Interaction of tellurium and tellurium-containing semiconductor compounds with solutions of HI-HNO3-H2O system

International Nuclear Information System (INIS)

Tomashik, V.N.; Sava, A.A.; Tomashik, Z.F.

1994-01-01

As a result of experimental investigations and physical-chemical simulation are established regularities of solution of semiconducting tellurium-containing compounds in HI-HNO 3 -H 2 O systems. In HNO 3 -HI system solutions enriched by HNO 3 are not used for CdTe treatment but HI enriched solution are similar in composition with I 2 -HI solutions. Solution of the given tellurium-containing materials proceeds by a chemical mechanism and is determined by tellurium oxidation with iodine

Tellurium release and deposition during the TMI-2 accident

International Nuclear Information System (INIS)

Vinjamuri, K.; Osetek, D.J.; Hobbins, R.R.; Jessup, J.S.

1984-09-01

The estimated behavior of tellurium during and after the accident at the Three Mile Island Unit-2 is presented. The behavior is based on all available measurement data for /sup 129m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te and 130 Te), and best estimate calculations of tellurium release and transport. The predicted release was calculated using current techniques that relate release rate to fuel temperature and holdup of tellurium in zircaloy until significant oxidation occurs. The calculated release fraction was low, approx. 7%, but the total measured release for samples analyzed to date is about 5.8%. Of the measured tellurium about 2.4, 1.8, 0.88, 0.42, 0.17 and 0.086% of core inventory were in the containment sump water, upper plenum assembly surfaces, containment solids in the sump water, makeup and purification demineralizer, containment inside surface, and the reactor primary coolant, respectively. A significant fraction (54%) of the tellurium calculated to be retained on the upper plenum surfaces (4.61% of the core inventory) was deposited during the high pressure injection of coolant at about 200 min after the reactor scram. Comparison of tellurium behavior with in-pile and out-of-pile tests strongly suggests that zircaloy holds tellurium until significant cladding oxidation occurs

Tellurium behavior during and after the TMI-2 accident

International Nuclear Information System (INIS)

Vinjamuri, K.; Osetek, D.J.; Hobbins, R.R.

1984-01-01

The estimated behavior of tellurium during and after the accident at the Three Mile Island Unit-2 is presented. The behavior is based on all available measurement data for /sup 129m/Te, 132 Te and stable tellurium ( 126 Te, 128 Te and 130 Te), and best estimate calculations of tellurium release and transport. The predicted release was calculated using current techniques that relate release rate to fuel temperature and holdup of tellurium in zircaloy until significant oxidation occurs. The calculated release fraction was low, approximately 7%, but the total measured release for samples analyzed to date is about 4.0%. Of the measured tellurium about 2.4, 0.88, 0.42, 0.17 and 0.086% of core inventory were in the containment sump water, containment solids in water, makeup and purification demineralizer, containment inside surface, and the reactor primary coolant, respectively. A significant fraction (54%) of the calculated tellurium retained on the upper plenum surfaces (4.61% of the core inventory) was deposited during the high pressure injection of coolant at about 200 minutes after the reactor scram. Comparison of tellurium behavior with inpile and out-of-pile tests strongly suggests that zircaloy holds tellurium until significant cladding oxidation occurs

Fission product tellurium chemistry from fuel to containment

International Nuclear Information System (INIS)

McFarlane, J.

1996-01-01

Chemical equilibrium calculations were performed on the speciation of tellurium in-core and inside the primary heat transport system (PHTS) under loss-of-coolant accident conditions. Data from recent Knudsen-cell experiments on the volatilization of Cs 2 Te were incorporated into the calculation. These data were used to recalculate thermodynamic quantities for Cs 2 Te(g), including Δ f G o (298 K)= -118±9 kJ.mol -1 . The description of the condensed high-temperature cesium-tellurium phase was expanded to include Cs 2 Te 3 (c) in addition to Cs 2 Te(c). These modifications were incorporated into the database used in the equilibrium calculations; the net effect was to stabilize the condensed cesium-tellurium phase and reduce the vapour pressure of Cs 2 Te(g) between 1200 and 1600 K. The impact of tellurium speciation in containment, after release from the PHTS, is discussed along with the possible effect of tellurium on iodine chemistry. (author) 10 figs., 5 tabs., 21 refs

Fission product tellurium chemistry from fuel to containment

Energy Technology Data Exchange (ETDEWEB)

McFarlane, J [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Labs.

1996-12-01

Chemical equilibrium calculations were performed on the speciation of tellurium in-core and inside the primary heat transport system (PHTS) under loss-of-coolant accident conditions. Data from recent Knudsen-cell experiments on the volatilization of Cs{sub 2}Te were incorporated into the calculation. These data were used to recalculate thermodynamic quantities for Cs{sub 2}Te(g), including {Delta}{sub f}G{sup o}(298 K)= -118{+-}9 kJ.mol{sup -1}. The description of the condensed high-temperature cesium-tellurium phase was expanded to include Cs{sub 2}Te{sub 3}(c) in addition to Cs{sub 2}Te(c). These modifications were incorporated into the database used in the equilibrium calculations; the net effect was to stabilize the condensed cesium-tellurium phase and reduce the vapour pressure of Cs{sub 2}Te(g) between 1200 and 1600 K. The impact of tellurium speciation in containment, after release from the PHTS, is discussed along with the possible effect of tellurium on iodine chemistry. (author) 10 figs., 5 tabs., 21 refs.

Quantitative analysis of tellurium in simple substance sulfur

International Nuclear Information System (INIS)

Arikawa, Yoshiko

1976-01-01

The MIBK extraction-bismuthiol-2 absorptiometric method for the quantitative analysis of tellurium was studied. The method and its limitation were compared with the atomic absorption method. The period of time required to boil the solution in order to decompose excess hydrogen peroxide and to reduce tellurium from 6 valance to 4 valance was examined. As a result of experiment, the decomposition was fast in the alkaline solution. It takes 30 minutes with alkaline solution and 40 minutes with acid solution to indicate constant absorption. A method of analyzing the sample containing tellurium less than 5 ppm was studied. The experiment revealed that the sample containing a very small amount of tellurium can be analyzed when concentration by extraction is carried out for the sample solutions which are divided into one gram each because it is difficult to treat several grams of the sample at one time. This method also is suitable for the quantitative analysis of selenium. This method showed good addition effect and reproducibility within the relative error of 5%. The comparison between the calibration curve of the standard solution of tellurium 4 subjected to the reaction with bismuthiol-2 and the calibration curve obtained from the extraction of tellurium 4 with MIBK indicated that the extraction is perfect. The result by bismuthiol-2 method and that by atom absorption method coincided quite well on the same sample. (Iwakiri, K.)

Facile electrochemical synthesis of tellurium nanorods and their photoconductive properties

Energy Technology Data Exchange (ETDEWEB)

Li, H.H. [Center for Photon Manufacturing Science and Technology, School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); Zhang, P. [Dongguan University of Technology, Dongguan-523808 (China); School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou - 510275 (China); Liang, C.L. [Instrumental Analysis and Research Center, SunYat-sen University, Guangzhou - 510275 (China); Yang, J. [School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); Zhou, M. [Center for Photon Manufacturing Science and Technology, School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); The State Key Laboratory of Tribology, Tsinghua University, Beijing - 10084 (China); Lu, X.H. [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou - 510275 (China); Hope, G.A. [School of Biomolecular and Physical Sciences, Griffith University, Nathan - Qld 4111 (Australia)

2012-10-15

Tellurium nanorods have been successfully fabricated by template and surfactant-free electrochemical technique from an aqueous solution at room temperature. The as-prepared tellurium nanorods were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Raman spectrometry, UV-vis spectroscopy and photoluminescence spectroscopy. Films based on tellurium nanorods were constructed to study the photoresponse and I-V curves. These photoresponse measurements demonstrate that tellurium nanorods exhibited enhanced conductivity under illumination compared to in the dark measurement. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Analysis of tellurium thin films electrodeposition from acidic citric bath

Energy Technology Data Exchange (ETDEWEB)

Kowalik, Remigiusz; Kutyła, Dawid [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, al. A. Mickiewicza 30, 30-059 Krakow (Poland); Mech, Krzysztof [AGH University of Science and Technology, Academic Centre for Materials and Nanotechnology, al. A. Mickiewicza 30, Krakow (Poland); Żabiński, Piotr, E-mail: rkowalik@agh.edu.pl [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, al. A. Mickiewicza 30, 30-059 Krakow (Poland)

2016-12-01

This work presents the description of the electrochemical process of formation thin tellurium layers from citrate acidic solution. The suggested methodology consists in the preparation of stable acidic baths with high content of tellurium, and with the addition of citrate acid. In order to analyse the mechanism of the process of tellurium deposition, the electroanalytical tests were conducted. The tests of cyclic voltammetry and hydrodynamic ones were performed with the use of polycrystalline gold disk electrode. The range of potentials in which deposition of tellurium in direct four-electron process is possible was determined as well as the reduction of deposited Te° to Te{sup 2−} and its re-deposition as a result of the comproportionation reaction. On the basis of the obtained results, the deposition of tellurium was conducted by the potentiostatic method. The influence of a deposition potential and a concentration of TeO{sub 2} in the solution on the rate of tellurium coatings deposition was examined. The presence of tellurium was confirmed by X-ray spectrofluorometry and electron probe microanalysis. In order to determine the phase composition and the morphology, the obtained coatings were analysed with the use of x-ray diffraction and scanning electron microscopy.

NMR spectroscopy of organic compounds of selenium and tellurium. Communication 8. Constants of spin-spin interaction of /sup 125/Te-/sup 1/o/sup 3/C in nmr spectra of unsaturated organtellurides

Energy Technology Data Exchange (ETDEWEB)

Kalabin, G.A.; Kushnarev, D.F.; Valeev, R.B. (Irkutskij Gosudarstvennyj Univ. (USSR))

1981-06-01

On the basis of /sup 13/C NMR spectra of a series of unsaturated and aromatic tellurium compounds the constants of spin-spin interaction (SSIC) (sup(1.2)J(Te, C)) are measured. A reliable linear relation between /sup 1/J(Te, C) and s-character of a carbon orbitale forming bond with tellurium is found. Correlation of straight SSIC of carbon with selenium and tellurium in isological compounds is established.

Properties of low-alloy steel with tellurium

International Nuclear Information System (INIS)

Popova, L.V.; Lebedev, D.V.; Litvinenko, D.A.; Nasibov, A.G.

1983-01-01

The results of investigations into 09G2 and 09G2F steels alloyed with tellurium after controlled rolling are presented. 0.002-0.011% tellurium additions did not change strength and plastic properties of the steels after controlled rolling. Tellurium additions results in 40-50% increase of the steel impact strength on samples With circular and sharp cuts in brittle-viscous region. 0.002-0.003% of tellurium is considered to be the optimum content from the view point of increa=. sing steel strength. Increase of impact strength takes place at the expense of growth of both work function of crack formation and work function of crack propagation but in different temperature ranges: at the expense of firstone at 80-40 deg C, at the expense of second one at 20-40 deg C. 0.002-0.011% teilurium additions mainly at the expense of sulphide globularization bring about decrease of anisotropy of steet properties by impact strength reducing anisotropy factor from 2 to 1.5

Synthesis of ultra-thin tellurium nanoflakes on textiles for high-performance flexible and wearable nanogenerators

Energy Technology Data Exchange (ETDEWEB)

He, Wen; Van Ngoc, Huynh; Qian, Yong Teng; Hwang, Jae Seok; Yan, Ya Ping [Department of Physics and Interdisciplinary Course of Physics and Chemistry, Sungkyunkwan University, 2066, Seobu-ro, Jangan-gu, Suwon 16419, Gyeoggi-do (Korea, Republic of); Choi, Hongsoo [Department of Robotics Engineering, Daegu Gyeongbuk Institute of Science and Technology (DGIST), 711-873, Daegu (Korea, Republic of); Kang, Dae Joon, E-mail: djkang@skku.edu [Department of Physics and Interdisciplinary Course of Physics and Chemistry, Sungkyunkwan University, 2066, Seobu-ro, Jangan-gu, Suwon 16419, Gyeoggi-do (Korea, Republic of)

2017-01-15

Highlights: • Ultra-thin tellurium (Te) nanoflakes were successfully grown on textile and used as an active piezoelectric material. • Te nanoflake nanogenerator device was systematically studied by bending and compressing test. • The ultra-high output power during compressing test can light up 10 LEDs without any external power source. • The device can offer a breakthrough in applying tellurium nanoflakes into high-performance flexible and wearable piezoelectric nanogenerator. - Abstract: We report that ultra-thin tellurium (Te) nanoflakes were successfully grown on a sample of a gold-coated textile, which then was used as an active piezoelectric material. An output voltage of 4 V and a current of 300 nA were obtained from the bending test under a driving frequency of 10 Hz. To test the practical applications, Te nanoflake nanogenerator (TFNG) device was attached to the subject’s arm, and mechanical energy was converted to electrical energy by means of periodic arm-bending motions. The optimized open-circuit voltage and short-circuit current density of approximately 125 V and 17 μA/cm{sup 2}, respectively, were observed when a TFNG device underwent a compression test with a compressive force of 8 N and driving frequency of 10 Hz. This high-power generation enabled the instantaneous powering of 10 green light-emitting diodes that shone without any assistance from an external power source.

Analysis of tellurium-silicon alloys. Part 1. Determination of tellurium by the reduction from perchloric acid solution

International Nuclear Information System (INIS)

Teperek, J.

1977-01-01

When 100-150 mg of tellurium is dissolved in the solution containing 20 cm 3 72 wt.% of perchloric acid, the reduction of tellurium to elementary form is possible only after adding 60-100 milimoles of HCl. The reduction is performed by adding 1 cm 3 of saturated sodium pyrosulphite solution (Na 2 S 2 O 5 ) and 10 cm 3 of 10 wt.% hydrazine hydrochloride solution (N 2 H 4 .2HCl) to 80-90 cm 3 of cold solution of Te in HClO 4 -HCl mixture. The reduction is completed after 3-5 min. of boiling. When 150-200 mg sample of Te-Si alloy is dissolved in 20 cm 3 of hot 72% per chloric acid, the separation of components is reached. Tellurium can be determinated in filtrate by proposed procedure with high accuracy and precision. (author)

Polarographic determination of selenium and tellurium in silver-gold alloys

International Nuclear Information System (INIS)

Gornostaeva, T.D.; Shmargun, S.V.

1986-01-01

The determination of selenium and tellurium is of importance in monitoring the composition of silver-gold alloys (SGA) since these elements are harmful impurities in the pure metals. Tellurium is determined in silver alloys by atomic absorption and atomic emmission methods; selenium determination is made by atomic absorption methods. This paper examines the polarographic determination of silver and tellurium in SGA containing platinum metals and copper. Copper and the bulk of the platinum and palladium were removed by precipitating selenium and tellurium with potassium hypophosphite in the elementary state from 6 M HC1. The results of an analysis of samples of SGA according to the proposed method were compared with the results obtained by the atomic absorption method. the relative deviation in the determination of 0.02-1.0% by weight selenium and tellurium does not exceed 0.12 (n = 5)

Biosynthesis and recovery of rod-shaped tellurium nanoparticles and their bactericidal activities

Energy Technology Data Exchange (ETDEWEB)

Zare, Bijan; Faramarzi, Mohammad Ali; Sepehrizadeh, Zargham [Department of Pharmaceutical Biotechnology and Biotechnology Research Center, Faculty of Pharmacy, Tehran University of Medical Sciences, P.O. Box 14155-6451 Tehran (Iran, Islamic Republic of); Shakibaie, Mojtaba [Department of Pharmacognosy and Biotechnology, School of Pharmacy, Pharmaceutics Research Center, Kerman University of Medical Sciences, P.O. Box 76175-493 Kerman (Iran, Islamic Republic of); Rezaie, Sassan [Department of Medical Biotechnology, School of Advanced Medical Technologies, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Shahverdi, Ahmad Reza, E-mail: shahverd@sina.tums.ac.ir [Department of Pharmaceutical Biotechnology and Biotechnology Research Center, Faculty of Pharmacy, Tehran University of Medical Sciences, P.O. Box 14155-6451 Tehran (Iran, Islamic Republic of)

2012-11-15

Highlights: ► Biosynthesis of rod shape tellurium nanoparticles with a hexagonal crystal structure. ► Extraction procedure for isolation of tellurium nanoparticles from Bacillus sp. BZ. ► Extracted tellurium nanoparticles have good bactericidal activity against some bacteria. -- Abstract: In this study, a tellurium-transforming Bacillus sp. BZ was isolated from the Caspian Sea in northern Iran. The isolate was identified by various tests and 16S rDNA analysis, and then used to prepare elemental tellurium nanoparticles. The isolate was subsequently used for the intracellular biosynthesis of elemental tellurium nanoparticles. The biogenic nanoparticles were released by liquid nitrogen and purified by an n-octyl alcohol water extraction system. The shape, size, and composition of the extracted nanoparticles were characterized. The transmission electron micrograph showed rod-shaped nanoparticles with dimensions of about 20 nm × 180 nm. The energy dispersive X-ray and X-ray diffraction spectra respectively demonstrated that the extracted nanoparticles consisted of only tellurium and have a hexagonal crystal structure. This is the first study to demonstrate a biological method for synthesizing rod-shaped elemental tellurium by a Bacillus sp., its extraction and its antibacterial activity against different clinical isolates.

Biosynthesis and recovery of rod-shaped tellurium nanoparticles and their bactericidal activities

International Nuclear Information System (INIS)

Zare, Bijan; Faramarzi, Mohammad Ali; Sepehrizadeh, Zargham; Shakibaie, Mojtaba; Rezaie, Sassan; Shahverdi, Ahmad Reza

2012-01-01

Highlights: ► Biosynthesis of rod shape tellurium nanoparticles with a hexagonal crystal structure. ► Extraction procedure for isolation of tellurium nanoparticles from Bacillus sp. BZ. ► Extracted tellurium nanoparticles have good bactericidal activity against some bacteria. -- Abstract: In this study, a tellurium-transforming Bacillus sp. BZ was isolated from the Caspian Sea in northern Iran. The isolate was identified by various tests and 16S rDNA analysis, and then used to prepare elemental tellurium nanoparticles. The isolate was subsequently used for the intracellular biosynthesis of elemental tellurium nanoparticles. The biogenic nanoparticles were released by liquid nitrogen and purified by an n-octyl alcohol water extraction system. The shape, size, and composition of the extracted nanoparticles were characterized. The transmission electron micrograph showed rod-shaped nanoparticles with dimensions of about 20 nm × 180 nm. The energy dispersive X-ray and X-ray diffraction spectra respectively demonstrated that the extracted nanoparticles consisted of only tellurium and have a hexagonal crystal structure. This is the first study to demonstrate a biological method for synthesizing rod-shaped elemental tellurium by a Bacillus sp., its extraction and its antibacterial activity against different clinical isolates.

Tellurium labeled analogues of the fatty acid hexadecenoic acid for imaging of myocardial tissue

International Nuclear Information System (INIS)

Mills, S.L.

1980-01-01

Non-invasive nuclear diagnostic procedures for the evaluation of acute myocardial infarction and ischemia are currently limited by problems associated with the availablity of radiopharmaceuticals, development of imaging equipment, and inherent characteristics of radionuclides. Myocardial tissue requires high levels of substrates which provide energy for the continuous functioning of this vital organ. Of the major sources of energy, the most utilized source is fatty acids. Tellurium-123m, with excellent gamma imaging characteristics was chosen as the radionuclide. A 16 carbon fatty acid, hexadecenoic acid, was chosen as the carrier molecule. The tellurium-123m fatty acid radiopharmaceuticals were formulated either in a solution of 20 percent ethanol, two percent polysorbate 80, and brought to volume with normal saline or in 12.5 percent human serum ablumin and brought to volume with normal saline. Biodistribution was performed in three animal species: Sprague-Dawley rats (three rats per time frame), Australian white rabbits (three rabbits per time frame), and mongrel dogs (one dog per time frame). Dosimetry calculations were performed to assess the radiation dose

Structure and activity of tellurium-cerium oxide acrylonitrile catalysts

International Nuclear Information System (INIS)

Bart, J.C.J.; Giordano, N.

1982-01-01

Ammoxidation of propylene to acrylonitrile (ACN) was investigated over various silica-supported (Te,Ce)O catalysts at 360 and 440 0 C. The binary oxide system used consists of a single nonstoichiometric fluorite-type phase α-(Ce,Te)O 2 up to about 80 mole% TeO 2 and a tellurium-saturated solid solution β-(Ce,Te)O 2 at higher tellurium concentrations. The ACN yield varies almost linearly with the tellurium content of (Ce,Te)O 2 . The β-(Ce,Te)O 2 phase is the most active component of the system (propylene conversion and ACN selectivity at 440 C of 76.7 and 74%, respectively) and is slightly more selective to ACN than α-Te0 2 . Tellurium reduces the overoxidation properties of cerium and selective oxidation occurs through Te(IV)-bonded oxygen

A recycling model of the biokinetics of systemic tellurium.

Science.gov (United States)

Giussani, Augusto

2014-11-01

To develop a compartmental model of the systemic biokinetics of tellurium required for calculating the internal dose and interpreting bioassay measurements after incorporation of radioactive tellurium. The compartmental model for tellurium was developed with the software SAAM II v. 2.0 (©The Epsilon Group, Charlottesville, Virginia, USA). Model parameters were determined on the basis of published retention and excretion data in humans and animals. The model consists of two blood compartments, one compartment each for liver, kidneys, thyroid, four compartments for bone tissues and a generic compartment for the soft tissues. The model predicts a rapid urinary excretion of systemic tellurium: 45% in the first 24 h and 84% after 50 d. Faecal excretion amounts to 0.4% after 3 d and 9% after 50 d. Whole body retention is 55% after one day, and 2.8% after 100 d. These values as well as the retained fractions in the single organs are reasonably consistent with the available human and animal data (studies with swine and guinea pigs). The proposed model gives a realistic description of the available biokinetic data for tellurium and will be adopted by the International Commission on Radiological Protection for applications in internal dosimetry.

Atomic absorption determination of ultratrace tellurium in rocks utilizing high sensitivity sampling systems

International Nuclear Information System (INIS)

Beaty, R.D.

1973-01-01

The sampling boat and the graphite furnace were shown to possess the required sensitivity to detect tellurium at ultratrace levels, in a variety of sample types, by atomic absorption. In the sampling boat approach, tellurium in sample solutions is chemically separated and concentrated by extraction into methyl isobutyl ketone before measurement. For samples exhibiting extraction interferences or excessively high background absorption, a preliminary separation of tellurium by coprecipitation with selenium is described. Using this technique, tellurium can be quantitatively detected down to 5 nanograms and linear response is observed to 100 nanograms. Relative standard deviations of better than 7 percent are achieved for 50 nanograms of tellurium. For samples that have a tellurium content below the detection limits of the sampling boat, the graphite furnace is used for atomization. By this method, as little as 0.07 nanograms of tellurium can be detected, and a precision of 1 percent relative standard deviation is achievable at the 5 nanogram level. A routinely applicable procedure was developed for determining tellurium in rocks, using the graphite furnace, after a hydrofluoric acid decomposition of the sample. Using this procedure, tellurium data were obtained on 20 different rocks, and the significance of this new information is discussed. (Diss. Abstr. Int., B)

METHODS OF SYNTHESIS EIGHT-TELLURIUM-CONTAINING HETEROCYCLES WITH MORE HETEROATOMS

Directory of Open Access Journals (Sweden)

G. M. Abakarov

2013-01-01

Full Text Available In this article systematized and summarized data on the synthesis of neweight-embered tellurium-containing heterocycles and new preparative methods described above produce heterocyclic tellurium.

Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method

Science.gov (United States)

Bolotnikov, Aleskey E [South Setauket, NY; James, Ralph B [Ridge, NY

2010-07-20

The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

Selenium and tellurium reagents in organic synthesis

International Nuclear Information System (INIS)

Comasseto, J.V.

1984-01-01

A review of the contribution of the University of Sao Paulo (SP, Brazil) to the organic synthesis of selenium and tellurium reagents is made. Major reactions amoung selenium compounds and insaturated substrates, phosphorus, ester enolates as well as the use of phase transference catalysed reactions to produce arylselenolate are described. For tellurium, interactions of its compounds with organic substrates and reactive intermediates (e.g. benzino diazomethane) are reported. (C.L.B.) [pt

Rapid radiochemical ion-exchange separation of iodine from tellurium: a novel radioiodine-132 generator

Energy Technology Data Exchange (ETDEWEB)

Abrao, A

1975-01-01

Tellurium ions form a soluble cationic complex with thiourea in acid medium. The cationic tellurium-thiourea species is strongly absorbed on a cationic ion exchanger. The retention of tellurium on the resin enables many interesting separation schemes for tellurium from various ions. With special interest, the separation of iodine from tellurium was studied. An efficient and convenient iodine-132 generator is described, in which the radio-iodine is eluted with water or 9 g/1 NaCl, when desired.

Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis

Directory of Open Access Journals (Sweden)

Yang F

2014-10-01

Full Text Available Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellurium-containing phycocyanin (Te-PC and allophycocyanin (Te-APC, two organic tellurium (Te species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 µg g-1 protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropanedihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress. Keywords: tellurium, phycocyanin, allophycocyanin, purification, antioxidant activity

Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis.

Science.gov (United States)

Yang, Fang; Wong, Ka-Hing; Yang, Yufeng; Li, Xiaoling; Jiang, Jie; Zheng, Wenjie; Wu, Hualian; Chen, Tianfeng

2014-01-01

Tellurium-containing phycocyanin (Te-PC) and allophycocyanin (Te-APC), two organic tellurium (Te) species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 μg g(-1) protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropane)dihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress.

Flame and flameless atomic-absorption determination of tellurium in geological materials

Science.gov (United States)

Chao, T.T.; Sanzolone, R.F.; Hubert, A.E.

1978-01-01

The sample is digested with a solution of hydrobromic acid and bromine and the excess of bromine is expelled. After dilution of the solution to approximately 3 M in hydrobromic acid, ascorbic acid is added to reduce iron(III) before extraction of tellurium into methyl isobutyl ketone (MIBK). An oxidizing air-acetylene flame is used to determine tellurium in the 0.1-20 ppm range. For samples containing 4-200 ppb of tellurium, a carbon-rod atomizer is used after the MIBK extract has been washed with 0.5 M hydrobromic acid to remove the residual iron. The flame procedure is useful for rapid preliminary monitoring, and the flameless procedure can determine tellurium at very low concentrations. ?? 1978.

A rapid radiochemical ion-exchange separation of iodine from tellurium: a novel radioiodine-132 generator

International Nuclear Information System (INIS)

Abrao, A.

1975-01-01

Tellurium ions form a soluble cationic complex with thiourea in acid medium. The cationic tellurium-thiourea species is strongly absorbed on a cationic ion exchanger. The retention of tellurium on the resin enables many interesting separation schemes for tellurium from various ions. With special interest, the separation of iodine from tellurium was studied. An efficient and convenient iodine-132 generator is described, in which the radio-iodine is eluted with water or 9 g/1 NaCL, when desired

Study of distribution coefficients of admixtures in tellurium

International Nuclear Information System (INIS)

Kuchar, L.; Drapala, J.; Kuchar, L. jr.

1986-01-01

Limit areas of tellurium-admixture binary systems were studied and the values determined of steady-state distribution coefficients of admixtures. A second order polynomial was used to express equations of solidus and liquidus curves for Te-Se, Te-S, Te-Hg systems; the curves are graphically represented. The most effective method for preparing high-purity tellurium is zonal melting with material removal. (M.D.). 4 figs., 4 tabs., 16 refs

Effects of tellurium concentration on the structure of melt-grown ZnSe crystals

International Nuclear Information System (INIS)

Atroshchenko, Lyubov V.; Galkin, Sergey N.; Rybalka, Irina A.; Voronkin, Evgeniy F.; Lalayants, Alexandr I.; Ryzhikov, Vladimir D.; Fedorov, Alexandr G.

2005-01-01

It has been shown that isovalent doping by tellurium positively affects the structural perfection of ZnSe crystals related to the completeness of the wurtzite-sphalerite phase transition. The optimum concentration range of tellurium in ZnSe crystals is 0.3-0.6 mass %. X-ray diffraction studies have shown that in ZnSe 1-x Te x crystals at tellurium concentrations below 0.3 mass % twinning and packing defects occur, while tellurium concentrations above 0.6 mass % lead to formation of tetragonal crystal lattice

Van der Waals epitaxy and photoresponse of hexagonal tellurium nanoplates on flexible mica sheets.

Science.gov (United States)

Wang, Qisheng; Safdar, Muhammad; Xu, Kai; Mirza, Misbah; Wang, Zhenxing; He, Jun

2014-07-22

Van der Waals epitaxy (vdWE) is of great interest due to its extensive applications in the synthesis of ultrathin two-dimensional (2D) layered materials. However, vdWE of nonlayered functional materials is still not very well documented. Here, although tellurium has a strong tendency to grow into one-dimensional nanoarchitecture due to its chain-like structure, we successfully realize 2D hexagonal tellurium nanoplates on flexible mica sheets via vdWE. Chemically inert mica surface is found to be crucial for the lateral growth of hexagonal tellurium nanoplates since it (1) facilitates the migration of tellurium adatoms along mica surface and (2) allows a large lattice mismatch. Furthermore, 2D tellurium hexagonal nanoplates-based photodetectors are in situ fabricated on flexible mica sheets. Efficient photoresponse is obtained even after bending the device for 100 times, indicating 2D tellurium hexagonal nanoplates-based photodetectors on mica sheets have a great application potential in flexible and wearable optoelectronic devices. We believe the fundamental understanding of vdWE effect on the growth of 2D tellurium hexagonal nanoplate can pave the way toward leveraging vdWE as a useful channel to realize the 2D geometry of other nonlayered materials.

Investigation of γ-irradiation influence on the DLTS spectra in silicon diluted by tellurium

International Nuclear Information System (INIS)

Sultanov, N.A.; Tadzhibaev, M.; Mirzabadalov, Zh

1997-01-01

The influence of gamma-radiation on deep level transient spectroscopy(DLTS) spectra for silicon crystals doped with tellurium was studied. The DLTS spectra have shown that tellurium in silicon formed two deep levels with fixed ionization energy. It was shown that the presence of tellurium prevents the formation of radiation defects

Status of tellurium--hastelloy N studies in molten fluoride salts

International Nuclear Information System (INIS)

Keiser, J.R.

1977-10-01

Tellurium, which is a fission product in nuclear reactor fuels, can embrittle the surface grain boundaries of nickel-base structural materials. This report summarizes results of an experimental investigation conducted to understand the mechanism and to develop a means of controlling this embrittlement in the alloy Hastelloy N. The addition of a chromium telluride to salt can be used to provide small partial pressures of tellurium simulating a reactor environment where tellurium appears as a fission product. The intergranular embrittlement produced in Hastelloy N when exposed to this chromium telluride-salt mixture can be reduced by adding niobium to the Hastelloy N or by controlling the oxidation potential of the salt in the reducing range

Comparison between selenium and tellurium clusters

International Nuclear Information System (INIS)

Benamar, A.; Rayane, D.; Tribollet, B.; Broyer, M.; Melinon, P.

1991-01-01

Selenium and tellurium clusters are produced by the inert gas condensation technique. The mass spectra of both species are completely different and reveal different properties. In selenium, a periodicity of 6-7 is observed and may be interpreted by the binding energy between small cyclic molecules. Moreover, it was very difficult to obtained large clusters probably because the binding energy between these molecules is very small. In tellurium, these periodic structures do not exist and large clusters are easily obtained in nucleation conditions where only small selenium clusters are present. These results are discussed and a simple nucleation model is used to illustrate this different behavior. Finally these clusters properties are correlated to the bulk structure of both materials. (orig.)

