared and investigated for hyperthermia applications at different concentrations of the nanohybrid. This achieves a hyperthermia temperature (42 °C) under an AC magnetic field. The hybrid nanomaterial SnO2:5Tb/Fe3O4 was found to exhibit biocompatibility with HeLa cells (human cervical cancer cells) at concentrations up to 74% for 100 μg L(-1). Also, this nanohybrid shows green emission and thus it will be helpful in tracing magnetic nanoparticles through optical imaging in vivo and in vitro application.

  17. Filmes delgados luminescentes obtidos a partir de hidroxicarbonatos de ítrio ativados por európio ou térbio Luminescent thin films obtained from ytrium hydroxycarbonates activated by terbium or europium

    Directory of Open Access Journals (Sweden)

    Emy Niyama

    2004-04-01

    Full Text Available These films were obtained by dip coating. Parameters like dislocation velocity; number of deposits, suspension concentration, and number of deposits followed or not by heat treatment between each deposit and calcination temperature were evaluated for establishing the best homogeneity. The obtained films were characterized in terms of their morphology, optical quality and photoluminescence by scanning electron microscopy (SEM, UV-vis absorption spectrophotometry and luminescence spectroscopy, respectively. The morphologic and luminescent characteristics showed dip coating as good laboratory technique for development of thin films for optical applications.

  18. Criteríos generales sobre necesidad, diseño, administración y construcción de la linea de transmisión a 138 kv. Daule peripa - chone

    OpenAIRE

    Ruiz Maldonado, Isabel; Sarmiento Martinez, Pomerio; Salomon F., Leo

    2009-01-01

    Manabí es por muchas razones la tercera provincia en importancia del país, una provincia que ha través de las ultimas décadas experimenta un crecimiento sostenido en su producción, lamentablemente este crecimiento no ha incrementado el déficit de energía que padece durante muchos años y en el sector eléctrico los planes de expansión del CONELEC en el área de la Transmisión no contemplan la tan necesaria unión al Sistema Nacional Interconectado a nivel de 230 Kv. El ultimo proyecto desarrol...

  19. Trends and mortality effects of vitamin A deficiency in children in 138 low-income and middle-income countries between 1991 and 2013: a pooled analysis of population-based surveys.

    Science.gov (United States)

    Stevens, Gretchen A; Bennett, James E; Hennocq, Quentin; Lu, Yuan; De-Regil, Luz Maria; Rogers, Lisa; Danaei, Goodarz; Li, Guangquan; White, Richard A; Flaxman, Seth R; Oehrle, Sean-Patrick; Finucane, Mariel M; Guerrero, Ramiro; Bhutta, Zulfiqar A; Then-Paulino, Amarilis; Fawzi, Wafaie; Black, Robert E; Ezzati, Majid

    2015-09-01

    Vitamin A deficiency is a risk factor for blindness and for mortality from measles and diarrhoea in children aged 6-59 months. We aimed to estimate trends in the prevalence of vitamin A deficiency between 1991 and 2013 and its mortality burden in low-income and middle-income countries. We collated 134 population-representative data sources from 83 countries with measured serum retinol concentration data. We used a Bayesian hierarchical model to estimate the prevalence of vitamin A deficiency, defined as a serum retinol concentration lower than 0·70 μmol/L. We estimated the relative risks (RRs) for the effects of vitamin A deficiency on mortality from measles and diarrhoea by pooling effect sizes from randomised trials of vitamin A supplementation. We used information about prevalences of deficiency, RRs, and number of cause-specific child deaths to estimate deaths attributable to vitamin A deficiency. All analyses included a systematic quantification of uncertainty. In 1991, 39% (95% credible interval 27-52) of children aged 6-59 months in low-income and middle-income countries were vitamin A deficient. In 2013, the prevalence of deficiency was 29% (17-42; posterior probability [PP] of being a true decline=0·81). Vitamin A deficiency significantly declined in east and southeast Asia and Oceania from 42% (19-70) to 6% (1-16; PP>0·99); a decline in Latin America and the Caribbean from 21% (11-33) to 11% (4-23; PP=0·89) also occurred. In 2013, the prevalence of deficiency was highest in sub-Saharan Africa (48%; 25-75) and south Asia (44%; 13-79). 94 500 (54 200-146 800) deaths from diarrhoea and 11 200 (4300-20 500) deaths from measles were attributable to vitamin A deficiency in 2013, which accounted for 1·7% (1·0-2·6) of all deaths in children younger than 5 years in low-income and middle-income countries. More than 95% of these deaths occurred in sub-Saharan Africa and south Asia. Vitamin A deficiency remains prevalent in south Asia and sub-Saharan Africa. Deaths attributable to this deficiency have decreased over time worldwide, and have been almost eliminated in regions other than south Asia and sub-Saharan Africa. This new evidence for both prevalence and absolute burden of vitamin A deficiency should be used to reconsider, and possibly revise, the list of priority countries for high-dose vitamin A supplementation such that a country's priority status takes into account both the prevalence of deficiency and the expected mortality benefits of supplementation. Bill & Melinda Gates Foundation, Grand Challenges Canada, UK Medical Research Council. © 2015 World Health Organization; licensee Elsevier. This is an Open Access article published without any waiver of WHO's privileges and immunities under international law, convention, or agreement. This Article should not be reproduced for use in association with the promotion of commercial products, services, or any legal entity. There should be no suggestion that WHO endorses any specific organisation or products. The use of the WHO logo is not permitted. This notice should be preserved along with the Article's original URL.

  20. SU-E-J-138: An IGRT QA Device for Measuring with Tenths-Millimeter Accuracy KV and MV Isocenter Congruence, Couch Travel and Laser Alignment of Accelerators Used for SRS and SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Brezovich, I; Popple, R; Duan, J; Huang, M; Benhabib, S; Shen, S; Cardan, R; Wu, X [University of Alabama Birmingham, Birmingham, AL (United States)

    2014-06-01

    Purpose: To develop a practical device having sufficient accuracy for daily QA tests of accelerators used for SRS and SBRT. Methods: The UAB (Universal Alignment Ball) consists of a 6.35 mm (1/4 inch) diameter tungsten sphere located concentrically within a 25.4 mm (1 inch) diameter acrylic plastic (PMMA) sphere. The spheres are embedded in polystyrene foam, which, in turn, is surrounded by a cylindrical PMMA shell. The UAB is placed on the couch and aligned with wall lasers according to marks that have known positions in relation to the center of the spheres. Using planar and cone beam images the couch is shifted till the surface of the PMMA sphere matches Eclipse-generated circular contours. Anterior and lateral MV images taken with small MLC openings allow measurement of distance between kV and MV isocenter, laser and MLC alignment. Measurements were taken over a one-month period. Results: Artifacts from the tungsten sphere were confined within the PMMA sphere and did not affect cone beam localization of the sphere boundary, allowing 0.1 mm precise alignment with a computer-generated circle centered at kV isocenter. In tests extending over a one-month period, the distance between kV and MV isocenters along the vertical, longitudinal and lateral directions was 0.125 +/−0.06, 0.19 +/−0.08, and 0.02 +/−0.08 mm, respectively. Laser misalignment along these directions was 0.34 +/- 0.15, 0.74 +/−0.29, and 0.49 +/−0.22 mm. Automated couch shifts moved the spheres to within 0.1 mm of the selected position. The center of a 1cmx1cm MLC-defined field remained within +/−0.2 mm of the tungsten sphere center as the gantry was rotated. Conclusion: The UAB is practical for daily end-to-end QA tests of accelerator alignment. It provides tenths-mm accuracy for measuring agreement of kV and MV isocenters, couch motions, gantry flex and laser alignment.

  1. Monitoring of the incorporation of I-138 by inhalation in facilities of metabolic treatment; Vigilancia de la incorporacion de I{sub 1}31 por inhalacion en las instalaciones de tratamientos de metabolicos

    Energy Technology Data Exchange (ETDEWEB)

    Baquero, R.; Anton, D.; Miguel, D. de

    2013-07-01

    The measure of thyroid activity with a surface contamination meter allows you to rule out or confirm the presence of iodine in the thyroid of the nursing staff. You have these teams in all Nuclear Medicine facilities, which can be used with simplicity immediately. To carry out these measures is necessary to have a background environment in which are carried out low, so as the limit of detection got enable check low levels to determine. (Author)

  2. Reflection for Nursing Life: Principles, Process and Practice McKinnon John Reflection for Nursing Life: Principles, Process and Practice 138pp £5.99 Routledge 9781138757599 1138787590 [Formula: see text].

    Science.gov (United States)

    2016-09-30

    The author of this book has considered the process of reflection from his point of view as a nurse. He guides readers through the development of the skills needed for reflection and presents theoretical frameworks to show how the process is academically supported.

  3. Impact on health-related quality of life of a switch from enfuvirtide to raltegravir among multidrug-resistant HIV-1-infected patients: a randomized open-label trial (EASIER-ANRS 138).

    Science.gov (United States)

    Boulet, Thomas; Pavie, Juliette; Charreau, Isabelle; Braun, Joséphine; Reynes, Jacques; Morlat, Philippe; Piroth, Lionel; Spire, Bruno; Molina, Jean-Michel; Aboulker, Jean-Pierre

    2010-01-01

    among multidrug-resistant HIV-1-infected patients, enfuvirtide has demonstrated sustained efficacy, but long-term use is inconvenient due to twice-daily subcutaneous injections which often induce injection-site reactions. We investigated whether a switch from enfuvirtide to raltegravir, an orally available HIV-integrase inhibitor, may improve health-related quality of life (HRQoL). 170 multidrug-resistant HIV-1-infected patients who were receiving enfuvirtide-based regimens were randomised to the maintenance of enfuvirtide or the switch to raltegravir at day 0. At week 24, all patients received raltegravir up to week 48. HRQoL was assessed at baseline and weeks 24 and 48 using a self-report MOS-HIV questionnaire. HRQoL scores were compared between arms using analysis of covariance (ANCOVA) models. at week 24, least-squares means changes from baseline for the maintenance and the substitution arms were -5.3 and +5.8 (P = .001) for the pain score, -4.7 and +4.8 (P = .02) for the social functioning score, and -1.3 and +2.0 (P = .003) for the physical summary score, respectively. among multidrug-resistant HIV-1-infected patients, a switch from enfuvirtide to raltegravir resulted in statistically significant improvements in multiple HRQoL dimensions over 24 weeks in comparison to the maintenance under enfuvirtide.

  4. Comment on "On a class of exact solutions of the equations of motion of a second grade fluid" by C. Fetecau and J. Zierep (Acta Mech. 150, 135-138, 2001)

    CERN Document Server

    Christov, Ivan C; 10.1007/s00707-010-0300-2

    2010-01-01

    In a 2001 article, Fetecau and Zierep [1] considered Stokes' first problem for a second grade (SG) fluid, unaware that it had already been solved (correctly) by Puri [2] in 1984. These authors used the Fourier sine transform to obtain, what they believed to be, the exact solution of the resulting initial-boundary-value problem (IBVP). Unfortunately, due to their incorrect computation of the distributional derivative of the Heaviside function, an omission of a critical term in the subsidiary equation occurred, an elementary mistake (gracefully explained in [3]) apparently not uncommon in the literature. Therefore, the solution given in [1] is, generally speaking, incorrect.