Electrodeposition of antimony, tellurium and their alloys from molten acetamide mixtures

NARCIS (Netherlands)

Nguyen, H.P.; Peng, X.; Murugan, G.; Vullers, R.J.M.; Vereecken, P.M.; Fransaer, J.

2013-01-01

We examine the electrodeposition of antimony (Sb), tellurium (Te) and their alloys from molten mixtures of acetamide - antimony chloride and tellurium chloride. The binary mixtures of acetamide with SbCl3 and TeCl 4 exhibit eutectic formation with large depressions of freezing points to below room

Neutron activation analysis of high purity tellurium

International Nuclear Information System (INIS)

Gil'bert, Eh.N.; Verevkin, G.V.; Obrazovskij, E.G.; Shatskaya, S.S.

1980-01-01

A scheme of neutron activation analysis of high purity tellurium is developed. Weighed amount of Te (0.5 g) is irradiated for 20-40 hr in the flux of 2x10 13 neutron/(cm 2 xs). After decomposition of the sample impurities of gold and palladium are determined by the extraction with organic sulphides. Tellurium separation from the remaining impurities is carried out by the extraction with monothiobenzoic acid from weakly acidic HCl solutions in the presence of iodide-ions, suppressing silver extraction. Remaining impurity elements in the refined product are determined γ-spectrometrically. The method allows to determine 34 impurities with determination limits 10 -6 -10 -11 g

The defects produced by electron irradiation in tellurium-doped germanium

International Nuclear Information System (INIS)

Fukuoka, Noboru; Saito, Haruo

1989-01-01

The nature of the irradiation induced defects in a germanium single crystal doped with tellurium was studied by DLTS and electrical measurements. The E c -0.21 eV level produced by irradiation with 1.5 MeV electrons was studied using the DLTS technique. It was found that the defect associated with this level is a divacancy. The E-center like defect (group V impurity-vacancy pair) introduces the E c -0.20 eV level in samples doped with a group V impurity. The level introduced by a tellurium (group VI impurity)-vacancy pair is deeper. The E c -0.16 eV level was generated by annealing at 430 K. A tellurium-vacancies complex is proposed as the defect associated with this level. (author)

DETECTION OF THE SECOND r-PROCESS PEAK ELEMENT TELLURIUM IN METAL-POOR STARS ,

International Nuclear Information System (INIS)

Roederer, Ian U.; Lawler, James E.; Cowan, John J.; Beers, Timothy C.; Frebel, Anna; Ivans, Inese I.; Schatz, Hendrik; Sobeck, Jennifer S.; Sneden, Christopher

2012-01-01

Using near-ultraviolet spectra obtained with the Space Telescope Imaging Spectrograph on board the Hubble Space Telescope, we detect neutral tellurium in three metal-poor stars enriched by products of r-process nucleosynthesis, BD +17 3248, HD 108317, and HD 128279. Tellurium (Te, Z = 52) is found at the second r-process peak (A ≈ 130) associated with the N = 82 neutron shell closure, and it has not been detected previously in Galactic halo stars. The derived tellurium abundances match the scaled solar system r-process distribution within the uncertainties, confirming the predicted second peak r-process residuals. These results suggest that tellurium is predominantly produced in the main component of the r-process, along with the rare earth elements.

Review of tellurium release rates from LWR fuel elements under accident conditions

International Nuclear Information System (INIS)

Lorenz, R.A.; Beahm, E.C.; Wichner, R.P.

1983-01-01

Although fission product tellurium presents a potentially significant radiohazard, its release and transport in source-term experiments is frequently overlooked because it does not possess a readily measurable, gamma emission; moreover, a recent study emphasized noble gas, iodine and cesium release from LWR fuel elements because of the large data base that exists for these materials. Some new tests show that in some cases tellurium may be held up in core material to a greater degree than previously assumed - an observation that prompts a careful reappraisal of the existing tellurium-release data and its chemical foundation

Optimization of scintillator loading with the tellurium-130 isotope for long-term stability

Science.gov (United States)

Duhamel, Lauren; Song, Xiaoya; Goutnik, Michael; Kaptanoglu, Tanner; Klein, Joshua; SNO+ Collaboration

2017-09-01

Tellurium-130 was selected as the isotope for the SNO + neutrinoless double beta decay search, as 130Te decays to 130Xe via double beta decay. Linear alkyl benzene(LAB) is the liquid scintillator for the SNO + experiment. To load tellurium into scintillator, it is combined with 1,2-butanediol to form an organometallic complex, commonly called tellurium butanediol (TeBD). This study focuses on maximizing the percentage of tellurium loaded into scintillator and evaluates the complex's long-term stability. Studies on the effect of nucleation due to imperfections in the detector's surface and external particulates were employed by filtration and induced nucleation. The impact of water on the stability of TeBD complex was evaluated by liquid-nitrogen sparging, variability in pH and induced humidity. Alternative loading methods were evaluated, including the addition of stability-inducing organic compounds. Samples of tellurium-loaded scintillator were synthesized, treated, and consistently monitored in a controlled environment. It was found that the hydronium ions cause precipitation in the loaded scintillator, demonstrating that water has a detrimental effect on long-term stability. Optimization of loaded scintillator stability can contribute to the SNO + double beta decay search.

Calculation of 125Te NMR Chemical Shifts at the Full Four-Component Relativistic Level with Taking into Account Solvent and Vibrational Corrections: A Gateway to Better Agreement with Experiment.

Science.gov (United States)

Rusakova, Irina L; Rusakov, Yuriy Yu; Krivdin, Leonid B

2017-06-29

Four-component relativistic calculations of 125 Te NMR chemical shifts were performed in the series of 13 organotellurium compounds, potential precursors of the biologically active species, at the density functional theory level under the nonrelativistic and four-component fully relativistic conditions using locally dense basis set scheme derived from relativistic Dyall's basis sets. The relativistic effects in tellurium chemical shifts were found to be of as much as 20-25% of the total calculated values. The vibrational and solvent corrections to 125 Te NMR chemical shifts are about, accordingly, 6 and 8% of their total values. The PBE0 exchange-correlation functional turned out to give the best agreement of calculated tellurium shifts with their experimental values giving the mean absolute percentage error of 4% in the range of ∼1000 ppm, provided all corrections are taken into account.

Methods of selenium and tellurium determination in geological and enviromental materials

International Nuclear Information System (INIS)

Nazarenko, I.I.; Kislova, I.V.

1988-01-01

Atomic-absorption and atomic-emission methods of tellurium determination in ores and products of their processing are described. Flame variant with extractional concentration permits to determine tellurium with the concentration up to 6x10 -6 %, the use of graphite cuvette after preliminary concentration-up to 1x10 -6 %. Atomic-emissional method permits to determine 3x10 -4 % Te from sample of 0.5 g

Selenium and tellurium as carbon substitutes

International Nuclear Information System (INIS)

Knapp, F.F. Jr.

1980-01-01

This review has summarized structure-activity studies with 75 Se- and /sup 123m/Te-labeled radiopharmaceuticals in which the selenium or tellurium heteroatom has been inserted between carbon-carbon bonds. The agents that have been investigated in most detail include steroids for adrenal imaging and long-chain fatty acids, and a variety of other unique agents have also been studied. Because of the great versatility of the organic chemistry of selenium and tellurium, there is continuing interest in the preparation of radiopharmaceuticals labeled with 75 Se, 73 Se, and /sup 123m/Te. There are two important factors which will determine the extent of future interest in such agents. These include the necessity of a decrease in the cost of highly enriched 122 Te to make the reactor production of /sup 123m/Te cost effective. In addition, the potential preparation of large amounts of 73 Se should stimulate the development of 73 Se-labeled radiopharmaceuticals

Selective floatation-spectrophotometric determination of tellurium (4) with papaverine and butyl rhodamine B

International Nuclear Information System (INIS)

Skripchuk, V.G.

1981-01-01

It is shown, that papaverine reacts with a bromide complex of tellurium (4) to form a compound readily floated by toluene. The floatation is carried out from an aqueous solution, 5.2 M in H 2 SO 4 , 0.2 M in KBr and 5.4x10 -3 M in papaverine. The absorbance is a function of tellurium (4) concentration over a range of 5-100 μg Te/5 ml. Such a highly sensitive reagent as butylrhodamine B can be effectively substituted for papaverine. The floatation results in better selectivity. The method makes it possible to determine tellurium in blister, anodic and cathodic copper without matrix preseparation [ru

Investigation of biomethylation of arsenic and tellurium during composting

International Nuclear Information System (INIS)

Diaz-Bone, Roland A.; Raabe, Maren; Awissus, Simone; Keuter, Bianca; Menzel, Bernd; Kueppers, Klaus; Widmann, Renatus; Hirner, Alfred V.

2011-01-01

Though the process of composting features a high microbiological activity, its potential to methylate metals and metalloids has been little investigated so far in spite of the high impact of this process on metal(loid) toxicity and mobility. Here, we studied the biotransformation of arsenic, tellurium, antimony, tin and germanium during composting. Time resolved investigation revealed a highly dynamic process during self-heated composting with markedly differing time patterns for arsenic and tellurium species. Extraordinary high concentrations of up to 150 mg kg -1 methylated arsenic species as well as conversion rates up to 50% for arsenic and 5% for tellurium were observed. In contrast, little to no conversion was observed for antimony, tin and germanium. In addition to experiments with metal(loid) salts, composting of arsenic hyperaccumulating ferns Pteris vittata and P. cretica grown on As-amended soils was studied. Arsenic accumulated in the fronds was efficiently methylated resulting in up to 8 mg kg -1 methylated arsenic species. Overall, these studies indicate that metal(loid)s can undergo intensive biomethylation during composting. Due to the high mobility of methylated species this process needs to be considered in organic waste treatment of metal(loid) contaminated waste materials.

Determining arsenic in elemental antimony containing selenium and tellurium

International Nuclear Information System (INIS)

Mogileva, M.G.; Kozlova, E.L.

1986-01-01

The authors have developed a method of determining arsenic in metallic antimony containing selenium, tellurium, and mercury, in which they isolated it in elementary form for separation from the antimony and the associated elements (silicon and phosphorus), followed by colorimetric determination of the arsenic from arsenic-molbdenum blue. The reducing agents to reduce the arsenic were sodium hypophosphite and tin(II) chloride, which do not reduce antimony and which do not interfere with the determination. This method of determining arsenic in metallic antimony without preliminary separation of the selenium and tellurium is in no way inferior in accuracy to the method given in All-Union State Standard (GOST) 1367.4-83

Release of tellurium and cesium from UO2 in LWR fuel rods during irradiation

International Nuclear Information System (INIS)

Malen, K.A.

1983-01-01

In this paper the release of tellurium (Te-132) and cesium (Cs-134 and Cs-137) from UO 2 -fuel is analyzed. The basis for the analysis is the experimental results from the S176 series of experiments performed at Studsvik. It seems that the model developed earlier for release of iodine applies also to tellurium and cesium. This model assumes sweeping up of the species in question by moving grain boundaries and subsequent release through grain boundary porosity. An interesting extra feature is deposition of tellurium at temperatures in the range 1500-2000 K believed to be due to condensation. (author)

METALCOMPLEXES OF TELLURIUM-CONTAINING AMINES AND AZOMETINES

Directory of Open Access Journals (Sweden)

G. M. Abakarov

2014-01-01

Full Text Available In this article methods of synthesis and reactionary ability of metalcomplexes of tellurium-containing amines, azometines, of a problem of competitive coordination with use of the principle of "soft" and "rigid" acids and the bases (R. Pearson.

The characterisation of vapour-phase alkali metal-tellurium-oxygen species

International Nuclear Information System (INIS)

Gomme, R.A.; Ogden, J.S.; Bowsher, B.R.

1986-10-01

Detailed assessments of hypothetical severe accidents in light water reactors require the identification of the chemical forms of the radionuclides in order to determine their transport characteristics. Caesium and tellurium are important volatile fission products in accident scenarios. This report describes detailed studies to characterise the chemical species that vaporise from heated mixtures of various alkali metal-tellurium-oxygen systems. The molecular species were characterised by a combination of quadrupole mass spectrometry and matrix isolation-infrared spectroscopy undertaken in conjunction with experiments involving oxygen-18 substitution. The resulting spectra were interpreted in terms of a vapour-phase molecule with the stoichiometry M 2 TeO 3 (M = K,Rb,Cs) for M/Te molecular ratios of ∼ 2, and polymeric species for ratios < 2. This work has demonstrated the stability of caesium tellurite. The formation of this relatively low-volatility, water-soluble species could significantly modify the transport and release of caesium and tellurium. The data presented in this report should allow more comprehensive thermodynamic calculations to be undertaken that assist in the quantification of fission product behaviour during severe reactor accidents. (author)

Double beta decay of tellurium-130

International Nuclear Information System (INIS)

Richardson, J.F.; Manuel, O.K.; Sinha, B.; Thorpe, R.I.

1986-01-01

The isotopic composition of xenon is reported in four, neutron-irradiated tellurium minerals - tellurobismuthite from Boliden, Sweden, native tellurium from the Good Hope Mine of Gunnison County, Colorado, altaite from the Kirkland Lake area, Ontario, and altaite from the Mattagami Lake area, Quebec. From the amount of radiogenic 130 Xe and pile-produced 131 Xe in these samples, it is concluded that the half-life of 130 Te for ββ-decay is 21 y based on measured values of (1.0+-0.3) . 10 21 y and higher. Our results demonstrate that there has been no significant partial leakage of radiogenic 130 Xe from these minerals over geologic time. Larger values of Tsub(1/2), as indicated from some of the analysis reported here and in other studies, are attributed to recrystallization of the soft telluride minerals and complete resetting of the Te-Xe system after mineralization. The value obtained here for the half-life of 130 Te is substantiated by recent measurements on xenon in tellurides from Kalgoorlie, Western Australia. (orig.)

Sulfur, selenium, tellurium and polonium

International Nuclear Information System (INIS)

Berry, F.J.

1987-01-01

This chapter on the coordination compounds of sulfur, selenium, tellurium and polonium starts with an introduction to the bonding, valence and geometry of the elements. Complexes of the group VIB elements are discussed with particular reference to the halo and pseudohalide complexes, oxo acid complexes, oxygen and nitrogen donor complexes and sulfur and selenium donor complexes. There is a section on the biological properties of the complexes discussed. (UK)

RILIS-ionized mercury and tellurium beams at ISOLDE CERN

Energy Technology Data Exchange (ETDEWEB)

Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN (Switzerland); Billowes, J. [The University of Manchester, School of Physics and Astronomy (United Kingdom); Chrysalidis, K. [CERN (Switzerland); Fedorov, D. V. [Petersburg Nuclear Physics Institute (Russian Federation); Fedosseev, V. N.; Marsh, B. A. [CERN (Switzerland); Molkanov, P. L. [Petersburg Nuclear Physics Institute (Russian Federation); Rossel, R. E.; Rothe, S.; Seiffert, C. [CERN (Switzerland); Wendt, K. D. A. [Johannes Gutenberg Universität, Institut für Physik (Germany)

2017-11-15

This paper presents the results of ionization scheme development for application at the ISOLDE Resonance Ionization Laser Ion Source (RILIS). Two new ionization schemes for mercury are presented: a three-step three-resonance ionization scheme, ionizing via an excitation to a Rydberg level and a three-step two-resonance ionization scheme, with a non-resonant final step to the ionization continuum that corresponded to a factor of four higher ionization efficiency. The efficiency of the optimal mercury ionization scheme was measured, together with the efficiency of a new three-step three resonance ionization scheme for tellurium. The efficiencies of the mercury and tellurium ionization schemes were determined to be 6 % and >18 % respectively.

Nano-Structured Crystalline Te Films by Laser Gas-Phase Pyrolysis of Dimethyl Tellurium

Czech Academy of Sciences Publication Activity Database

Pola, Josef; Pokorná, Veronika; Boháček, Jaroslav; Bastl, Zdeněk; Ouchi, A.

2004-01-01

Roč. 71, č. 2 (2004), s. 739-746 ISSN 0165-2370 R&D Projects: GA AV ČR IAA4072107; GA MŠk OC 523.60 Institutional research plan: CEZ:AV0Z4072921; CEZ:AV0Z4032918; CEZ:AV0Z4040901 Keywords : dimethyl tellurium * tellurium films * laser Subject RIV: CA - Inorganic Chemistry Impact factor: 1.352, year: 2004

Thermoelectric properties of electrodeposited tellurium films and the sodium lignosulfonate effect

International Nuclear Information System (INIS)

Abad, Begoña; Rull-Bravo, Marta; Hodson, Stephen L.; Xu, Xianfan; Martin-Gonzalez, Marisol

2015-01-01

The effect of the addition of a surfactant, sodium lignosulfonate (SLS), on the thermoelectric properties of tellurium films prepared by electrochemical deposition is studied. The growth mechanism is found to have an important role in the thermoelectric properties since the grain size of the films is sharply reduced when the surfactant is added to the solution. For this reason, the electrical resistivity of the tellurium films when the surfactant is not added is 229 μΩ·m, which is lower than 798 μΩ·m with SLS. The Seebeck coefficient values are not influenced, with values in the vicinity of 285 μV/K for both solutions. The power factor resulted higher values than previous works, reaching values of 280 μW/m·K 2 (without SLS) and 82 μW/m·K 2 (with SLS) at room temperature. Finally, the thermal conductivity was measured by means of the Photoacoustic technique, which showed values of the order of 1 W/m·K for both solutions, which is a factor of 3 less than the bulk value of tellurium. A notable observation is that the power factor and the thermal conductivity of electrodeposited tellurium films have the same order of magnitude of bismuth telluride films grown by electrodeposition. The figure of merit is estimated to be approximately one order of magnitude higher than the bulk value, 0.09 without SLS and 0.03 with SLS, both at room temperature

Influence of ion beam irradiation induced defects on the structural, optical and electrical properties of tellurium nanowires

Energy Technology Data Exchange (ETDEWEB)

Kumar, Narinder [Department of Physics, Chaudhary Devi Lal University, Sirsa, 125055 (India); Department of Physics, Haryana College of Technology & Management, Kaithal, 136027 (India); Kumar, Rajesh [Department of Physics, RN College of Engineering & Technology, Madlauda, 132104 (India); Kumar, Sushil, E-mail: sushil_phys@rediffmail.com [Department of Physics, Chaudhary Devi Lal University, Sirsa, 125055 (India); Chakarvarti, S.K. [Research and Development, Manav Rachana International University, Faridabad, 121001 (India)

2016-11-01

In this study, tellurium nanowires were electrodeposited into the polymer membranes from aqueous acidic bath containing HTeO{sub 2}{sup +} ions. The field emission scanning electron microscopy (FESEM) images confirmed the formation of uniform and straight nanowires. The influence of 110 MeV Ni{sup 8+} ion irradiation induced defects on the structural, optical and electrical properties of as–deposited tellurium nanowires were examined using X-ray diffraction (XRD), UV–visible absorption spectroscopy and current–voltage (I–V) measurements. The XRD data depicted the hexagonal phase of tellurium nanowires and further revealed a variation in the intensity of diffraction peaks of ion irradiated nanowires. Williamson–Hall (WH) analysis is used for convoluting the size and microstrain contributions to the width of diffraction peaks. Tellurium nanowires exhibited a distinct absorbance band in the visible region at 686 nm, while this was absent in bulk tellurium. Electrical properties of nanowires are explored on the basis of I–V curves, which revealed a significant increase in the electrical conductivity of irradiated nanowires. A possible mechanism for the enhanced electrical conductivity is the increase in carrier concentration due to thermally excited defects. The defects produced by ion irradiation play a vital role in modifying the properties of semiconducting nanowires. - Highlights: • 110 MeV Ni{sup 8+} ion beam induced changes in tellurium nanowires have been examined. • Nanowires were prepared using template electrodeposition method. • Irradiation improved the electrical conductivity of tellurium nanowires. • Mechanism for enhanced electrical conductivity of irradiated nanowires was discussed.

Kinetics and mechanism of oxidation of tellurium (IV) by periodate in alkaline medium

International Nuclear Information System (INIS)

Srinivas, K.; Vani, P.; Dikshitulu, L.S.A.

1995-01-01

Detailed kinetic study of the oxidation of tellurium (IV) by periodate in alkaline medium has been carried out to compare the mechanisms of oxidation in the acid and alkaline media. It is interesting to note that the rate step involves a two-electron transfer from tellurium (IV) to periodate in alkaline medium although the kinetic pattern is somewhat different from that in the acid medium. 7 refs., 1 tab

Chemical Process for Treatment of Tellurium and Chromium Liquid Waste from I-131 Radioisotope Production

International Nuclear Information System (INIS)

Zainus-Salimin; Gunandjar; Dedy-Harsono; Hendro; Sugeng-Purnomo; Mohammad-Faruq; Zulfakhri

2000-01-01

The I-131 radioisotope is used in nuclear medicine for diagnosis and therapy. The I-131 radioisotope is produced by wet distillation at Bandung Nuclear Research Center and generated about 4,875 Itr of liquid waste containing 2,532.8 ppm of tellurium and 1,451.8 ppm chromium at pH 1. Considering its negative impact to the environment caused by toxic behaviour of tellurium and chromium, it is necessary to treat chemically that's liquid waste. The research of chemical treatment of tellurium and chromium liquid waste from I-131 radioisotope production has been done. The steps of process are involved of neutralisation with NaOH, coagulation-flocculation process for step I using Ca(OH) 2 coagulant for precipitation of sulphate, sulphite, oxalic, chrome Cr 3+ , and coagulation-flocculation process for step II using BaCI 2 coagulant for precipitation of chrome Cr 6+ and tellurium from the supernatant of coagulation in step I. The best result of experiment was achieved at 0.0161 ppm of chromium concentration on the supernatant from coagulation-flocculation of step I using 3.5 g Ca(OH) 2 for 100 ml of liquid waste, and 0.95 ppm of tellurium concentration on the final supernatant from coagulation-flocculation by of step II using 0.7 g BaCI 2 for supernatant from coagulation of step I. (author)

Enhancement of Au-Ag-Te contents in tellurium-bearing ore minerals via bioleaching

Science.gov (United States)

Choi, Nag-Choul; Cho, Kang Hee; Kim, Bong Ju; Lee, Soonjae; Park, Cheon Young

2018-03-01

The purpose of this study was to enhance the content of valuable metals, such as Au, Ag, and Te, in tellurium-bearing minerals via bioleaching. The ore samples composed of invisible Au and Au paragenesis minerals (such as pyrite, chalcopyrite, sphalerite and galena) in combination with tellurium-bearing minerals (hessite, sylvanite and Tellurobismuthite) were studied. Indigenous microbes from mine drainage were isolated and identified as Acidithiobacillus ferrooxidans, which were used in bioleaching after adaption to copper. The effect of the microbial adaption on the bioleaching performance was then compared with the results produced by the non-adaptive process. The microbial adaption enhanced the Au-Ag-Te contents in biological leaching of tellurium-bearing ore minerals. This suggests that bioleaching with adapted microbes can be used both as a pretreatment and in the main recovery processes of valuable metals.

Tellurium Stable Isotopes as a Paleoredox Proxy

Science.gov (United States)

Wasserman, N.; Johnson, T. M.

2017-12-01

Despite arguments for variably-oxygenated shallow waters and anoxic deep marine waters, which delayed animal development until the Neoproterozoic Oxidation Event, the magnitude of atmospheric oxygen during the Proterozoic is still uncertain [1]. The evidence for low pO2 (<0.1-1% PAL) is based on geochemical and isotopic proxies, which track the mobilization of Fe and Mn on the continents. For example, large chromium isotope shifts occur at the Neoproterozoic Oxidation Event due to the initiation of Cr redox cycling, but this proxy is insensitive to fluctuations in the lower-pO2 conditions at other times during the Proterozoic. Tellurium, a metalloid with a lower threshold to oxidation, may be sensitive to pO2 shifts in a lower range. In the reduced forms, Te(-II) and Te(0), the element is insoluble and immobile. However, in the more oxidized phases, Te(IV) and Te(VI), Te can form soluble oxyanions (though it tends to adsorb to Fe-oxyhydroxides and clays) [2]. Te stable isotopes have been shown to fractionate during abiotic or biologic reduction of Te(VI) or Te(IV) to elemental Te(0) [3, 4]. Utilizing hydride generation MC-ICP-MS, we are able to obtain high precision (2σ 0.04‰) measurements of δ128Te/125Te for natural samples containing < 10 ng of Te. A suite of Phanerozoic and Proterozoic ironstones show significant variation in δ128Te/125Te (<0.5‰), suggesting that the Te redox cycle was active during the Proterozoic. Future directions will include Te isotope measurements of Precambrian paleosols to determine natural isotope variation before the Great Oxidation Event and experiments to determine fractionation during adsorption to Fe-oxyhydroxides. [1] Planavsky et al. (2014) Science 346 (6209), pp. 635-638 [2] Qin et al. (2017) Environmental Science and Technology 51 (11), pp 6027-6035 [3] Baesman et al. (2007) Applied Environmental Microbiology 73 (7), pp 2135-2143 [4] Smithers and Krause (1968) Canadian Journal of Chemistry 46(4): pp 583-591

Rutherford backscatter measurements on tellurium and cadmium implanted gallium arsenide

International Nuclear Information System (INIS)

Bell, E.C.

1979-10-01

The primary aim of the work described in this thesis was to examine implanted layers of the dopant impurities cadmium and tellurium in gallium arsenide and to experimentally assess their potential for producing electrically active layers. 1.5 MeV Rutherford backscattering measurements of lattice disorder and atom site location have been used to assess post implantation thermal annealing and elevated temperature implantations to site the dopant impurities on either gallium or arsenic lattice positions in an otherwise undisordered lattice. Pyrolitically deposited silicon dioxide was used as an encapsulant to prevent thermal dissociation of the gallium arsenide during annealing. It has been shown that high doses of cadmium and tellurium can be implanted without forming amorphous lattice disorder by heating the gallium arsenide during implantation to relatively low temperatures. Atom site location measurements have shown that a large fraction of a tellurium dose implanted at 180 0 C is located on or near lattice sites. Channeled backscatter measurements have shown that there is residual disorder or lattice strain in gallium arsenide implanted at elevated temperatures. The extent of this disorder has been shown to depend on the implanted dose and implantation temperature. The channeling effect has been used to measure annealing of the disorder. (author)

Phenylethynyl-butyltellurium inhibits the sulfhydryl enzyme Na+, K+ -ATPase: an effect dependent on the tellurium atom.

Science.gov (United States)

Quines, Caroline B; Rosa, Suzan G; Neto, José S S; Zeni, Gilson; Nogueira, Cristina W

2013-11-01

Organotellurium compounds are known for their toxicological effects. These effects may be associated with the chemical structure of these compounds and the oxidation state of the tellurium atom. In this context, 2-phenylethynyl-butyltellurium (PEBT) inhibits the activity of the sulfhydryl enzyme, δ-aminolevulinate dehydratase. The present study investigated on the importance of the tellurium atom in the PEBT ability to oxidize mono- and dithiols of low molecular weight and sulfhydryl enzymes in vitro. PEBT, at high micromolar concentrations, oxidized dithiothreitol (DTT) and inhibited cerebral Na(+), K(+)-ATPase activity, but did not alter the lactate dehydrogenase activity. The inhibition of cerebral Na(+), K(+)-ATPase activity was completely restored by DTT. By contrast, 2-phenylethynyl-butyl, a molecule without the tellurium atom, neither oxidized DTT nor altered the Na(+), K(+)-ATPase activity. In conclusion, the tellurium atom of PEBT is crucial for the catalytic oxidation of sulfhydryl groups from thiols of low molecular weight and from Na(+), K(+)-ATPase.

Study On Analytical Methods Of Tellurium Content In Natriiodide (Na131I) Radiopharmaceutical Solution Produced In The Dalat Nuclear Reactor

International Nuclear Information System (INIS)

Vo Thi Cam Hoa; Duong Van Dong; Nguyen Thi Thu; Chu Van Khoa

2007-01-01

This report describes the practical methods for analyzing of Tellurium content in Na 131 I solution produced at the Dalat Nuclear Research Institute. We studied analytical methods to control Tellurium content in final Na 131 I solution product used in medical purposes by three methods such as: spot test, gamma spectrometric and spectrophotometric methods. These investigation results are shown that the spot test method is suitable for controlling Tellurium trace in the final product. This spot test can be determinate Tellurium trace less than 10 ppm and are used to quality control of Na 131 I solution using in medical application. (author)

Simple and effective method for nuclear tellurium isomers separation from antimony cyclotron targets

International Nuclear Information System (INIS)

Bondarevskij, S.I.; Eremin, V.V.

1999-01-01

Simple and effective method of generation of tellurium nuclear isomers from irradiated on cyclotron metallic antimony is suggested. Basically this method consists in consideration of the big difference in volatilities of metallic forms of antimony, tin and tellurium. Heating of the tin-antimony alloy at 1200 K permits to separate about 90 % of produced quantity of 121m Te and 123m Te (in this case impurity of antimony radionuclides is not more than 1 % on activity) [ru

Simultaneous determination of selenium and tellurium in native sulfur by atomic absorption spectrophotometry

International Nuclear Information System (INIS)

Arikawa, Yoshiko; Hirai, Shoji; Ozawa, Takejiro.

1979-01-01

A method for the determination of selenium and tellurium in native sulfur has been investigated by means of atomic absorption spectrophotometry. Native sulfur collected from around fumarole or volcanic crater is ground down into powder, a portion of which weighing 1 g is subjected to analysis. A 2.6% (w/v) sodium hydroxide solution is added by 10 ml to the sample in a teflon beaker, and the mixture is then heated on a hot plate. Sulfur is decomposed and dissolved in the form of disulfide and thiosulfate. A 30% hydrogenperoxide solution is added by 10 ml to oxidize them to sulfate. At the same time selenium and tellurium contained in the sulfur sample are also thought to be oxidized to Se(VI) and Te(VI) states. The solution is neutralized with hydrochloric acid and diluted with distilled water to 100 ml. The sample solution thus prepared is sprayed into the air-acetylene flame of the atomic absorption spectrophotometer. The absorbance is measured at 195.9 nm for selenium and 214.2 nm for tellurium. Calibration curve is prepared by measuring the absorbances of the solutions prepared as follows. One gram portions of pure sulfur (99.9999%) are decomposed as for the samples. After neutralization, standard solutions containing each same amount of selenium and tellurium (0 -- 1000 μg) are added to the sulfur solution and then diluted with water to 100 ml. The standard deviations were estimated to be 50.4 ppm for selenium at 756 ppm and 16.6 ppm for tellurium at 587 ppm. For the check of the reliability of the method, results were compared with those obtained by neutron activation analysis. Results obtained by both methods showed good agreement. (author)

Selenium- or tellurium- containing bile acids and derivatives thereof

International Nuclear Information System (INIS)

Monks, R.; Riley, A.L.M.

1981-01-01

This invention relates to the preparation of selenium and tellurium derivatives, particularly γ-emitting radioactive derivatives of bile acids and bile salts. Such compounds are valuable in the examination of body function, especially small bowel function. (author)

Electrochemical characterization of the underpotential deposition of tellurium on Au electrode

International Nuclear Information System (INIS)

Zhu, W.; Yang, J.Y.; Zhou, D.X.; Bao, S.Q.; Fan, X.A.; Duan, X.K.

2007-01-01

Electrochemical characterization of the underpotential deposition (UPD) of tellurium on Au substrate has been performed in this paper. The mechanism of Te deposition and its voltammetry dependence on the Te ion concentration were studied, and it suggests that variations in the metal ion concentration may affect the UPD process kinetics. The effect of tellurium adsorbates on UPD behavior of Te has also been investigated. The results show that the tellurium adsorbates could be irreversibly adsorbed upon the Au substrate surface under the open-circuit conditions. Subsequent removal of the Te adsorbates was also proved to be very difficult within the Au double-layer region, and a standard electrochemical cleaning procedure is necessary to remove the Te adsorbates completely. When the potential was cycled into the Au oxidation region, a substantial loss of Te adsobates was observed, which occurs simultaneously with the Au oxidation features. Scan rate dependent cyclic voltammetry experiments reveal that the peak current in the Te UPD peak is not a linear function of the scan rate, ν, but of a 2/3 power of the scan rate, ν 2/3 . It is in good consistent with a two-dimension nucleation and growth mechanism

Speciation analysis of tellurium by solid-phase extraction in the presence of ammonium pyrrolidine dithiocarbamate and inductively coupled plasma mass spectrometry

Energy Technology Data Exchange (ETDEWEB)

Yu, Chunhai; Cai, Qiantao; Guo, Zhong-Xian; Yang, Zhaoguang [Centre for Advanced Water Technology, Innovation Centre (NTU), Singapore (Singapore); Khoo, Soo Beng [Department of Chemistry, National University of Singapore (Singapore)

2003-05-01

Under acidic conditions tellurium(IV) formed a complex with ammonium pyrrolidine dithiocarbamate (APDC). The tellurium(IV) complex was completely retained on a non-polar Isolute silica-based octadecyl (C{sub 18}) sorbent-containing solid-phase extraction (SPE) cartridge, while the uncomplexed Te(VI) passed through the cartridge and remained as a free species in the solution. Only partial Te(IV) was retained on the SPE cartridge for samples without addition of APDC. On the basis of different retention behaviours of the complexed Te(IV) and uncomplexed Te(VI), a simple and highly sensitive method is proposed for the determination of total tellurium and Te(VI) by SPE separation and inductively coupled plasma mass spectrometry (ICP-MS) detection. The Te(IV) concentration was calculated as the difference between total tellurium and Te(VI) concentrations. The detection limit (3{sigma}) is 3 ng L{sup -1} tellurium. Factors affecting the separation and detection of tellurium species were investigated. Coexisting ions did not show significant interferences with the Te(IV)-APDC complex retention and the subsequent ICP-MS detection of Te. The method has been successfully applied to the tellurium speciation analysis in waters with spiked recoveries for Te(IV) and Te(VI) of 86.0-108% and 87.1-97.4%, respectively. (orig.)

Intergranular tellurium cracking of nickel-based alloys in molten Li, Be, Th, U/F salt mixture

Science.gov (United States)

Ignatiev, Victor; Surenkov, Alexander; Gnidoy, Ivan; Kulakov, Alexander; Uglov, Vadim; Vasiliev, Alexander; Presniakov, Mikhail

2013-09-01

In Russia, R&D on Molten Salt Reactor (MSR) are concentrated now on fast/intermediate spectrum concepts which were recognized as long term alternative to solid fueled fast reactors due to their attractive features: strong negative feedback coefficients, easy in-service inspection, and simplified fuel cycle. For high-temperature MSR corrosion of the metallic container alloy in primary circuit is the primary concern. Key problem receiving current attention include surface fissures in Ni-based alloys probably arising from fission product tellurium attack. This paper summarizes results of corrosion tests conducted recently to study effect of oxidation state in selected fuel salt on tellurium attack and to develop means of controlling tellurium cracking in the special Ni-based alloys recently developed for molten salt actinide recycler and tranforming (MOSART) system. Tellurium corrosion of Ni-based alloys was tested at temperatures up to 750 °C in stressed and unloaded conditions in molten LiF-BeF2 salt mixture fueled by about 20 mol% of ThF4 and 2 mol% of UF4 at different [U(IV)]/[U(III)] ratios: 0.7, 4, 20, 100 and 500. Following Ni-based alloys (in mass%): HN80М-VI (Mo—12, Cr—7.6, Nb—1.5), HN80МТY (Mo—13, Cr—6.8, Al—1.1, Ti—0.9), HN80МТW (Mo—9.4, Cr—7.0, Ti—1.7, W—5.5) and ЕМ-721 (W—25.2, Cr—5.7, Ti—0.17) were used for the study in the corrosion facility. If the redox state the fuel salt is characterized by uranium ratio [U(IV)]/[U(III)] uranium intermetallic compounds and alloys with nickel and molybdenum. This leads to spontaneous behavior of alloy formation processes on the specimens' surface and further diffusion of uranium deep into the metallic phase. As consequence of this films of intermetallic compounds and alloys of nickel, molybdenum, tungsten with uranium are formed on the alloys specimens' surface, and intergranular corrosion does not take place. In the fuel salt with [U(IV)]/[U(III)] = 4-20 the potentials of uranium

Determination of tellurium in coal samples by means of graphite furnace atomic absorption spectrometry after coprecipitation with iron(III) hydroxide

Energy Technology Data Exchange (ETDEWEB)

Oda, S.; Arikawa, Y. [Japan Womens University, Tokyo (Japan)

2005-11-01

A simple and accurate method for the determination of tellurium in coal samples was investigated by the combustion of samples under a high pressure of oxygen and coprecipitation with Fe(OH){sub 3}, followed by a measurement by graphite furnace atomic absorption spectrometry (GF-AAS). About 0.5 g of an accurately weighed ground coal sample and 0.5 g of starch were combusted in an oxygen combustion bomb filled with oxygen to 3 MPa and added with 3 ml of water as an absorbing solution. The formed tellurium trioxide TeOs dissolved in water as TeO{sub 4}{sup 2-}, which was in turn reduced to TeO{sub 3}{sup 2-} by heating. After diluting the above-mentioned solution up to about 50 ml with water, Fe(OH){sub 3} is formed upon adding Fe(NO{sub 3}){sub 3} and sodium hydroxide solutions at pH 8-9 and left standing overnight. After dissolving the precipitate by HCl, the solution was diluted to 10 ml with water and the concentration of tellurium was measured by GF-AAS at a wavelength of 214.3 nm. The standard addition method was employed for the determination of tellurium in real coal samples, because those processes for the formation of tellurium(VI) oxide and coprecipitation with Fe(OH)3 were interfered by matrices. For NIST SRM 1632c, the standard coal sample tellurium content of 0.057 {+-} 0.004 mg kg{sup -1} was in good agreement with the information value of 0.05 mg kg{sup -1} with 7% of RSD in five replicate analyses. The tellurium contents in 20 real coal samples given by Center for Coal Utilization, Japan were also determined. The tellurium contents in these samples were scattered over the narrow range between 0.032 and 0.100 mg kg{sup -1}.

Site-specific nucleation and controlled growth of a vertical tellurium nanowire array for high performance field emitters

International Nuclear Information System (INIS)

Safdar, Muhammad; Zhan Xueying; Mirza, Misbah; Wang Zhenxing; Sun Lianfeng; He Jun; Niu Mutong; Zhang Jinping; Zhao Qing

2013-01-01

We report the controlled growth of highly ordered and well aligned one-dimensional tellurium nanostructure arrays via a one-step catalyst-free physical vapor deposition method. The density, size and fine structures of tellurium nanowires are systematically studied and optimized. Field emission measurement was performed to display notable dependence on nanostructure morphologies. The ordered nanowire array based field emitter has a turn-on field as low as 3.27 V μm −1 and a higher field enhancement factor of 3270. Our finding offers the possibility of controlling the growth of tellurium nanowire arrays and opens up new means for their potential applications in electronic devices and displays. (paper)

Exploring molecular and spin interactions of Tellurium adatom in reduced graphene oxide

Energy Technology Data Exchange (ETDEWEB)

Alegaonkar, Ashwini [Department of Chemistry, Savitribai Phule Pune University (Formerly University of Pune), Ganeshkhind, Pune, 411 007, MS (India); Alegaonkar, Prashant [Department of Applied Physics, Defence Institute of Advance Technology, Girinagar, Pune, 411 025, MS (India); Pardeshi, Satish, E-mail: skpar@chem.unipune.ac.in [Department of Chemistry, Savitribai Phule Pune University (Formerly University of Pune), Ganeshkhind, Pune, 411 007, MS (India)

2017-07-01

The transport of spin information fundamentally requires favourable molecular architecture and tunable spin moments to make the medium pertinent for spintronic. We report on achieving coherent molecular-spin parameters for rGO due to Tellurium (Te) adatom. Initially, GO prepared using graphite, was modified into rGO by in situ incorporation of 1 (w/w)% of Te. Both the systems were subjected to ESCA, FTIR, Raman dispersion, ESR spectroscopy, and electron microscopy. Analysis revealed that, Te substantially reacted with epoxides, carbonyl, and carboxylate groups that improved C-to-O ratio by twice. However, the spin splitting character, between Te and C, seems to be quenched. Moreover, Te altered the dynamical force constant between C-C and C=C that generated the mechanical stress within rGO network. The layer conjugation, nature of folding, symmetry, and electronic states of the edges were also affected by precipitation and entrapment of Te. The calculated dynamic molecular Raman and ESR spin parameters indicated that, Te acted as a bridging element for long range spin transport. This is particularly due to, the p-orbital moments of Te contributing, vectorially, to spin relaxation process operative at broken inversion symmetry sites. Our study suggests that, facile addition of Te in rGO is useful to achieve favourable spintronic properties. - Highlights: • Spin interactions and molecular dynamics modification due to Tellurium adatom in rGO. • Molecular level manipulation of Tellurium adatom for favourable spintronic properties. • Bychocov-Rashaba coupling are the operative channels in rGO. • Extrinsic coupling component get added vectorially by Tellurium. • Te-rGO is a viable medium for molecular spintronics.

Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery.

Science.gov (United States)

Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric

2017-04-01

Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

Comparison of analytical possibilities of inversion voltammetry of tellurium with cathodic and anodic potential scanning taking layer-by-layer analysis of GaAs-Te films as example

International Nuclear Information System (INIS)

Kaplin, A.A.; Portnyagina, Eh.O.; Gridaev, V.F.

1979-01-01

Possibility of application in analytical purposes of the process of tellurium precipitation electrosolution from the surfaces of graphite and mercury-graphite electrodes at the cathode scanning of the potential is shown. As a result of comparison of direct and inversion scanning with cathodic and anodic scanning of the potential, variants of voltammetric method of tellurium determination in artificial solutions and, taking the developed method of layer-by-layer analysis of the GaAsTe films as an example, advantage of mercury-graphite electrode with cathodic scanning as compared to graphite electrode with cathode scanning of the potential is shown. Reproducibility of the GaAs film analysis results according to anodic and cathodic tellurium peaks is satisfactory. Maximum deviation from the results of analysis of oxidation peaks and tellurium peduction does not exceed 15 rel. %. Thus, for tellurium concentrations, exceeding 5x10 -6 g-ion/l, both anodic and cathodic scanning of the potential can be used, though error in tellurium determination according to cathodic peaks is 1.5-2.0 times higher. At tellurium amounts lower 5x10 -6 g-ion/l the determination should be carried out according to the peaks of tellurium anodic oxidation from the surface of graphite electrode or according to the peaks of tellurium cathodic reduction from the surface of mercury-graphite electrode

Modelling the chemical behaviour of tellurium species in the reactor pressure vessel and the reactor cooling system under severe accident conditions

International Nuclear Information System (INIS)

Alonso, A.; Gonzalez, C.

1991-07-01

This state of the art report contains information on the behaviour of tellurium and its compounds in the reactor pressure vessel and the reactor coolant system under light water reactor severe accident conditions. To characterise tellurium behaviour, it is necessary the previous knowledge of the species of tellurium released from the core, and simultaneity of its release with that of other materials which can alter the transport, for instance, control rod and structural materials. Release and transport experiments have been reviewed along with the models implemented in the codes which are used in the international community: TRAPMELT, RAFT, VICTORIA and SOPHIE. From the experiments, it can be concluded that other species different to Te 2 , such as tin telluride and cesium telluride, may be released from the fuel. That is why they must be considered in the transport phenomena. There is also experimental evidence of the strong interaction of Te 2 with Inconel 600 and stainless steel of the pipe walls and structures, however this strong interaction is in competition with the interaction of tellurium with aerosols, which under severe accident conditions may represent an area greater than that of the primary system. It is for the absence of significant tellurium species in the transport models, and also for the interaction of tellurium with aerosols, for which some codes show the greatest deficiencies

The enhancing of Au-Ag-Te content in tellurium-bearing ore mineral by bio-oxidation-leaching

Science.gov (United States)

Kim, PyeongMan; Kim, HyunSoo; Myung, EunJi; Kim, YoonJung; Lee, YongBum; Park*, CheonYoung

2015-04-01

The purpose of this study is to enhance the content of valuable metals such as Au-Ag-Te in tellurium-bearing minerals by bio-oxidation-leaching. It was confirmed that pyrite, chalcopyrite, sphalerite and galena were produced together with tellurium-bearing minerals including hessite, sylvanite and tellurobismuthite from ore minerals and concentrates through microscopic observation and SEM/EDS analysis. In a bio-oxidation-leaching experiment, with regard to Au, Ag, Te, Cu and Fe, the changes in the amount of leaching and the content of leaching residues were compared and analyzed with each other depending on the adaptation of an indigenous microbe identified as Acidithiobacillus ferrooxidans. As a result of the experiment, the Au-Ag-Te content in tellurium-bearing ore mineral was enhanced in the order of physical oxidation leaching, physical/non-adaptive bio-oxidation-leaching and physical/adaptive biological leaching. It suggests that the bio-oxidation-leaching using microbes adapted in tellurium-bearing ore mineral can be used as a pre-treatment and a main process in a recovery process of valuable metals. "This research was supported by Basic Science Research Program through the National Research Foundation of Korea(NRF) funded by the Ministry of Education(NRF-2013R1A1A2004898)"

ELECTROCHEMICAL STUDY OF RHENIUM-TELLURIUM-COPPER SYSTEM

OpenAIRE

E.A.Salakhova*1, D.B.Tagiyev2, P.E.Kalantarova3 and A.M.Askerova4

2017-01-01

The formation of the triple alloys Re-Te-Cu on the platinum electrode at volt amperemetric cycling has been studied. The investigation was carried out from chloride acidic solution containing tellurium acid, potassium perrhenate, chloride copper. The kinetics of the processes was controlled using the measurements by the method of cyclic volt-amperometry on the device İVİUMSTAT. For the analysis of composition and structure the methods of XRD (X-ray diffraction analysis) were used, and the inv...

Acousto-optic measurements of ultrasound attenuation in tellurium dioxide crystal

International Nuclear Information System (INIS)

Voloshinov, V. B.; Lemyaskina, E. A.

1996-01-01

The paper is devoted to experimental investigation of ultrasound propagation in tellurium dioxide monocrystal. In particular, attenuation of slow shear acoustic modes in the crystal was measured. The measurements were performed by acousto-optic methods using probing of acoustic column by a laser beam. The paper describes measurements of acoustic attenuation coefficient for slow shear ultrasonic waves propagating at an angle =4.5 O with respect to the (110) direction in the (110) plane. The investigation was made at acoustic frequency f = 100 MHz with pulsed acoustic waves and with an optical beam of a He-Ne laser. It is found that the attenuation coefficient is α = 0.57 cm -1 ± 15 %. The attenuation at acoustic frequencies f ≥ 100 MHz influences performance characteristics of acousto-optical devices based on tellurium dioxide. As proved, spectral resolution of a quasicollinear acoustooptic filter decreases by a factor of 2 compared to a case of the attenuation absence. (authors)

Solvent Extraction of Tellurium from Chloride Solutions Using Tri-n-butyl Phosphate: Conditions and Thermodynamic Data

Directory of Open Access Journals (Sweden)

Dongchan Li

2014-01-01

Full Text Available The extractive separation of tellurium (IV from hydrochloric acid media with tri-n-butyl phosphate (TBP in kerosene was investigated. The dependence on the extraction of tellurium species, concentrations of tellurium and TBP, extraction time and stage, organic/aqueous ratio, and interferences from coexist metallic ions were examined and are discussed. Besides, the stripping agent and stripping time were also studied. It was found that the extraction reaction corresponds to the neutral complex formation mechanism and the extracted species is TeCl4·3TBP and that the extraction process is exothermic. The thermodynamic parameters of enthalpy ΔH, entropy ΔS, and free energy ΔG of the extraction process were evaluated at −26.2 kJ·mol−1, −65.6 J·mol−1·K−1, and −7.0 kJ·mol−1, respectively at 293 K.

Copper Tellurium Oxides - A Playground for Magnetism.

Energy Technology Data Exchange (ETDEWEB)

Norman, M. R.

2018-04-15

A variety of copper tellurium oxide minerals are known, and many of them exhibit either unusual forms of magnetism, or potentially novel spin liquid behavior. Here, I review a number of the more interesting materials with a focus on their crystalline symmetry and, if known, the nature of their magnetism. Many of these exist (so far) in mineral form only, and most have yet to have their magnetic properties studied. This means a largely unexplored space of materials awaits our exploration.

Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

International Nuclear Information System (INIS)

Bajo, S.; Wyttenbach, A.

1978-03-01

The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

A Magnetic Resonance Force Microscopy Quantum Computer with Tellurium Donors in Silicon

OpenAIRE

Berman, G. P.; Doolen, G. D.; Tsifrinovich, V. I.

2000-01-01

We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines the well-developed silicon technology with expected advances in MRFM.

Subnanosecond pulse measurements of 10.6 μm radiation with tellurium

NARCIS (Netherlands)

Haselhoff, E.H.; Bonnie, R.J.M.; Ernst, G.J.; Witteman, W.J.

1988-01-01

Subnanosecond infrared pulses have been measured by noncollinear secondharmonic generation in tellurium. The method is very practical because due to the high refractive index the fine tuning of the phase matching is easily obtained by rotating the crystal around the optic axis.

Flotation concentration for tellurium determination in industrial sewage

International Nuclear Information System (INIS)

Skripchuk, V.G.; Bormotova, L.V.; Lukoyanova, L.P.; Tret'yakova, M.I.

1983-01-01

Combination of the flotation of tellurium (4) precipitate with papaverine toluene and extraction-photometric determination of Te with butylrhodamine C allows one to determine 0.002-0.1 mg Te/l without its preliminary precipitation. Accompanying elements found in non-ferrous metallurgy sewage have no effect upon it. The duration of analysis of 10 samples is 1 to 1.5 h. Relative error is 12%. The method is introduced at the ''Uralelektromed'' plant

Magnetic resonance force microscopy quantum computer with tellurium donors in silicon.

Science.gov (United States)

Berman, G P; Doolen, G D; Hammel, P C; Tsifrinovich, V I

2001-03-26

We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines well-developed silicon technology and expected advances in MRFM. Our proposal does not use electrostatic gates to realize quantum logic operations.

Magnetic Resonance Force Microscopy Quantum Computer with Tellurium Donors in Silicon

International Nuclear Information System (INIS)

Berman, G. P.; Doolen, G. D.; Hammel, P. C.; Tsifrinovich, V. I.

2001-01-01

We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines well-developed silicon technology and expected advances in MRFM. Our proposal does not use electrostatic gates to realize quantum logic operations

Determination of half life of tellurium isotopes: a proposal for the teaching of nuclear physics

International Nuclear Information System (INIS)

Ruivo, Julio C.; Zamboni, Cibele B.; Batista, Wagner F.

2013-01-01

This work aimed at the development of courseware for teaching nuclear physics, using experimental data of half-life measurement (T1/2) of Tellurium isotopes (A=127 and 131). The choice of Tellurium was established for providing nuclear data, which are fundamental in related investigations of nuclear structure and its use in various areas such as geochemistry, chemical and pharmaceutical industries, astrophysics etc. For evaluation of the proposal performance, the material was made available, bringing a lot of information about nuclear safety, production and storage of radioactive material and concepts of radioactive decay, subatomic particles, emission of gamma radiation, half-life, etc.

Determination of half life of tellurium isotopes: a proposal for the teaching of nuclear physics

Energy Technology Data Exchange (ETDEWEB)

Ruivo, Julio C.; Zamboni, Cibele B.; Batista, Wagner F., E-mail: julio.ruivo.costa@usp.br, E-mail: czamboni@ipen.br, E-mail: fisicawagner@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2013-07-01

This work aimed at the development of courseware for teaching nuclear physics, using experimental data of half-life measurement (T1/2) of Tellurium isotopes (A=127 and 131). The choice of Tellurium was established for providing nuclear data, which are fundamental in related investigations of nuclear structure and its use in various areas such as geochemistry, chemical and pharmaceutical industries, astrophysics etc. For evaluation of the proposal performance, the material was made available, bringing a lot of information about nuclear safety, production and storage of radioactive material and concepts of radioactive decay, subatomic particles, emission of gamma radiation, half-life, etc.

The dependence of the texture of tellurium thin films on vacuum deposition angle

International Nuclear Information System (INIS)

Cocks, F.H.; Peterson, M.J.; Jones, P.L.

1980-01-01

Vacuum-deposited tellurium thin films can show substantially different surface morphologies depending on the angle with which the vapor stream impinges on the substrate surface. These tellurium thin films have a tendency to grow as acicular crystallites but as the deposition angle is increased so that the vapor stream becomes tangential to the substrate surface the spacing between crystallites increases and approaches, at stream angles of approximately 80 0 from the normal, dimensions roughly once or twice the average wavelength of visible light. Such films may have application in solar energy collector systems because of the high absorptivity of sunlight shown by such films. Mechanisms which describe the tendency for crystallite spacing to increase with increasing angle are discussed. (Auth.)

Large-scale synthesis of Tellurium nanostructures via galvanic displacement of metals

Science.gov (United States)

Kok, Kuan-Ying; Choo, Thye-Foo; Ubaidah Saidin, Nur; Rahman, Che Zuraini Che Ab

2018-01-01

Tellurium (Te) is an attractive semiconductor material for a wide range of applications in various functional devices including, radiation dosimeters, optical storage materials, thermoelectric or piezoelectric generators. In this work, large scale synthesis of tellurium (Te) nanostructures have been successfully carried out in different concentrations of aqueous solutions containing TeO2 and NaOH, by galvanic displacements of Zn and Al which served as the sacrificial materials. Galvanic displacement process is cost-effective and it requires no template or surfactant for the synthesis of nanostructures. By varying the concentrations of TeO2 and NaOH, etching temperatures and etching times, Te nanostructures of various forms of nanostructures were successfully obtained, ranging from one-dimensional needles and rod-like structures to more complex hierarchical structures. Microscopy examinations on the nanostructures obtained have shown that both the diameters and lengths of the Te nanostructures increased with increasing etching temperature and etching time.

Iodine-129 in thyroids and tellurium isotopes in meteorites by neutron activation analysis

International Nuclear Information System (INIS)

Ballad, R.V.

1978-06-01

A combination of neutron activation and mass spectrometry has been used to determine the concentration of fissiogenic 129 I and the value of the 129 I/ 127 I ratio in thyroids of man, cow, and deer from Missouri. Deer thyroids show an average value of 129 I/ 127 I = 1.8 x 10 -8 and an average concentration of 3 x 10 -3 pCi 129 I per gram of thyroid (wet weight). Thyroids of cows and humans show successively lower values for the 129 I/ 127 I ratio and the 129 I content because their diets dilute fission-produced 129 I in the natural iodine cycle with mineral iodine. The results of analyses on a few thyroids from other geographic areas are also reported. The isotopic compositions of tellurium, krypton, and xenon were determined in acid-resistant residues of the Allende meteorite. Neutron activation and γ-counting were used to determine the relative abundances of six tellurium isotopes, and mass spectrometry was used to determine the isotopic compositions of krypton and xenon in aliquots of the same residues. Nucleogenetic anomalies were observed in the isotopic compositions of these three elements. The presence of isotopically distinct components of tellurium, krypton, and xenon in these residues provides strong support for the suggestion that our solar system formed directly from the debris of a supernova

Organotellurium ligands – designing and complexation reactions

Indian Academy of Sciences (India)

Unknown

membered rings it is negative and ~30 ppm only. Keywords. Organotellurium ligands; hybrid telluroether; platinum metal complexes; tellurium-125 NMR. 1. Introduction. Tellurium is the noblest metalloid which may act as a Lewis acid as well as Lewis base. The ligand chemistry of tellurium, which acts as a 'soft' donor, was ...

Thermoelectric properties of bismuth antimony tellurium thin films through bilayer annealing prepared by ion beam sputtering deposition

Energy Technology Data Exchange (ETDEWEB)

Zheng, Zhuang-hao [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Fan, Ping, E-mail: fanping308@126.com [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Luo, Jing-ting [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Cai, Xing-min; Liang, Guang-xing; Zhang, Dong-ping [College of Physics Science and Technology, Shenzhen University, 518060 (China); Ye, Fan [Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China)

2014-07-01

Bismuth antimony tellurium is one of the most important tellurium-based materials for high-efficient thermoelectric application. In this paper, ion beam sputtering was used to deposit Bi{sub 2}Te{sub 3} and Sb{sub 2}Te{sub 3} bilayer thin films on borosilicate substrates at room-temperature. Then the bismuth antimony tellurium thin films were synthesized via post thermal treatment of the Bi{sub 2}Te{sub 3} and Sb{sub 2}Te{sub 3} bilayer thin films. The effect of annealing temperature and compositions on the thermoelectric properties of the thin films was investigated. After the thin films were annealed from 150 °C to 350 °C for 1 h in the high vacuum condition, the Seebeck coefficient changed from a negative sign to a positive sign. The X-ray diffraction results showed that the synthesized tellurium-based thermoelectric thin film exhibited various alloys phases, which contributed different thermoelectricity conductivity to the synthesized thin film. The overall Seebeck coefficient of the synthesized thin film changed from negative sign to positive sign, which was due to the change of the primary phase of the tellurium-based materials at different annealing conditions. Similarly, the thermoelectric properties of the films were also associated with the grown phase. High-quality thin film with the Seebeck coefficient of 240 μV K{sup −1} and the power factor of 2.67 × 10{sup −3} Wm{sup −1} K{sup −2} showed a single Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} phase when the Sb/Te thin film sputtering time was 40 min. - Highlights: • Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} thermoelectric thin films synthesized via bilayer annealing • The film has single Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} phase with best thermoelectric performance. • The film has high thermoelectric properties comparable with other best results.

Equilibrium state of delta-phase with tellurium in the Sb-Bi-Te system

International Nuclear Information System (INIS)

Gajgukova, V.S.; Dudkin, L.D.; Erofeev, R.S.; Musaelyan, V.V.; Nadzhip, A.Eh.; Sokolov, O.B.

1978-01-01

A research has been carried out with a view to establish the equilibrium state of delta-phase of the composition (Sbsub(1-x)Bisub(x)) 2 Te 3 with tellurium, depending on x and temperature. The Hall effect, the thermoelectromotive force, and the electric conductivity of the samples of Sb-Bi-Te alloys have been measured, the samples being annealed at various temperatures (550 to 250 deg C). The measurement results have shown that as the Bi 2 Te 3 content in the solid solutions increases and temperature decreases, the delta-phase-Te boundary monotonously approaches the stoichiometric composition. Using the research carrid out as the basis, the general character of the equilibrium delta-phase with tellurium boundary has been rendered more precise in Sb-Bi-Te system, depending on the temperature and Bi content (up to 25 at.%)

GALVANIC MAGNETIC PROPERTIES OF BISMUTH THIN FILMS DOPED WITH TELLURIUM MADE BY THERMAL VACUUM EVAPORATION

Directory of Open Access Journals (Sweden)

V. A. Komarov

2013-01-01

Full Text Available The influence of n-type impurity of tellurium (concentration range from 0.005 atomic % Te to 0.15 atomic % Te on galvanic magnetic properties (resistivity, magnetic resistance and Hall constant of Bi thin films with various thicknesses was studied. The properties were measured in temperature range from 77 to 300 K. It was established that the classical size effect in the films is significant and decreases with higher concentration of Te impurity. The analysis of experimental results was carried out in approximation of the law of Jones-Schoenberg dispersion for Bi films doped with tellurium. Calculation of concentration and mobility of charge carriers in the studied films was made.

Hydrogen-assisted post-growth substitution of tellurium into molybdenum disulfide monolayers with tunable compositions

Science.gov (United States)

Yin, Guoli; Zhu, Dancheng; Lv, Danhui; Hashemi, Arsalan; Fei, Zhen; Lin, Fang; Krasheninnikov, Arkady V.; Zhang, Ze; Komsa, Hannu-Pekka; Jin, Chuanhong

2018-04-01

Herein we report the successful doping of tellurium (Te) into molybdenum disulfide (MoS2) monolayers to form MoS2x Te2(1-x) alloy with variable compositions via a hydrogen-assisted post-growth chemical vapor deposition process. It is confirmed that H2 plays an indispensable role in the Te substitution into as-grown MoS2 monolayers. Atomic-resolution transmission electron microscopy allows us to determine the lattice sites and the concentration of introduced Te atoms. At a relatively low concentration, tellurium is only substituted in the sulfur sublattice to form monolayer MoS2(1-x)Te2x alloy, while with increasing Te concentration (up to ˜27.6% achieved in this study), local regions with enriched tellurium, large structural distortions, and obvious sulfur deficiency are observed. Statistical analysis of the Te distribution indicates the random substitution. Density functional theory calculations are used to investigate the stability of the alloy structures and their electronic properties. Comparison with experimental results indicate that the samples are unstrained and the Te atoms are predominantly substituted in the top S sublattice. Importantly, such ultimately thin Janus structure of MoS2(1-x)Te2x exhibits properties that are distinct from their constituents. We believe our results will inspire further exploration of the versatile properties of asymmetric 2D TMD alloys.

Electric field fluctuations in liquid tellurium alloys a hint to bond character

NARCIS (Netherlands)

Paulick, C.A.; Brinkmann, R.; Elwenspoek, Michael Curt; von Hartrott, M.; Kiehl, M.; Maxim, P.; Quitmann, D.

1985-01-01

Atomic scale electric field fluctuations in liquid tellurium alloys are detected as they induce nuclear spin relaxation rate RQ in noble gas impurity atoms, via quadrupolar interaction. Results for Xe in liquid Ag, Ga, In, Tl, Ge, Sn---Te alloys are discussed, assuming that bonding in these alloys

Vaporization studies on elemental tellurium and selenium by Knudsen effusion mass spectrometry

Energy Technology Data Exchange (ETDEWEB)

Viswanathan, R., E-mail: rvis1953@gmail.com; Balasubramanian, R., E-mail: rbs@igcar.gov.in; Darwin Albert Raj, D., E-mail: darwinalbertraj1953@gmail.com; Sai Baba, M., E-mail: msb@igcar.gov.in; Lakshmi Narasimhan, T.S., E-mail: tslak@igcar.gov.in

2014-08-01

Highlights: • A detailed KEMS study of vaporization of elemental tellurium and selenium systems. • Clusters Te{sub i}(g) (i = 2 to 7) and Se{sub i}(g) (i = 2 to 9) identified over Te(s) and Se(s). • p–T relations for Te{sub i}(g) (590 to 690 K) and Se{sub i}(g) (380 to 480 K). • Vapor phase of Te dominated by Te{sub 2}(g) (∼95%) while that of Se by Se{sub 6}(g) (∼50%) and Se{sub 5}(g) (∼25%). • Sublimation and atomization enthalpies deduced for Te{sub i}(g) and Se{sub i}(g). - Abstract: Vaporization studies on elemental tellurium and selenium were conducted by Knudsen effusion mass spectrometry in the temperature range of 590–690 K and 380–480 K, respectively. The ionic species Te{sub i}{sup +} (i = 1–7) and Se{sub i}{sup +}(g) (i = 1–9) were detected in the mass spectra over these two condensed phases. Measurement of ion intensities were performed as a function of electron impact energy and as a function of temperature (at different electron impact energies) for identifying the gaseous precursor species as well as for determining the partial pressure–temperature relations and sublimation enthalpies for these species. While the major species over elemental tellurium was confirmed to be Te{sub 2}(g) (with all other gaseous species Te{sub 3}–Te{sub 7} put together constituting less than 5%), the major species over elemental selenium was found to be Se{sub 6}(g), closely followed by Se{sub 5}(g) (with other gaseous species Se{sub 2}–Se{sub 4} and Se{sub 7}–Se{sub 9} put together also moderately constituting ∼25%). From the partial pressures, the thermodynamic data for the sublimation reactions i Te(s) = Te{sub i}(g) and i Se(s) = Se{sub i}(g) were deduced by second- and third-law methods. The atomization enthalpies of tellurium and selenium clusters were also deduced by using the recommended enthalpies of formation of monomeric species. Comparison of the findings obtained in the present study with those in previous studies revealed

Starting material radiation source for Moessbauer investigations of tellurium compounds

International Nuclear Information System (INIS)

Alexandrov, A.J.; Grushko, J.S.; Makarov, E.F.; Mishin, K.Y.; Baltrunas, D.A.J.