  5. «Its Maṭla‘ and Ḫarja are Twofold in Function»: Form and Content in Ibn Quzmān’s «Zajal 59» and «138» / "Maṭla‘ y Ḫarja tienen doble función": forma y contenido en los zéjeles «59» and «138» de Ibn Quzmān

    Directory of Open Access Journals (Sweden)

    James T. Monroe

    2011-04-01

    Full Text Available SUMMARY. This article begins (1 by briefly contrasting the goals of those treatises on rhetoric and poetics composed in Greek, Latin and Arabic during the Ancient and Medieval periods, on the one hand, with the goals of modern, post-Romantic literary criticism, on the other, in order to highlight the fact that pre-modern treatises had, as their main purpose, that of teaching students how to write, and of correcting their mistakes when they did so. As such they were largely prescriptive, and cannot be of much use for the purposes of modern literary criticism, which is largely descriptive and interpretative in its approach. Despite this obvious fact, pre-modern methods have often been misapplied, in modern times, to the study of Arabic poetry. (2 The article proceeds to discuss the role and function of the ‘initial refrain’ or maṭla‘ as well as the ‘exit’ or ḫarja in Andalusī-Arabic strophic poetry, pointing out that the function of those two elements is essentially a musical one, and stems from an oral tradition. (3 and 4 Thereafter, the article analyses two zajal poems by the renowned twelfthcentury Andalusī-Arab poet Ibn Quzmān. These two poems exhibit an unusual trait: each one makes use of a single, identical text, that is repeated verbatim at the beginning and end of the poem, both as its maṭla‘ and as its ḫarja. It is suggested that this external thematic parallelism framing the poem encloses an internal patterning based on ring composition, an organizational technique of which the poet may well have been consciously aware. (5 The form this patterning takes, however, points to certain ambiguities and contradictions, inviting the reader to interpret the text by penetrating beyond its surface meaning, in order to arrive at its deeper layers of significance. This technique of «allegorical» interpretation is, in turn, based on methods of Qur’ānic interpretation introduced by the Mu‘tazilī school of Islamic theologians, and which had heavily influenced literary authors long before the time of Ibn Quzmān. (6 Finally, it is concluded that, in this instance, the tension between the surface and hidden meaning of the text is a means of allowing the author to adopt a critical stance toward the society in which he lives. RESUMEN. Este artículo comienza por contrastar brevemente los objetivos de aquellos tratados de poesía y retórica compuestos en griego, latín y árabe durante la Antigüedad y el periodo medieval, por un lado, con los objetivos de la crítica literaria moderna y post-romántica, por otro, para subrayar el hecho de que los tratados premodernos tenían como propósito principal aquel de enseñar a los estudiantes cómo escribir, y corregir sus errores. Como tal, eran mayoritariamente prescriptivos, y no pueden ser de gran utilidad para el propósito de la crítica literaria moderna, que es ampliamente descriptiva e interpretativa en su enfoque. A pesar de este hecho obvio, en la actualidad se han aplicado erróneamente métodos premodernos en el estudio de la poesía árabe. Este artículo prosigue discutiendo el papel y la función del ‘estribillo inicial’ o maṭla‘ así como la ‘salida’ o jarŷa en la poesía estrófica arábigo-andalusí, señalando que la función de estos dos elementos es esencialmente musical, pues surge de la tradición oral. A partir de aquí, el artículo analiza dos zéjeles del ilustre poeta arábigo-andalusí Ibn Quzmān. Estos poemas muestran un rasgo inusual: cada uno se vale de un único e idéntico texto, que se repite textualmente al comienzo y al final del poema, ambos como su maṭla‘ y como su jarŷa. Se sugiere, por tanto, que este paralelismo temático que enmarca el poema encierra un patrón interno basado en la composición circular, una técnica organizativa de la cual el poeta bien podría haber sido consciente. La forma que toma este patrón, no obstante, presenta ciertas ambigüedades y contradicciones, invitando al lector a interpretar el texto introduciéndose más allá de la superficie de su significado, para alcanzar las capas más profundas de su mensaje. Esta técnica de interpretación alegórica está, asimismo, basada en los métodos de interpretación del Alcorán introducidos por la escuela Mu‘tazilī de teólogos islámicos, que había influido a diversos autores mucho antes del tiempo de Ibn Quzmān. Finalmente, se concluye que, en este caso, la tensión entre la superficie y el significado oculto del texto permite al autor adoptar una postura crítica ante la sociedad en la que vive.

  6. Synthesis and characterization of spherical Tb-MCM-41

    Energy Technology Data Exchange (ETDEWEB)

    Pires, Luiza H.O., E-mail: lulenapires@hotmail.co [Universidade Federal do Para, Instituto de Ciencias Exatas e Naturais, Laboratorio de Catalise e Oleoquimica, CP 479, CEP 66075-110, Belem, PA (Brazil); Queiroz, Renan M.; Souza, Ruth P.; Costa, Carlos E.F. da; Zamian, Jose R. [Universidade Federal do Para, Instituto de Ciencias Exatas e Naturais, Laboratorio de Catalise e Oleoquimica, CP 479, CEP 66075-110, Belem, PA (Brazil); Weber, Ingrid T. [Universidade Federal de Pernambuco, Centro de Ciencias Exatas e da Natureza, Av. Prof. Luis Barros Freire, s/n, Cidade Universitaria, 50670-901 Recife, PE (Brazil); Filho, Geraldo N. da Rocha [Universidade Federal do Para, Instituto de Ciencias Exatas e Naturais, Laboratorio de Catalise e Oleoquimica, CP 479, CEP 66075-110, Belem, PA (Brazil)

    2010-02-04

    Spherical MCM-41 was synthesized at room temperature and functionalized by means of direct synthesis method. Evidence for the terbium presence in the silica matrix was obtained by means of EDX. Scanning electron microscopy (SEM) micrographs showed that terbium incorporation did not change significantly MCM-41 morphology. The maintenance of the hexagonal structure was confirmed by X-ray diffraction (XRD) pattern analysis. The cell parameter increase and the surface area decrease, observed by N{sub 2} adsorption-desorption technique, were taken as evidence of terbium introduction inside the MCM-41 framework. By FT-IR spectra it was found that the main features of the silica framework were maintained. The presence of a strong absorption band centered at ca. 220 nm in the diffuse reflectance UV-vis spectra could indicate the presence of tetra-coordinated terbium in the silica network of Tb-MCM-41 samples.

  7. Therapeutic use of radioactive isotopes

    CERN Multimedia

    Caroline Duc

    2013-01-01

    In December, researchers from ISOLDE-CERN, the Paul Scherrer Institute (PSI) and the Institut Laue-Langevin (ILL) published the results of an in vivo study which successfully proved the effectiveness of four terbium isotopes for diagnosing and treating cancerous tumours.   Four terbium isotopes suitable for clinical purposes. “ISOLDE is the only installation capable of supplying terbium isotopes of such purity and intensity in the case of three out of the four types used in this study,” explains Karl Johnson, a physicist at ISOLDE.  “Producing over a thousand different isotopes, our equipment offers the widest choice of isotopes in the world!” Initially intended for fundamental physics research, ISOLDE has diversified its activities over time to invest in various projects in the materials science, biochemistry and nuclear medicine fields. The proof-of-concept study has confirmed that the four terbium isotopes 149Tb, 152Tb, 155Tb produ...

  8. Thermal History Using Microparticle Trap Luminescence

    Science.gov (United States)

    2012-06-01

    and thermoluminescence of terbium-activated silicates and aluminates " . Radiat. Meas. 43, 323-326 (2008). HDTRA1-07-1-0016 University of...of terbium-activated silicates and aluminates " . 15th Solid State Dosimetry Conference, Delft, The Netherlands, July 8-13 (2007). 2 INTRODUCTION...increased to 500°C until combustion occurred (- 7 min). The remaining powder was collected, crushed in a agate mortar, and annealed (typically at 900

  9. ORF Alignment: NC_006908 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TKHAFGIRTS Sbjct: 1 ... LATVVGNIFPVKDLKDGVFSENMLGEGIYIEPLENKFYAPVSGILETVFPTKHAFGIRTS 60 ... Query: 138 ESSKKASTML...TSGKVTLE 155 ... ESSKKASTMLTSGKVTLE Sbjct: 121 ESSKKASTMLTSGKVTLE 138

  10. On the quenching of trivalent terbium luminescence by ligand low lying triplet state energy and the role of the {sup 7}F{sub 5} level: The [Tb(tta){sub 3} (H{sub 2}O){sub 2}] case

    Energy Technology Data Exchange (ETDEWEB)

    Souza, A.S., E-mail: adelmosaturnino@hotmail.com [Departamento de Química Fundamental, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Nunes, L.A. [Instituto de Física de São Carlos, Universidade de São Paulo, 13560-970 São Carlos, SP (Brazil); Felinto, M.C.F.C. [Instituto de Pesquisas Energéticas e Nucleares-IPEN, 05505-800 São Paulo, SP (Brazil); Brito, H.F. [Instituto de Química, Universidade de São Paulo, 05508-900 São Paulo, SP (Brazil); Malta, O.L. [Departamento de Química Fundamental, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil)

    2015-11-15

    In this work we discuss the observed Tb{sup 3+} ion luminescence quenching, due to the relative ligand low lying triplet state energy, in the [Tb(tta){sub 3} (H{sub 2}O){sub 2}] compound at low and room temperature (tta=thenoyltrifluoroacetonate). Theoretical energy transfer rates, for both multipolar and exchange mechanisms, were calculated and discussed on the basis of selection rules and energy mismatch conditions from the [Tb(tta){sub 3} (H{sub 2}O){sub 2}] emission spectra. We have concluded that the exchange mechanism by far dominates, in the present case, and that the long first excited state {sup 7}F{sub 5} lifetime (in the millisecond scale) plays a crucial role in the Tb{sup 3+} luminescence quenching. - Highlights: • The energy exchange between the ligand T{sub 1} and Tb{sup 3+5}D{sub 4} levels occur by the exchange interaction. • The Tb{sup 3+} first excited {sup 7}F{sub 5} level plays a crucial role in this process due to its long lifetime. • At room temperature the energy exchanged between the {sup 5}D{sub 4} level of the Tb{sup 3+} ion and the T{sub 1} of the ligand is lost via the intersystem crossing T{sub 1} → S{sub 0} channel.

  11. Synthesis, structure, and magnetic properties of a new family of tetra-nuclear {Mn2(III)Ln2}(Ln = Dy, Gd, Tb, Ho) clusters with an arch-type topology: single-molecule magnetism behavior in the dysprosium and terbium analogues.

    Science.gov (United States)

    Chandrasekhar, Vadapalli; Bag, Prasenjit; Speldrich, Manfred; van Leusen, Jan; Kögerler, Paul

    2013-05-06

    Sequential reaction of Mn(II) and lanthanide(III) salts with a new multidentate ligand, 2,2'-(2-hydroxy-3-methoxy-5-methylbenzylazanediyl)diethanol (LH3), containing two flexible ethanolic arms, one phenolic oxygen, and a methoxy group afforded heterometallic tetranuclear complexes [Mn2Dy2(LH)4(μ-OAc)2](NO3)2·2CH3OH·3H2O (1), [Mn2Gd2(LH)4(μ-OAc)2](NO3)2·2CH3OH·3H2O (2), [Mn2Tb2(LH)4(μ-OAc)2](NO3)2·2H2O·2CH3OH·Et2O (3), and [Mn2Ho2(LH)4(μ-OAc)2]Cl2·5CH3OH (4). All of these dicationic complexes possess an arch-like structural topology containing a central Mn(III)-Ln-Ln-Mn(III) core. The two central lanthanide ions are connected via two phenolate oxygen atoms. The remaining ligand manifold assists in linking the central lanthanide ions with the peripheral Mn(III) ions. Four doubly deprotonated LH(2-) chelating ligands are involved in stabilizing the tetranuclear assembly. A magnetochemical analysis reveals that single-ion effects dominate the observed susceptibility data for all compounds, with comparably weak Ln···Ln and very weak Ln···Mn(III) couplings. The axial, approximately square-antiprismatic coordination environment of the Ln(3+) ions in 1-4 causes pronounced zero-field splitting for Tb(3+), Dy(3+), and Ho(3+). For 1 and 3, the onset of a slowing down of the magnetic relaxation was observed at temperatures below approximately 5 K (1) and 13 K (3) in frequency-dependent alternating current (AC) susceptibility measurements, yielding effective relaxation energy barriers of ΔE = 16.8 cm(-1) (1) and 33.8 cm(-1) (3).

  12. Reactive Chemical Vapor Deposition Method as New Approach for Obtaining Electroluminescent Thin Film Materials

    Directory of Open Access Journals (Sweden)

    Valentina V. Utochnikova

    2012-01-01

    Full Text Available The new reactive chemical vapor deposition (RCVD method has been proposed for thin film deposition of luminescent nonvolatile lanthanide aromatic carboxylates. This method is based on metathesis reaction between the vapors of volatile lanthanide dipivaloylmethanate (Ln(dpm3 and carboxylic acid (HCarb orH2Carb′ and was successfully used in case of HCarb. Advantages of the method were demonstrated on example of terbium benzoate (Tb(bz3 and o-phenoxybenzoate thin films, and Tb(bz3 thin films were successfully examined in the OLED with the following structure glass/ITO/PEDOT:PSS/TPD/Tb(bz3/Ca/Al. Electroluminescence spectra of Tb(bz3 showed only typical luminescent bands, originated from transitions of the terbium ion. Method peculiarities for deposition of compounds of dibasic acids H2Carb′ are established on example of terbium and europium terephtalates and europium 2,6-naphtalenedicarboxylate.

  13. Interação, interatividade e humor no rádio: estudo de caso sobre o programa Graffite veiculado pela rádio 98 FM de Belo Horizonte http://dx.doi.org/10.15601/1983-7631/rt.v6n11p122-138

    Directory of Open Access Journals (Sweden)

    Luciano Andrade Ribeiro

    2013-11-01

    Full Text Available Os recursos interativos têm proporcionado aos meios de comunicação possibilidades para realizar uma nova forma de programação, a fim de atender as exigências dos receptores que não querem mais somente receber conteúdo, mas também querem participar e sugerir seus próprios conteúdos. Além disso, o uso de recursos humorísticos é cada vez mais frequente nas mídias tradicionais com o objetivo de atrair a atenção do público. Diante dessa realidade, este artigo busca identificar recursos de interação, interatividade e humor utilizados em um programa radiofônico através de um estudo de caso sobre o Programa Graffite, veiculado pela rádio 98 FM de Belo Horizonte.

  14. Risk Profile May Affect Search Process but Not Results. A review of: McKibbon, K. Ann, Douglas B. Fridsma, and Rebecca S. Crowley. “How Primary Care Physicians’ Attitudes Toward Risk and Uncertainty Affect Their Use of Electronic Information Resources.” Journal of the Medical Library Association 95.2 (2007: 138‐46, e49‐50. 10 Nov. 2007 .

    Directory of Open Access Journals (Sweden)

    Gale G. Hannigan

    2007-12-01

    Full Text Available Objective – To compare the use, in terms of process and outcomes, of electronic information resources by primary care physicians with different risk profiles and comfort with uncertainty.Design – Survey, and observation using “think‐aloud” method.Setting – Physicians’ offices.Subjects – Canadian and U.S. primary carephysicians who report seeing patients in clinic settings.Methods – Volunteers were recruited from personal contacts and the list of physicianswho rate current studies for the McMaster Online Rating of Evidence (MORE project. Physicians completed the Pearson scale to measure attitude toward risk and the Gerrity scale to measure comfort with uncertainty, and those who scored at the extremes of each of these two scales were included in the study (n=25, resulting in four groups (risk‐seeking, risk‐avoiding, uncertainty‐stressed, uncertainty unstressed. One researcher observed each of these physicians in their offices for an hour during which they completed questionnaires about their computer skills and familiarity with resources, answered multiple‐choice clinical questions, and indicated level of certainty with regard to those answers (scale of 0 to 100%. Physicians also chose two of the clinical questions to answer using their own resources. The think‐aloud method was employed, and transcripts were coded and analyzed.Main results – The study analysis included two comparisons: risk‐seeking (11 subjects versus risk‐avoiding (11 subjects physicians,and uncertainty‐stressed (11 subjects versus uncertainty‐unstressed (10 subjects physicians. Most physicians were included in both sets of analyses. The researchers found no association of risk attitude and uncertainty stress with computer skills nor with familiarity and use of specific information resources (Internet, MEDLINE, PIER, Clinical Evidence, and UpToDate. No differences were found for the following outcomes: time spent searching, answers correct before searching, answers correct after searching, and certainty of answer if answer is right, certainty of answer if answer is wrong. There was a statistically significant association of participants’ indicating certainty for answers that were correct versus those that were not correct (pConclusion – Based on a small sample, it appears that primary care physicians who are risk‐seeking and/or less stressed by uncertainty have the same (poor search results as their more risk‐averse and stressed‐by‐uncertainty colleagues although their search processes may differ.

  15. الحياة السياسية في الأندلس (95-138هـ/714-755م Political life in Andalusia

    Directory of Open Access Journals (Sweden)

    Dr. FirasSalimHayawi أ.د.فراس سليم حياوي

    2016-10-01

    Full Text Available The Arab history Andalusian is part of the Arab-Muslim history, cherish the Arab nation and the title by other nations, because of its especially in the hearts of her sons niche, because they were a link between East and West, and cultural bridge however, and a dam stopped the advance of AlbrberhTeutons and Normans in the direction of Morocco the main islands in the Mediterranean, has witnessed the history of Muslims in Andalusia years of victory, and years of refraction.

  16. Production of sup 5 sup 5 Co via the sup 5 sup 4 Fe(d, n)-process and excitation functions of sup 5 sup 4 Fe(d, t) sup 5 sup 3 Fe and sup 5 sup 4 Fe(d, alpha) sup 5 sup 2 sup m Mn reactions from threshold up to 13.8 MeV

    CERN Document Server

    Zaman, M R; Qaim, S M

    2003-01-01

    For production of the medically interesting beta; sup + -emitter sup 5 sup 5 Co (T sup 1 sup / sup 2 = 17.6 h) via the sup 5 sup 4 Fe(d, n)-reaction, 91.6% enriched sup 5 sup 4 Fe sub 2 O sub 3 , mixed with Al powder, was pressed to a pellet which could be irradiated with 14 MeV deuterons at 4 mu A in a water-cooled target system. A separation method was developed which led to > 99.9% pure sup 5 sup 5 Co and allowed a recovery of the enriched target material. For a target thickness of E sub d = 12.6 -> 5 MeV, the experimental thick target yield of sup 5 sup 5 Co after chemical separation amounted to about 13 MBq/mu A.h, which is about 60% of the theoretical value. In a 3 h irradiation at 4 mu A, the batch yield of sup 5 sup 5 Co achieved was 160 MBq (4.3 mCi). An 8 h irradiation could lead to a batch yield of about 400 MBq. The sup 5 sup 4 Fe(d, n) reaction leads to the highest purity sup 5 sup 5 Co but it is essential that the isotopic enrichment of the target is not less than 90%. In addition to the product...

  17. Elizabeth Wager. GETTING RESEARCH PUBLISHED – An A to Z of Publication Strategy, Third Edition. Boca Raton, New York, London: CRC Press, Taylor & Francis Group, LLC, 2015. 188 pages; ISBN-13:978-1-78523-138-4 (Paperback - CAT# K28669

    Directory of Open Access Journals (Sweden)

    Doncho Donev

    2016-02-01

    CONCLUSION: The book is intended to help all authors, young and old, novice and experienced, to plan their research and publications effectively and prepare manuscripts for journals and other publications, increasing the likelihood that their work will be published. Providing essential information on publishing strategy and process, the book should be extremely useful to everyone who wants to publish research results.

  18. There is a Significant Relationship Between Computer Attitudes and Library Anxiety Among African American Graduate Students. A review of: Jiao, Qun G., and Anthony J. Onwuegbuzie. “The Impact of Information Technology on Library Anxiety: The Role of Computer Attitudes.” Information Technology & Libraries 23.4 (Dec. 2004: 138 ‐44.

    Directory of Open Access Journals (Sweden)

    Gill Needham

    2007-03-01

    Full Text Available Objective – To investigate whether African American students’ computer attitudes predict levels of library anxiety. Design – A user study in which two instruments were administered to a group of graduate students to measure computer attitudes and library anxiety. Setting – The College of Education at an historically black college and university in the United States of America. Subjects – Ninety ‐four, predominantly female, African American graduate students, ranging in age from 22 ‐62 years old, and enrolled in either a statistics or a measurement course. Methods – Two instruments, the Computer Attitude Scale (CAS and the Library Anxiety Scale (LAS were administered to all the study participants. The Computer Anxiety Scale contains forty Likert ‐type items that assess individuals’ attitudes toward computers and their use. It includes four scales which can be administered separately: 1. Anxiety or fear of computers 2. Confidence in the ability to use computers 3. Liking or enjoying working with computers 4. Computer usefulnessThe LAS contains forty ‐three, 5 ‐point, Likert ‐format items that assess levels of library anxiety experienced by college students. It also has five subscales as follows: 1. Barriers with staff 2. Affective barriers 3. Comfort with the library 4. Knowledge of the library 5. Mechanical barriers Main results – There were twenty correlations between the library anxiety subscale scores and the computer attitude subscale scores. Four of these correlations were statistically significant. Liking or enjoying working with computers was statistically significantly linked to affective barriers, comfort with the library, and knowledge of the library. There was also a statistically significant association between an attitude of computer usefulness and knowledge of the library. Conclusion – These findings suggest that in this group of students there is a medium to strong relationship between computer attitudes and library anxiety.

  19. Spatial resolution in X-ray imaging with scintillating glass optical fiber plates

    Science.gov (United States)

    Pavan, P.; Zanella, G.; Zannoni, R.; Marigo, A.

    1993-04-01

    Some scintillating optical fiber plates, fabricated with terbium glasses are tested for their intrinsic spatial resolution under X-ray irradiation and the result is compared with a typical phosphor screen. The spatial resolution (CTF and MTF) is measured as a function of spatial frequency and the standard deviation of the corresponding Gaussian PSF is derived.

  20. PROCESS FOR THE PREPARATION OF ALLOY NANOPARTICLES COMPRISING A NOBLE AND A NON-NOBLE METAL

    DEFF Research Database (Denmark)

    2017-01-01

    The present invention concerns a chemical process for preparing nanoparticles of an alloy comprising both a noble metal, such as platinum, and a non-noble transition or lanthanide metal, such as yttrium, gadolinium or terbium. The process is carried out by reduction with hydrogen and removal...

  1. Multiplet effects in the electronic structure of heavy rare-earth metals

    NARCIS (Netherlands)

    Lebegue, S.; Svane, A.; Katsnelson, M.I.; Lichtenstein, A.I.; Eriksson, O.

    2006-01-01

    The spectroscopic properties of elemental terbium, dysprosium, holmium, and erbium are investigated using first-principles calculations taking into account intra-atomic correlation effects. In order to describe the strongly localized f electrons together with the conduction bands, we have used the

  2. Performance of 20 Ci 137Cs γ-ray Compton spectrometer for the ...

    Indian Academy of Sciences (India)

    The in-house 137Cs spectrometer is very useful for the measurement of momentum densities of heavy materials. The performance of the machine is assessed using aluminum, terbium and mercury samples and the exper- imental data from comparable apparatus. Keywords. Compton scattering; electron momentum density; ...