1977-01-01

A method is described of preparing a radiation source for Mossbauer investigations of tellurium compounds manufactured on the basis of 5 MgO . Te 124 O 3 . 5 MgO . Te 124 O 3 is irradiated in a reactor by means of thermal neutrons, followed by annealing at a temperature ranging from 600 0 to 1,100 0 C for a period of from 5 to 10 hours

Catalytic activity of oxide cerium-molybdenum-tellurium catalysts in oxidation ammonolysis

International Nuclear Information System (INIS)

Dzhordano, N.; Bart, D.; Madzhori, R.

1984-01-01

A commercial catalyst containing a mixture of Ce-, Mo-, Te oxides deposited on SiO 2 is shown to manifest a high efficiency in oxidative ammonolysis of propylene (C 3 - ) to acrylonitrile (AN). The dependence of the catalytic properties on the catalyst composition and reaction conditions is studied. It is established that three-component mixtures are more active and selective than the systems with a lesser number of components. Using the catalyst with the optimum ratio of constituent oxides in a microreactor at 440 deg enabled one to achieve initial selectivity in terms of AN equal to 82.5% at 97% conversion of C 3 - . Acrolein, acetonitrile, HCN and nitrogen oxides are the reaction by-products. A supposition is made that the reaction proceeds via the formation of π-compleXes on the centres of Te(4). Setective oxidation occurs on oxygen atoms bonded with the Mo(6) ions. Tellurium enhances the molybdenum reducibleness due to delocalization of electrons, whereas the cerium addition to the mixture of tellurium- and molybdenum oxides increases the rate of molybdenum reoxidation and thus enhances the catalytic system stability

Determination of spins and radioactive widths of tellurium nuclear levels with capturre gamma rays

International Nuclear Information System (INIS)

Bianchini, F.G.

1973-01-01

Spins and levels widths of the tellurium, mainly 128 Te and 130 Te, were determinated by gamma spectroscopy. Measurements of inelastic and elastic scattering, angular distribution and scattering temperature dependence, were still made. Energy levels of this isotopes, were also determinated [pt

Selenium and tellurium nanomaterials

Science.gov (United States)

Piacenza, Elena; Presentato, Alessandro; Zonaro, Emanuele; Lampis, Silvia; Vallini, Giovanni; Turner, Raymond J.

2018-04-01

Over the last 40 years, the rapid and exponential growth of nanotechnology led to the development of various synthesis methodologies to generate nanomaterials different in size, shape and composition to be applied in various fields. In particular, nanostructures composed of Selenium (Se) or Tellurium (Te) have attracted increasing interest, due to their intermediate nature between metallic and non-metallic elements, being defined as metalloids. Indeed, this key shared feature of Se and Te allows us the use of their compounds in a variety of applications fields, such as for manufacturing photocells, photographic exposure meters, piezoelectric devices, and thermoelectric materials, to name a few. Considering also that the chemical-physical properties of elements result to be much more emphasized when they are assembled at the nanoscale range, huge efforts have been made to develop highly effective synthesis methods to generate Se- or Te-nanomaterials. In this context, the present book chapter will explore the most used chemical and/or physical methods exploited to generate different morphologies of metalloid-nanostructures, focusing also the attention on the major advantages, drawbacks as well as the safety related to these synthetic procedures.

Deposition of tellurium films by decomposition of electrochemically-generated H{sub 2}Te: application to radiative cooling devices

Energy Technology Data Exchange (ETDEWEB)

Engelhard, T.; Jones, E.D.; Viney, I. [Coventry Univ. (United Kingdom). Centre for Data Storage Mater.; Mastai, Y.; Hodes, G. [Department of Materials and Interfaces, Weizmann Institute of Science, 76100, Rehovot (Israel)

2000-07-17

The preparation of homogenous, large area thin layers of tellurium on thin polyethylene foils is described. The tellurium was formed by room temperature decomposition of electrochemically generated H{sub 2}Te. Pre-treatment of the polyethylene substrates with KMnO{sub 4} to give a Mn-oxide layer was found to improve the Te adhesion and homogeneity. Optical characterization of the layers was performed using UV/VIS/NIR spectroscopy. Such coatings have favorable characteristics for use as solar radiation shields in radiative cooling devices. The simplicity of generation of the very unstable H{sub 2}Te was also exploited to demonstrate formation of size-quantized CdTe nanocrystals. (orig.)

A new tellurium-containing amphiphilic molecule induces apoptosis in HCT116 colon cancer cells.

Science.gov (United States)

Du, Peng; Saidu, Nathaniel Edward Bennett; Intemann, Johanna; Jacob, Claus; Montenarh, Mathias

2014-06-01

Chalcogen-based redox modulators over the years have attracted considerable attention as anti-cancer agents. New selenium- and tellurium-containing compounds with a polar head group and aryl-groups of various lengths have recently been reported as biologically active in several organisms. In the present study, we used the most active of the tellurium compound DP41, and its selenium counterpart DP31 to investigate their effects on the human cancer cell line HCT116. Cells were treated with DP41 or DP31 and the formation of superoxide radicals was determined using dihydroethidium. Cell cycle analysis and apoptosis was determined by cytofluorimetry. Proteins involved in ER signaling and apoptosis were determined by Western blot analysis and fluorescence microscopy. With 50μM of DP41, we observed an increase in O2(-) formation. There was, however, no such increase in O2(-) after treatment with the corresponding selenium compound under the same conditions. In the case of DP41, the production of O2(-) radicals was followed by an up-regulation of Nrf2, HO-1, phospho-eIF2α and ATF4. CHOP was also induced and cells entered apoptosis. Unlike the cancer cells, normal retinal epithelial ARPE-19 cells did not produce elevated levels of O2(-) radicals nor did they induce the ER signaling pathway or apoptosis. The tellurium-containing compound DP41, in contrast to the corresponding selenium compound, induces O2(-) radical formation and oxidative and ER stress responses, including CHOP activation and finally apoptosis. These results indicate that DP41 is a redox modulating agent with promising anti-cancer potentials. Copyright © 2014 Elsevier B.V. All rights reserved.

Continuous removal and recovery of tellurium in an upflow anaerobic granular sludge bed reactor

International Nuclear Information System (INIS)

Mal, Joyabrata; Nancharaiah, Yarlagadda V.; Maheshwari, Neeraj; Hullebusch, Eric D. van; Lens, Piet N.L.

2017-01-01

Highlights: • Tellurite bioreduction coupled to recovery of biogenic Te(0) nanocrystals. • First report on continuous tellurite removal in a UASB reactor. • Biogenic Te(0) was mainly associated with loosely-bound EPS of granular sludge. • Repeated exposure to tellurite caused compositional changes in the EPS matrix. - Abstract: Continuous removal of tellurite (TeO 3 2− ) from synthetic wastewater and subsequent recovery in the form of elemental tellurium was studied in an upflow anaerobic granular sludge bed (UASB) reactor operated at 30 °C. The UASB reactor was inoculated with anaerobic granular sludge and fed with lactate as carbon source and electron donor at an organic loading rate of 0.6 g COD L −1 d −1 . After establishing efficient and stable COD removal, the reactor was fed with 10 mg TeO 3 2− L −1 for 42 d before increasing the influent concentration to 20 mg TeO 3 2− L −1 . Tellurite removal (98 and 92%, respectively, from 10 and 20 mg Te L −1 ) was primarily mediated through bioreduction and most of the removed Te was retained in the bioreactor. Characterization using XRD, Raman spectroscopy, SEM-EDX and TEM confirmed association of tellurium with the granular sludge, typically in the form of elemental Te(0) deposits. Furthermore, application of an extracellular polymeric substances (EPS) extraction method to the tellurite reducing sludge recovered up to 78% of the tellurium retained in the granular sludge. This study demonstrates for the first time the application of a UASB reactor for continuous tellurite removal from tellurite-containing wastewater coupled to elemental Te(0) recovery.

Synthesis and structure of aromatic and heterocyclic compounds of tellurium

International Nuclear Information System (INIS)

Sadekov, I.D.; Maksimenko, A.A.; Rivkin, B.B.

1983-01-01

A new universal method of preparing assymmetric and symmetric diaryl-tellurium chlorides and-dibromides, based on the interaction of diarylditellurides with cations of aryl-diazonium in the presence of copper (2) halogenides is developed. High yields of diaryltellium dihalogenices (60-90 de %), the possibility of the a wide variation of the nature of substituents in both components make this reaction one of the most general methods of preparing assymmetric diaryltellurium dihalogenides. It is advisable to use aryldiazonium boron fluorides instead of halogenides in this reaction

Characterization of tellurium-based films for NO2 detection

International Nuclear Information System (INIS)

Tsiulyanu, D.; Tsiulyanu, A.; Liess, H.-D.; Eisele, I.

2005-01-01

Sensing characteristics of tellurium-based thin films for NO 2 monitoring was studied systematically. The influence of contact materials, thermal treatment, temperature and thickness of the samples on the electrical conductivity and sensitivity to NO 2 with respect to scanning electron microscopy analyses is given. The possibility is shown to optimize the properties of the films for the development of a simple and stable NO 2 sensor device with rapid response/recovery time and low operating temperature. The sensing mechanism is discussed for the direct interaction of gaseous species with lone-pair electrons of chalcogen atoms

Tellurium adsorption on tungsten and molybdenum field emitters

International Nuclear Information System (INIS)

Collins, R.A.; Kiwanga, C.A.

1977-01-01

Studies of the adsorption of tellurium onto tungsten and molybdenum field emitters are described and the results obtained are compared with those obtained in previous work on the adsorption of silicon and selenium. The adsorption of Te onto W was found to be much more uniform than in the case of Se. Although Te is metallic in many of its properties its adsorptive behavior on field emitters is found to be similar to that of selenium and these adsorptive properties are basically common to all semiconductors. The most evident property of these adsorbates is that the work function and emission current decrease simultaneously at coverages of less than half a monolayer and the work function subsequently increases. (B.D.)

Microbial-assisted synthesis and evaluation the cytotoxic effect of tellurium nanorods

Energy Technology Data Exchange (ETDEWEB)

Forootanfar, Hamid [Herbal and Traditional Medicines Research Center, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Amirpour-Rostami, Sahar; Jafari, Mandana [Pharmaceutics Research Center, Institute of Neuropharmacology, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Forootanfar, Amir [Department of Pharmacology and Toxicology, Faculty of Pharmacy, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Yousefizadeh, Zahra [The Student Research Committee, Faculty of Pharmacy, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Shakibaie, Mojtaba, E-mail: shakiba@kmu.ac.ir [Pharmaceutics Research Center, Institute of Neuropharmacology, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of)

2015-04-01

The present study was designed to isolate bacterial strain capable of tellurium nanorods' (Te NRs) production followed by purification and evaluation of the cytotoxic effect of Te NRs. Among 25 environmental samples collected for screening of Te NR-producer bacterial strains one bacterial colony (isolated from hot spring and identified as Pseudomonas pseudoalcaligenes strain Te) was selected and applied for biosynthesis of Te NRs. Thereafter, an organic–aqueous partitioning system was applied for the purification of the biogenic Te NRs and the purified Te NRs were characterized using transmission electron microscopy (TEM), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), X-ray diffraction spectroscopy (XRD), UV–visible spectroscopy, and Fourier transform infrared spectroscopy (FTIR) techniques. The cytotoxic effect of biologically synthesized Te NRs and potassium tellurite on four cell lines of MCF-7, HT1080, HepG2 and A549 was then determined using the MTT assay method. The obtained results revealed lower toxicity for the rod-shaped biogenic tellurium nanostructures (~ 22 nm diameter by 185 nm length) compared to K{sub 2}TeO{sub 3}. - Highlights: • Te NR producing bacterial strain were isolated from hot springs. • Organic–aqueous partitioning system was applied for purification of Te nanorods. • The rod-shaped biogenic Te NPs showed lower cytotoxicity compared to K{sub 2}TeO{sub 3}.

Microbial-assisted synthesis and evaluation the cytotoxic effect of tellurium nanorods

International Nuclear Information System (INIS)

Forootanfar, Hamid; Amirpour-Rostami, Sahar; Jafari, Mandana; Forootanfar, Amir; Yousefizadeh, Zahra; Shakibaie, Mojtaba

2015-01-01

The present study was designed to isolate bacterial strain capable of tellurium nanorods' (Te NRs) production followed by purification and evaluation of the cytotoxic effect of Te NRs. Among 25 environmental samples collected for screening of Te NR-producer bacterial strains one bacterial colony (isolated from hot spring and identified as Pseudomonas pseudoalcaligenes strain Te) was selected and applied for biosynthesis of Te NRs. Thereafter, an organic–aqueous partitioning system was applied for the purification of the biogenic Te NRs and the purified Te NRs were characterized using transmission electron microscopy (TEM), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), X-ray diffraction spectroscopy (XRD), UV–visible spectroscopy, and Fourier transform infrared spectroscopy (FTIR) techniques. The cytotoxic effect of biologically synthesized Te NRs and potassium tellurite on four cell lines of MCF-7, HT1080, HepG2 and A549 was then determined using the MTT assay method. The obtained results revealed lower toxicity for the rod-shaped biogenic tellurium nanostructures (~ 22 nm diameter by 185 nm length) compared to K 2 TeO 3 . - Highlights: • Te NR producing bacterial strain were isolated from hot springs. • Organic–aqueous partitioning system was applied for purification of Te nanorods. • The rod-shaped biogenic Te NPs showed lower cytotoxicity compared to K 2 TeO 3

Continuous removal and recovery of tellurium in an upflow anaerobic granular sludge bed reactor

Energy Technology Data Exchange (ETDEWEB)

Mal, Joyabrata, E-mail: joyabrata2006@gmail.com [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Nancharaiah, Yarlagadda V. [Biofouling and Biofilm Processes Section, Water and Steam Chemistry Division, Bhabha Atomic Research Centre, Kalpakkam, 603102, Tamil Nadu (India); Homi Bhabha National Institute, Anushakti Nagar Complex, Mumbai 400094 (India); Maheshwari, Neeraj [CNRS UMR 7338, BMBI University de Technologie Compiegne, 60200 Compiegne (France); Hullebusch, Eric D. van [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Université Paris-Est, Laboratoire Géomatériaux et Environnement (LGE), EA 4508, UPEM, 77454, Marne-la-Vallée (France); Lens, Piet N.L. [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Department of Chemistry and Bioengineering, Tampere University of Technology, P.O-Box 541, Tampere (Finland)

2017-04-05

Highlights: • Tellurite bioreduction coupled to recovery of biogenic Te(0) nanocrystals. • First report on continuous tellurite removal in a UASB reactor. • Biogenic Te(0) was mainly associated with loosely-bound EPS of granular sludge. • Repeated exposure to tellurite caused compositional changes in the EPS matrix. - Abstract: Continuous removal of tellurite (TeO{sub 3}{sup 2−}) from synthetic wastewater and subsequent recovery in the form of elemental tellurium was studied in an upflow anaerobic granular sludge bed (UASB) reactor operated at 30 °C. The UASB reactor was inoculated with anaerobic granular sludge and fed with lactate as carbon source and electron donor at an organic loading rate of 0.6 g COD L{sup −1} d{sup −1}. After establishing efficient and stable COD removal, the reactor was fed with 10 mg TeO{sub 3}{sup 2−} L{sup −1} for 42 d before increasing the influent concentration to 20 mg TeO{sub 3}{sup 2−} L{sup −1}. Tellurite removal (98 and 92%, respectively, from 10 and 20 mg Te L{sup −1}) was primarily mediated through bioreduction and most of the removed Te was retained in the bioreactor. Characterization using XRD, Raman spectroscopy, SEM-EDX and TEM confirmed association of tellurium with the granular sludge, typically in the form of elemental Te(0) deposits. Furthermore, application of an extracellular polymeric substances (EPS) extraction method to the tellurite reducing sludge recovered up to 78% of the tellurium retained in the granular sludge. This study demonstrates for the first time the application of a UASB reactor for continuous tellurite removal from tellurite-containing wastewater coupled to elemental Te(0) recovery.

Surface studies on graphite furnace platforms covered with Pd, Rh and Ir as modifiers in graphite furnace atomic absorption spectrometry of tellurium

Energy Technology Data Exchange (ETDEWEB)

Pedro, Juana [Area de Química Analítica, Departamento de Química, Facultad de Ingeniería Química, Universidad Nacional del Litoral, Santiago del Estero 2829 (S3000GL.N), Santa Fe (Argentina); Stripekis, Jorge [Laboratorio de Análisis de Trazas, Departamento de Química Inorgánica, Analítica y Química Física, INQUIMAE, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria (1428), Buenos Aires (Argentina); Departamento de Ingeniería Química, Instituto Tecnológico de Buenos Aires, Av. Eduardo Madero 399 (1106), Buenos Aires (Argentina); Bonivardi, Adrian [Area de Química Analítica, Departamento de Química, Facultad de Ingeniería Química, Universidad Nacional del Litoral, Santiago del Estero 2829 (S3000GL.N), Santa Fe (Argentina); Tudino, Mabel, E-mail: tudino@qi.fcen.uba.ar [Laboratorio de Análisis de Trazas, Departamento de Química Inorgánica, Analítica y Química Física, INQUIMAE, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria (1428), Buenos Aires (Argentina)

2015-05-01

The main objective of this work is the study of correlations between the efficiency of the distribution of the permanent platinum group modifiers Pd, Rh and Ir over the graphite surface with the aim of improving analytical signal of tellurium. Modifier solution was deposited onto the platform and pyrolysed after drying. In the case of Pd, the physical vaporization/deposition technique was also tested. In order to analyze the differences amongst coverings (morphology, topology and distribution), the graphite surfaces were studied with scanning electron microscopy and energy dispersive X-ray microscopy. Micrographs for physical vaporization and pyrolytic deposition of Pd were also analyzed in order to explain the lack of signal obtained for tellurium with the first alternative. Similar micrographs were obtained for pyrolytic deposition of Ir and Rh and then, compared to those of Pd. Ir showed the most homogeneous distribution on the graphite surface and the tallest and sharpest transient. With the aim of improving the analytical signal of tellurium, the correlation between the surface studies and the tellurium transient signal (height, area and shape) is discussed. - Highlights: • Distribution of Rh, Pd and Ir onto graphite furnaces is evaluated by SEM and EDX • Micrographs and spectra showed that surface distribution could influence Te signal. • Ir showed the best signal together with the most homogeneous surface distribution. • Pd-PVD micrographs revealed the absence of graphite and no signal for Te.

Tellurium quantum dots: Preparation and optical properties

Science.gov (United States)

Lu, Chaoyu; Li, Xueming; Tang, Libin; Lai, Sin Ki; Rogée, Lukas; Teng, Kar Seng; Qian, Fuli; Zhou, Liangliang; Lau, Shu Ping

2017-08-01

Herein, we report an effective and simple method for producing Tellurium Quantum dots (TeQDs), zero-dimensional nanomaterials with great prospects for biomedical applications. Their preparation is based on the ultrasonic exfoliation of Te powder dispersed in 1-methyl-2-pyrrolidone. Sonication causes the van der Waals forces between the structural hexagons of Te to break so that the relatively coarse powder breaks down into nanoscale particles. The TeQDs have an average size of about 4 nm. UV-Vis absorption spectra of the TeQDs showed an absorption peak at 288 nm. Photoluminescence excitation (PLE) and photoluminescence (PL) are used to study the optical properties of TeQDs. Both the PLE and PL peaks revealed a linear relationship against the emission and excitation energies, respectively. TeQDs have important potential applications in biological imaging and catalysis as well as optoelectronics.

Continuous reduction of tellurite to recoverable tellurium nanoparticles using an upflow anaerobic sludge bed (UASB) reactor.

Science.gov (United States)

Ramos-Ruiz, Adriana; Sesma-Martin, Juan; Sierra-Alvarez, Reyes; Field, Jim A

2017-01-01

According to the U.S. Department of Energy and the European Union, tellurium is a critical element needed for energy and defense technology. Thus methods are needed to recover tellurium from waste streams. The objectives of this study was to determine the feasibility of utilizing upflow anaerobic sludge bed (UASB) reactors to convert toxic tellurite (Te IV ) oxyanions to non-toxic insoluble elemental tellurium (Te 0 ) nanoparticles (NP) that are amendable to separation from aqueous effluents. The reactors were supplied with ethanol as the electron donating substrate to promote the biological reduction of Te IV . One reactor was additionally amended with the redox mediating flavonoid compound, riboflavin (RF), with the goal of enhancing the bioreduction of Te IV . Its performance was compared to a control reactor lacking RF. The continuous formation of Te 0 NPs using the UASB reactors was found to be feasible and remarkably improved by the addition of RF. The presence of this flavonoid was previously shown to enhance the conversion rate of Te IV by approximately 11-fold. In this study, we demonstrated that this was associated with the added benefit of reducing the toxic impact of Te IV towards the methanogenic consortium in the UASB and thus enabled a 4.7-fold higher conversion rate of the chemical oxygen demand. Taken as a whole, this work demonstrates the potential of a methanogenic granular sludge to be applied as a bioreactor technology producing recoverable Te 0 NPs in a continuous fashion. Copyright © 2016 Elsevier Ltd. All rights reserved.

Characterization of tellurium-based films for NO{sub 2} detection

Energy Technology Data Exchange (ETDEWEB)

Tsiulyanu, D. [Technical University, Department of Physics, bul. Dacia 41, MD-2060 Kishinau (Moldova, Republic of)]. E-mail: tsiu@cni.md; Tsiulyanu, A. [Technical University, Department of Physics, bul. Dacia 41, MD-2060 Kishinau (Moldova, Republic of); Liess, H.-D. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany); Eisele, I. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany)

2005-08-01

Sensing characteristics of tellurium-based thin films for NO{sub 2} monitoring was studied systematically. The influence of contact materials, thermal treatment, temperature and thickness of the samples on the electrical conductivity and sensitivity to NO{sub 2} with respect to scanning electron microscopy analyses is given. The possibility is shown to optimize the properties of the films for the development of a simple and stable NO{sub 2} sensor device with rapid response/recovery time and low operating temperature. The sensing mechanism is discussed for the direct interaction of gaseous species with lone-pair electrons of chalcogen atoms.

Strong nonlinear photonic responses from microbiologically synthesized tellurium nanocomposites

Science.gov (United States)

Liao, K.-S.; Wang, Jingyuan; Dias, S.; Dewald, J.; Alley, N.J.; Baesman, S.M.; Oremland, R.S.; Blau, W.J.; Curran, S.A.

2010-01-01

A new class of nanomaterials, namely microbiologically-formed nanorods composed of elemental tellurium [Te(0)] that forms unusual nanocomposites when combined with poly(m-phenylenevinylene-co-2,5-dioctoxy-phenylenevinylene) (PmPV) is described. These bio-nanocomposites exhibit excellent broadband optical limiting at 532 and 1064 nm. Nonlinear scattering, originating from the laser induced solvent bubbles and microplasmas, is responsible for this nonlinear behavior. The use of bacterially-formed Te(0) when combined with an organic chemical host (e.g., PmPV) is a new green method of nanoparticle syntheses. This opens the possibilities of using unique, biologically synthesized materials to advance future nanoelectronic and nanophotonic applications. ?? 2009 Elsevier B.V. All rights reserved.

Extraction-spectrophotometric method for silicon determination in high-purity substances. 1. Silicon determination in tellurium

Energy Technology Data Exchange (ETDEWEB)

Shaburova, V P; Yudelevich, I G [AN SSSR, Novosibirsk (USSR). Inst. Neorganicheskoj Khimii

1989-01-01

The extraction-spectrophotometric method for silicon determination in tellurium based on extraction isolation of the base by tributyl phosphate from hydrochloride solutions and with addition of HNO/sub 3/ and spectrophotometric silicon determination using malachite green is developed. The method permits to determine 2x10/sup -1/-3x10/sup -4/ % Si.

The use of masking agents in the determination, by hydride generation and atomic-absorption spectrophotometry, of arsenic, antimony, selenium, tellurium, and bismuth in the presence of noble metals

International Nuclear Information System (INIS)

Kellerman, S.P.

1982-01-01

The effectiveness of thiosemicarbazide, tellurium, and potassium iodide as masking agents to eliminate interferences was assessed. Thiosemicarbazide was found to be effective in eliminating or reducing the interferences on arsenic, antimony, and bismuth, and tellurium reduced the interferences on selenium. The interferences on tellurium could not be eliminated. Arsenic, antimony, selenium, and bismuth were determined in metal sulphide concentrates that were spiked with the noble metals (defined here as gold plus all the platinum-group metals except osmium). The relative standard deviations for arsenic, antimony, bismuth, and selenium were 0,061, 0,017, 0,029, and 0,145 respectively. The values obtained for all the analytes agreed favourably with the preferred values for two in-house reference samples. The laboratory method is detailed in an appendix

Improvement of physical properties of ZnO thin films by tellurium doping

Energy Technology Data Exchange (ETDEWEB)

Sönmezoğlu, Savaş, E-mail: svssonmezoglu@kmu.edu.tr; Akman, Erdi

2014-11-01

Highlights: • We report the synthesis of tellurium-doped zinc oxide (Te–ZnO) thin films using sol–gel method. • Highly c-axis oriented Te-doped ZnO thin films were grown on FTO glasses as substrate. • 1.5% Te-doping ratio could improve the physical properties of ZnO thin films. - Abstract: This investigation addressed the structural, optical and morphological properties of tellurium incorporated zinc oxide (Te–ZnO) thin films. The obtained results indicated that Te-doped ZnO thin films exhibit an enhancement of band gap energy and crystallinity compared with non-doped films. The optical transmission spectra revealed a shift in the absorption edge toward lower wavelengths. X-ray diffraction measurement demonstrated that the film was crystallized in the hexagonal (wurtzite) phase and presented a preferential orientation along the c-axis. The XRD obtained patterns indicate that the crystallite size of the thin films, ranging from 23.9 to 49.1 nm, changed with the Te doping level. The scanning electron microscopy and atomic force microscopy results demonstrated that the grain size and surface roughness of the thin films increased as the Te concentration increased. Most significantly, we demonstrate that it is possible to control the structural, optical and morphological properties of ZnO thin films with the isoelectronic Te-incorporation level.

High performance supercapacitor and non-enzymatic hydrogen peroxide sensor based on tellurium nanoparticles

Directory of Open Access Journals (Sweden)

M. Manikandan

2017-04-01

Full Text Available Tellurium nanoparticles (Te Nps were synthesized by wet chemical method and characterized by XRD, Raman, FESEM, TEM, XPS, UV–Vis and FL. The Nps were coated on graphite foil and Glassy carbon electrode to prepare the electrodes for supercapacitor and biosensor applications. The supercapacitor performance is evaluated in 2 M KOH electrolyte by both Cyclic Voltammetry (CV and galvanostatic charge-discharge method. From charge-discharge method, Te Nps show a specific capacitance of 586 F/g at 2 mA/cm2 and 100 F/g at 30 mA/cm2 as well as an excellent cycle life (100% after 1000 cycles. In addition, the H2O2 sensor performance of Te Nps modified glassy carbon electrode is checked by CV and Chronoamperometry (CA in phosphate buffer solution (PBS. In the linear range of 0.67 to 8.04 μM of hydrogen peroxide (H2O2, Te NPs show a high sensitivity of 0.83 mA mM−1 cm−2 with a correlation coefficient of 0.995. The detection limit is 0.3 μM with a response time less than 5 s. Keywords: Tellurium nanoparticles, Supercapacitor, Biosensor, Hydrogen peroxide

On-line I{sup −}/Te{sup −} separation for the AMS analysis of {sup 125}I

Energy Technology Data Exchange (ETDEWEB)

Charles, C.R.J., E-mail: christopher.charles@uottawa.ca [Andre E. Lalonde Accelerator Mass Spectrometry Laboratory, Advanced Research Complex, University of Ottawa, 25 Templeton Street, Ottawa, ON K1N 6N5 (Canada); Cornett, R.J.; Zhao, X.-L. [Andre E. Lalonde Accelerator Mass Spectrometry Laboratory, Advanced Research Complex, University of Ottawa, 25 Templeton Street, Ottawa, ON K1N 6N5 (Canada); Litherland, A.E. [IsoTrace Laboratory, Department of Physics, University of Toronto, 60 St. George Street, Toronto, ON M5S 1A7 (Canada); Kieser, W.E. [Andre E. Lalonde Accelerator Mass Spectrometry Laboratory, Advanced Research Complex, University of Ottawa, 25 Templeton Street, Ottawa, ON K1N 6N5 (Canada)

2015-10-15

The isobar separator for anions (ISA) was used together with a 3 MV tandem accelerator mass spectrometer (AMS) to demonstrate the real time (on-line) separation of Te{sup −} from I{sup −}. Following the ion source mass spectrometry and major retardation to tens of eV, the ISA uses a radiofrequency quadrupole (RFQ) ion guide to confine and direct I{sup −} and associated Te{sup −} isobar anions through a gas-reaction cell, where chemical reactions occur at eV energies with the electronegative gas NO{sub 2}. Anions are subsequently reaccelerated out of the ISA to near original ion source extraction energies for AMS analysis. At 5 mTorr NO{sub 2} in the ISA gas-reaction cell, {sup 125}Te{sup −} was observed to be attenuated by a factor of ∼10{sup 7} as compared to {sup 127}I{sup −} that did not experience significant (<50%) losses. A comparative test using {sup 37}Cl{sup −} and {sup 32}S{sup −} (having similar chemical properties to iodine and tellurium) showed a {sup 32}S{sup −} attenuation of >10{sup 7} relative to {sup 37}Cl{sup −} under the same ISA–AMS conditions. The preferential destruction of Te{sup −} (and S{sup −}) at eV energies in the ISA is likely due to a larger favorable destruction cross-section with NO{sub 2}. This study is the first demonstration of I–Te anion separation for AMS, and makes possible the use of {sup 125}I, free of the contaminant {sup 125}Te isobar after suitable sample purification, for future {sup 129}I/{sup 125}I carrier-free analyses of natural samples at ultra-low trace levels.

Intrinsic two-dimensional states on the pristine surface of tellurium

Science.gov (United States)

Li, Pengke; Appelbaum, Ian

2018-05-01

Atomic chains configured in a helical geometry have fascinating properties, including phases hosting localized bound states in their electronic structure. We show how the zero-dimensional state—bound to the edge of a single one-dimensional helical chain of tellurium atoms—evolves into two-dimensional bands on the c -axis surface of the three-dimensional trigonal bulk. We give an effective Hamiltonian description of its dispersion in k space by exploiting confinement to a virtual bilayer, and elaborate on the diminished role of spin-orbit coupling. These intrinsic gap-penetrating surface bands were neglected in the interpretation of seminal experiments, where two-dimensional transport was otherwise attributed to extrinsic accumulation layers.

Tellurium Enrichment in Jurassic Coal, Brora, Scotland

Directory of Open Access Journals (Sweden)

Liam Bullock

2017-11-01

Full Text Available Mid-Jurassic pyritic coals exposed at the village of Brora, northern Scotland, UK, contain a marked enrichment of tellurium (Te relative to crustal mean, average world coal compositions and British Isles Carboniferous coals. The Te content of Brora coal pyrite is more than one order of magnitude higher than in sampled pyrite of Carboniferous coals. The Te enrichment coincides with selenium (Se and mercury (Hg enrichment in the rims of pyrite, and Se/Te is much lower than in pyrites of Carboniferous coals. Initial pyrite formation is attributed to early burial (syn-diagenesis, with incorporation of Te, Se, Hg and lead (Pb during later pyrite formation. The source of Te may have been a local hydrothermal system which was responsible for alluvial gold (Au in the region, with some Au in Brora headwaters occurring as tellurides. Anomalous Te is not ubiquitous in coal, but may occur locally, and is detectable by laser ablation inductively coupled plasma-mass spectrometry (LA-ICP-MS.

Effect of tellurium on viscosity and liquid structure of GaSb melts

Energy Technology Data Exchange (ETDEWEB)

Ji Leilei [School of Material Science and Engineering, Jinan University, Jinan 250022 (China); Geng Haoran [School of Material Science and Engineering, Jinan University, Jinan 250022 (China)], E-mail: mse_genghr@ujn.edu.cn; Sun Chunjing [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Teng Xinying; Liu Yamei [School of Material Science and Engineering, Jinan University, Jinan 250022 (China)

2008-04-03

The behavior of GaSb melt with tellurium addition was investigated using viscometer and differential scanning calorimetry (DSC). Normally, the viscosity of all melts measured decreased with the increasing temperature. However, anomalous transition points were observed in the temperature dependence of viscosity for Ga-Sb-Te system. Corresponded with the abnormal points on the viscosity-temperature curves, there were thermal effect peaks on the DSC curves. Furthermore, viscous activation energy and flow units of these melts and their structural features were discussed in this paper.

Ecological aspects of selenium and tellurium in human and animal health

Energy Technology Data Exchange (ETDEWEB)

Frost, D V; Ingvoldstad, D

1975-01-01

Animal and human studies indicate that selenium inadequacy, in part, underlies various chronic diseases. Epidemiologic evidence suggests that cancer and heart disease are most common where ambient Se availability is low. Plant Se uptake and Se blood levels are inverse to human cancer mortality. As the active group in glutathione peroxidase, Se/sup -2/ inhibits aberrant oxidations which lead to chronic diseases. It binds heavy metals, and with tocopherol maintains tissue integrity. Sulfur dioxide fallout from the atmosphere, resulting from fossil fuel burning, may diminish the nutritional availability of selenium by diminishing plant uptake. Intensive ruminant grazing returns unavailable Se/sup 0/ to soils. Trimethyl selenium ion, as excreted by animals, also appears to be unavailable to plants. Modern fertilization practices and the effect of buildup of sulfates in the soil, due to acid rains, both appear to lessen the availability of Se to plants. SeO/sub 2/ added to the atmosphere from combustion and volcanic activity react with SO/sub 2/ to yield Se/sup 0/. This is presumed to fall out as particles from the air. How traces of Se are otherwise carried in air, explaining its enrichment in some areas, is unknown. The New Zealand experience with Se inadequacy in animals and man may be repeated in other parts of the world. Se inadequacy is far more of a human health problem than Se toxicity. There are no known adverse health effects from tellurium, other than tellurium breath. 164 references, 5 figures, 3 tables.

Synthesis of Novel E-2-Chlorovinyltellurium Compounds Based on the Stereospecific Anti-addition of Tellurium Tetrachloride to Acetylene

Directory of Open Access Journals (Sweden)

Svetlana V. Amosova

2012-05-01

Full Text Available The reaction of tellurium tetrachloride with acetylene proceeds in a stereospecific anti-addition manner to afford the novel products E-2-chlorovinyltellurium trichloride and E,E-bis(2-chlorovinyltellurium dichloride. Reaction conditions for the selective preparation of each of these products were found. The latter was obtained in 90% yield in CHCl₃ under a pressure of acetylene of 10–15 atm, whereas the former product was formed in up to 72% yield in CCl₄ under a pressure of acetylene of 1–3 atm. Synthesis of the previously unknown E,E-bis(2-chlorovinyl telluride, E,E-bis(2-chlorovinyl ditelluride, E-2-chlorovinyl 1,2,2-trichloroethyl telluride and E,E-bis(2-chlorovinyl-tellurium dibromide is described.

The application of three-phase liquid-liquid extraction to the analysis of bismuth and tellurium in sulphide concentrates

International Nuclear Information System (INIS)

Nicholas, D.J.

1976-01-01

An extraction system consisting of one aqueous and two organic phases is described. Diantipyrylmethane (DAM) is used as the extractant for bismuth and tellurium, which are extracted into the smaller of the two organic phases from nitric acid and perchloric acid respectively. The extraction efficiency is in the range of 90 to 95 per cent, compensation for incomplete extraction being made by the technique of standard addition. Copper, lead, and zinc are not extracted in either procedure. When the solutions contain high concentrations of iron, thioglycolic acid is used as a masking agent for iron in the extraction of bismuth. Atomic-absorption spectrophotometry is used for the analysis of the third phase after it has been diluted with methanol. The precision for bismuth and tellurium is in the range of 3 to 4 per cent. The accuracy, as ascertained from comparative analyses of sulphide concentrates, is good

The influence of composition of fluoride electrolytes and conditions of the electrodeposition on some properties of tellurium

International Nuclear Information System (INIS)

Bugelis, V.M.; Kum, G.N.; Abrarov, O.A.; Madumarov, A.; Navalikhin, L.V.; Ajnakulov, Eh.B.

1981-01-01

Effect of electrolytic bath content, cathode current density, illumination and temperature on specific resistance, photosensitivity, structure and chemical purity of plated tellurium coatings is studied. Deposition is realized from moderately acid fluoride electrolytes at the constant temperature with a platinum working electrode. X-ray studies of precipitates obtained are carried out

A 125Te and 23Na NMR investigation of the structure and crystallisation of sodium tellurite glasses.

Science.gov (United States)

Holland, D; Bailey, J; Ward, G; Turner, B; Tierney, P; Dupree, R

2005-01-01

125Te static nuclear magnetic resonance (NMR) and 23Na and 125Te magic angle spinning (MAS) NMR have been used, in conjunction with X-ray diffraction, to examine the structure and crystallisation behaviour of glasses of composition xNa2O.(1-x)TeO2 (0.075 x 0.4). The MAS NMR 23Na spectra from the glasses are broad and featureless but shift by approximately +5 ppm with increased x, i.e. as the system becomes more ionic. The static 125Te NMR spectra show an increase in axial symmetry with increasing x, indicating a shift from predominantly [TeO4] to [TeO3] structural units. The 23Na and 125Te spectra from the crystallised samples have been fitted to obtain information on the sites in the metastable crystal phases, which are the first to form on heating and which are therefore more closely related to the glass structure than thermodynamically stable crystal phases. New sodium tellurite phases are reported, including a sodium stabilised, face centred cubic phase related to delta-TeO2; a metastable form of Na2Te4O9 containing 3 sodium and 4 tellurium sites; and a metastable form of Na2Te2O5 containing 2 sodium sites. There is evidence of oxidation of TeIV to TeVI occurring in glasses with high values of x and, at x=0.40 and 0.50 (outside the glass forming range), some sodium metatellurate (Na2TeO4) is formed at the same time as sodium metatellurite (Na2TeO3). The 125Te shift is very sensitive to environment within the sodium tellurite system, covering more than 320 ppm, with anisotropies varying from 640 to 1540 ppm. The lack of features in the 125Te spectra of the glass phases, combined with the large shift range and high but variable anisotropy, means than it is not possible to obtain a unique fit to any presumed species present. Furthermore, the chemical shift anisotropy parameters for three of the four Te sites in the Na2Te4O9 phase are found to lie outside the range used for previous simulations of glass spectra.

Evaluated phase diagrams of binary metal-tellurium systems of the D-block transition elements

International Nuclear Information System (INIS)

Chattopadhyay, G.; Bharadwaj, S.R.

1989-01-01

The binary phase diagrams of metal-tellurium systems for twenty seven d-block transition elements have been critically evaluated. Complete phase diagrams are presented for the elements, chromium, manganese, iron, cobalt, nickel, copper, molybdenum, palladium, silver, lanthanum, platinum and gold, whereas, for scandium, titanium, vanadium, yttrium, zirconium, niobium, technitium, ruthenium, rhodium, hafnium, tantalum, tungsten , rhenium, osmium and iridium, the phase diagrams are incomplete and tentative. (author). 20 refs., 27 tabs., 27 figs

Thermodynamic assessment of the palladium-tellurium (Pd-Te) system

International Nuclear Information System (INIS)

Gosse, S.; Gueneau, C.

2011-01-01

Among the fission products formed in nuclear fuels, the platinum-group metal palladium and the chalcogen element tellurium exhibit strong interaction. It is therefore of interest to be able to predict the chemical equilibria involving the Pd and Te fission products. A thermodynamic assessment is carried out using the Calphad (Calculation of Phase Diagram) method to investigate the behaviour of Pd-Te alloy system in nuclear fuels under irradiation and under waste disposal conditions. The Pd-Te binary description was optimized using experimental data found in literature including thermodynamic properties and phase diagram data. To validate the calculated phase diagram and thermodynamic properties, the results are compared with data from the literature. Both calculated and experimental phase diagrams and thermodynamic properties are in good agreement in the whole Pd-Te composition range. (authors)

Investigation of evaporation characteristics of polonium and its lighter homologues selenium and tellurium from liquid Pb-Bi-eutecticum

CERN Document Server

Neuhausen, J; Eichler, B

2004-01-01

The evaporation behaviour of polonium and its lighter homologues selenium and tellurium dissolved in liquid Pb-Bi-eutecticum (LBE) has been studied at various temperatures in the range from 482 K up to 1330 K under Ar/H2 and Ar/H2O-atmospheres using γ-ray spectroscopy. Polonium release in the temperature range of interest for technical applications is slow. Within short term (1h) experiments measurable amounts of polonium are evaporated only at temperatures above 973 K. Long term experiments reveal that a slow evaporation of polonium occurs at temperatures around 873 K resulting in a fractional polonium loss of the melt around 1% per day. Evaporation rates of selenium and tellurium are smaller than those of polonium. The presence of H2O does not enhance the evaporation within the error limits of our experiments. The thermodynamics and possible reaction pathways involved in polonium release from LBE are discussed.

Effect of sample preparation methods on photometric determination of the tellurium and cobalt content in the samples of copper concentrates

Directory of Open Access Journals (Sweden)

Viktoriya Butenko

2016-03-01

Full Text Available Methods of determination of cobalt and nickel in copper concentrates currently used in factory laboratories are very labor intensive and time consuming. The limiting stage of the analysis is preliminary chemical sample preparation. Carrying out the decomposition process of industrial samples with concentrated mineral acids in open systems does not allow to improve the metrological characteristics of the methods, for this reason improvement the methods of sample preparation is quite relevant and has a practical interest. The work was dedicated to the determination of the optimal conditions of preliminary chemical preparation of copper concentrate samples for the subsequent determination of cobalt and tellurium in the obtained solution using tellurium-spectrophotometric method. Decomposition of the samples was carried out by acid dissolving in individual mineral acids and their mixtures by heating in an open system as well as by using ultrasonification and microwave radiation in a closed system. In order to select the optimal conditions for the decomposition of the samples in a closed system the phase contact time and ultrasonic generator’s power were varied. Intensification of the processes of decomposition of copper concentrates with nitric acid (1:1, ultrasound and microwave radiation allowed to transfer quantitatively cobalt and tellurium into solution spending 20 and 30 min respectively. This reduced the amount of reactants used and improved the accuracy of determination by running the process in strictly identical conditions.

LIGHT INDUCED TELLURIUM ENRICHMENT ON CDZNTE CRYSTAL SURFACES DETECTED BY RAMAN SPECTROSCOPY

International Nuclear Information System (INIS)

Hawkins, S; Eliel Villa-Aleman, E; Martine Duff, M; Douglas Hunter, D

2007-01-01

Synthetic CdZnTe or 'CZT' crystals can be grown under controlled conditions to produce high quality crystals to be used as room temperature radiation detectors. Even the best crystal growth methods result in defects, such as tellurium secondary phases, that affect the crystal's performance. In this study, CZT crystals were analyzed by micro Raman spectroscopy. The growth of Te rich areas on the surface was induced by low powered lasers. The growth was observed versus time with low power Raman scattering and was observed immediately under higher power conditions. The detector response was also measured after induced Te enrichment

Equilibrium evaporation test of lead-bismuth eutectic and of tellurium in lead-bismuth

International Nuclear Information System (INIS)

Ohno, Shuji; Nishimura, Masahiro; Hamada, Hirotsugu; Miyahara, Shinya; Sasa, Toshinobu; Kurata, Yuji

2005-01-01

A series of equilibrium evaporation experiment was performed to acquire the essential and the fundamental knowledge about the transfer behavior of lead-bismuth eutectic (LBE) and impurity tellurium in LBE from liquid to gas phase. The experiments were conducted using the transpiration method in which saturated vapor in an isothermal evaporation pot was transported by inert carrier gas and collected outside of the pot. The size of the used evaporation pot is 8 cm inner diameter and 15 cm length. The weight of the LBE pool in the pot is about 500 g. The investigated temperature range was 450degC to 750degC. From this experiment and discussion using the data in literature, we have obtained several instructive and useful data on the LBE evaporation behavior such as saturated vapor pressure of LBE, vapor concentration of Pb, Bi and Bi 2 in LBE saturated gas phase, and activity coefficient of Pb in the LBE. The LBE vapor pressure equation is represented as the sum of Pb, Bi and Bi 2 vapor in the temperature range between 550degC and 750degC as logP[Pa]=10.2-10100/T[k]. The gas-liquid equilibrium partition coefficient of tellurium in LBE is in the range of 10 to 100, with no remarkable temperature dependency between 450degC and 750degC. This research was founded by the Ministry of Education, Culture, Sports, Science and Technology (MEXT). (author)

Facile Hydrothermal Synthesis of Tellurium Nanostructures for Solar Cells

Directory of Open Access Journals (Sweden)

M. Panahi-Kalamuei

2014-10-01

Full Text Available Tellurium (Te nanostructures have been successfully synthesized via a simple hydrothermal methodfrom the reaction of a TeCl4 aqueous solution with thioglycolic acid (TGA as a reductant. TGA can be easily oxidized to the corresponding disulfide [SCH2CO2H]2, which in turn can reduce TeCl4 to Te. The obtained Te was characterized by XRD, SEM, EDS, and DRS. The effect of reducing agent on morphology and size of the products were also studied. Additionally, Te thin film was deposited on the FTO-TiO2 by Dr- blading then employed to solar cell application and measured open circuit voltage (Voc, short circuit current (Isc, and fill factor (FF were determined as well. The studies showed that particle morphology and sizes play crucial role on solar cell efficiencies.

Simulation of 125I-induced DNA strand breaks in a CAP-DNA complex

International Nuclear Information System (INIS)

Li, W.; Friedland, W.; Jacob, P.

2000-01-01

DNA strand breakage induced by decay of 125 I incorporated into the pyrimidine of a small piece of DNA with a specific base pair sequence has been investigated theoretically and experimentally (Lobachevsky and Martin 2000a, 2000b; Nikjoo et al., 1996; Pomplun and Terrissol, 1994; Charlton and Humm, 1988). Recently an attempt was made to analyse the DNA kinks in a CAP-DNA complex with 125 I induced DNA strand breakage (Karamychev et al., 1999). This method could be used as a so called radioprobing for such DNa distortions like other chemical and biological assays, provided that it has been tested and confirmed in a corresponding theoretical simulation. In the measurement, the distribution of the first breaks on the DNA strands starting from their labeled end can be determined. Based on such first breakage distributions, the simulation calculation could then be used to derive information on the structure of a given DNA-protein complex. The biophysical model PARTRAC has been applied successfully in simulating DNA damage induced by irradiation (Friedland et al., 1998; 1999). In the present study PARTRAC is adapted to a DNA-protein complex in which a specific sequence of 30 base pairs of DNA is connected with the catabolite gene activator protein (CAP). This report presents the first step of the analysis in which the CAP-DNA model used in NIH is overlaid with electron track structures in liquid water and the strand breaks due to direct ionization and due to radical attack are simulated. The second step will be to take into account the neutralization of the heavily charged tellurium and the protective effect of the CAP protein against radical attack. (orig.)

Determination of gold, indium, tellurium and thallium in the same sample digest of geological materials by atomic-absorption spectroscopy and two-step solvent extraction

Science.gov (United States)

Hubert, A.E.; Chao, T.T.

1985-01-01

A rock, soil, or stream-sediment sample is decomposed with hydrofluoric acid, aqua regia, and hydrobromic acid-bromine solution. Gold, thallium, indium and tellurium are separated and concentrated from the sample digest by a two-step MIBK extraction at two concentrations of hydrobromic add. Gold and thallium are first extracted from 0.1M hydrobromic acid medium, then indium and tellurium are extracted from 3M hydrobromic acid in the presence of ascorbic acid to eliminate iron interference. The elements are then determined by flame atomic-absorption spectrophotometry. The two-step solvent extraction can also be used in conjunction with electrothermal atomic-absorption methods to lower the detection limits for all four metals in geological materials. ?? 1985.

Evaluation of the Content of Antimony, Arsenic, Bismuth, Selenium, Tellurium and Their Inorganic Forms in Commercially Baby Foods.

Science.gov (United States)

Ruiz-de-Cenzano, M; Rochina-Marco, A; Cervera, M L; de la Guardia, M

2017-12-01

Baby foods, from the Spanish market and prepared from meat, fish, vegetables, cereals, legumes, and fruits, were analyzed to obtain the concentration of antimony (Sb), arsenic (As), bismuth (Bi), and tellurium (Te) as toxic elements and selenium (Se) as essential element. An analytical procedure was employed based on atomic fluorescence spectroscopy which allowed to obtain accurate data at low levels of concentration. Values of 14 commercial samples, expressed in nanograms per gram fresh weight, ranged for Sb 0.66-6.9, As 4.5-242, Te 1.35-2.94, Bi 2.18-4.79, and Se 5.4-109. Additionally, speciation studies were performed based on data from a non-chromatographic screening method. It was concluded that tellurium and bismuth were mainly present as inorganic forms and selenium as organic form, and antimony and arsenic species depend on the ingredients of each baby food. Risk assessment considerations were made by comparing dietary intake of the aforementioned elements through the consumption of one baby food portion a day and recommended or tolerable guideline values.

Resource recovery from urban stock, the example of cadmium and tellurium from thin film module recycling

Energy Technology Data Exchange (ETDEWEB)

Simon, F.-G., E-mail: franz-georg.simon@bam.de [BAM Federal Institute for Materials Research and Testing, Division 4.3 Contaminant Transfer and Environmental Technologies, Unter den Eichen 87, 12205 Berlin (Germany); Holm, O.; Berger, W. [BAM Federal Institute for Materials Research and Testing, Division 4.3 Contaminant Transfer and Environmental Technologies, Unter den Eichen 87, 12205 Berlin (Germany)

2013-04-15

Highlights: ► The semiconductor layer on thin-film photovoltaic modules can be removed from the glass-plate by vacuum blast cleaning. ► The separation of blasting agent and semiconductor can be performed using flotation with a valuable yield of 55%. ► PV modules are a promising source for the recovery of tellurium in the future. - Abstract: Raw material supply is essential for all industrial activities. The use of secondary raw material gains more importance since ore grade in primary production is decreasing. Meanwhile urban stock contains considerable amounts of various elements. Photovoltaic (PV) generating systems are part of the urban stock and recycling technologies for PV thin film modules with CdTe as semiconductor are needed because cadmium could cause hazardous environmental impact and tellurium is a scarce element where future supply might be constrained. The paper describes a sequence of mechanical processing techniques for end-of-life PV thin film modules consisting of sandblasting and flotation. Separation of the semiconductor material from the glass surface was possible, however, enrichment and yield of valuables in the flotation step were non-satisfying. Nevertheless, recovery of valuable metals from urban stock is a viable method for the extension of the availability of limited natural resources.

Resource recovery from urban stock, the example of cadmium and tellurium from thin film module recycling

International Nuclear Information System (INIS)

Simon, F.-G.; Holm, O.; Berger, W.

2013-01-01

Highlights: ► The semiconductor layer on thin-film photovoltaic modules can be removed from the glass-plate by vacuum blast cleaning. ► The separation of blasting agent and semiconductor can be performed using flotation with a valuable yield of 55%. ► PV modules are a promising source for the recovery of tellurium in the future. - Abstract: Raw material supply is essential for all industrial activities. The use of secondary raw material gains more importance since ore grade in primary production is decreasing. Meanwhile urban stock contains considerable amounts of various elements. Photovoltaic (PV) generating systems are part of the urban stock and recycling technologies for PV thin film modules with CdTe as semiconductor are needed because cadmium could cause hazardous environmental impact and tellurium is a scarce element where future supply might be constrained. The paper describes a sequence of mechanical processing techniques for end-of-life PV thin film modules consisting of sandblasting and flotation. Separation of the semiconductor material from the glass surface was possible, however, enrichment and yield of valuables in the flotation step were non-satisfying. Nevertheless, recovery of valuable metals from urban stock is a viable method for the extension of the availability of limited natural resources

Determination of tellurium by hydride generation with in situ trapping flame atomic absorption spectrometry

Energy Technology Data Exchange (ETDEWEB)

Matusiewicz, H.; Krawczyk, M. [Politechn Poznanska, Poznan (Poland)

2007-03-15

The analytical performance of coupled hydride generation - integrated atom trap (HG-IAT) atomizer flame atomic absorption spectrometry (FAAS) system was evaluated for determination of Te in reference material (GBW 07302 Stream Sediment), coal fly ash and garlic. Tellurium, using formation of H{sub 2}Te vapors, is atomized in air-acetylene flame-heated IAT. A new design HG-IAT-FAAS hyphenated technique that would exceed the operational capabilities of existing arrangernents (a water-cooled single silica tube, double-slotted quartz tube or an 'integrated trap') was investigated. An improvement in detection limit was achieved compared with using either of the above atom trapping techniques separately. The concentration detection limit, defined as 3 times the blank standard deviation (3{sigma}), was 0.9 ng mL{sup -1} for Te. For a 2 min in situ preconcentration time (sample volume of 2 mL), sensitivity enhancement compared to flame AAS, was 222 fold, using the hydride generation atom trapping technique. The sensitivity can be further improved by increasing the collection time. The precision, expressed as RSD, was 7.0% (n = 6) for Te. The accuracy of the method was verified using a certified reference material (GBW 07302 Stream Sediment) by aqueous standard calibration curves. The measured Te contents of the reference material was in agreement with the information value. The method was successfully applied to the determination of tellurium in coal fly ash and garlic.

Test of irradiation of tellurium oxide for obtaining iodine-131 by dry distillation

International Nuclear Information System (INIS)

Alanis M, J.

2003-07-01

With the purpose of optimizing to the maximum independently the work of the reactor of those mathematical calculations of irradiation that are already optimized, now it corresponds to carry out irradiation tests in the different positions with their respective neutron fluxes that it counts the reactor for samples irradiation. Then, it is necessary to carry out the irradiation of the tellurium dioxide through cycles, with the purpose of observing the activity that it goes accumulating in each cycle and this way to obtain an activity of the Iodine-131 obtained when finishing the last cycle. (Author)

Tumor therapy with 125I-octreotide and 125I-UdR

International Nuclear Information System (INIS)

Fan, W.; Zhu, R.; Yang, C.; Sun, J.J.; Xu, Y.J.; Zhang, Y.J.; Wu, M.J.; Wang, D.J.

2005-01-01

Purpose: To determine the tumor cell damage effect with Auger-electron emitter 125 I in different chemical states. Methods: (1) [Tyr 3 ] octreotide (TOC) and UdR are labeled with 125 I,respectively. (2) Receptor analysis of 125 I-TOC on small cell lung cancer (SCLC) NCI-H446 cell lines is performed comparing with normal lymph cells. NCI-H446 cells added various dose of 125 I-TOC are incubated for different time with 125 I-Nal and non-labeled TOC as control. The capacity of NCI-H446 cell lines bound and internalization of 125 I TOC are determined. The radiation damage of tumor cells is measured by MTF methods. (3) The killing effects of 125 I-UdR in human pancreatic cancer cell line Bax-Pc and Sca-BER bladder carcinoma cells are evaluated with the similar methods. I-UdR penetrating into the Sca-BER cell nucleus is observed with confocal microscope. The grow suppression and clonogenic formation of Sca-BER cells after incubation with 125 I-UdR are analyzed. Proliferation fraction and S phase cell fraction of Sca-BER cell added 125 I-UdR is measured with flow cytometric analysis. Results: (1) Kd=(0.56∼2.0) x 10 -11 mol/L and B max =(1.17∼2.0) x 10 5 cell site are obtained by receptor analysis of 125 I-TOC on NCI-H446 cells. Comparatively, the difference between total binding and non-specific binding is low and there is no saturation of specific binding for normal lymphocyte. About 50% of 125 I-TOC is internalized into the NCI-H446 cell nucleus at 24h after incubation. The damige of NCI-H446 cells by 125 I-TOC is clearly observed. (2) The penetration amount of 125 I-UdR into cell nucleus increases with the incubate time when the concentration of 125 I-UdR is in the range of 10∼500 kBq/mL and reaches the peak fraction of 94% at 36 h after incubation. The radioactivity of 125 I-UdR is then achieved equelibration and no more increased with time. The linear correlation with γ=0.867∼0.978 between the concentration of 125 I-UdR in cell nucleus and the incubation time

Selenium Se and tellurium Te

International Nuclear Information System (INIS)

Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.

1978-01-01

The basic methods for determining selenium and tellurium in various objects are presented. The bichromatometric determination of Te in cadmium, zinc and mercury tellurides is based on oxidation of Te(4) to (6) in H 2 SO 4 with potassium bichromate. In steels, Te is determined photometrically with the aid of KI. The determination is hindered by Fe(3), Cu(2), Bi(3) and Se(4) ions, which must be separated. The extraction-photometric determination of Te in native sulfur is carried out with the aid of 5-mercapto-3-(naphthyl-2)-1,3,4-thiadiazolthione-2 (pH=4.8-5.0). The dyed complex is readily extracted with chloroform and benzene. The spectrophotometric determination of Te in selenium is performed with the aid of 3,5-diphenylpyrazoline-1-dithiocarbamate of sodium. Te is determined in commercial indium, arsenic and their semiconductor compounds photometrically with the aid of copper diethyldithiocarbamate. The method permits determining 5x10 -5 % Te in a weighed amount of 0.5 g. The chloride complex of Te(4) with diantipyriodolpropylmethane is quantitatively extracted with dichloroethane from hydrochloric acid solutions. Thus, any amounts of Te can be separated from Se and determined photometrically. The extraction-photometric determination of Te in commercial lead and bismuth is carried out with the aid of pyrazolone derivatives, in commercial copper with the aid of diantipyridolpropylmethane, and in ores (more than 0.01% Te) with the aid of bismuthol 2. Also described is the extraction-polarographic determination of Te in sulfide ores

Formation of defects in tellurium at various levels of gravitation

International Nuclear Information System (INIS)

Parfen'ev, R.V.; Farbshtejn, I.I.; Shul'pina, I.L.; Yakimov, S.V.; Shalimov, V.P.; Turchaninov, A.M.

2002-01-01

One investigated into effect of gravitation conditions during tellurium crystallization (ranging from microgravitation up to increased gravitation - 5g 0 ) on concentration of neutral (N D ) and electrically active (N AD ) acceptor structure defects in specimens grown both under complete remelting of parent ingot and under directed recrystallization of ingot with inoculation. N AD and N D concentrations and their distribution along the specimen depth were determined on the basis of analysis of electrical characteristics (conductivity and the Hall effect) measured along ingots within 1.6-300 K temperature range. The results were compared with characteristics of specimens grown following the similar program under normal conditions. At complete remelting under microgravitation one detected attributes of strong supercooling and spontaneous crystallization, as well as, of specimen resistance oscillation by its depth caused by N D modulation [ru

Use of Iodine-131 to Tellurium-132 Ratios for Assessing the Relationships between Human Inhaled Radioactivity and Environmental Monitoring after the Accident in Fukushima

Directory of Open Access Journals (Sweden)

Koji Uchiyama

2018-03-01

Full Text Available Significant differences in findings were seen between the intake amounts of iodine-131 that were derived from direct measurements and the estimated intake from environmental monitoring data at the Fukushima accident. To clarify these discrepancies, we have investigated the iodine-131 and tellurium-132 body burdens of five human subjects, who after being exposed to a radioactive plume, underwent 21.5 h whole body counter measurements at Fukui Prefectural Hospital, so clear intake scenario and thyroid counter measurement data were available. To determine the iodine-131 and tellurium-132 body burdens, we introduced a new method of whole body counter calibration composed of a self-consistent approach with the time-dependent correction efficiency factors concept. The ratios of iodine-131 to tellurium-132, ranging from 0.96 ± 0.05 to 2.29 ± 0.38, were consistent with results of the environmental measurements. The 24 h iodine uptake values ranging from 12.1–16.0% were within euthyroid range in Japanese people. These results suggest, even if the relatively low thyroid iodine uptake in the Japanese population was taken into consideration, that there is no doubt about the consistency between direct measurements and environmental monitoring data. Adequate intake scenario is suggested to be principally important to estimate the inhaled radioactivity in areas in or around nuclear accidents.

Exploratory studies of element substitutions in synthetic tetrahedrite. Part II. Selenium and tellurium as anions in Zn-Fe tetrahedrites

DEFF Research Database (Denmark)

Karup-Møller, Sven; Makovicky, E.

1999-01-01

-free) compositons do not materialize. The substituted Se tetrahedrite coexists with Cu3SbSe3, (iron-bearing) Cu2-xSe, Cu3SbSe4 plus/minus low Zn-sulfide melt. Selenium does not adopt the role of cation and tellurium that of anion in the tetrahedrite structure. The explanation of the severely restricted composition...

The effect of hydrostatic pressure on the anomalous sign reversal of the Hall coefficient in tellurium

International Nuclear Information System (INIS)

Balynas, V.; Dobrovolskis, Z.; Krotkus, A.; Hoerstel, W.

1981-01-01

In order to obtain information about the pressure behaviour of the higher lying second conduction band the dependences of the Hall coefficient of single crystalline tellurium on temperature (300 to 500 K) have been measured at atmospheric pressure and hydrostatic pressures of 500 and 800 MPa. The separation between the two conduction bands in Te decreases with increasing pressure. The anomalous sign reversal of the Hall coefficient can be well explained by a double-conduction band model

Revision and extension to the analysis of the third spectrum of tellurium: Te III

International Nuclear Information System (INIS)

Tauheed, A.; Naz, A.

2011-01-01

The spectrum of doubly ionized tellurium atom (Te III) has been investigated in the vacuum ultraviolet wavelength region. The ground configuration of Te III is 5s 2 5p 2 and the excited configurations are of the type 5s 2 5p nl. The core excitation leads to a 5s5p 3 configuration. Cowan's multi-configuration interaction code was utilized to predict the ion structure. The observed spectrum of tellurium was recorded on a 3-m normal incidence vacuum spectrograph of Antigonish Laboratory (Canada) in the wavelength region of 300 - 2000 A by using a triggered spark light source for the excitation of the spectrum. The 5s 2 5p 2 - [ 5s 2 5p (5d + 6d + 7d + 6s + 7s + 8s) + 5s5p 3 ] transition array has been analyzed. Previously reported levels by Joshi et al have been confirmed while the older analysis by Crooker and Joshi has been revised and extended to include the 5s 2 5p (5d, 6d, 7d, 6s,7s, 8s) and 5s5p 3 configurations. Least-squares- fitted parametric calculations were used to interpret the final results. One hundred and fifty spectral lines have been identified to establish 60 energy levels. Our wavelength accuracy for unblended and sharp lines is better than ±0.005 A. The ionization potential of Te III was found to be 224550 ± 300 cm -1 (27.841 ± 0.037eV).