  3. Author Details

    African Journals Online (AJOL)

    Pengkiliya, P. Vol 67 (2014) - Articles Interaction of 3-Hydroxypicolinamide with TbIII and its Sensitizing Effect on Terbium Luminescence as a Function of pH and Medium Abstract PDF. ISSN: 0379-4350. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...

  4. Author Details

    African Journals Online (AJOL)

    Devi, TP. Vol 67 (2014) - Articles Interaction of 3-Hydroxypicolinamide with TbIII and its Sensitizing Effect on Terbium Luminescence as a Function of pH and Medium Abstract PDF. ISSN: 0379-4350. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

  5. THz near-field Faraday imaging in hybrid metamaterials

    NARCIS (Netherlands)

    Kumar, N.; Strikwerda, A.C.; Fan, K.; Zhang, X.; Averitt, R.D.; Planken, P.C.M.; Adam, A.J.L.

    2012-01-01

    We report on direct measurements of the magnetic near-field of metamaterial split ring resonators at terahertz frequencies using a magnetic field sensitive material. Specifically, planar split ring resonators are fabricated on a single magneto-optically active terbium gallium garnet crystal.

  6. Synthesis and photoluminescence properties of CaSixOy:Tb3+ phosphors prepared using solution-combustion method

    CSIR Research Space (South Africa)

    Dejene, FB

    2011-07-01

    Full Text Available to Ca3Si2O7 as the terbium concentration increase. Broad band excitations peaking between 280 - 360 nm derived from excited states of Tb3+ ions were observed for all powders grown from various Tb compositions. The green emission peak at 545 nm due...

  7. Scanning Electron Microscope-Cathodoluminescence Analysis of Rare-Earth Elements in Magnets.

    Science.gov (United States)

    Imashuku, Susumu; Wagatsuma, Kazuaki; Kawai, Jun

    2016-02-01

    Scanning electron microscope-cathodoluminescence (SEM-CL) analysis was performed for neodymium-iron-boron (NdFeB) and samarium-cobalt (Sm-Co) magnets to analyze the rare-earth elements present in the magnets. We examined the advantages of SEM-CL analysis over conventional analytical methods such as SEM-energy-dispersive X-ray (EDX) spectroscopy and SEM-wavelength-dispersive X-ray (WDX) spectroscopy for elemental analysis of rare-earth elements in NdFeB magnets. Luminescence spectra of chloride compounds of elements in the magnets were measured by the SEM-CL method. Chloride compounds were obtained by the dropwise addition of hydrochloric acid on the magnets followed by drying in vacuum. Neodymium, praseodymium, terbium, and dysprosium were separately detected in the NdFeB magnets, and samarium was detected in the Sm-Co magnet by the SEM-CL method. In contrast, it was difficult to distinguish terbium and dysprosium in the NdFeB magnet with a dysprosium concentration of 1.05 wt% by conventional SEM-EDX analysis. Terbium with a concentration of 0.02 wt% in an NdFeB magnet was detected by SEM-CL analysis, but not by conventional SEM-WDX analysis. SEM-CL analysis is advantageous over conventional SEM-EDX and SEM-WDX analyses for detecting trace rare-earth elements in NdFeB magnets, particularly dysprosium and terbium.

  8. Performance of 20 Ci 137Cs γ-ray Compton spectrometer for the ...

    Indian Academy of Sciences (India)

    ... than the conventional 241Am Compton spectrometers. The in-house 137Cs spectrometer is very useful for the measurement of momentum densities of heavy materials. The performance of the machine is assessed using aluminum, terbium and mercury samples and the experimental data from comparable apparatus.

  9. Faraday isolator based on TSAG crystal for high power lasers.

    Science.gov (United States)

    Mironov, E A; Palashov, O V

    2014-09-22

    A Faraday isolator based on a new magneto-optical medium, TSAG (terbium scandium aluminum garnet) crystal, has been constructed and investigated experimentally. The device provides an isolation ratio of more than 30 dB at 500 W laser power. It is shown that this medium can be used in Faraday isolators for kilowatt-level laser powers.

  10. 1. Novel Dopants in Silica Based Fibers. 2. Applications of Embedded Optical Fiber Sensors in Reinforced Concrete Buildings and Structures

    Science.gov (United States)

    1990-05-20

    effects in fibers, and nonlinear phenomena in fibers. We also use NMR, ESR and Raman techniques to study incorporation of novel as well as...neodymium, erbium, holmium or terbium. These products can be vacuum dried at elevated temperature. The acac-compound is less expensive since the hfa

  11. Time-gated FRET nanoassemblies for rapid and sensitive intra- and extracellular fluorescence imaging

    NARCIS (Netherlands)

    Afsari, Hamid Samareh; Cardoso Dos Santos, Marcelina; Lindén, Stina; Chen, Ting; Qiu, Xue; van Bergen En Henegouwen, Paul M P|info:eu-repo/dai/nl/071919481; Jennings, Travis L; Susumu, Kimihiro; Medintz, Igor L; Hildebrandt, Niko; Miller, Lawrence W

    Time-gated Förster resonance energy transfer (FRET) using the unique material combination of long-lifetime terbium complexes (Tb) and semiconductor quantum dots (QDs) provides many advantages for highly sensitive and multiplexed biosensing. Although time-gated detection can efficiently suppress

  12. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 39; Issue 7. Issue front cover thumbnail. Volume 39, Issue 7. December 2016, pages 1619-1889. pp 1619-1623. Luminescence properties of terbium-doped Li 3 PO 4 phosphor for radiation dosimetry · C B PALAN N S BAJAJ S K OMANWAR · More Details Abstract ...

  13. Interaction of 3-Hydroxypicolinamide with Tb III and its Sensitizing ...

    African Journals Online (AJOL)

    Interaction of 3-Hydroxypicolinamide with Tb III and its Sensitizing Effect on Terbium Luminescence as a Function of pH and Medium. ... The complex formed exists asML2 species in which HPA behaves as anO,O,N,N-chelating ligand. The solid complex is isolated from aqueous medium and characterized employing ...

  14. Lanthanide Enhanced Luminescence (LEL) with One and Two Photon Excitation of Quantum Dyes(copyright) Lanthanide(III)-Macrocycles

    National Research Council Canada - National Science Library

    Leif, Robert C; Becker, Margie C; Bromm Jr., Al; Chen, Nanguang; Cowan, Ann E; Vallarino, Lidia M; Yang, Sean; Zucker, Robert M

    2004-01-01

    .... Preliminary studies indicate that cells stained with the europium Quantum Dye can be observed both by conventional UV laser excitation and by infrared two-photon confocal microscopy. An enhancer has been found that enables the observation of simultaneous emissions from both the europium and terbium Quantum Dyes.

  15. Kinetically inert lanthanide complexes as reporter groups for binding of potassium by 18-crown-6

    DEFF Research Database (Denmark)

    Junker, Anne Kathrine Ravnsborg; Tropiano, Manuel; Faulkner, Stephen

    2016-01-01

    in a copper(I)-catalyzed alkyne-azide cycloaddition (CuAAC) “click” reaction with azide-functionalized crown ethers. The resulting complexes were investigated using NMR and optical methods. Titrations with potassium chloride in methanol observing the sensititzed europium- and terbium-centered emissions were...

  16. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VLAREVARRMDERLDYIRIEPKRILDLGCGTGADFGGLGRRYPKAMRI 60 ... Query: 138 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFID...MHDLGDALVA 197 ... ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA Sbjct: 121 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA 180 ...

  17. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TATAPQSFGFYSKGCFAGGVAIPMDGPTWQVMRPSRNRRWGHPAMIALIEKLSRDADAD 138 ... PTATAP...QSFGFYSKGCFAGGVAIPMDGPTWQVMRPSRNRRWGHPAMIALIEKLSRDADAD Sbjct: 1 ... PTATAPQSFGFYSKGCFAGGVAIPMDGPTWQVMRPSRNRRWGHPAM

  18. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 138 ... Query: 4 ... IATFDTSRGPIVVELYPEKAPLTVANFVNLARRGFYNGLSFHRVIA...DFMIQXXXXXXXXX 63 ... IATFDTSRGPIVVELYPEKAPLTVANFVNLARRGFYNGLSFHRVIADFMIQ ... Sbjct: 1 ... IATFDTS

  19. Luminescent properties of Al{sub 2}O{sub 3}: Tb powders; Propiedades luminiscentes de polvos de Al{sub 2}O{sub 3}: Tb

    Energy Technology Data Exchange (ETDEWEB)

    Esparza G, A.E.; Garcia, M.; Falcony, C.; Azorin N, J. [CICATA-IPN, Legaria 694, Col. Irrigacion, 11500 Mexico D.F. (Mexico)

    2000-07-01

    In this work the photo luminescent and cathode luminescent characteristics of aluminium oxide (Al{sub 2}O{sub 3}) powders impurified with terbium (Tb) were studied for their use in dosimetry. The optical, structural, morphological characteristics of the powders as function of variation in the impurity concentration and the annealing temperature will be presented. As regards the optical properties of powders (photoluminescence and cathode luminescence) it was observed a characteristic emission associated with radiative transitions between electron energy levels of terbium, the spectra associated with this emission consists of several peaks associated with such transitions. In the structural and morphological characterization (X-ray diffraction and scanning electron microscopy) it was appreciated that in accordance the annealing temperature of powders is augmented it is evident the apparition of certain crystalline phases. The results show that this is a promissory material for radiation dosimetry. (Author)

  20. Plastic optical fibre sensor for in-vivo radiation monitoring during brachytherapy

    Science.gov (United States)

    Woulfe, P.; Sullivan, F. J.; Lewis, E.; O'Keeffe, S.

    2015-09-01

    An optical fibre sensor is presented for applications in real-time in-vivo monitoring of the radiation dose a cancer patient receives during seed implantation in Brachytherapy. The sensor is based on radioluminescence whereby radiation sensitive scintillation material is embedded in the core of a 1mm plastic optical fibre. Three scintillation materials are investigated: thallium-doped caesium iodide (CsI:Tl), terbium-doped gadolinium oxysulphide (Gd2O2S:Tb) and europium-doped lanthanum oxysulphide (La2O2S:Eu). Terbium-doped gadolinium oxysulphide was identified as being the most suitable scintillator and further testing demonstrates its measureable response to different activities of Iodine-125, the radio-active source commonly used in Brachytherapy for treating prostate cancer.

  1. [Luminescent cytochemical methods of detecting microorganisms].

    Science.gov (United States)

    Ivanovskaia, N P; Osin, N S; Khramov, E N; Zlobin, V N

    1999-01-01

    The paper shows that the luminescence cytochemical technique can be used for identification of microorganisms and microbiological synthesis products. The method is based on the interaction of specific fluorescence probes (ANS, terbium ions, and beta-diketonate complexes of europium, as well as metal-containing porphyrines) with major microbial intracellular components and toxins. Unlike classical microbiological, immunochemical or biochemical methods of detection, the proposed method has a reasonable versatility, specificity, sensitivity, rapid action, and possible automation.

  2. Radiotherapy dosimetry based on plastic optical fibre sensors

    Science.gov (United States)

    O'Keeffe, S.; Grattan, M.; Hounsell, A.; McCarthy, D.; Woulfe, P.; Cronin, J.; Lewis, E.

    2013-05-01

    The use of a PMMA based plastic optical fibre in radiotherapy dosimetry is presented. The optical fibre tip is coated with a scintillation material, terbium-doped gadolinium oxysulfide (Gd2O2S:Tb), which fluoresces under ionising radiation. The emitted signal penetrates the fibre and propagates along the fibre where it is remotely monitored using a fluorescence spectrometer. The results demonstrate good repeatability, with a maximum percentage error of 0.59% and the response is independent of dose rate.