Validation of a new design of tellurium dioide-irradiated target

Energy Technology Data Exchange (ETDEWEB)

Fllaoui, Aziz; Ghamad, Younes; Zoubir, Brahim; Ayaz, Zinel Abidine; El Morabiti, Aissam; Amayoud, Hafid [Centre National de l' Energie des Sciences et des Techniques Nucleaires, Rabat (Morocco); Chakir, El Mahjoub [Nuclear Physics Department, University Ibn Toufail, Kenitra (Morocco)

2016-10-15

Production of iodine-131 by neutron activation of tellurium in tellurium dioxide (TeO{sub 2}) material requires a target that meets the safety requirements. In a radiopharmaceutical production unit, a new lid for a can was designed, which permits tight sealing of the target by using tungsten inert gas welding. The leakage rate of all prepared targets was assessed using a helium mass spectrometer. The accepted leakage rate is ≤ 10 - 4 mbr.L/s, according to the approved safety report related to iodine-131 production in the TRIGA Mark II research reactor (TRIGA: Training, Research, Isotopes, General Atomics). To confirm the resistance of the new design to the irradiation conditions in the TRIGA Mark II research reactor's central thimble, a study of heat effect on the sealed targets for 7 hours in an oven was conducted and the leakage rates were evaluated. The results show that the tightness of the targets is ensured up to 600 .deg. C with the appearance of deformations on lids beyond 450 .deg. C. The study of heat transfer through the target was conducted by adopting a one-dimensional approximation, under consideration of the three transfer modes-convection, conduction, and radiation. The quantities of heat generated by gamma and neutron heating were calculated by a validated computational model for the neutronic simulation of the TRIGA Mark II research reactor using the Monte Carlo N-Particle transport code. Using the heat transfer equations according to the three modes of heat transfer, the thermal study of I-131 production by irradiation of the target in the central thimble showed that the temperatures of materials do not exceed the corresponding melting points. To validate this new design, several targets have been irradiated in the central thimble according to a preplanned irradiation program, going from 4 hours of irradiation at a power level of 0.5 MW up to 35 hours (7 h/d for 5 days a week) at 1.5 MW. The results show that the irradiated targets are

Validation of a New Design of Tellurium Dioxide-Irradiated Target

Directory of Open Access Journals (Sweden)

Aziz Fllaoui

2016-10-01

Full Text Available Production of iodine-131 by neutron activation of tellurium in tellurium dioxide (TeO2 material requires a target that meets the safety requirements. In a radiopharmaceutical production unit, a new lid for a can was designed, which permits tight sealing of the target by using tungsten inert gas welding. The leakage rate of all prepared targets was assessed using a helium mass spectrometer. The accepted leakage rate is ≤ 10−4 mbr.L/s, according to the approved safety report related to iodine-131 production in the TRIGA Mark II research reactor (TRIGA: Training, Research, Isotopes, General Atomics. To confirm the resistance of the new design to the irradiation conditions in the TRIGA Mark II research reactor's central thimble, a study of heat effect on the sealed targets for 7 hours in an oven was conducted and the leakage rates were evaluated. The results show that the tightness of the targets is ensured up to 600°C with the appearance of deformations on lids beyond 450°C. The study of heat transfer through the target was conducted by adopting a one-dimensional approximation, under consideration of the three transfer modes—convection, conduction, and radiation. The quantities of heat generated by gamma and neutron heating were calculated by a validated computational model for the neutronic simulation of the TRIGA Mark II research reactor using the Monte Carlo N-Particle transport code. Using the heat transfer equations according to the three modes of heat transfer, the thermal study of I-131 production by irradiation of the target in the central thimble showed that the temperatures of materials do not exceed the corresponding melting points. To validate this new design, several targets have been irradiated in the central thimble according to a preplanned irradiation program, going from 4 hours of irradiation at a power level of 0.5 MW up to 35 hours (7 h/d for 5 days a week at 1.5 MW. The results show that the irradiated targets are

Light-Induced Tellurium Enrichment on CdZnTe Crystal Surfaces Detected by Raman Spectroscopy

International Nuclear Information System (INIS)

Hawkins, Samantha A.; Villa-Aleman, Eliel; Duff, Martine C.; Hunter, Doug B.; Burger, Arnold; Groza, Michael; Buliga, Vladimir; Black, David R.

2008-01-01

CdZnTe (CZT) crystals can be grown under controlled conditions to produce high-quality crystals to be used as room-temperature radiation detectors. Even the best crystal growth methods result in defects, such as tellurium secondary phases, that affect the crystal's performance. In this study, CZT crystals were analyzed by micro-Raman spectroscopy. The growth of Te rich areas on the surface was induced by low-power lasers. The growth was observed versus time with low-power Raman scattering and was observed immediately under higher-power conditions. The detector response was also measured after induced Te enrichment.

Synthesis of (125) I-lamivudine and (125) I-lamivudine-ursodeoxycholic acid codrug.

Science.gov (United States)

Motaleb, M A; Abo-Kul, M; Ibrahim, Samy M; Saad, Shokry M; Arafat, Muhammad

2016-09-01

The preparation of (125) I-lamivudine ((125) I-3TC) and (125) I-lamivudine-ursodeoxycholic acid codrug ((125) I-3TC-UDCA), suitable for comparative biodistribution studies, is described. The synthesis of the unlabeled precursor 3TC-UDCA proceeds in an 11.6% yield, and the radiolabelling yields for (125) I-3TC and (125) I-3TC-UDCA were 89 and 92%, respectively. The final products are radiochemically pure (greater than 98%). Copyright © 2016 John Wiley & Sons, Ltd.

Tellurium rings as electron pair donors in cluster compounds and coordination polymers; Tellurringe als Elektronenpaardonoren in Clusterverbindungen und Koordinationspolymeren

Energy Technology Data Exchange (ETDEWEB)

Guenther, Anja

2011-11-08

In this dissertation novel and already known molecular tellurium rings are presented in cluster compounds and quasi-one-dimensional coordination polymers. The cyclic, homonuclear units are always stabilized by coordination to electron-rich transition metal atoms, with the coordinating tellurium atoms acting as two-electron donors. As a synthesis route, the solid-state reaction in quartz glass vials was used uniformly. In addition to structural determination, the focus was on the characterization of the resulting compounds. For this purpose, resistance measurements were carried out on selected compounds, the magnetic behavior and the thermal degradation reactions were investigated and accompanying quantum chemical calculations were carried out. [German] In dieser Dissertation werden neuartige sowie bereits bekannte molekulare Tellurringe in Clusterverbindungen und quasi-eindimensionalen Koordinationspolymeren vorgestellt. Die Stabilisierung der zyklischen, homonuklearen Einheiten erfolgt dabei stets durch die Koordination an elektronenreiche Uebergangsmetallatome, wobei die koordinierenden Telluratome gegenueber diesen als Zwei-Elektronendonoren fungieren. Als Syntheseroute wurde dabei einheitlich auf die Festkoerperreaktion in Quarzglasampullen zurueckgegriffen. Neben der Strukturaufklaerung stand die Charakterisierung der erhaltenden Verbindungen im Fokus der Arbeit. Dazu wurden an ausgewaehlten Verbindungen Widerstandsmessungen durchgefuehrt, das magnetische Verhalten sowie die thermischen Abbaureaktionen untersucht und begleitende quantenchemische Rechnungen durchgefuehrt.

Radionuclides in diffusion probing of inorganic materials based on chalcogenides

International Nuclear Information System (INIS)

Firsova, L.P.

1994-01-01

Migration of tellurium-125m, selenium-75, sulfur-35 radionuclides in solid solutions Pb 1-y (Se 0.08 Te 0.92 ) y and (Pb 1-x Sn x ) y Te 1-y , where x=0.1 and 0.2, has been studied, the results are presented. Data on dependence of selenium and tellurium self-diffusion coefficients on temperature in the range of 600-750 deg C are given. The results of the study of self-diffusion coefficient isothermal dependences on lead and tellurium vapour pressure in equilibrium with solid phases have been considered. It is ascertained that a change in the temperature and p-n transitions initiate the change in self-diffusion mechanisms of chalcogenide atoms. 8 refs., 3 tabs

Determination of tellurium at ultra-trace levels in drinking water by on-line solid phase extraction coupled to graphite furnace atomic absorption spectrometer

International Nuclear Information System (INIS)

Pedro, Juana; Stripekis, Jorge; Bonivardi, Adrian; Tudino, Mabel

2008-01-01

In this paper, two time-based flow injection (FI) separation pre-concentration systems coupled to graphite furnace atomic absorption spectrometry (GFAAS) for tellurium determination are studied and compared. The first alternative involves the pre-concentration of the analyte onto Dowex 1X8 employed as packaging material of a micro-column inserted in the flow system. The second set-up is based on the co-precipitation of tellurium with La(OH) 3 followed by retention onto XAD resins. Both systems are compared in terms of limit of detection, linear range, RSD%, sample throughput, micro-columns lifetime and aptitude for fully automatic operation. The features of the Dowex system are: 37% efficiency of retention and an enhancement factor of 42 for a pre-concentration time of 180 seconds (sample flow rate = 3 ml min -1 ) with acetic acid elution volumes of 80 μl. The detection limit (3 s) is 7 ng l -1 and the relative standard deviation (n = 7200 ng l -1 ) is 5.8%. The analytical performance of the XAD system is: 72% efficiency of retention and an enhancement factor of 25 for a pre-concentration time of 180 s (sample flow rate = 3 ml min -1 ) with nitric acid elution volumes of 300 μl. The detection limit is 66 ng l -1 and the relative standard deviation (n = 7200 ng l -1 ) is 8.3%. Applications to the determination of tellurium in tap water and the validation of the analytical methodology employing SRM 1643e as certified reference material are shown

Challenges in assessment of clean energy supply-chains based on byproduct minerals: A case study of tellurium use in thin film photovoltaics

International Nuclear Information System (INIS)

Bustamante, Michele L.; Gaustad, Gabrielle

2014-01-01

Highlights: • Byproduct mining presents unique challenges to quantifying energy security issues. • This case study shows Te scarcity is closely tied to Cu demand and production. • Material intensity changes over time have a significant impact on projections. • Recycling as a mitigation strategy is shown to have poor short-term results. - Abstract: Transitioning to a sustainable energy supply will be critical to meeting future economic and environmental goals. This transition will require optimizing and commercializing a portfolio of new clean energy technologies. However, many promising clean energy technologies are based on materials with inherent risks in their supply; these risks include scarcity, price volatility, criticality, and other potential supply-chain disruptions. Using tellurium use in CdTe photovoltaics as a case study, this paper presents analysis of some of the key challenges associated with modeling byproduct systems (a supply-chain where a key material is actually a byproduct of extraction of another material, copper in the case of tellurium). This work presents a novel modeling approach; the results of the case study are used to identify potential supply risks facing this clean technology, with a unique focus on sensitivity to changes in the preliminary lifecycle stages. Supply-chain sensitivities are connected with direct environmental impacts to frame the implications in a broader sustainability context and to emphasize the future role of recycling. Ultimately, it was shown that if historical supply and demand trends continue, supply gap conditions will emerge before the end of the current decade. However, improvements in byproduct yield, end-use recycling rate, and end-use material intensity exhibit significant leverage to minimize risk in the energy-critical tellurium supply-chain

Gamma Radiation Dosimetry Using Tellurium Dioxide Thin Film Structures

Directory of Open Access Journals (Sweden)

Olga Korostynska

2002-08-01

Full Text Available Thin films of Tellurium dioxide (TeO2 were investigated for γ-radiation dosimetry purposes. Samples were fabricated using thin film vapour deposition technique. Thin films of TeO2 were exposed to a 60Co γ-radiation source at a dose rate of 6 Gy/min at room temperature. Absorption spectra for TeO2 films were recorded and the values of the optical band gap and energies of the localized states for as-deposited and γ-irradiated samples were calculated. It was found that the optical band gap values were decreased as the radiation dose was increased. Samples with electrical contacts having a planar structure showed a linear increase in current values with the increase in radiation dose up to a certain dose level. The observed changes in both the optical and the electrical properties suggest that TeO2 thin film may be considered as an effective material for room temperature real time γ-radiation dosimetry.

Studies on nickel (II and palladium (II complexes with some tetraazamacrocycles containing tellurium

Directory of Open Access Journals (Sweden)

Rathee Nitu

2012-01-01

Full Text Available The synthesis of 10-membered and 12-membered tellurium containing tetraazamacrocyclic complexes of divalent nickel and palladium by template condensation of diaryltellurium dichlorides, (aryl = p-hydroxyphenyl, 3-methyl-4-hydroxyphenyl, p-methoxyphenyl with 1,2-diaminoethane and 1,3-diaminopropane in the presence of metal dichloride is reported. The resulting complexes have been subjected to elemental analyses, magnetic measurements, electronic absorption, infra-red, and proton magnetic resonance spectral studies. The formation of proposed macrocyclic skeletons and their donor sites have been identified on the basis of spectral studies. Distorted octahedral structure for the nickel complexes in the solid state and squareplanar structure for the palladium complexes have been suggested.

Flavoprotein-mediated tellurite reduction: structural basis and applications to the synthesis of tellurium-containing nanostructures

Directory of Open Access Journals (Sweden)

Mauricio Arenas-Salinas

2016-07-01

Full Text Available The tellurium oxyanion tellurite (TeO32- is extremely harmful for most organisms. It has been suggested that a potential bacterial tellurite resistance mechanism would consist of an enzymatic, NAD(PH-dependent, reduction to the less toxic form elemental tellurium (Te0. To date, a number of enzymes such as catalase, type II NADH dehydrogenase and terminal oxidases from the electron transport chain, nitrate reductases, and dihydrolipoamide dehydrogenase (E3, among others, have been shown to display tellurite-reducing activity. This activity is generically referred to as tellurite reductase (TR. Bioinformatic data resting on some of the abovementioned enzymes enabled the identification of common structures involved in tellurite reduction including vicinal catalytic cysteine residues and the FAD/NAD(P+-binding domain, which is characteristic of some flavoproteins. Along this line, thioredoxin reductase (TrxB, alkyl hydroperoxide reductase (AhpF, glutathione reductase (GorA, mercuric reductase (MerA, NADH: flavorubredoxin reductase (NorW, dihydrolipoamide dehydrogenase, and the putative oxidoreductase YkgC from Escherichia coli or environmental bacteria were purified and assessed for TR activity. All of them displayed in vitro TR activity at the expense of NADH or NADPH oxidation. In general, optimal reducing conditions occurred around pH 9-10 and 37 °C.Enzymes exhibiting strong TR activity produced Te-containing nanostructures (TeNS. While GorA and AhpF generated TeNS of 75 nm average diameter, E3 and YkgC produced larger structures (> 100 nm. Electron-dense structures were observed in cells over-expressing genes encoding TrxB, GorA and YkgC.

Tracing Tellurium and Its Nanostructures in Biology.

Science.gov (United States)

Zare, Bijan; Nami, Mohammad; Shahverdi, Ahmad-Reza

2017-12-01

Tellurium (Te) is a semimetal rare element in nature. Together with oxygen, sulfur (S), and selenium (Se), Te is considered a member of chalcogen group. Over recent decades, Te applications continued to emerge in different fields including metallurgy, glass industry, electronics, and applied chemical industries. Along these lines, Te has recently attracted research attention in various fields. Though Te exists in biologic organisms such as microbes, yeast, and human body, its importance and role and some of its potential implications have long been ignored. Some promising applications of Te using its inorganic and organic derivatives including novel Te nanostructures are being introduced. Before discovery and straightforward availability of antibiotics, Te had considered and had been used as an antibacterial element. Antilishmaniasis, antiinflammatory, antiatherosclerotic, and immuno-modulating properties of Te have been described for many years, while the innovative applications of Te have started to emerge along with nanotechnological advances over the recent years. Te quantum dots (QDs) and related nanostructures have proposed novel applications in the biological detection systems such as biosensors. In addition, Te nanostructures are used in labeling, imaging, and targeted drug delivery systems and are tested for antibacterial or antifungal properties. In addition, Te nanoparticles show novel lipid-lowering, antioxidant, and free radical scavenging properties. This review presents an overview on the novel forms of Te, their potential applications, as well as related toxicity profiles.

Influence of the hydrolysis conditions on the properties of tellurium coatings obtained from hydrochloric acid baths

International Nuclear Information System (INIS)

Bigelis, V.M.; Kim, G.N.; Navalikhin, L.V.; Kalanov, M.; Abrarov, O.A.

1982-01-01

The structure of tellurium coatings has been studied using the methods of activational analysis on fast neutrons, roentgenography using DRON-2. The study is carried out in electrolyte 1N TeO 2 +6NHCl+2NH 2 SO 4 at the temperatures 25 and 95 deg C in the range of current densities 10-150 mA/cm 2 with and without mixing. Atomic content of chlorine and oxygen in deposite depending on the electrolyte work is determined. Nicrohardness, density, specific resistance of the coatings investigated are determined

Detection Limits Of The 125I Air Sampler ''RIS125''

International Nuclear Information System (INIS)

Belaish, I.; Levinson, S.; German, U.; Kravchik, T.

1999-01-01

A system for 125 I monitoring in air (RIS-125) was designed and manufactured at NRCN. The main features of the system are described elsewhere. The system can monitor 125 I air contamination in gaseous and aerosol forms. An air monitoring system should have a fast response and the lowest available Minimum Detectable Activity (MDA). The present work presents the characteristic MDA values of the system

Near threshold electron impact ionization cross section for tellurium atoms

International Nuclear Information System (INIS)

Chipev, F.F.; Chernyshova, I.V.; Kontros, J.E.; Shpenik, O.B.

2004-01-01

Full text: Up today electron-impact ionization is one of the most intensively investigated processes in atomic and molecular physics [1]. These experiments however, are associated with difficulties: high temperatures and densities are required to produce atomic beams and monochromatic intensive electron beams. A crossed electron and atomic beams scattering geometry was employed to measure the ionization efficiency curve for tellurium atoms. Our electron spectrometer comprises two serially mounted hypocycloidal electron energy analyzers [2], the first being the monochromator and the second - the scattered electron analyzer. The whole spectrometer is immersed into the homogenous magnetic field. Great care was taken in selecting the value of the extracting potential at the electrode, mounted normally to the atomic beam direction. By careful choosing this potential as low as possible (∼1.4 V), its influence on the motion of the monochromatized electrons in the collision region was minimized and the full collection of the formed ions was reached. The atom beam was produced using a compact effusion source made of the stainless steel with a microchannel exit to minimise the angular divergency of the beam. The temperature of the microchannel plate was taken about 50 K higher than that of the metal vapour in the heated reservoir. This atomic beam source enabled to produce an atomic beam with the concentration of two orders of magnitude higher than that in the case of a standard effusion source. A typical value of the electron energy spread was 0.15 eV (FWHM) in the 0.1-15 eV energy range. The primary electron beam current was equal to 10 -7 A. Such values of electron energy spread and beam current for the primary electron beam passing through the collision chamber were chosen to provide identical conditions for carrying out all the measurements. The energy scale was calibrated with the accuracy of ± 0.05 eV. The measured ionization cross-section normalized to the results

Reprint of “Extracellular production of tellurium nanoparticles by the photosynthetic bacterium Rhodobacter capsulatus”

Energy Technology Data Exchange (ETDEWEB)

Borghese, Roberto, E-mail: roberto.borghese@unibo.it [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy); Brucale, Marco [Institute for the Study of Nanostructured Materials (CNR-ISMN), Rome (Italy); Fortunato, Gianuario [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy); Lanzi, Massimiliano [Dept. of Industrial Chemistry “Toso Montanari”, University of Bologna (Italy); Mezzi, Alessio [Institute for the Study of Nanostructured Materials (CNR-ISMN), Rome (Italy); Valle, Francesco; Cavallini, Massimiliano [Institute for the Study of Nanostructured Materials (CNR-ISMN), Bologna (Italy); Zannoni, Davide [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy)

2017-02-15

Highlights: • Tellurite is reduced by R. capsulatus as cytosolic tellurium nanoprecipitates TeNPs. • Lawsone allows R. capsulatus to produce extracellular TeNPs. • Extracellular TeNPs production depends on the carbon source used for cells growth. • Both lawsone concentration and the incubation time determine the TeNPs size. • Extracellular TeNPs are coated with extracellular polymeric substances (EPS). - Abstract: The toxic oxyanion tellurite (TeO{sub 3}{sup 2−}) is acquired by cells of Rhodobacter capsulatus grown anaerobically in the light, via acetate permease ActP2 and then reduced to Te{sup 0} in the cytoplasm as needle-like black precipitates. Interestingly, photosynthetic cultures of R. capsulatus can also generate Te{sup 0} nanoprecipitates (TeNPs) outside the cells upon addition of the redox mediator lawsone (2-hydroxy-1,4-naphtoquinone). TeNPs generation kinetics were monitored to define the optimal conditions to produce TeNPs as a function of various carbon sources and lawsone concentration. We report that growing cultures over a 10 days period with daily additions of 1 mM tellurite led to the accumulation in the growth medium of TeNPs with dimensions from 200 up to 600–700 nm in length as determined by atomic force microscopy (AFM). This result suggests that nucleation of TeNPs takes place over the entire cell growth period although the addition of new tellurium Te{sup 0} to pre-formed TeNPs is the main strategy used by R. capsulatus to generate TeNPs outside the cells. Finally, X-ray photoelectron spectroscopy (XPS) and Fourier transform infrared (FT-IR) analysis of TeNPs indicate they are coated with an organic material which keeps the particles in solution in aqueous solvents.

Total β-decay energies and masses of tin, antimony and tellurium isotopes in the vicinity of 50132Sn82

International Nuclear Information System (INIS)

Lund, E.; Aleklett, K.; Rudstam, G.

1977-01-01

Experimental β-decay energies for short-lived isotopes of tin, antimony and tellurium are presented. Mass-separated sources were produced at the on-line isotope separator OSIRIS. By applying β-γ coincidence methods, total β-decay energies have been determined for the following nuclides: 127-131 Sn, 128 130 131 134 Sb and 134 135 Te. The atomic mass excess has been derived for these nuclei, and comparisons are made with mass formula predictions. (Auth.)

In vitro and in vivo activity of an organic tellurium compound on Leishmania (Leishmania chagasi.

Directory of Open Access Journals (Sweden)

Isabella Aparecida Salerno Pimentel

Full Text Available Tellurium compounds have shown several biological properties and recently the leishmanicidal effect of one organotellurane was demonstrated. These findings led us to test the effect of the organotellurium compound RF07 on Leishmania (Leishmania chagasi, the agent of visceral leishmaniasis in Latin America. In vitro assays were performed in L. (L. chagasi-infected bone marrow derived macrophages treated with different concentrations of RF07. In in vivo experiments Golden hamsters were infected with L. (L. chagasi and injected intraperitoneally with RF07 whereas control animals received either Glucantime or PBS. The effect of RF07 on cathepsin B activity of L. (L. chagasi amastigotes was assayed spectrofluorometrically using fluorogenic substrates. The main findings were: 1 RF07 showed significant leishmanicidal activity against intracellular parasites at submicromolar concentrations (IC50 of 529.7±26.5 nM, and the drug displayed 10-fold less toxicity to macrophages (CC50 of 5,426±272.8 nM; 2 kinetics assays showed an increasing leishmanicidal action of RF07 at longer periods of treatment; 3 one month after intraperitoneal injection of RF07 L. (L. chagasi-infected hamsters showed a reduction of 99.6% of parasite burden when compared to controls that received PBS; 4 RF07 inhibited the cathepsin B activity of L. (L. chagasi amastigotes. The present results demonstrated that the tellurium compound RF07 is able to destroy L. (L. chagasi in vitro and in vivo at concentrations that are non toxic to the host. We believe these findings support further study of the potential of RF07 as a possible alternative for the chemotherapy of visceral leishmaniasis.

Ab-initio study of pure sup 7 sup 7 Se and sup 1 sup 2 sup 5 Te systems and of the sup 7 sup 7 Se nuclear quadrupole interaction in tellurium

CERN Document Server

Oh, Y K; Cho, H S

1999-01-01

Using the Hartree-Fock cluster procedure, we have studied the electric-field gradient tensors at the nuclear sites of sup 7 sup 7 Se and sup 1 sup 2 sup 5 Te in pure sup 1 sup 2 sup 5 Te systems and in tellurium crystalline system's with a sup 7 sup 7 Se impurity. From the results for the pure systems, sup 7 sup 7 Se in selenium and sup 1 sup 2 sup 5 Te in tellurium, using the observed quadrupole moments: Q( sup 7 sup 7 Se) 0.75 +- 0.07 barns and Q( sup 1 sup 2 sup 5 Te) = 0.35 +- 0.04 barns. Comparison is made with earlier values obtained by different methods. Using our calculated values of Q and the results of a study of the field-gradient tensors for sup 7 sup 7 Se in tellurium, the theoretical values of the quadrupole coupling constants are found to agree, within about 7 percent, with experiment. The calculated asymmetry parameters are also found to be in reasonable agreement with the experiment values, although the agreement not as close as in the case of the quadrupole -coupling constants. Directions fo...

Melt-gas phase equilibria and state diagrams of the selenium-tellurium system

Science.gov (United States)

Volodin, V. N.; Trebukhov, S. A.; Burabaeva, N. M.; Nitsenko, A. V.

2017-05-01

The partial pressures of saturated vapor of the components in the Se-Te system are determined and presented in the form of temperature-concentration dependences from which the boundaries of the melt-gas phase transition are calculated at atmospheric pressure and vacuums of 2000 and 100 Pa. The existence of azeotropic mixtures is revealed. It is found that the points of inseparably boiling melts correspond to 7.5 at % of Se and 995°C at 101325 Pa, 10.9 at % at 673°C and 19.5 at % at 522°C in vacuums of 2000 and 100 Pa, respectively. A complete state diagram is constructed, including the fields of gas-liquid equilibria at atmospheric and low pressures, the boundaries of which allow us to assess the behavior of selenium and tellurium upon distillation fractionation.

Simultaneous analysis of arsenic, antimony, selenium and tellurium in environmental samples using hydride generation ICPMS

International Nuclear Information System (INIS)

Jankowski, L.M.; Breidenbach, R.; Bakker, I.J.I.; Epema, O.J.

2009-01-01

Full text: A quantitative method for simultaneous analysis of arsenic, antimony, selenium and tellurium in environmental samples is being developed using hydride generation ICPMS. These elements must be first transformed into hydride-forming oxidation states. This is particularly challenging for selenium and antimony because selenium is susceptible to reduction to the non-hydride-forming elemental state and antimony requires strong reducing conditions. The effectiveness of three reducing agents (KI, thiourea, cysteine) is studied. A comparison is made between addition of reducing agent to the sample and addition of KI to the NaBH 4 solution. Best results were obtained with the latter approach. (author)

Luminescent Tellurium-Doped Cadmium Sulfide Electrodes as Probes of Semiconductor Excited-State Deactivation Processes in Photoelectrochemical Cells.

Science.gov (United States)

1980-08-12

photocurrent and emission intensity. Whereas CdS:Te electrochemistry consisted of oxidation of an electrolyte 2+ reductant, ZnO underwent photoanodic...employed n- and 1 3 2,3 3 3,4p-type GaPl’ n-type ZnO , n-type CdS , and n- and p-type GaAs. We have focussed our attention recently on n-type, tellurium...should point out that our treatment of Or and 0x is not without precedent. Both GaP- and ZnO -based PECs have been examined in this regard.l12 The

The anti-inflammatory effects of the tellurium redox modulating compound, AS101, are associated with regulation of NFκB signaling pathway and nitric oxide induction in macrophages

Directory of Open Access Journals (Sweden)

Sredni Benjamin

2010-01-01

Full Text Available Abstract Background LPS-activated macrophages produce mediators which are involved in inflammation and tissue injury, and especially those associated with endotoxic shock. The non toxic tellurium compound ammonium tri-chloro(dioxoethylene-O,O'-tellurate, AS101, has been recently shown to exert profound anti-inflammatory properties in animal models, associated with its Te(IV redox chemistry. This study explores the anti-inflammatory properties of AS101 with respect to modulation of inflammatory cytokines production and regulation of iNOS transcription and expression in activated macrophages via targeting the NFkB complex. Results AS101 decreased production of IL-6 and in parallel down-regulated LPS-induced iNOS expression and NO secretion by macrophages. AS101 reduced IkB phosphorylation and degradation, and reduced NFkB nuclear translocalization, albeit these effects were exerted at different kinetics. Chromatin immunoprecipitation assays showed that AS101 treatment attenuated p50-subunit ability to bind DNA at the NFkB consensus site in the iNOS promotor following LPS induction. Conclusions Besides AS101, the investigation of therapeutic activities of other tellurium(IV compounds is scarce in the literature, although tellurium is the fourth most abundant trace element in the human body. Since IKK and NFkB may be regulated by thiol modifications, we may thus envisage, inview of our integrated results, that Te(IV compounds, may have important roles in thiol redox biological activity in the human body and represent a new class of anti-inflammatory compounds.

Stability studies of arsenic, selenium, antimony and tellurium species in water, urine, fish and soil extracts using HPLC/ICP-MS

Energy Technology Data Exchange (ETDEWEB)

Lindemann, T.; Prange, A.; Neidhart, B. [GKSS Research Centre, Geesthacht (Germany). Inst. of Physical and Chemical Analysis; Dannecker, W. [Hamburg Univ. (Germany). Inst. fuer Anorganische und Angewandte Chemie

2000-10-01

The stability of arsenic, selenium, antimony and tellurium species in water and urine (NIST SRM 2670n) as well as in extracts of fish and soil certified reference materials (DORM-2 and NIST SRM 2710) has been investigated. Stability studies were carried out with As(III), As(V), arsenobetaine, monomethylarsonic acid (MMA), dimethylarsinic acid (DMA), phenylarsonic acid (PAA), Se(IV), Se(VI), selenomethionine, Sb(III), Sb(V) and Te(VI). Speciation analysis was performed by on-line coupling of anion exchange high-performance liquid chromatography (HPLC) with inductively coupled plasma mass spectrometry (ICP-MS). Best storage of aqueous mixtures of the examined species was achieved at 3 C whereas at -20 C species transformation especially of selenomethionine and Sb(V) took place and a new selenium species appeared within a period of 30 days. Losses and species transformations during extraction processes were investigated. Extraction of the spiked fish material with methanol/water led to partial conversion of Sb(III), Sb(V) and selenomethionine to two new antimony and one new selenium species. The other arsenic, selenium and tellurium species were almost quantitatively extracted. For soil spiked with MMA, PAA, Se(IV) and Sb(III), recoveries after extraction with water and sulfuric acid (0.01 mol/L) were below 20%. (orig.)

R.I.S.-125 {sup 125}I air monitor system

Energy Technology Data Exchange (ETDEWEB)

Belaish, I; Levinson, S; German, U; Pelled, O; Laichter, Y; Wangrovitz, U; Tirosh, D; Barak, D [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev

1996-12-01

We have developed at NRCN a prototype of a continuous K-Ray air monitoring (CAM) system called `R.1.S.-125` (Radioactive Isotope Sampler for {sup 125}I). The system. was checked according to ANSI N42.17B -1989 (authors).

Standardization of 125 Sb in equilibrium non-equilibrium situations with 125m Te

International Nuclear Information System (INIS)

Rodriguez Barquero, L.; Jimenez de Mingo, A.; Grau Carles, A.

1997-10-01

We study the stability of ''125 Sb in the following scintillators: HiSafeIII''TM, Insta- Gel reg s ign Plus and '' Ultima-Gold'' TM. Since ''125 m Te requires more than one year to reach the secular equilibrium with ''125 Sb, we cannot be sure, for a given sample, whether equilibrium is reached or not. In this report we present a new procedure that permits one calibrate mixtures of ''125 Sb+''125 m Te out of the equilibrium. The steps required for the radiochemical separation of the components are indicated. Finally, we study the evolution of counting rate when column yields are less than 100%. (Author)

Calculations of energy levels and electromagnetic properties for tellurium pair isotopes, by unified method

International Nuclear Information System (INIS)

Teixeira, R.R.P.