  3. Luminescent Lanthanide Metal Organic Frameworks for cis-Selective Isoprene Polymerization Catalysis

    OpenAIRE

    Samantha Russell; Thierry Loiseau; Christophe Volkringer; Marc Visseaux

    2015-01-01

    In this study, we are combining two areas of chemistry; solid-state coordination polymers (or Metal-Organic Framework—MOF) and polymerization catalysis. MOF compounds combining two sets of different lanthanide elements (Nd3+, Eu3+/Tb3+) were used for that purpose: the use of neodymium was required due to its well-known catalytic properties in dienes polymerization. A second lanthanide, europium or terbium, was included in the MOF structure with the aim to provide luminescent properties. Sev...

  4. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  5. Factors Affecting the Efficiency of Excited-States Interactions of Complexes between Some Visible Light-Emitting Lanthanide Ions and Cyclophanes Containing Spirobiindanol Phosphonates

    Directory of Open Access Journals (Sweden)

    M. S. Attia

    2007-01-01

    Full Text Available The efficiency of excited-states interactions between lanthanide ions Tb3+ and Eu3+ and some new cyclophanes (I, II, and III has been studied in different media. High luminescence quantum yield values for terbium and europium complexes in DMSO and PMMA were obtained. The photophysical properties of the green and red emissive Tb3+ and Eu3+ complexes have been elucidated, respectively.

  6. The effect of core and lanthanide ion dopants in sodium fluoride-based nanocrystals on phagocytic activity of human blood leukocytes

    Science.gov (United States)

    Sojka, Bartlomiej; Liskova, Aurelia; Kuricova, Miroslava; Banski, Mateusz; Misiewicz, Jan; Dusinska, Maria; Horvathova, Mira; Ilavska, Silvia; Szabova, Michaela; Rollerova, Eva; Podhorodecki, Artur; Tulinska, Jana

    2017-02-01

    Sodium fluoride-based β-NaLnF4 nanoparticles (NPs) doped with lanthanide ions are promising materials for application as luminescent markers in bio-imaging. In this work, the effect of NPs doped with yttrium (Y), gadolinium (Gd), europium (Eu), thulium (Tm), ytterbium (Yb) and terbium (Tb) ions on phagocytic activity of monocytes and granulocytes and the respiratory burst was examined. The surface functionalization of leukocytes and respiratory burst of cells was observed for limited number of samples.

  7. The effect of metal distribution on the luminescence properties of mixed-lanthanide metal-organic frameworks.

    Science.gov (United States)

    Cadman, Laura K; Mahon, Mary F; Burrows, Andrew D

    2018-02-13

    A series of lanthanide metal-organic frameworks (MOFs) of the general formula [Ln(Hodip)(H 2 O)]·nH 2 O (Sm, 1; Eu, 2; Gd, 3; Tb, 4; Dy, 5; Er, 6; H 4 odip = 5,5'-oxydiisophthalic acid) have been prepared and shown crystallographically to have isostructural three-dimensional frameworks. The fluorescence emission spectra of the europium compound 2, which is red, and the terbium compound 4, which is green, show characteristic peaks for transitions involving the metal centres, whereas that for the gadolinium compound 3 is dominated by transitions involving Hodip. Using a 1 : 1 : 1 mixture of europium, gadolinium and terbium nitrates in the synthesis resulted in the mixed-metal MOF [Gd 0.17 Tb 0.19 Eu 0.64 (Hodip)(H 2 O)]·nH 2 O 7, for which the ratio of the metal ions was determined using EDX spectroscopy. The fluorescence emission spectrum of 7 is dominated by europium emission bands reflecting the higher proportion of Eu 3+ centres and quenching of the terbium fluorescence by metal-to-metal energy transfer. A series of core-shell MOF materials based on the Ln(Hodip)(H 2 O) framework have been prepared in order to isolate the lanthanides in different domains within the crystals. The emission spectra for materials with Gd@Tb@Eu (8) and Tb@Eu@Gd (9) are dominated by terbium emissions, suggesting that physical separation from europium suppresses quenching. In contrast, the material with Eu@Gd@Tb (10) shows only broad ligand bands and europium emissions. This confirms that core-shell MOFs have different fluorescence properties to simple mixed-metal MOFs, demonstrating that the spatial distribution of the metals within a mixed-lanthanide MOF affects the fluorescence behaviour.

  8. Synthesis and stimulated luminescence property of Zn(BO2)2:Tb(3).

    Science.gov (United States)

    Del Rosario, G Cedillo; Cruz-Zaragoza, E; Hipólito, M García; Marcazzó, J; Hernández A, J M; Murrieta S, H

    2017-09-01

    Zinc borate, Zn(BO2)2, doped with different concentrations of terbium (0.5-8mol%) was synthesized and polycrystalline samples were characterized by Scanning Electron Microscopy and X-Ray Diffraction. The Zn(BO2)2 was formed in the pure samples sintered at 750 and 800°C which has the body centered cubic structure, and a ZnB4O7 primitive orthorhombic phase was present. The thermoluminescent intensity was dependents on the thermal treatment (250-500°C) and also on the impurity concentration. The linear dose-response was obtained between 0.022-27.7Gy and 0.5-50Gy when the samples were exposed to beta and gamma radiation, respectively. The complex structure of the glow curves was analyzed by the Computerized Glow Curve Deconvolution method. The kinetics parameters were calculated assuming the general order kinetics model describing accurately the TL process. The glow curves of Tb(3+)-doped zinc borate phosphor were well deconvolved by six glow peaks. Zinc borate with 8mol% of impurity concentration exhibited an intense radioluminescent emission. The radioluminescent spectra show their maximum bands at 370, 490, 545 and 700nm related to the terbium ion in the zinc borate. These obtained results suggest that the terbium doped zinc borate is a promising phosphor for use in radiation dosimetry because of its high TL sensitivity to the ionizing radiation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Effect of Ising-type Tb3+ ions on the low-temperature magnetism of La, Ca cobaltite.

    Science.gov (United States)

    Knížek, K; Jirák, Z; Hejtmánek, J; Veverka, M; Kaman, O; Maryško, M; Santavá, E; André, G

    2014-03-19

    Crystal and magnetic structures of the x = 0.2 member of the La0.8-xTbxCa0.2CoO3 perovskite series have been determined from powder neutron diffraction. Enhancement of the diffraction peaks due to ferromagnetic or cluster glass ordering is observed below TC = 55 K. The moments first evolve on Co sites, and ordering of Ising-type Tb(3+) moments is induced at lower temperatures by a molecular field due to Co ions. The final magnetic configuration is collinear Fx for the cobalt subsystem, while it is canted FxCy for terbium ions. The rare-earth moments align along local Ising axes within the ab-plane of the orthorhombic Pbnm structure. The behavior in external fields up to 70-90 kOe has been probed by magnetization and heat capacity measurements. The dilute terbium ions contribute to significant coercivity and remanence that both steeply increase with decreasing temperature. A remarkable manifestation of the Tb(3+) Ising character is the observation of a low-temperature region with an anomalously large linear term of heat capacity and its field dependence. Similar behaviors are detected also for other terbium dopings x = 0.1 and 0.3.

  10. Luminescence enhancement by energy transfer in melamine-Y{sub 2}O{sub 3}:Tb{sup 3+} nanohybrids

    Energy Technology Data Exchange (ETDEWEB)

    Stagi, Luigi, E-mail: luigi.stagi@dsf.unica.it; Chiriu, Daniele; Carbonaro, Carlo M.; Ricci, Pier Carlo [Dipartimento di Fisica, Università degli Studi di Cagliari, S.P. Monserrato-Sestu Km 0,700, 09042 Monserrato (Italy); Ardu, Andrea; Cannas, Carla [Departimento di Scienze Chimiche e Geologiche and INSTM, Università d Cagliari, SS 554 bivio Sestu, I-09042 Monserrato (Italy)

    2015-09-28

    The phenomenon of luminescence enhancement was studied in melamine-Y{sub 2}O{sub 3}:Tb hybrids. Terbium doped Y{sub 2}O{sub 3} mesoporous nanowires were synthesized by hydrothermal method. X-ray diffraction patterns and Raman scattering spectra testified the realization of a cubic crystal phase. Organic-inorganic melamine-Y{sub 2}O{sub 3}:Tb{sup 3+} hybrid system was successfully obtained by vapour deposition method. Vibration Raman active modes of the organic counterpart were investigated in order to verify the achievement of hybrid system. Photoluminescence excitation and photoluminescence spectra, preformed in the region between 250 and 350 nm, suggest a strong interaction among melamine and Terbium ions. In particular, a remarkable improvement of {sup 5}D{sub 4}→ F{sub J} Rare Earth emission (at about 542 nm) of about 10{sup 2} fold was observed and attributed to an efficient organic-Tb energy transfer. The energy transfer mechanism was studied by the use of time resolved photoluminescence measurements. The melamine lifetime undergoes to a significant decrease when adsorbed to oxide surfaces and it was connected to a sensitization mechanism. The detailed analysis of time decay profile of Terbium radiative recombination shows a variation of double exponential law toward a single exponential one. Its correlation with surface defects and non-radiative recombination was thus discussed.

  11. THE ZOOCARTOGRAPHIC APPROACH TO ANURAN ECOLOGY In ...

    African Journals Online (AJOL)

    Matandellas. 12,8. Zebedela. 12,7. MarandeUas. 12,8 (10,1). Twinthorns. 13,0. 13,8. ,Salisbury. 13,8. Sinoia. 13,8. Salisbury. \\3,8. Salisbury. 13,7. Sinoia. \\3,7. Sinola. 13,7. Sinoia. 13,8. Salisbury. \\3,8. Salisbury. \\3,8. Salisbury. 13,4. Fort Victoria. 13,8. Salisbury. 13,8. Salisbury. 13,7. Sinoia. 13,9. Louis Trichardt. Between.

  12. Gclust Server: 183670 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available HSA_4885635 Cluster Sequences - 138 NP_005416.1 transition protein 2 (during histone to protamine replacement)...length 138 Representative annotation NP_005416.1 transition protein 2 (during histone to protamine replacement)

  13. Gene : CBRC-PHAM-01-1762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available n-dz1 protein [Volvox carteri f. nagariensis] 1e-138 85% MYKAILHSSRCSLRTLTSTAVPHLPSPVSTEPPPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPQPPPTPPPPPPPP...QPPPPPPPPPPPPPSPPPTPSPPPPSPPTPPPPPPPPPPPPPPPPPPPPPPTPPPPPPPPPTPPPPPPPPPPPPPPPPPPPPPQPPPTPPPPPSPPPPPPPPPPPPPP...PPPPTPPPTPPPPPPPPTPPLPPPPPLQPPPTPPPPPPPPSPPPPPPPPPPPQAAPMSWLS ...

  14. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SVERGPLEVTIGTGMVIPGFDRALLDMEPGQKKTVNIP Sbjct: 1 ... KKGDKVLVHYTGTYDDGTVFDSSVERGPLEVTIGTGMVIPGFDRALLDMEPGQKKTVNIP 60 ... Query: 125 HPMA...GLDLNFELELVEIL 142 ... HPMAGLDLNFELELVEIL Sbjct: 121 HPMAGLDLNFELELVEIL 138

  15. Gclust Server: 252 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available transferase/ transferase, transferring glycosyl groups 138 1.00e-90 57.14 0.0 4.0 0.0 0.0 0.0 Show 252...transferase/ transferase, transferring glycosyl groups Number of Sequences 138 Homologs 138 Clustering

  16. AcEST: DK951191 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nhydrase (Fragment) OS=Gossypiu... 138 2e-31 tr|Q43231|Q43231_UROPA Carbonic anhydrase 1 OS=Urochloa panicoi...d... 138 2e-31 tr|Q43230|Q43230_UROPA Carbonic anhydrase 2 OS=Urochloa panicoid... 138 2e-31 tr|B6TLF0|B6TLF

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC138 (Link to dictyBase) - - - Contig-U15456-1 VFC138P (Link... to Original site) VFC138F 411 VFC138Z 440 VFC138P 851 - - Show VFC138 Library VF (Link to library) Clone ID VFC138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...ducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D.... 815 0.0 4 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathepsin D, exons 1 to 2. 815 0.0 5

  18. LLE Review 120 (July-September 2009)

    Energy Technology Data Exchange (ETDEWEB)

    Edgell, D.H., editor

    2001-02-19

    This issue has the following articles: (1) The Omega Laser Facility Users Group Workshop; (2) The Effect of Condensates and Inner Coatings on the Performance of Vacuum Hohlraum Targets; (3) Zirconia-Coated-Carbonyl-Iron-Particle-Based Magnetorheological Fluid for Polishing Optical Glasses and Ceramics; (4) All-Fiber Optical Magnetic Field Sensor Based on Faraday Rotation in Highly Terbium Doped Fiber; (5) Femtosecond Optical Pump-Probe Characterization of High-Pressure-Grown Al{sub 0.86}Ga{sub 0.14}N Single Crystals; (6) LLE's Summer High School Research Program; (7) Laser Facility Report; and (8) National Laser Users Facility and External Users Programs.

  19. Luminescent trimethoprim-polyaminocarboxylate lanthanide complex conjugates for selective protein labeling and time-resolved bioassays

    Science.gov (United States)

    Reddy, D. Rajasekhar; Pedró Rosa, Laura E.; Miller, Lawrence W.

    2011-01-01

    Labeling proteins with long-lifetime emitting lanthanide (III) chelate reporters enables sensitive, time-resolved luminescence bioaffinity assays. Heterodimers of trimethoprim (TMP) covalently linked to various cs124-sensitized, polyaminocarboxylate chelates stably retain lanthanide ions and exhibit quantum yields of europium emission up to 20% in water. A time-resolved, luminescence resonance energy transfer (LRET) assay showed that TMP-polyaminocarboxylates bind to Escherichia coli dihydrofolate reductase (eDHFR) fusion proteins with nanomolar affinity in purified solutions and in bacterial lysates. The ability to selectively impart terbium or europium luminescence to fusion proteins in complex physiological mixtures bypasses the need for specific antibodies and simplifies sample preparation. PMID:21619068

  20. Micro-meter size organogelator with tri-color luminescence (blue, green and red) activated by Dy3+, Tb3+ and Eu3+ ions.

    Science.gov (United States)

    Wang, QianMing

    2009-09-01

    The preparation of a novel type of low-molecular-weight amphiphilic organogelator bearing three long 14-alkyl chains and hydrophilic oligo(oxyethylene) groups was described. Ultra-violet absorption and fluorescence spectra give evidence of the energy transfer between organic ligands to lanthanide ions. Characteristic green, blue and red luminescence of the organogels were obtained and interesting emission properties of terbium, dysprosium and europium ions were unexpectedly observed at the first time during the order-disorder phase transition point (29 degrees C).

  1. Giant onsite electronic entropy enhances the performance of ceria for water splitting

    DEFF Research Database (Denmark)

    Naghavi, S. Shahab; Emery, Antoine A.; Hansen, Heine Anton

    2017-01-01

    lanthanides, and reaches a maximum value of ≈4.7 kB per oxygen vacancy for Ce4+/Ce3+ reduction. This unique and large positive entropy source in ceria explains its excellent performance for high-temperature catalytic redox reactions such as water splitting. Our calculations also show that terbium dioxide has......Previous studies have shown that a large solid-state entropy of reduction increases the thermodynamic efficiency of metal oxides, such as ceria, for two-step thermochemical water splitting cycles. In this context, the configurational entropy arising from oxygen off-stoichiometry in the oxide, has...

  2. Surface-Modified Gold Nanoparticles Possessing Two-Channel Responsive Eu(III) /Tb(III) Cyclen Complexes as Luminescent Logic Gate Mimics.

    Science.gov (United States)

    Truman, Laura K; Bradberry, Samuel J; Comby, Steve; Kotova, Oxana; Gunnlaugsson, Thorfinnur

    2017-07-05

    The development of material-supported molecular logic gate mimics (MGLMs) for contained application and device fabrication has become of increasing interest. Herein, we present the formation of ≈5 nm gold nanoparticles (AuNPs) that have been surface-modified (via a thiol linkage) with heptadentate cyclen-based complexes of europium and terbium for sensing applications using delayed lanthanide luminescence and as integrated logic gate mimics within competitive media. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Synthesis and characterization of multifunctional silica core-shell nanocomposites with magnetic and fluorescent functionalities

    Energy Technology Data Exchange (ETDEWEB)

    Ma Zhiya; Dosev, Dosi [Department of Mechanical and Aeronautical Engineering, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Nichkova, Mikaela [Department of Entomology, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Dumas, Randy K. [Department of Physics, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Gee, Shirley J.; Hammock, Bruce D. [Department of Entomology, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Liu Kai [Department of Physics, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Kennedy, Ian M. [Department of Mechanical and Aeronautical Engineering, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States)], E-mail: imkennedy@ucdavis.edu

    2009-05-15

    Multifunctional core-shell nanocomposites with a magnetic core and a silica shell doped with lanthanide chelate have been prepared by a simple method. First, citric acid-modified magnetite nanoparticles were synthesized by a chemical coprecipitation method. Then the magnetite nanoparticles were coated with silica shells doped with terbium (Tb{sup 3+}) complex by a modified Stoeber method based on hydrolyzing and condensation of tetraethyl orthosilicate (TEOS) and a silane precursor. These multifunctional nanocomposites are potentially useful in a variety of biological areas such as bio-imaging, bio-labeling and bioassays because they can be simultaneously manipulated with an external magnetic field and exhibit unique phosphorescence properties.

  4. Luminescent probing of the simplest chiral α-amino acid-alanine in an enantiopure and racemic state.

    Science.gov (United States)

    Tarasevych, Arkadii V; Kostyukov, Anton I; Baronskiy, Mark G; Rastorguev, Alexander A; Guillemin, Jean-Claude; Snytnikov, Valeriy N

    2017-07-01

    Luminescent spectroscopy combined with the technique of luminescent probing with rare earth ions (europium, gadolinium, terbium) and an actinide ion (uranyl) was used to differentiate enantiopure and racemic alanine, the simplest chiral proteinogenic amino acid. Using the achiral luminescent probes, small differences between pure L and DL alanine in the solid state were strongly amplified. Based on the observed electronic transitions of the probes, the position of the triplet level of the coordinated alanine was estimated. Formation of homo- and heterochiral complexes between enantiomers of alanine and the metal ions is discussed as a possible mechanism of chiral self-discrimination. © 2017 Wiley Periodicals, Inc.

  5. Investigation of magnon dispersion relations and neutron scattering cross sections with special attention to anisotropy effects

    DEFF Research Database (Denmark)

    Lindgård, Per-Anker; Kowalska, A.; Laut, Peter

    1967-01-01

    -helical structure. A numerical calculation is performed for terbium on the basis of the Kaplan-Lyons Hamiltonian with added crystalline anisotropy. The non-istropic exchange part is shown to have a small effect on the dispersion curves, and it turns out that radical changes of the Ruderman-Kittel-type functions...... for the exchange interaction seem to be necessary for agreement with experimental dispersion curves be obtained. The effect of the anisotropy in the cross section is estimated and shown to be important for small magnon energies....

  6. Rare (Earth Elements [score

    Directory of Open Access Journals (Sweden)

    Camilo Méndez

    2014-12-01

    Full Text Available Rare (Earth Elements is a cycle of works for solo piano. The cycle was inspired by James Dillon’s Book of Elements (Vol. I-V. The complete cycle will consist of 14 pieces; one for each selected rare (earth element. The chosen elements are Neodymium, Erbium, Tellurium, Hafnium, Tantalum, Technetium, Indium, Dysprosium, Lanthanium, Cerium, Europium, Terbium, Yttrium and Darmstadtium. These elements were selected due to their special atomic properties that in many cases make them extremely valuable for the development of new technologies, and also because of their scarcity. To date, only 4 works have been completed Yttrium, Technetium, Indium and Tellurium.

  7. Alaska's rare earth deposits and resource potential

    Science.gov (United States)

    Barker, James C.; Van Gosen, Bradley S.

    2012-01-01

    Alaska’s known mineral endowment includes some of the largest and highest grade deposits of various metals, including gold, copper and zinc. Recently, Alaska has also been active in the worldwide search for sources of rare earth elements (REE) to replace exports now being limitedby China. Driven by limited supply of the rare earths, combined with their increasing use in new ‘green’ energy, lighting, transportation, and many other technological applications, the rare earth metals neodymium, europium and, in particular, the heavy rare earth elements terbium, dysprosium and yttrium are forecast to soon be in critical short supply (U.S. Department of Energy, 2010).

  8. Sol-Gel Electrolytes Incorporated by Lanthanide Luminescent Materials and Their Photophysical Properties

    Science.gov (United States)

    Yu, Chufang; Zhang, Zhengyang; Fu, Meizhen; Gao, Jinwei; Zheng, Yuhui

    2017-10-01

    A group of silica gel electrolytes with lanthanide luminescent hybrid materials were assembled and investigated. Photophysical studies showed that terbium and europium hybrids displayed characteristic green and red emissions within the electrolytes. The influence of different concentration of the lanthanide hybrids on the electrochemical behavior of a gelled electrolyte valve-regulated lead-acid battery were studied through cyclic voltammograms, electrochemical impedance spectroscopy, water holding experiments and mobility tests. The morphology and particle size were analyzed by scanning electron microscopy. The results proved that lanthanide (Tb3+/Eu3+) luminescent materials are effective additives which will significantly improve the electrochemical properties of lead-acid batteries.

  9. SPECTROSCOPIC PROPERTIES OF THE Ln-Ge COMPLEXES WITH DIETHYLENETRIAMINEPENTAACETIC ACID

    Directory of Open Access Journals (Sweden)

    Sergiy Smola

    2007-06-01

    Full Text Available Four new heteronuclear lanthanide complexes with general formula [Ge(OH(μ-HDTPALnGe(OH (μ-DTPA] (Ln = Sm – Dy were synthesized and subsequently characterized by different physico- chemical methods. The structures of new compounds have been proposed. In considered complexes the 4f-luminescence of three-charged ions of samarium, europium, terbium and dysprosium is realized at UV-excitation. It is noteworthy that it is the first observation of 4f-luminescence in water solutions of heteronuclear f-p-complexes. The comparison of luminescent characteristics of hetero- and homonuclear landthanide complexes is described and discussed as well.

  10. Tetrakis(μ-2-phenoxypropionato-κ3O,O′:O′;κ3O:O,O′,κ4O:O′-bis[(1,10-phenanthroline-κ2N,N′(2-phenoxypropionato-κ2O,O′praseodymium(III

    Directory of Open Access Journals (Sweden)

    Jin-Bei Shen

    2011-09-01

    Full Text Available In the centrosymmetric binuclear title complex, [Pr2(C9H9O36(C12H8N22], the two PrIII ions are linked by four 2-phenoxypropionate (L groups through their bi- and tridentate bridging modes. Each PrIII ion is nine-coordinated by one 1,10-phenanthroline molecule, one bidentate carboxylate group and four bridging carboxylate groups in a distorted PrN2O7 monocapped square-antiprismatic geometry. The title compound is isotypic with its terbium- and dysprosium-containing analogues.

  11. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  12. Faraday rotator based on TSAG crystal with orientation.