1988-01-01

Calculations with the Unified Model (vibrator coupled to two particles), of the energy levels and the eletromagnetic properties have been performed and compared with the twelve pair isotopes from tellurium with A between 112 and 134. The results were analysed using as particles interaction: pairing and SDI (Surface Delta Interaction). The SDI and 3 fonons collective states were used in the fittings, and a syntematic comparison between the theoretical and experimental results was made. The dependence of the results with the model parameters was determined, through large variation sof them. Calculations using 4 fonons have been made, and the importance of the introduced variations in the results was discussed. Calculations have been made in the VAX Computer of the Pelletron at IFUSP. (author) [pt

Development of tellurium oxide and lead-bismuth oxide glasses for mid-wave infra-red transmission optics

Science.gov (United States)

Zhou, Beiming; Rapp, Charles F.; Driver, John K.; Myers, Michael J.; Myers, John D.; Goldstein, Jonathan; Utano, Rich; Gupta, Shantanu

2013-03-01

Heavy metal oxide glasses exhibiting high transmission in the Mid-Wave Infra-Red (MWIR) spectrum are often difficult to manufacture in large sizes with optimized physical and optical properties. In this work, we researched and developed improved tellurium-zinc-barium and lead-bismuth-gallium heavy metal oxide glasses for use in the manufacture of fiber optics, optical components and laser gain materials. Two glass families were investigated, one based upon tellurium and another based on lead-bismuth. Glass compositions were optimized for stability and high transmission in the MWIR. Targeted glass specifications included low hydroxyl concentration, extended MWIR transmission window, and high resistance against devitrification upon heating. Work included the processing of high purity raw materials, melting under controlled dry Redox balanced atmosphere, finning, casting and annealing. Batch melts as large as 4 kilograms were sprue cast into aluminum and stainless steel molds or temperature controlled bronze tube with mechanical bait. Small (100g) test melts were typically processed in-situ in a 5%Au°/95%Pt° crucible. Our group manufactured and evaluated over 100 different experimental heavy metal glass compositions during a two year period. A wide range of glass melting, fining, casting techniques and experimental protocols were employed. MWIR glass applications include remote sensing, directional infrared counter measures, detection of explosives and chemical warfare agents, laser detection tracking and ranging, range gated imaging and spectroscopy. Enhanced long range mid-infrared sensor performance is optimized when operating in the atmospheric windows from ~ 2.0 to 2.4μm, ~ 3.5 to 4.3μm and ~ 4.5 to 5.0μm.

Reaction of 1-bromo-3-chloropropane with tellurium and dimethyl telluride in the system of hydrazine hydrate-alkali

International Nuclear Information System (INIS)

Russavskaya, N.V.; Levanova, E.P.; Sukhomazova, Eh.N.; Grabel'nykh, V.A.; Elaev, A.V.; Klyba, L.V.; Zhanchipova, E.R.; Albanov, A.I.; Korotaeva, I.M.; Toryashinova, D.S.D.; Korchevin, N.A.

2006-01-01

A synthesis of oligomeric substance of thiocol type, the poly(trimethyleneditelluride), from 1-bromo-3-chloropropane and elemental tellurium is performed using a hydrazine hydrate-alkali system. Reductive splitting of the tellurocol followed by alkylation with methyl iodide give rise to preparation of bis(methyltelluro)propane, which was synthesized also from dimethyl telluride and 1,3-dihalopropanes using the N 2 H 4 ·H 2 O/KOH system. The reaction products were characterized by elementary analysis, NMR, and IR spectra. Mass spectra of the synthesized low molecular weight organotellurium compounds are considered [ru

Potential for improved extraction of tellurium as a byproduct of current copper mining processes

Science.gov (United States)

Hayes, S. M.; Spaleta, K. J.; Skidmore, A. E.

2016-12-01

Tellurium (Te) is classified as a critical element due to its increasing use in high technology applications, low average crustal abundance (3 μg kg-1), and primary source as a byproduct of copper extraction. Although Te can be readily recovered from copper processing, previous studies have estimated a 4 percent extraction efficiency, and few studies have addressed Te behavior during the entire copper extraction process. The goals of the present study are to perform a mass balance examining Te behavior during copper extraction and to connect these observations with mineralogy of Te-bearing phases which are essential first steps in devising ways to optimize Te recovery. Our preliminary mass balance results indicate that less than 3 percent of Te present in copper ore is recovered, with particularly high losses during initial concentration of copper ore minerals by flotation. Tellurium is present in the ore in telluride minerals (e.g., Bi-Te-S phases, altaite, and Ag-S-Se-Te phases identified using electron microprobe) with limited substitution into sulfide minerals (possibly 10 mg kg-1 Te in bulk pyrite and chalcopyrite). This work has also identified Te accumulation in solid-phase intermediate extraction products that could be further processed to recover Te, including smelter dusts (158 mg kg-1) and pressed anode slimes (2.7 percent by mass). In both the smelter dusts and anode slimes, X-ray absorption spectroscopy indicates that about two thirds of the Te is present as reduced tellurides. In anode slimes, electron microscopy shows that the remaining Te is present in an oxidized form in a complex Te-bearing oxidate phase also containing Pb, Cu, Ag, As, Sb, and S. These results clearly indicate that more efficient, increased recovery of Te may be possible, likely at minimal expense from operating copper processing operations, thereby providing more Te for manufacturing of products such as inexpensive high-efficiency solar panels.

Metabolism in the isolated rat heart: comparison of 125I-BMIPP with 125I-IPPA

International Nuclear Information System (INIS)

Chen Shaoliang; Cheng Aiping; Xu Lanwen; Qiao Weiwei

2008-01-01

Objective: The fatty acid metabolism in myocardium is recently one of the most interesting subjects in nuclear cardiology. The purpose of this study was to clarify the metabolic fate of 125 I-labeled 15-(p-iodophenyl)-3-(R, S)-methyl-pentadecanoic acid ( 125 I-BMIPP) and 15-(p-[ 125 I] iodophenyl) pentadecanoic acid ( 125 I-IPPA) by means of isolated rat hearts. Methods: Ten isolated rat hearts were prepared and perfused with 125 I-BMIPP (5 rats) or 125 I-IPPA (5 rats) for 3 h following a basic perfusion of 30 min. After perfusion, the radioactivity in the recirculated buffer was measured. The metabolites in the buffer were then extracted and analyzed using high performance liquid chromatography (HPLC) and thin-layer chromatography (TLC). Results: At the beginning (5 rain) of 125 I-BMIPP perfusion, the main radioactive peak appeared on HPLC at 37 min, which remained after 3 h perfusion. Several small peaks eluting were found before the parent peak at 30, 26, 21, 16, 12 and 9 min, respectively. At the beginning (5 min) of 125 I-IPPA perfusion, the main peak appeared on HPLC at 33 min, which disappeared after 3 h. Conclusions: 125 I-BMIPP strongly inhibited beta-oxidation, therefore appeared suitable for myocardial metabolic imaging. 125 I-IPPA was metabolized rapidly. (authors)

Agglomeration during wet milling of LAST (lead-antimony-silver-tellurium) powders

International Nuclear Information System (INIS)

Hall, B.D.; Case, E.D.; Ren, F.; Johnson, J.R.; Timm, E.J.

2009-01-01

LAST (lead-antimony-silver-tellurium) compounds comprise a family of semiconducting materials with good thermoelectric properties. However, the as-cast form of LAST exhibits large grain size and hence low mechanical strength. Powder processing can produce a fine powder particle size that enhances fracture strength, however the powders tend to agglomerate if the individual powder diameters are less than a few microns across. Dry milling or wet milling (hexane additions of 0 cm 3 and 10 cm 3 ) produced hard agglomerates roughly 40 μm in diameter while wet milling with hexane additions of 25 cm 3 , 30 cm 3 or 50 cm 3 resulted in small, porous agglomerates roughly 20 μm in diameter. Thus, by adjusting the amount of milling liquid used while milling LAST powders, one can shift from hard to soft agglomerates, where the literature shows that soft agglomerates are less harmful to the final, sintered product. Also, in agreement with the results from the literature on other materials, wet milling of LAST powders produced smaller particle sizes but required longer times to reach the grindability limit

77 FR 57041 - Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and...

Science.gov (United States)

2012-09-17

... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines. The existing AD currently... TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but not limited to...

Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

CERN Document Server

Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

2016-01-01

The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

Energy Technology Data Exchange (ETDEWEB)

Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN, CH-1211 Geneva 23 (Switzerland); School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Fedorov, D. [Petersburg Nuclear Physics Institute, 188350 Gatchina (Russian Federation); Fedosseev, V.N.; Forster, L.; Marsh, B.A. [CERN, CH-1211 Geneva 23 (Switzerland); Rossel, R.E. [CERN, CH-1211 Geneva 23 (Switzerland); Institut für Physik, Johannes Gutenberg Universität, D-55099 Mainz (Germany); Faculty of Design, Computer Science and Media, Hochschule RheinMain, Wiesbaden (Germany); Rothe, S.; Veinhard, M. [CERN, CH-1211 Geneva 23 (Switzerland)

2016-09-11

The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

75 FR 71371 - Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and...

Science.gov (United States)

2010-11-23

... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but..., Operation & Maintenance Manual OM- 01-02, Issue 3, Revision 13. (ii) For TAE 125-02-99 and TAE 125-02-114...

The preparation of 125I - gastrin I and 125 - minigastrin for medical diagnostics

International Nuclear Information System (INIS)

Byszewska-Szpocinska, E.; Markiewicz, A.

2002-01-01

Gastrin I G-17 and minigastrin G-13 were iodinated using direct methods with chloramin T and iodogen procedures and by indirect method with Bolton-Hunter reagent. 125 I - gastrin and 1 25 I - minigastrin were isolated from the iodination mixtures by gel filtration on Sephadex G-10 and Sephadex G-25 (PD-10 column) and by HPLC system (Lichrospher WP-300-RP-18 column). Radiochemical purity was shown by HPLC also. It was confirmed that iodogen procedure is the best for iodination of these peptides. 125 I - gastrin I obtained by this method with specific activity 80 μCi/nmol was homogeneous but iodination to higher specific activity (440μCi/nmol) caused appearance of two subfractions. 125 I - minigastrin with high and low specific activity were isolated by HPLC as the two forms (subfractions). It was shown that high performance liquid chromatography (HPLC) was the best method for isolation and purification of 125 I - gastrin I and 125 I - minigastrin. (author)

18 CFR 284.125 - [Reserved

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.125 Section 284.125 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Transportation by Intrastate Pipelines § 284.125 [Reserved] ...

7 CFR 1220.125 - Research.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1220.125 Section 1220.125 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.125 Research. The term...

Etravirine: R165335, TMC 125, TMC-125, TMC125.

Science.gov (United States)

2006-01-01

Etravirine [TMC 125] is a next-generation non-nucleoside reverse transcriptase inhibitor (NNRTI) that is being developed by Tibotec (Tibotec-Virco Group; now Johnson & Johnson) for the treatment of HIV-1 infections. Etravirine is a highly flexible, di-aryl-pyrimidine (DAPY) compound. The flexibility enables favourable binding interactions with mutant HIV strains as well as wild-type virus. Etravirine has superseded dapivirine as Tibotec's lead NNRTI in clinical development worldwide. Tibotec merged with Virco to form Tibotec-Virco Group in March 2001. Subsequently, Tibotec-Virco Group was acquired by Johnson & Johnson on 18 April 2002. Etravirine was discovered by Tibotec in collaboration with the Janssen Research Foundation. However, the Janssen Research Foundation is no longer involved in the development of etravirine. Etravirine has received fast-track status from the US FDA for the treatment of HIV-1 infections. An expanded access programme for etravirine began in the US in September 2006. The programme made etravirine available to HIV-1 infected adults who have limited treatment options due to virological failure or intolerance to multiple antiretroviral regimens. The progamme will also be introduced in Canada and Europe. In November 2005, Tibotec initiated two randomised, placebo-controlled phase III trials of etravirine in treatment-experienced HIV-1 infected patients with NNRTI resistance and at least three primary protease mutations. The two trials will each enroll 600 patients and will be conducted in 18 countries. Darunavir will be used as the background protease inhibitor in the trials. This is the first time that two investigational antivirals have been evaluated in combination in heavily treatment-experienced patients. The trial design is supported by the FDA, the Committee for Medicinal Products for Human Use (CHMP) of the EMEA and the HIV patient community. Patient enrolment in the two phase III trials was completed in September 2006. A multicentre

76 FR 17757 - Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and...

Science.gov (United States)

2011-03-31

... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114.... Applicability (c) This AD applies to Thielert Aircraft Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE...) For TAE 125-02-99 and TAE 125-02-114 engines, Operation & Maintenance Manual OM-02-02, Version 2...

49 CFR 1.25 - Relationships.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Relationships. 1.25 Section 1.25 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND DUTIES Office of the Secretary § 1.25 Relationships. (a) Normal staff role. Normally, the functions of the Assistant Secretaries...

Effect of aging and temperature on alternating current conductivity of tellurium thin films

Energy Technology Data Exchange (ETDEWEB)

Tsiulyanu, D. [Technical University, Department of Physics, bul. Dacia 41, MD-2060, Chisinau (Moldova, Republic of)], E-mail: tsiu@cni.md; Marian, T.; Tiuleanu, A. [Technical University, Department of Physics, bul. Dacia 41, MD-2060, Chisinau (Moldova, Republic of); Liess, H.-D.; Eisele, I. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany)

2009-02-27

The impedance spectra of tellurium films with interdigital platinum electrodes were investigated in air at temperatures between 10 and 50 deg. C . Cole-Cole analysis made it possible to assess time constants, resistance, and capacitance of the film at characteristic frequencies and the dependence of these parameters on aging and temperature. Aging under normal conditions over 12 months led to a relative increase of only {approx} 5% in film impedance at the characteristic frequency. However, aging noticeably influences the electrical resistance of the film at high (> 500 kHz) frequencies, and capacitance diminished after 12 months by more than 50% throughout the spectrum. Scanning electron microscopy confirmed that the effect of aging is due to structural changes in the film. Temperature does not influence the capacitance of the film but uncommonly influences its resistance, which reaches a maximum at around 20 deg. C . This is ascribed to desorption of oxygen previously adsorbed from the environment.

Effect of aging and temperature on alternating current conductivity of tellurium thin films

International Nuclear Information System (INIS)

Tsiulyanu, D.; Marian, T.; Tiuleanu, A.; Liess, H.-D.; Eisele, I.

2009-01-01

The impedance spectra of tellurium films with interdigital platinum electrodes were investigated in air at temperatures between 10 and 50 deg. C . Cole-Cole analysis made it possible to assess time constants, resistance, and capacitance of the film at characteristic frequencies and the dependence of these parameters on aging and temperature. Aging under normal conditions over 12 months led to a relative increase of only ∼ 5% in film impedance at the characteristic frequency. However, aging noticeably influences the electrical resistance of the film at high (> 500 kHz) frequencies, and capacitance diminished after 12 months by more than 50% throughout the spectrum. Scanning electron microscopy confirmed that the effect of aging is due to structural changes in the film. Temperature does not influence the capacitance of the film but uncommonly influences its resistance, which reaches a maximum at around 20 deg. C . This is ascribed to desorption of oxygen previously adsorbed from the environment

Study on concentration nonlinearity of interacting acoustic flows in cadmium sulfide and tellurium

International Nuclear Information System (INIS)

Ilisavskij, Yu.V.; Kulakova, L.A.; Yakhkind, Eh.Z.

1976-01-01

The ratio of an one-mode (self-action of an external monochromatic sound wave) and a many-mode (interaction of an external wave with crystal thermal phonons) concentration nonlinearity has been experimentally investigated on sound amplification in cadmium sulphide and tellurium. It has been shown that in a strong piezoelectric the main part in the nonlinear limitation of the sound amplification in a drift field is played by the wave interaction, i.e., the transfer of the sound wave energy into the crystal sound modes starts before the nonlinear self-action of a wave. In Te characterized by a large value of the electromechanical coupling constant value at the sound frequency of about 250 MHz the threshold of many-mode nonlinearity is achieved in fields much below the critical one, and corresponds to the sound intensity as low as 10 -7 W/cm 2 , as compared with 10 -2 W/cm 2 -the threshold of the one-mode nonlinearity

Electrochemical and antimicrobial activity of tellurium oxide nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Gupta, Pramod K. [Department of Applied Sciences and Humanities, Jamia Millia Islamia, New Delhi 110067 (India); Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India); Sharma, Prem Prakash; Sharma, Anshu [Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India); Khan, Zishan H., E-mail: zishan_hk@yahoo.co.in [Department of Applied Sciences and Humanities, Jamia Millia Islamia, New Delhi 110067 (India); Solanki, Pratima R., E-mail: pratimarsolanki@gmail.com [Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India)

2016-09-15

Highlights: • TeO{sub 2} NPs synthesized without using any catalyst by chemical vapour deposition method. • The growth temperature was 410 °C with continuous flow of O{sub 2.} • TeO{sub 2} NPs have anti-bacterial activity against E. coli, K. pneumoniae and S. aureus while enhances the growth of S. pyogenes. • TeO{sub 2} shows maximum redox current at pH 7 for phosphate buffer solution. - Abstract: Thin film of tellurium oxide (TeO{sub 2}) has been synthesized by chemical vapour deposition method onto indium tin oxide (ITO) coated glass substrate without using any catalyst. XRD pattern of TeO{sub 2} thin film suggests that the structure of TeO{sub 2} changes from amorphous to crystalline (paratellurite) on dispersing into deionized water. Zeta potential measurement reveals a positive surface potential of 28.8 mV. TEM images shows spherical shaped TeO{sub 2} nanoparticles having average particle size of 65 nm. Electrochemical studies of TeO{sub 2}/ITO electrode exhibit improved electron transfer owing to its inherent electron transfer property at pH 7.0 of phosphate buffer. Antimicrobial activity of TeO{sub 2} has been studied for gram-positive (Staphylococcus aureus and Streptococcus pyogenes) and gram negative (Escherichia coli and Klebsiella pneumoniae) bacterial and fungal strains (Aspergillus nizer and Candida albicans). These studies suggest that the TeO{sub 2} NPs inhibit the growth of E. coli, K. pneumoniae and S. aureus bacteria, whereas the same particles enhance the growth of S. pyogenes bacteria.

Antiparasitic activity of 1,3-dioxolanes containing tellurium in Trichomonas vaginalis.

Science.gov (United States)

Sena-Lopes, Ângela; das Neves, Raquel Nascimento; Bezerra, Francisco Silvestre Brilhante; de Oliveira Silva, Mara Thais; Nobre, Patrick C; Perin, Gelson; Alves, Diego; Savegnago, Lucielli; Begnini, Karine Rech; Seixas, Fabiana Kommling; Collares, Tiago; Borsuk, Sibele

2017-05-01

The increased prevalence of metronidazole-resistant infections has resulted in a search for alternative drugs for the treatment of trichomoniasis. In the present study, we report the preparation and in vitro activity of three 1,3-dioxolanes that contain tellurium (PTeDOX 01, PTeDOX 02, and PTeDOX 03) against Trichomonas vaginalis. Six concentrations of these compounds were analyzed for in vitro activity against ATCC 30236 isolate of T. vaginalis. PTeDOX 01 reported a cytotoxic effect against 100% of T. vaginalis trophozoites at a final concentration of 90μM with an IC 50 of 60μM. The kinetic growth curve of trophozoites indicated that PTeDOX 01 reduced the growth by 22% at a concentration of 90μM after an exposure of 12h, and induced complete parasite death at 24h. It induced cytotoxicity of 44% at 90μM concentration but and had no effect in lower concentrations in a culture of CHO-K1 cells. These results confirmed that PTeDOX 01 is an important drug for the treatment of T. vaginalis, and should be evaluated in other infectious agents as well. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Leaching of cadmium and tellurium from cadmium telluride (CdTe) thin-film solar panels under simulated landfill conditions

Science.gov (United States)

Ramos-Ruiz, Adriana; Wilkening, Jean V.; Field, James A.; Sierra-Alvarez, Reyes

2017-01-01

A crushed non-encapsulated CdTe thin-film solar cell was subjected to two standardized batch leaching tests (i.e., Toxicity Characteristic Leaching Procedure (TCLP) and California Waste Extraction Test (WET)) and to a continuous-flow column test to assess cadmium (Cd) and tellurium (Te) dissolution under conditions simulating the acidic- and the methanogenic phases of municipal solid waste landfills. Low levels of Cd and Te were solubilized in both batch leaching tests (leaching behavior of CdTe in the columns is related to different aqueous pH and redox conditions promoted by the microbial communities in the columns, and is in agreement with thermodynamic predictions. PMID:28472709

76 FR 9963 - Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-02-99 and TAE 125-02-114...

Science.gov (United States)

2011-02-23

... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-02-99 and TAE 125-02-114 Reciprocating... TAE 125-02-99 and TAE 125-02-114 reciprocating engines installed in, but not limited to, Cessna 172... occurs later. Repetitive Replacements of Timing Chains for All TAE 125-02-99 and TAE 125-02-114 Engines...

76 FR 64285 - Airworthiness Directives; Thielert Aircraft Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125...

Science.gov (United States)

2011-10-18

... Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125-01 Reciprocating Engines AGENCY: Federal Aviation... substance. But we have found it necessary to reduce the initial compliance time for TAE 125-02-99 engines... about 370 TAE 125-01 and TAE 125-02-99 reciprocating engines installed on products of U.S. registry. We...

Optical properties of tellurium-doped InxGa1-xAsySb1-y epitaxial layers studied by photoluminescence spectroscopy

International Nuclear Information System (INIS)

Diaz-Reyes, J; Cardona-Bedoya, J A; Gomez-Herrera, M L; Herrera-Perez, J L; Riech, I; Mendoza-Alvarez, J G

2003-01-01

Controlled doping of quaternary alloys of In x Ga 1-x As y Sb 1-y with tellurium is fundamental to obtain the n-type layers needed for the development of optoelectronic devices based on p-n heterojunctions. InGaAsSb epitaxial layers were grown by liquid phase epitaxy and Te doping was obtained by incorporating small Sb 3 Te 2 pellets in the growth melt. The tellurium doping levels were in the range 10 16 -10 17 cm -3 . We have used low-temperature photoluminescence (PL) spectroscopy to study the influence of the Te donor levels on the radiative transitions shown in the PL spectra. The PL measurements were done by exciting the samples with the 448 nm line of an Ar ion laser with varying excitation powers in the range from 10 to 200 mW. For the low-doped sample the PL spectrum showed a narrow exciton-related peak centred at around 610 meV with a full width at half maximum (FWHM) of about 7 meV which is evidence of the good crystalline quality of the layers. For higher Te doping, the PL spectra show the presence of band-to-band and donor-to-acceptor transitions which overlap as the Te concentration increases. The peak of the PL band shifts to higher energies as Te doping increases due to a band-filling effect as the Fermi level enters into the conduction band. From the peak energy of the PL spectra, and using a model that includes the band-filling and band-shrinkage effects due to the carriers, we have estimated the effective carrier concentration due to doping with Te in the epilayers

Thyroid measurements of Iodine-125 workers

International Nuclear Information System (INIS)

Burns, P.A.; Peggie, J.R.

1979-02-01

The accumulation of 125 I in the thyroid presents real hazards to workers who use this radionuclide. Recent assessments of the maximum permissible thyroid burden for 125 I have tended to be lower than those previously adopted. Workers using 125 I may receive small doses to a film badge monitor from external radiation while accumulating significant doses to the thyroid from internal contamination. It is therefore necessary to perform some form of thyroid monitoring on such workers. In the past two years the Australian Radiation Laboratory has monitored 125 I workers from six different institutations in the Melbourne area to determine the activity of 125 I in their thyroids. Most of the levels monitored were less than one tenth of the most recently recommended thyroid burden of 400 nanocurie. The highest levels were measured in workers who actually perform iodinations. Workers who handle the iodinate generally had lower levels than those performing the iodinations. Only a very small number of the workers measured were below the detectable limit of the system indicating that even when low activities of 125 I are handled in relatively stable forms it is still possible to accumulate 125 I in the thyroid

14 CFR 125.145 - Firewall construction.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewall construction. 125.145 Section 125.145 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Requirements § 125.145 Firewall construction. Each firewall and shroud must— (a) Be so made that no hazardous...

From Selenium- to Tellurium-Based Glass Optical Fibers for Infrared Spectroscopies

Directory of Open Access Journals (Sweden)

Jacques Lucas

2013-05-01

Full Text Available Chalcogenide glasses are based on sulfur, selenium and tellurium elements, and have been studied for several decades regarding different applications. Among them, selenide glasses exhibit excellent infrared transmission in the 1 to 15 µm region. Due to their good thermo-mechanical properties, these glasses could be easily shaped into optical devices such as lenses and optical fibers. During the past decade of research, selenide glass fibers have been proved to be suitable for infrared sensing in an original spectroscopic method named Fiber Evanescent Wave Spectroscopy (FEWS. FEWS has provided very nice and promising results, for example for medical diagnosis. Then, some sophisticated fibers, also based on selenide glasses, were developed: rare-earth doped fibers and microstructured fibers. In parallel, the study of telluride glasses, which can have transmission up to 28 µm due to its atom heaviness, has been intensified thanks to the DARWIN mission led by the European Space Agency (ESA. The development of telluride glass fiber enables a successful observation of CO2 absorption band located around 15 µm. In this paper we review recent results obtained in the Glass and Ceramics Laboratory at Rennes on the development of selenide to telluride glass optical fibers, and their use for spectroscopy from the mid to the far infrared ranges.

Dicty_cDB: SFF125 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT

14 CFR 135.125 - Aircraft security.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft security. 135.125 Section 135.125....125 Aircraft security. Certificate holders conducting operators conducting operations under this part must comply with the applicable security requirements in 49 CFR chapter XII. [67 FR 8350, Feb. 22, 2002] ...

34 CFR 303.125 - Fiscal control.

Science.gov (United States)

2010-07-01

... 34 Education 2 2010-07-01 2010-07-01 false Fiscal control. 303.125 Section 303.125 Education... DISABILITIES State Application for a Grant Statement of Assurances § 303.125 Fiscal control. The statement must provide assurance satisfactory to the Secretary that such fiscal control and fund accounting procedures...

Structural Modeling of Djenkolic Acid with Sulfur Replaced by Selenium and Tellurium

Directory of Open Access Journals (Sweden)

Petr Melnikov

2014-04-01

Full Text Available The comparative structural modeling of djenkolic acid and its derivatives containing selenium and tellurium in chalcogen sites (Ch = Se, Te has provided detailed information about the bond lengths and bond angles, filling the gap in what we know about the structural characteristics of these aminoacids. The investigation using the molecular mechanics technique with good approximation confirmed the available information on X-ray refinements for the related compounds methionine and selenomethionine, as well as for an estimate made earlier for telluromethionine. It was shown that the Ch-C(3 and Ch-C(4 bond lengths grow in parallel with the increasing anionic radii. Although the distances C-C, C-O, and C-N are very similar, the geometry of conformers is quite different owing to the possibility of rotation about four carbon atoms, hence the remarkable variability observed in dihedral angles. It was shown that the compounds contain a rigid block with two Ch atoms connected through a methylene group. The standard program Gaussian 03 with graphical interface Gaussview 4.1.2 has proved to be satisfactory tool for the structural description of less-common bioactive compositions when direct X-ray results are absent.

Direct determination of tellurium and its redox speciation at the low nanogram level in natural waters by catalytic cathodic stripping voltammetry.

Science.gov (United States)

Biver, Marc; Quentel, François; Filella, Montserrat

2015-11-01

Tellurium is one of the elements recently identified as technologically critical and is becoming a new emergent contaminant. No reliable method exists for its determination in environmental samples such as natural waters. This gap is filled by the method described here; it allows the rapid detection of trace concentrations of Te(IV) and Te(VI) in surface waters by differential pulse cathodic stripping voltammetry. It is based on the proton reduction catalysed by the absorption of Te(IV) on the mercury electrode. Under our conditions (0.1 mol L(-1) HCl) a detection limit of about 5 ng L(-1) for a deposition time of 300 s is achieved. Organic matter does not represent a problem at low concentrations; higher concentrations are eliminated by adsorptive purification. Tellurium occurs primarily as Te(IV) and Te(VI) in natural waters. Thus, determining total Te requires the reduction of Te(VI) that it is not electroactive. A number of reduction procedures have been carefully evaluated and a method based on the addition of TiCl3 to the acidified samples has been proven to reduce Te(VI) at the trace level to Te(IV) reliably and quantitatively. Therefore, the procedure described allows the direct determination of total Te and its redox speciation. It is flexible, reliable and cost effective compared to any possible alternative method based on the common preconcentration-ICPMS approach. It is readily implementable as a routine method and can be deployed in the field with relative ease. Copyright © 2015 Elsevier B.V. All rights reserved.

Synthesis and binding of [125I2]philanthotoxin-343, [125I2]philanthotoxin-343-lysine, and [125I2]philanthotoxin-343-arginine to rat brain membranes

International Nuclear Information System (INIS)

Goodnow, R.A. Jr.; Bukownik, R.; Nakanishi, K.; Usherwood, P.N.; Eldefrawi, A.T.; Anis, N.A.; Eldefrawi, M.E.

1991-01-01

125I2-iodinated philanthotoxin-343 (PhTX-343), [125I2]PhTX-343-arginine, and [125I2]PhTX-343-lysine were synthesized and evaluated as probes for glutamate receptors in rat brain synaptic membranes. It was found that these probes were not specific for the glutamate receptors but may be useful for investigating the polyamine binding site. Filtration assays with Whatman GF/B fiber glass filters were unsuitable because the iodinated PhTX-343 analogues exhibited high nonspecific binding to the filters, thus hindering detection of specific binding to membranes. When binding was measured by a centrifugal assay, [125I2]PhTX-343-lysine bound with low affinity (KD = 11.4 ± 2 microM) to a large number of sites (37.2 ± 9.1 nmol/mg of protein). The binding of [125I2]PhTX-343-lysine was sensitive only to the polyamines spermine and spermidine, which displaced [125I2]PhTX-343-lysine with Ki values of (3.77 ± 1.4) x 10(-5) M and (7.51 ± 0.77) x 10(-5) M, respectively. The binding was insensitive to glutamate receptor agonists and antagonists. Binding results with [125I2]PhTX-343-arginine were similar to those of [125I2]-PhTX-343-lysine. Considering the high number of toxin binding sites (10000-fold more than glutamate) in these membranes and the insensitivity of the binding to almost all drugs that bind to glutamate receptors, it is evident that most of the binding observed is not to glutamate receptors. On the other hand, PhTX analogues with photoaffinity labels may be useful in the isolation/purification of various glutamate and nicotinic acetylcholine receptors; they could also be useful in structural studies of receptors and their binding sites

14 CFR 125.355 - Airplane equipment.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane equipment. 125.355 Section 125.355...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Release Rules § 125.355 Airplane...

14 CFR 125.93 - Airplane limitations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations. 125.93 Section 125.93...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements § 125.93 Airplane...

75 FR 7996 - Airworthiness Directives; Thielert Aircraft Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02...

Science.gov (United States)

2010-02-23

... Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02-99 Reciprocating Engines Installed in, But Not Limited...-99 engines, initial and repetitive replacements of the PPRV, and installation of a vibration isolator..., we estimate that this proposed AD would affect about 300 TAE 125-01 and TAE 125-02-99 reciprocating...