    Science.gov (United States)

    Yasuhara, Ryo; Snetkov, Ilya; Starobor, Aleksey; Mironov, Evgeniy; Palashov, Oleg

    2016-07-11

    A Faraday isolator (FI) for high-power lasers with kilowatt-level average power and 1-µm wavelength was demonstrated using a terbium scandium aluminum garnet (TSAG) with its crystal axis aligned in the direction. Furthermore, no compensation scheme for thermally induced depolarization in a magnetic field was used. An isolation ratio of 35.4 dB (depolarization ratio γ of 2.9 × 10-4) was experimentally observed at a maximum laser power of 1470 W. This result for room-temperature FIs is the best reported, and provides a simple, practical solution for achieving optical isolation in high-power laser systems.

  13. Gclust Server: 83134 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available ative annotation eukaryotic membrane protein (cytomegalovirus gH-receptor) family chr_0_8254799_138; no anno...83134 TET_138.m00118 Cluster Sequences Related Sequences(254) 1801 eukaryotic membrane protein (cytomegalovi...rus gH-receptor) family chr_0_8254799_138; no annotation 1 1.00e-99 0.0 11.11 0.0 0

  14. EST Table: DC571631 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC571631 E_FL_wd--_24F11_R_0 10/09/28 58 %/138 aa ref|XP_968944.1| PREDICTED: similar to tout.../10 54 %/138 aa gnl|Amel|GB17343-PA 10/09/10 58 %/138 aa gi|91076108|ref|XP_968944.1| PREDICTED: similar to tout-velu CG10117-PA [Tribolium castaneum] FS826934 wd-- ...

  15. Detection of bacterial spores with lanthanide-macrocycle binary complexes.

    Science.gov (United States)

    Cable, Morgan L; Kirby, James P; Levine, Dana J; Manary, Micah J; Gray, Harry B; Ponce, Adrian

    2009-07-15

    The detection of bacterial spores via dipicolinate-triggered lanthanide luminescence has been improved in terms of detection limit, stability, and susceptibility to interferents by use of lanthanide-macrocycle binary complexes. Specifically, we compared the effectiveness of Sm, Eu, Tb, and Dy complexes with the macrocycle 1,4,7,10-tetraazacyclododecane-1,7-diacetate (DO2A) to the corresponding lanthanide aquo ions. The Ln(DO2A)(+) binary complexes bind dipicolinic acid (DPA), a major constituent of bacterial spores, with greater affinity and demonstrate significant improvement in bacterial spore detection. Of the four luminescent lanthanides studied, the terbium complex exhibits the greatest dipicolinate binding affinity (100-fold greater than Tb(3+) alone, and 10-fold greater than other Ln(DO2A)(+) complexes) and highest quantum yield. Moreover, the inclusion of DO2A extends the pH range over which Tb-DPA coordination is stable, reduces the interference of calcium ions nearly 5-fold, and mitigates phosphate interference 1000-fold compared to free terbium alone. In addition, detection of Bacillus atrophaeus bacterial spores was improved by the use of Tb(DO2A)(+), yielding a 3-fold increase in the signal-to-noise ratio over Tb(3+). Out of the eight cases investigated, the Tb(DO2A)(+) binary complex is best for the detection of bacterial spores.

  16. Structural Characterization and Absolute Luminescence Efficiency Evaluation of Gd2O2S High Packing Density Ceramic Screens Doped with Tb3+ and Eu3+ for further Applications in Radiology

    Science.gov (United States)

    Dezi, Anna; Monachesi, Elenasophie; D’Ignazio, Michela; Scalise, Lorenzo; Montalto, Luigi; Paone, Nicola; Rinaldi, Daniele; Mengucci, Paolo; Loudos, George; Bakas, Athanasios; Michail, Christos; Valais, Ioannis; Fountzoula, Christine; Fountos, George; David, Stratos

    2017-11-01

    Rare earth activators are impurities added in the phosphor material to enhance probability of visible photon emission during the luminescence process. The main activators employed are rare earth trivalent ions such as Ce+3, Tb+3, Pr3+ and Eu+3. In this work, four terbium-activated Gd2O2S (GOS) powder screens with different thicknesses (1049 mg/cm2, 425.41 mg/cm2, 313 mg/cm2 and 187.36 mg/cm2) and one europium-activated GOS powder screen (232.18 mg/cm2) were studied to investigate possible applications for general radiology detectors. Results presented relevant differences in crystallinity between the GOS:Tb doped screens and GOS:Eu screens in respect to the dopant agent present. The AE (Absolute efficiency) was found to rise (i) with the increase of the X-ray tube voltage with the highest peaking at 110kVp and (ii) with the decrease of the thickness among the four GOS:Tb. Comparing similar thickness values, the europium-activated powder screen showed lower AE than the corresponding terbium-activated.

  17. Synthesis and characterization of magnetic nanoparticles of oxides for dual MnFe{sub 2}O{sub 4} bioseparation, stabilized in fatty acid and the system chitosan - Eu(TTA){sub 3}(TPPO){sub 2}. Studies on the influence of doping with Gd{sup 3+}, Tb{sup 3+}, Ho{sup 3+} e Eu{sup 3+} in structural and magnetic properties; Sintese e caracterizacao de nanoparticulas magneticas de oxidos duplos de MnFe{sub 2}O{sub 4} para biosseparacao, estabilizadas em acido graxo e recobertas pelo sistema quitosana - Eu(TTA){sub 3}(TPPO){sub 2}. Estudo da influencia da dopagem com Gd{sup 3+}, Tb{sup 3+}, Ho{sup 3+} e Eu{sup 3+} nas propriedades estruturais e magneticas

    Energy Technology Data Exchange (ETDEWEB)

    Kovacs, Thelma Antunes Rodrigues

    2014-07-01

    This work was synthesized and characterized ferrite magnetic nanoparticles manganese, using the chemical coprecipitation method. By varying the heating time under 98°C (0, 10,20,40,60 3 80 minutes), the molar percentage of doping (1, 3, 5, 7, and 10%), gadolinium, europium, terbium and holmium. Magnetic ferrite nanoparticles and manganese ferrite doped with manganese were synthesized by coprecipitation method starting with chloride solutions of metals (iron (III), manganese (II), europium (III), gadolinium (III), terbium (III) and holmium (III)) and NaOH 5mol.L{sup -1} as precipitating agent. The magnetic nanoparticles were characterized by scanning electron microscopy, infrared spectroscopy, X-ray diffraction, magnetization curves, and thermal analysis. Most of manganese ferrite particles showed superparamagnetic behavior. After the characterization it was found that the samples synthesized manganese ferrite with more than 40 minutes heating time, crystal structure showed the characteristic pattern of the inverted manganese ferrite spinel type. The stabilization of the samples in oleic acid nanoparticles produced with a hydrophobic outer layer and facilitated by coating chitosan biopolymer, since this has a positive charge. Among the doped samples there was no significant change in the magnetic behavior. Several techniques for characterizing these materials have been used such as X-ray diffraction spectrum in the infrared region, magnetization curves and thermal analysis. The resins were tested as magnetic material for the separation of biological materials. In this paper, are used as biological targets separation of bovine serum albumin. (author)

  18. Cerium fluoride nanoparticles protect cells against oxidative stress

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, Alexander B.; Zholobak, Nadezhda M. [Zabolotny Institute of Microbiology and Virology, National Academy of Sciences of Ukraine, Kyiv D0368 (Ukraine); Baranchikov, Alexander E. [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); Ryabova, Anastasia V. [Prokhorov General Physics Institute of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Nuclear University MEPhI (Moscow Engineering Physics Institute), Moscow 115409 (Russian Federation); Ivanov, Vladimir K., E-mail: van@igic.ras.ru [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Tomsk State University, Tomsk 634050 (Russian Federation)

    2015-05-01

    A novel facile method of non-doped and fluorescent terbium-doped cerium fluoride stable aqueous sols synthesis is proposed. Intense green luminescence of CeF{sub 3}:Tb nanoparticles can be used to visualize these nanoparticles' accumulation in cells using confocal laser scanning microscopy. Cerium fluoride nanoparticles are shown for the first time to protect both organic molecules and living cells from the oxidative action of hydrogen peroxide. Both non-doped and terbium-doped CeF{sub 3} nanoparticles are shown to provide noteworthy protection to cells against the vesicular stomatitis virus. - Highlights: • Facile method of CeF{sub 3} and CeF{sub 3}:Tb stable aqueous sols synthesis is proposed. • Naked CeF{sub 3} nanoparticles are shown to be non-toxic and to protect cells from the action of H{sub 2}O{sub 2}. • CeF{sub 3} and CeF{sub 3}:Tb nanoparticles are shown to protect living cells against the vesicular stomatitis virus.

  19. Synthesis and characterization of Tin / Titanium mixed oxide nanoparticles doped with lanthanide for biomarking; Sintese e caracterizacao de nanoparticulas de oxido misto de estanho/titanio dopadas com lantanideos para marcacao biologica

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, Paula Pinheiro

    2012-07-01

    This work presents the synthesis, characterization and photo luminescent study of tin and titanium mixed oxide nanoparticles doped with europium, terbium and neodymium to be used with luminescent markers on biological systems. The syntheses were done by co-precipitation, protein sol-gel and Pechini methods and the nanoparticles were characterized by infrared spectroscopy, thermogravimetric analysis, scanning electron microscopy, X-ray diffraction and X-ray absorption spectroscopy. The photo luminescent properties studies were conducted for luminophores doped with europium, terbium and neodymium synthesized by coprecipitation method. For luminophore doped with europium it was possible to calculate the intensity parameters and quantum yield and it showed satisfactory results. In the case of biological system marking it was necessary the functionalization of these particles to allow them to bind to the biological part to be studied. So the nanoparticles were functionalized by microwave and Stoeber methods and characterized by infrared spectroscopy, scanning electron microscopy, energy dispersive X-ray spectroscopy and X-ray diffraction obtaining qualitative response of functionalization efficacy. The ninhydrin spectroscopic method was used for quantification of luminophores functionalization. The photo luminescent studies of functionalized particles demonstrate the potential applying of these luminophores as luminescent markers. (author)

  20. Fabrication of Tb3Al5O12 transparent ceramics using co-precipitated nanopowders

    Science.gov (United States)

    Dai, Jiawei; Pan, Yubai; Wang, Wei; Luo, Wei; Xie, Tengfei; Kou, Huamin; Li, Jiang

    2017-11-01

    Terbium aluminum garnet (TAG) precursor was synthesized by a co-precipitation method from a mixed solution of terbium and aluminum nitrates using ammonium hydrogen carbonate (AHC) as the precipitant. The powders calcined at different temperatures were investigated by XRD, FTIR and FESEM in order to choose the optimal calcination temperature. Fine and low-agglomerated TAG powders with average particle size of 88 nm were obtained by calcining the precursor at 1100 °C for 4 h. Using this powder as starting material, TAG transparent ceramics were fabricated by vacuum sintering combined with hot isostatic pressing (HIP) sintering. For the sample pre-sintered at 1700 °C for 20 h with HIP post-treated at 1700 °C for 3 h, the average grain size is about 3.9 μm and the in-line transmittance is beyond 55% in the region of 500-1600 nm, reaching a maximum transmittance of 64.2% at the wavelength of 1450 nm. The Verdet constant at 633 nm is measured to be -178.9 rad T-1 m-1, which is 33% larger than that of the commercial TGG single crystal (-134 rad T-1 m-1).

  1. Incorporation of Ln-Doped LaPO4 Nanocrystals as Luminescent Markers in Silica Nanoparticles.

    Science.gov (United States)

    van Hest, Jacobine J H A; Blab, Gerhard A; Gerritsen, Hans C; Donega, Celso de Mello; Meijerink, Andries

    2016-12-01

    Lanthanide ions are promising for the labeling of silica nanoparticles with a specific luminescent fingerprint due to their sharp line emission at characteristic wavelengths. With the increasing use of silica nanoparticles in consumer products, it is important to label silica nanoparticles in order to trace the biodistribution, both in the environment and living organisms.In this work, we synthesized LaPO4 nanocrystals (NCs) with sizes ranging from 4 to 8 nm doped with europium or cerium and terbium. After silica growth using an inverse micelle method, monodisperse silica spheres were obtained with a single LaPO4 NC in the center. We demonstrate that the size of the silica spheres can be tuned in the 25-55 nm range by addition of small volumes of methanol during the silica growth reaction. Both the LaPO4 core and silica nanocrystal showed sharp line emission characteristic for europium and terbium providing unique optical labels in silica nanoparticles of variable sizes.

  2. Magnetic phase transitions in TbFe sub 2 Al sub 1 sub 0 , HoFe sub 2 Al sub 1 sub 0 and ErFe sub 2 Al sub 1 sub 0

    CERN Document Server

    Reehuis, M; Krimmel, A; Scheidt, E W; Stüsser, N; Loidl, A; Jeitschko, W

    2003-01-01

    The magnetic order of the orthorhombic aluminides TbFe sub 2 Al sub 1 sub 0 , HoFe sub 2 Al sub 1 sub 0 and ErFe sub 2 Al sub 1 sub 0 (space group Cmcm) has been studied by specific heat and magnetic measurements, as well as by neutron powder diffraction down to 100 mK and in external fields up to 5 T. Only the rare-earth ions carry a magnetic moment. At T = 1.5 K the terbium moments in TbFe sub 2 Al sub 1 sub 0 show a square-wave modulated magnetic order with wavevector k = (0, 0.7977, 0) and a moment direction parallel to the a-axis. At a critical field of H sub c sub 1 = 0.9 T one of ten spins is forced to flip, going into an intermediate ferrimagnetic phase that is stable up to the critical field H sub c sub 2 = 1.8 T. Above this field finally all the rest of the spins flip, resulting in a ferromagnetic order of the terbium moments. ErFe sub 2 Al sub 1 sub 0 orders antiferromagnetically below T sub N 1.77(7) K with a similar magnetic structure characterized by a wavevector k (0, approx 0.8, 0). In contras...

  3. Deuteron induced Tb-155 production, a theranostic isotope for SPECT imaging and auger therapy.

    Science.gov (United States)

    Duchemin, C; Guertin, A; Haddad, F; Michel, N; Métivier, V

    2016-12-01

    Several terbium isotopes are suited for diagnosis or therapy in nuclear medicine. Tb-155 is of interest for SPECT imaging and/or Auger therapy. High radionuclide purity is mandatory for many applications in medicine. The quantification of the activity of the produced contaminants is therefore as important as that of the radionuclide of interest. The experiments performed at the ARRONAX cyclotron (Nantes, France), using the deuteron beam delivered up to 34MeV, provide an additional measurement of the excitation function of the Gd-nat(d,x)Tb-155 reaction and of the produced terbium and gadolinium contaminants. In this study, we investigate the achievable yield for each radionuclide produced in natural gadolinium as a function of the deuteron energy. Other reactions are discussed in order to define the production route that could provide Tb-155 with a high yield and a high radionuclide purity. This article aims to improve data for the Gd-nat(d,x) reaction and to optimize the irradiation conditions required to produce Tb-155. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ess ... protein family [Haloarcula marismortui ATCC 43049] ... Length = 138 ... Query: 1 ... MYSDILVPTDGSASME...QVLEHTIDIADGRDVTVHALYVIDDRAFLSMDDEMQDEVLENLR 60 ... MYSDILVPTDGSASME...QVLEHTIDIADGRDVTVHALYVIDDRAFLSMDDEMQDEVLENLR Sbjct: 1 ... MYSDILVPTDGSASMEQVLEHTIDIADGRDVTVHALYVIDDRAFLSMD

  5. Processed meat and the risk of selected digestive tract and laryngeal neoplasms in Switzerland

    National Research Council Canada - National Science Library

    Levi, F; Pasche, C; Lucchini, F; Bosetti, C; La Vecchia, C

    2004-01-01

    .... We studied 316 patients with incident, histologically confirmed oral and pharyngeal cancer, 138 patients with oesophageal cancer, 91 patients with laryngeal cancer and 323 patients with colorectal cancer...

  6. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LS] ... Length = 143 ... Query: 18 ... LTEKHINLNLGSSSKDEVIDTLIAMVADHDKVRDLKQLAEDVRKREREMSTGIGKNIGLP 77 ... ... ... LTEKHINLNLGSSSKDEVIDTLIAMVADHDKVRDLKQLAEDVRKREREMSTGIGKNIGLP Sbjct: 1 ... LT...EKHINLNLGSSSKDEVIDTLIAMVADHDKVRDLKQLAEDVRKREREMSTGIGKNIGLP 60 ... Query: 138 DDVRRKLIDAATPADVLELFKQE 160 ... DDVRRKLIDAATPADVLELFKQE Sbjct: 121 DDVRRKLIDAATPADVLELFKQE 143

  7. ORF Alignment: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Query: 29 ... DHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQ 88 ... ... ... DHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQ Sbjct: 18 ... DHRPLGAEFNITHILSVIKFQVIPEYLI...RKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQ 77 ... Query: 149 RKKPSVEPNENFMEQLHLFEK 169 ... RKKPSVEPNENFMEQLHLFEK Sbjct: 138 RKKPSVEPNENFMEQLHLFEK 158

  8. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rans ... isomerase [Xanthomonas oryzae pv. oryzae KACC10331] ... Length = 138 ... Query: 4 ... IATF...DTSRGPIVVALYPEKAPLTVANFVNLAKRGFYNGLSFHRVIADFMIQXXXXXXXXX 63 ... IATFDTSRGP...IVVALYPEKAPLTVANFVNLAKRGFYNGLSFHRVIADFMIQ ... Sbjct: 1 ... IATFDTSRGPIVVALYPEKAPLTVANFVNLAKRGFYNGLSFHRVIA

  9. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .13479 [Candida ... albicans SC5314] ... Length = 138 ... Query: 24 ... MNHTCLRIKDPKVSIPFYTEKFGMKLIATF...PFADFTLYMLNYETEANKHLNWSAREGVLE 83 ... MNHTCLRIKDPKVSIPFYTEKFGMKLIATFPFAD...FTLYMLNYETEANKHLNWSAREGVLE Sbjct: 1 ... MNHTCLRIKDPKVSIPFYTEKFGMKLIATFPFADFTLYMLNYETEANKHLNWSAREGVLE 60 ... Query

  10. Gclust Server: 127606 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 127606 TET_138.m00086 Cluster Sequences Related Sequences(8) 421 hypothetical prote...in chr_0_8254799_138; no annotation 1 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 127606 Cluster ID 127606 Seque

  11. 77 FR 53236 - Notice of Permit Applications Received Under the Antarctic Conservation Act of 1978 (Pub. L. 95-541)

    Science.gov (United States)

    2012-08-31

    ... 137-Northwest White Island, ASPA 138-Linnaeus Terrace, and, ASPA 154-Botany Bay to conduct a review of... review, general management and maintenance concerns such as ensuring that all signs and boundary markers... White Island, ASPA 138-Linnaeus Terrace, and, ASPA 154-Botany Bay. Dates August 15, 2012 to August 31...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 138 of 138 ... Vol 1, No 1 (2012), Profile of an epidemiological study of urinary schistosomiasis in two local government areas of Benue state, Nigeria, Abstract PDF ... BM Adu. Vol 3, No 2 (2014), Serum nickel level in patients with facial bone fractures treated with 0.5mm stainless steel wire, Abstract PDF.

  13. Molecular plasticity regulates oligomerization and cytotoxicity of the multipeptide-length amyloid-β peptide pool

    NARCIS (Netherlands)

    Vandersteen, Annelies; Masman, Marcelo F.; Baets, Greet De; Jonckheere, Wim; Werf, Kees van der; Marrink, Siewert J.; Rozenski, Jef; Benilova, Iryna; Strooper, Bart De; Subramaniam, Vinod; Schymkowitz, Joost; Rousseau, Frederic; Broersen, Kerensa

    2012-01-01

    Current therapeutic approaches under development for Alzheimer disease, including gamma-secretase modulating therapy, aim at increasing the production of A beta(1-38) and A beta(1-40) at the cost of longer A beta peptides. Here, we consider the aggregation of A beta(1-38) and A beta(1-43) in

  14. 76 FR 12957 - City of Tacoma, Washington; Notice of Preliminary Permit Application Accepted for Filing and...

    Science.gov (United States)

    2011-03-09

    ... are being evaluated for potential hydropower installations, and would consist of the following: Site 1... station transformer at the powerhouse to connect the turbine output to a 13.8-kilovolt (kV) distribution... capacity of 500 kW; and (2) a station transformer at the powerhouse to connect the turbine output to a 13.8...

  15. Microaneurysm count as a predictor of long-term progression in diabetic retinopathy in young patients with type 1 diabetes

    DEFF Research Database (Denmark)

    Rasmussen, Malin Lundberg; Broe, R; Frydkjaer-Olsen, U

    2015-01-01

    ), and incident diabetic macula edema (DME). RESULTS: We included 138 patients (138 eyes). Of these, 58 had no retinopathy and 80 had MAs only. At follow-up, rates of two-step progression of DR, progression to PDR and incident DME were 52.9, 21.7, and 10.1 %, respectively. In logistic regression models, MA count...

  16. A Theory of Dark Network Design

    Science.gov (United States)

    2010-12-01

    138 1. Understand and Change the Environment ........................ 138 2. Exploit External and Internal...configures its structure, component parts and sub-systems, and coordinates its activities in response to environmental changes .2 While a wealth of... Manangement 29, no. 3 (2003): 991-1013, 992. For the purpose of this study, we use the terms actors, nodes, and entities interchangeably when

  17. Anxiety in Patients with Cardiac Disease

    Science.gov (United States)

    2005-01-01

    HeartJ. 1999;138:32-38. 11. Migliaro ER, Canetti R, Contreras P, Hakas M. Heart rate variability: short-term studies are as useful as holter to...deep breathing as a prognostic index after myocardial infarction. Am Heart J. 1999; 138:32-38. 11. Migliaro ER, Canetti R, Contreras P, Hakas M. Heart

  18. 77 FR 72960 - International Mail: Product Rate and Fee Changes

    Science.gov (United States)

    2012-12-07

    ... International service with Registered Mail service. * * * * * 135 Mailable Dangerous Goods 135.1 Infectious... Registered Mail TM service. Nonregulated materials defined in DMM 601.10.17.3 and exempt human or animal... Registered Mail service. * * * * * 138 Perishable Matter 138.1 Animals All live or dead animals are...

  19. 77 FR 64768 - International Mailing Services: Proposed Product and Price Changes

    Science.gov (United States)

    2012-10-23

    ... with Registered Mail service. * * * * * 135 Mailable Dangerous Goods 135.1 Infectious Substances... materials defined in DMM 601.10.17.3 and exempt human or animal specimens defined in DMM 601.10.17.2d are... Priced Boxes with Registered Mail service. * * * * * 138 Perishable Matter 138.1 Animals All live or dead...

  20. Bathymetric observations from 60 degrees South to Princess Astrid Kyst in Queens Maud Land, Antarctica

    Digital Repository Service at National Institute of Oceanography (India)

    Pathak, M.C.; Kotnala, K.L.; Prabaharan, N; Walker, G.A.

    stream_size 6 stream_content_type text/plain stream_name Proc_Workshop_Antarct_Stud_1990_138.pdf.txt stream_source_info Proc_Workshop_Antarct_Stud_1990_138.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...