Beta-decay 125I → 125Te

Directory of Open Access Journals (Sweden)

A. A. Kurteva

2016-08-01

Full Text Available Beta-decay of the nucleus 125I and spectroscopic characteristics of the daughter nucleus are described within the framework of the dynamic collective model. Quasiparticle and multiphonon states, as well as vacuum fluctuations of quasiparticles are taken into account. The comparison of the results of calculations with the available experimental data is performed.

14 CFR 125.143 - Firewalls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewalls. 125.143 Section 125.143....143 Firewalls. Each engine, auxiliary power unit, fuel-burning heater, or other item of combusting... of firewalls or shrouds, or by other equivalent means. ...

33 CFR 125.25 - Aliens.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Aliens. 125.25 Section 125.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) WATERFRONT....25 Aliens. Alien registration records together with other papers and documents which indicated the...

Determination of tellurium in gallium by alternating current stripping voltammetry with a mercury/graphite electrode

International Nuclear Information System (INIS)

Berengard, I.B.; Kaplan, B. Ya.

1986-01-01

The analytical signal in ac stripping coltammetry (ACSV) with mercury indicator electrodes depends on the weight of the electrolytically collected analyte at the electrode surface, the depth of the collection layer being equal to the effective diffusion-layer thickness. Replacement of the static mercury drop electrode (SMDE) by the mercury/graphite electrode (MGE) is of practical interest in that the analyte detection limit can be lowered by decreasing the colume of the telluriumcontaining polarographed solution; in addition, plant laboratories find it difficult to control the SDME uniformity. The work in this article was done on a PU-1 universal polarograph in a square-wave vol tage component mode using the three-electrode cell shown. The rotating mercury/graphite electrode is found by the authors to be superior to the static mercury drop electrode in that it can lower the detection limit for tellurium in gallium to 5.10 /SUP -7percent/ , due to the smaller volume of the polarographed solution

Preparation of sup 125 I-creatine phosphokinase-MM

Energy Technology Data Exchange (ETDEWEB)

Jingxian, Su; Jingmin, Ma [Academia Sinica, Beijing, BJ (China). Inst. of Atomic Energy

1988-09-01

{sup 125}I-creatine phosphokinase-MM ({sup 125}I-CPK-MM) was prepared by {sup 125}I-labelled Bolton-Hunter reagent (HPNS). Iodinating conditions of HPNS and its conjugation to protein were studied. {sup 125}I-CPK-MM with immune activity was obtained and used to establish the {sup 125}I-CPK-MM radioimmunoassay method by the General Hospital of PLA. {sup 125}I-CPK-MM in PBS-G solution containing 0.015 mol/l ethyl mercaptan at 4-10 deg C can be used for one month.

Dibromidochlorido{2-[(dimethylaminomethyl]phenyl-κ2N,C1}tellurium(IV

Directory of Open Access Journals (Sweden)

Prakul Rakesh

2012-01-01

Full Text Available The title compound, C9H13Br2ClNTe, was synthesized by reacting [2-(dimethylaminomethylphenyl]tellurium(II chloride with Br2. As a consequence, the Cl and Br atoms are not well ordered but distributed over the three possible positions such that the overall stiochiometry is two Br atoms and one Cl atom. The scrambling of the Br and Cl atoms indicates a small energy barrier for the exchange process between the apical and equatorial positions. Overall, the Te atom geometry is slightly distorted square pyramidal (τ = 0.052 for the major component. However, there is a weak secondary interaction between the Te atoms and the disordered Br/Cl atoms of a nearby molecule. The Te—Br and Te—Cl distances in both disorder components fall into two groups; a longer distance for the Br/Cl involved in this secondary interaction [2.6945 (17 Å for Br and 2.601 (9Å for Cl] and shorter bond distances to the remaining halogen atoms, indicating that this interaction has slightly weakened the Te—X bond, as is the case in the previously reported tribromido structure [Singh et al. (1990. J. Chem. Soc. Dalton Trans. pp. 907–913]. Otherwise, the metrical parameters in the two structures are not significantly different. An intermolecular C—H...Br interaction occurs.

40 CFR 125.121 - Definitions.

Science.gov (United States)

2010-07-01

... environment means that territorial seas, the contiguous zone and the oceans. (c) Mixing zone means the zone... of the pollutants. (e) Unreasonable degradation of the marine environment means: (1) Significant... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 125.121 Section 125.121...

24 CFR 125.201 - Administrative Enforcement Initiative.

Science.gov (United States)

2010-04-01

... Initiative. 125.201 Section 125.201 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.201 Administrative Enforcement Initiative. The Administrative Enforcement Initiative provides funding to State and local fair housing agencies administering...

Size Controlled Synthesis of Tellurium Nanorices by Galvanic Displacement Reaction of Aluminum

International Nuclear Information System (INIS)

Wu, Tingjun; Myung, Lawrence Youngjae; Zhang, Miluo; Lee, Kyu-Hwan; Lee, Yeheun Laura; Lim, Hyo-Ryong; Kim, Bum Sung; Choa, Yong-Ho; Myung, Nosang V.

2015-01-01

ABSTRACT: Tellurium nanostructures were synthesized by galvanic displacement reaction (GDR) of aluminum in an alkaline solution containing TeO 3 2− ions. Due to negative redox potential of Al/AlO 2 − (i.e., −2.50 V vs. sat. Ag/AgCl), TeO 3 2− (+IV) can be reduced to Te 2 2− (-I) and Te 2− (-II), which resulted in the deposition of Te (0) nanostructures in the solution via chemical reaction between Te 2 2− or Te 2− and TeO 3 2− . The deposition mechanism led to the formation of unique “rice-like” nanostructures in the solution instead of branched structures on the substrate. The sharp tips of the “rice-like” nanostructures may be attributed to the high density of surface charges at the tips. The morphology, diameter and aspect ratio of Te “rice-like” nanostructures were altered by the TeO 3 2− concentration, solution pH, reaction time and the reaction temperature. Electrochemical analytical methods, including open circuit potential (OCP) and linear polarizations (LPs), were used to investigate the reaction mechanisms. The enhancement of piezoelectric constant (d 11 ) of nanorices at small diameter was probably due to a flexoelectric effect

27 CFR 21.125 - Rubber hydrocarbon solvent.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Rubber hydrocarbon solvent. 21.125 Section 21.125 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU....125 Rubber hydrocarbon solvent. (a) Rubber hydrocarbon solvent is a petroleum derivative. (b...

Fragmentation of chromatin with 125I radioactive disintegrations

International Nuclear Information System (INIS)

Turner, G.N.; Nobis, P.; Dewey, W.C.

1976-01-01

The DNA in Chinese hamster cells was labeled first for 3 h with [ 3 H]TdR and then for 3 h with [ 125 I]UdR. Chromatin was extracted, frozen, and stored at -30 0 C until 1.0 x 10 17 and 1.25 x 10 17 disintegrations/g of labeled DNA occurred for 125 I and 3 H, respectively. Velocity sedimentation of chromatin (DNA with associated chromosomal proteins) in neutral sucrose gradients indicated that the localized energy from the 125 I disintegrations, which gave about 1 double-strand break/disintegration plus an additional 1.3 single strand breaks, selectively fragmented the [ 125 I] chromatin into pieces smaller than the [ 3 H] chromatin. In other words, 125 I disintegrations caused much more localized damage in the chromatin labeled with 125 I than in the chromatin labeled with 3 H, and fragments induced in DNA by 125 I disintegrations were not held together by the associated chromosomal proteins. Use of this 125 I technique for studying chromosomal proteins associated with different regions in the cellular DNA is discussed. For these studies, the number of disintegrations required for fragmenting DNA molecules of different sizes is illustrated

7 CFR 1221.125 - Books and records.

Science.gov (United States)

2010-01-01

... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1221.125 Section 1221.125... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Reports, Books, and Records § 1221.125 Books and records. (a) Each first handler, producer, or importer subject to this subpart shall maintain...

23 CFR 635.125 - Termination of contract.

Science.gov (United States)

2010-04-01

... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.125 Termination of contract. (a) All contracts exceeding... 23 Highways 1 2010-04-01 2010-04-01 false Termination of contract. 635.125 Section 635.125... the termination will be effected and the basis for settlement. In addition, such contracts shall...

Mock iodine-125 radiation source

International Nuclear Information System (INIS)

Coffey, D.L.

1976-01-01

An intimate mixture of americium-241 and iodine-129 provides an energy spectrum that reliably simulates the spectrum of iodine-125 in a well-type detector. As such, it may be used as a long-lived standard to calibrate instruments such as well scintillation spectrometers in which measurements are to be made involving iodine-125

Computerized dosimetry of I-125 sources model 6711; Dosimetria computarizada de las fuentes de I-125 modelo 6711

Energy Technology Data Exchange (ETDEWEB)

Isturiz, J [Centre de Radiotherapie du Parc, Dijon (France)

2001-07-01

It tries on: physical presentation of the sources; radiation protection; mathematical model of I-125 source model 6711; data considered for the calculation program; experimental com probation of the dose distribution; exposure rate and apparent activity; techniques of the use given to the sources I-125; and the calculation planning systems. [Spanish] Trata sobre presentacion fisica de las fuentes, radioproteccion, modelo matematico de las fuentes I-125 modelo 6711, datos considerados en el programa de calculo, comprobacion experimental de la distribucion de dosis, tasa de exposicion y actividad aparente, tecnicas de utilizacion de las fuentes I-125; y los sistemas de planificacion del calculo de las dosis.

The Present, Mid-Term, and Long-Term Supply Curves for Tellurium; and Updates in the Results from NREL's CdTe PV Module Manufacturing Cost Model (Presentation)

Energy Technology Data Exchange (ETDEWEB)

Woodhouse, M.; Goodrich, A.; Redlinger, M.; Lokanc, M.; Eggert, R.

2013-09-01

For those PV technologies that rely upon Te, In, and Ga, first-order observations and calculations hint that there may be resource constraints that could inhibit their successful deployment at a SunShot level. These are only first-order approximations, however, and the possibility for an expansion in global Te, In, and Ga supplies needs to be considered in the event that there are upward revisions in their demand and prices.In this study, we examine the current, mid-term, and long-term prospects of Tellurium (Te) for use in PV. We find that the current global supply base of Te would support <10 GW of annual traditional CdTe PV manufacturing production. But as for the possibility that the supply base for Te might be expanded, after compiling several preliminary cumulative availability curves we find that there may be significant upside potential in the supply base for this element - principally vis a vis increasing demand and higher prices. Primarily by reducing the Tellurium intensity in manufacturing and by increasing the recovery efficiency of Te in Cu refining processes, we calculate that it may prove affordable to PV manufacturers to expand the supply base for Te such that 100 GW, or greater, of annual CdTe PV production is possible in the 2030 - 2050 timeframe.

21 CFR 131.125 - Nonfat dry milk.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Nonfat dry milk. 131.125 Section 131.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.125 Nonfat dry milk. (a...

29 CFR 102.125 - Action on petition.

Science.gov (United States)

2010-07-01

... 29 Labor 2 2010-07-01 2010-07-01 false Action on petition. 102.125 Section 102.125 Labor....125 Action on petition. Upon the filing of such petition, the Board shall consider the same and may thereupon either grant or deny the petition in whole or in part, conduct an appropriate hearing thereon, or...

14 CFR 125.7 - Display of certificate.

Science.gov (United States)

2010-01-01

... OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT General § 125.7 Display of certificate. (a) The certificate holder must display a true copy of the certificate in each of its aircraft. (b... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Display of certificate. 125.7 Section 125.7...

14 CFR 125.127 - Location of fuel tanks.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Location of fuel tanks. 125.127 Section 125... Requirements § 125.127 Location of fuel tanks. (a) Fuel tanks must be located in accordance with § 125.153. (b... compartment may be used as the wall of an integral tank. (c) Fuel tanks must be isolated from personnel...

Effect of 24,25-dihydroxyvitamin D3 on 1,25-dihydroxyvitamin D3 [1,25-(OH)2D3] metabolism in vitamin D-deficient rats infused with 1,25-(OH)2D3

International Nuclear Information System (INIS)

Yamato, H.; Matsumoto, T.; Fukumoto, S.; Ikeda, K.; Ishizuka, S.; Ogata, E.

1989-01-01

Previous studies revealed that administration of 24,25-dihydroxyvitamin D3 [24,25-(OH)2D3] to calcium (Ca)-deficient rats causes a dose-dependent reduction in markedly elevated serum 1,25-(OH)2D3 level. Although the results suggested that the metabolism of 1,25-(OH)2D3 was accelerated by 24,25-(OH)2D3, those experiments could not define whether the enhanced metabolism of 1,25-(OH)2D3 played a role in the reduction in the serum 1,25-(OH)2D3 level. In the present study, in order to address this issue more specifically, serum 1,25-(OH)2D3 was maintained solely by exogenous administration through miniosmotic pumps of 1,25-(OH)2D3 into vitamin D-deficient rats. Thus, by measuring the serum 1,25-(OH)2D3 concentration, the effect of 24,25-(OH)2D3 on the MCR of 1,25-(OH)2D3 could be examined. Administration of 24,25-(OH)2D3 caused a dose-dependent enhancement in the MCR of 1,25-(OH)2D3, and 1 microgram/100 g rat.day 24,25-(OH)2D3, which elevated serum 24,25-(OH)2D3 to 8.6 +/- 1.3 ng/ml, significantly increased MCR and suppressed serum levels of 1,25-(OH)2D3. The effect of 24,25-(OH)2D3 on 1,25-(OH)2D3 metabolism developed with a rapid time course, and the recovery of iv injected [1 beta-3H]1,25-(OH)2D3 in blood was significantly reduced within 1 h. In addition, there was an increase in radioactivity in the water-soluble fraction of serum as well as in urine, suggesting that 1,25-(OH)2D3 is rapidly degraded to a water-soluble metabolite(s). Furthermore, the reduction in serum 1,25-(OH)2D3 was associated with a reduction in both serum and urinary Ca levels. Because the conversion of [3H]24,25-(OH)2D3 to [3H]1,24,25-(OH)2D3 or other metabolites was minimal in these rats, 24,25-(OH)2D3 appears to act without being converted into other metabolites. These results demonstrate that 24,25-(OH)2D3 rapidly stimulates the metabolism of 1,25-(OH)2D3 and reduces its serum level

Predictors of pretreatment CA125 at ovarian cancer diagnosis

DEFF Research Database (Denmark)

Babic, Ana; Cramer, Daniel W; Kelemen, Linda E

2017-01-01

PURPOSE: Cancer antigen 125 (CA125) is a glycoprotein expressed by epithelial cells of several normal tissue types and overexpressed by several epithelial cancers. Serum CA125 levels are mostly used as an aid in the diagnosis of ovarian cancer patients, to monitor response to treatment and detect...... in CA125 between studies and linear regression to estimate the association between epidemiologic factors and tumor characteristics and pretreatment CA125 levels. RESULTS: In age-adjusted models, older age, history of pregnancy, history of tubal ligation, family history of breast cancer, and family...... cancer recurrence. Besides tumor characteristics, CA125 levels are also influenced by several epidemiologic factors, such as age, parity, and oral contraceptive use. Identifying factors that influence CA125 levels in ovarian cancer patients could aid in the interpretation of CA125 values for individuals...

Equilibrium evaporation behavior of polonium and its homologue tellurium in liquid lead-bismuth eutectic

International Nuclear Information System (INIS)

Ohno, Shuji; Miyahara, Shinya; Kurata, Yuji; Katsura, Ryoei; Yoshida, Shigeru

2006-01-01

Experimental study using the transpiration method investigates equilibrium evaporation behavior of radionuclide polonium ( 210 Po) generated and accumulated in liquid lead-bismuth eutectic (LBE) cooled nuclear systems. The experiment consists of two series of tests: preliminary evaporation tests for homologue element tellurium (Te) in LBE, and evaporation tests for 210 Po-accumulated LBE in which test specimens are prepared by neutron irradiation. The evaporation tests of Te in LBE provide the suggestion that Te exists in a chemical form of PbTe as well as the information for confirming the validity of technique and conditions of Po test. From the evaporation tests of 210 Po in LBE, we obtain fundamental data and empirical equations such as 210 Po vapor concentration in the gas phase, 210 Po partial vapor pressure, thermodynamic activity coefficients, and gas-liquid equilibrium partition coefficient of 210 Po in LBE in the temperature range from 450 to 750degC. Additionally, radioactivity concentration of 210 Po and 210m Bi vapor in a cover gas region of a typical LBE-cooled nuclear system is specifically estimated based on the obtained experimental results, and the importance of 210 Po evaporation behavior is quantitatively demonstrated. (author)

Iron-tellurium-selenium mixed oxide catalysts for the selective oxidation of propylene to acrolein

International Nuclear Information System (INIS)

Patel, B.M.; Price, G.L.

1990-01-01

This paper reports on iron-tellurium-selenium mixed oxide catalysts prepared by coprecipitation from aqueous solution investigated for the propylene to acrolein reaction in the temperature range 543-773 K. Infrared spectroscopy, electron dispersive X-ray analysis, X-ray diffraction, and isotopic tracer techniques have also been employed to characterize this catalytic system. Properties of the Fe-Te-Se mixed oxide catalysts have been compared with Fe-Te mixed oxides in an effort to deduce the functionality of Se. The selenium in the Fe-Te-Se-O catalyst has been found to be the hydrocarbon activating site. The activation energies for the acrolein and carbon dioxide formation are 71 and 54 kJ/mol, respectively. Reactions carried out with 18 O 2 have shown lattice oxygen to be primarily responsible for the formation of both acrolein and carbon dioxide. The initial and rate-determining step for acrolein formation is hydrogen abstraction as determined by an isotope effect associated with the C 3 D 6 reaction. No isotope effect is observed for carbon dioxide formation from C 3 D 6 suggesting that CO 2 is formed by parallel, not consecutive, oxidation of propylene

Enhanced Flexural Strength of Tellurium Nanowires/epoxy Composites with the Reinforcement Effect of Nanowires

Science.gov (United States)

Balguri, Praveen Kumar; Harris Samuel, D. G.; Aditya, D. B.; Vijaya Bhaskar, S.; Thumu, Udayabhaskararao

2018-02-01

Investigating the mechanical properties of polymer nanocomposite materials has been greatly increased in the last decade. In particular, flexural strength plays a major role in resisting bending and shear loads of a composite material. Here, one dimensional (1D) tellurium nanowires (TeNWs) reinforced epoxy composites have been prepared and the flexural properties of resulted TeNWs/epoxy nanocomposites are studied. The diameter and length of the TeNWs used to make TeNWs/epoxy nanocomposites are 21±2.5 nm and 697±87 nm, respectively. Plain and TeNWs/epoxy nanocomposites are characterized by X-ray diffraction (XRD), thermogravimetric analysis (TGA), and differential thermal analysis (DTA). Furthermore, significant enhancement in the flexural strength of TeNWs/epoxy nanocomposite is observed in comparison to plain epoxy composite, i.e. flexural strength is increased by 65% with the addition of very little amount of TeNWs content (0.05 wt.%) to epoxy polymer. Structural details of plain and TeNWs/epoxy at micrometer scale were examined by scanning electron microscopy (SEM). We believe that our results provide a new type of semiconductor nanowires based high strength epoxy polymer nanocomposites.

9 CFR 3.125 - Facilities, general.

Science.gov (United States)

2010-01-01

... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Facilities, general. 3.125 Section 3.125 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

44 CFR 19.125 - Effect of other requirements.

Science.gov (United States)

2010-10-01

... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.125 Effect of other requirements. (a... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Effect of other requirements. 19.125 Section 19.125 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

Synthesis of I-125 labeled photoaffinity rapamycin analogs

International Nuclear Information System (INIS)

Shu, A.Y.L.; Yamashita, D.S.; Holt, D.A.; Heys, J.R.

1996-01-01

Two no-carrier-added 125 I-labelled photoaffinity rapamycin analogs were prepared: 7-demethoxy-7-(4-azido-3- 125 I-benzyloxy) rapamycin and its C 28 -C 29 seco analog. The key reactions of the synthesis were substitution of the C 7 methoxyl of rapamycin with 4-azido-3-tributylstannylbenzyloxy group, exchange of tributyltin with 125 I using Na 125 I and Chloramine-T, and a ZnCl 2 mediated retro-Aldol cleavage of the C 28 -C 29 bond of rapamycin. (author)

24 CFR 572.125 - Replacement reserves.

Science.gov (United States)

2010-04-01

...) Homeownership Program Requirements-Implementation Grants § 572.125 Replacement reserves. (a) Purpose. A single replacement reserve may be established for the homeownership program only if HUD determines it is necessary to... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Replacement reserves. 572.125...

46 CFR 201.125 - Attendance and mileage fees.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Attendance and mileage fees. 201.125 Section 201.125 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Subpoenas (Rule 12) § 201.125 Attendance and mileage fees. Persons attending...

24 CFR 125.501 - Fair Housing Organizations Initiative.

Science.gov (United States)

2010-04-01

... Initiative. 125.501 Section 125.501 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.501 Fair Housing Organizations Initiative. (a) The Fair Housing Organizations Initiative of the FHIP provides funding to develop or expand the ability of...

Improved selectivity for Pb(II) by sulfur, selenium and tellurium analogues of 1,8-anthraquinone-18-crown-5: synthesis, spectroscopy, X-ray crystallography and computational studies.

Science.gov (United States)

Mariappan, Kadarkaraisamy; Alaparthi, Madhubabu; Hoffman, Mariah; Rama, Myriam Alcantar; Balasubramanian, Vinothini; John, Danielle M; Sykes, Andrew G

2015-07-14

We report here a series of heteroatom-substituted macrocycles containing an anthraquinone moiety as a fluorescent signaling unit and a cyclic polyheteroether chain as the receptor. Sulfur, selenium, and tellurium derivatives of 1,8-anthraquinone-18-crown-5 (1) were synthesized by reacting sodium sulfide (Na2S), sodium selenide (Na2Se) and sodium telluride (Na2Te) with 1,8-bis(2-bromoethylethyleneoxy)anthracene-9,10-dione in a 1 : 1 ratio. The optical properties of the new compounds are examined and the sulfur and selenium analogues produce an intense green emission enhancement upon association with Pb(II) in acetonitrile. Selectivity for Pb(II) is markedly improved as compared to the oxygen analogue 1 which was also competitive for Ca(II) ion. UV-Visible and luminescence titrations reveal that 2 and 3 form 1 : 1 complexes with Pb(II), confirmed by single-crystal X-ray studies where Pb(II) is complexed within the macrocycle through coordinate covalent bonds to neighboring carbonyl, ether and heteroether donor atoms. Cyclic voltammetry of 2-8 showed classical, irreversible oxidation potentials for sulfur, selenium and tellurium heteroethers in addition to two one-electron reductions for the anthraquinone carbonyl groups. DFT calculations were also conducted on 1, 2, 3, 6, 6 + Pb(II) and 6 + Mg(II) to determine the trend in energies of the HOMO and the LUMO levels along the series.

24 CFR 245.125 - Tenant organizers.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Tenant organizers. 245.125 Section... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.125 Tenant organizers. (a) A tenant organizer is a tenant or non-tenant who assists tenants in establishing and operating a tenant organization...

Cancer antigen-125 and risk of atrial fibrillation

DEFF Research Database (Denmark)

Cheung, Angel; Gong, Mengqi; Bellanti, Roberto

2018-01-01

Background: Cancer antigen-125 (Ca-125) is traditionally recognised as a tumour marker and its role in cardiovascular diseases has been studied only in recent years. Whether Ca-125 is elevated in patients with atrial fibrillation (AF) and its levels predict the risk of AF remains controversial. T...

40 CFR 40.125-1 - Limitations on duration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Limitations on duration. 40.125-1 Section 40.125-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE RESEARCH AND DEMONSTRATION GRANTS § 40.125-1 Limitations on duration. (a) [Reserved] (b) No...

Is tissue CA125 expression in epithelial ovarian adenocarcinoma heterogenic?

DEFF Research Database (Denmark)

Sparholt, Morten H; Høgdall, Claus K; Nedergaard, Lotte

2013-01-01

To evaluate if heterogeneity of tissue cancer antigen 125 (CA125) expression is present in epithelial serous adenocarcinomas. Furthermore, to investigate whether there is a correlation between levels of CA125 tissue expression, serum level of CA125, stage, and grade. A total of 10 patients...... diagnosed with serous ovarian adenocarcinomas were included. Preoperative blood samples were collected to determine serum CA125 levels. Tumor tissue from primary surgery was collected and processed for immunohistochemical analyses. CA125 was expressed in varying degrees in tumor tissues from all patients....... Mean tissue CA125 expression for each patient ranged from 36% to 98%. Intrapatient variations in tissue expression ranged from 10% to 90% point. No significant correlations between levels of CA125 tissue expression, serum level of CA125, stage, and grade were found. We found that the tissue expression...

The Correlation between Serum and Peritoneal Fluid CA125 The Correlation between Serum and Peritoneal Fluid CA125

Directory of Open Access Journals (Sweden)

Saghar Salehpour

2009-01-01

Full Text Available Background: Despite a high prevalence of endometriosis, there still exist many challenges indiagnosing the disease. This study aims to evaluate non-invasive and practical diagnostic methodsby measuring serum and peritoneal fluid CA 125 levels in patients with endometriosis. A secondaryaim is to determine the correlation between these markers with the stage of disease as well as therelationship of the two markers with each other.Materials and Methods: This is a cross-sectional study of 60 women who underwent laparoscopyfor benign conditions. Based on laparoscopic findings and biopsy results, patients were divided to twogroups; one group included patients with pelvic endometriosis (35 patients and the second enrolledpatients free from endometriosis (25 patients. Serum and peritoneal fluid specimens were provided at thetime of laparoscopy and CA125 levels were then assessed by electrochemiluminescence immunoassay.Results: Mean serum and peritoneal fluid CA125 levels were significantly higher in women withendometriosis as compared to the control group (26.42 ± 24.34 IU/ml versus 12.64 ± 6.87 IU/mlin serum and 2203.54 + 993.19 IU/ml versus 1583.42 ± 912.51 IU/ml in peritoneal fluid, p<0.05.CA 125 levels also varied proportionally with the stage of endometriosis; but showed a significantdifference only in higher stages of the disease, both in serum and peritoneal fluid. We calculatedthe cut-off value suggesting a diagnosis of pelvic endometriosis as 14.70 IU/ml for serum and1286.5 IU/ml for peritoneal fluid CA125. A linear correlation between CA 125 levels in serum andperitoneal fluid in patients with pelvic endometriosis has also been observed.Conclusion: Serum and peritoneal fluid CA 125 levels are simple and non-surgical tools fordiagnosing and staging pelvic endometriosis. These markers are of greater diagnostic value inhigher stages of the disease.

A comparative study of 19-iodocholesterol-''125I 3-acetate and Na''125I in liquid scintillation measurements

International Nuclear Information System (INIS)

Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J.M.; Grau Carles, A.

1994-01-01

A comparative study of performance of 19-iodocholesterol-''125I 3-acetate and sodium iodine samples labelled with ''125 I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I''-concentration of 0-90 ug and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol-''125I 3-acetate samples in Toluene-alcohol and 0.04% for Na''125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs

10 CFR 26.125 - Licensee testing facility personnel.

Science.gov (United States)

2010-01-01

... 10 Energy 1 2010-01-01 2010-01-01 false Licensee testing facility personnel. 26.125 Section 26.125 Energy NUCLEAR REGULATORY COMMISSION FITNESS FOR DUTY PROGRAMS Licensee Testing Facilities § 26.125... reports, if any; results of tests that establish employee competency for the position he or she holds...

46 CFR 28.125 - Stowage of survival craft.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Stowage of survival craft. 28.125 Section 28.125... FISHING INDUSTRY VESSELS Requirements for All Vessels § 28.125 Stowage of survival craft. (a) Each..., inflatable buoyant apparatus, and any auxiliary craft used in their place, must be kept readily accessible...

Isotopic labeling affects 1,25-dihydroxyvitamin D metabolism

International Nuclear Information System (INIS)

Halloran, B.P.; Bikle, D.D.; Castro, M.E.; Gee, E.

1989-01-01

Isotope substitution can change the biochemical properties of vitamin D. To determine the effect of substituting 3H for 1H on the metabolism of 1,25(OH)2D3, we measured the metabolic clearance rate and renal metabolism of unlabeled and 3H-labeled 1,25(OH)2D3. Substitution of 3H for 1H on carbons 26 and 27 [1,25(OH)2[26,27(n)-3H]D3] or on carbons 23 and 24 [1,25(OH)2[23,24(n)-3H]D3] reduced the in vivo metabolic clearance rate of 1,25(OH)2D3 by 36% and 37%, respectively, and reduced the in vitro renal catabolism of 1,25(OH)2D3 by 11% and 54%, respectively. Substitutions of 3H for 1H on carbons 23 and 24 as opposed to carbons 26 and 27 reduced conversion of [3H]1,25(OH)2D3 to [3H]1,24,25(OH)2D3 by 25% and to putative 24-oxo-1,23,25-dihydroxyvitamin D3 by 1600%. These results indicate that substitution of 3H for 1H on carbons 26 and 27 or on carbons 23 and 24 can reduce the metabolic clearance rate and in vitro metabolism of 1,25(OH)2D3 and quantitatively alter the pattern of metabolic products produced

40 CFR 179.125 - Judicial review.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Judicial review. 179.125 Section 179... EVIDENTIARY PUBLIC HEARING Judicial Review § 179.125 Judicial review. (a) The Administrator's final decision... judicial review within the period ending on the 60th day after the date of the publication of the order...

49 CFR 192.125 - Design of copper pipe.

Science.gov (United States)

2010-10-01

... 49 Transportation 3 2010-10-01 2010-10-01 false Design of copper pipe. 192.125 Section 192.125... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.125 Design of copper pipe. (a) Copper... hard drawn. (b) Copper pipe used in service lines must have wall thickness not less than that indicated...

Airborne iodine-125 arising from surface contamination

International Nuclear Information System (INIS)

Kwok, C.S.; Hilditch, T.E.

1982-01-01

Measurements of airborne 125 I were made during the subdivision of 740 MBq stocks of 125 I iodide solution in a hospital dispensary. Within the fume cupboard the mean airborne 125 I concentration was 3.5 +- 2.9 kBqm -3 . No airborne concentration contamination was found outside the fume cupboard during these dispensing sessions. The airborne 125 I concentration arising from deliberate surface contamination (50 μl, 3.7-6.3 MBq) of the top of a lead pot was measured at a height simulating face level at an open work bench. There was a progressive fall in airborne concentration over seven days but even then the level was still significantly above background. Measurements made with the extraction system of the fume cupboard in operation were 2-3 times lower. (U.K.)

7 CFR 4279.125 - Interest rates.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Interest rates. 4279.125 Section 4279.125 Agriculture... Interest rates. The interest rate for the guaranteed loan will be negotiated between the lender and the applicant and may be either fixed or variable as long as it is a legal rate. Interest rates will not be more...

14 CFR 125.211 - Seat and safety belts.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Seat and safety belts. 125.211 Section 125... Requirements § 125.211 Seat and safety belts. (a) No person may operate an airplane unless there are available... the airplane who is at least 2 years old; and (2) An approved safety belt for separate use by each...

Luminoimmunometric Assay of Tissue Polypeptide Antigen (Tpa and Cancer Antigen 125 (Ca-125 in Breast Cancer Patients

Directory of Open Access Journals (Sweden)

O. El-Ahmady

1993-01-01

Full Text Available Serum TPA and CA-125 were determined in 86 individuals (66 with breast cancer representing the different stages and grades of the disease and 20 normal healthy controls. TPA and CA-125 were estimated using the L1A reagents supplied by BYK Sangtec. TPA showed sensitivity rates of 31.8%, 42.4% and 51.5% while CA-125 showed sensitivities of 16.3%, 18.6% and 25.6% at specificity levels of 100%, 95% and 90% respectively. Combined determination of the two markers resulted in some improvement in sensitivity. For follow-up of breast cancer patients after surgery both markers were of value and showed near-identical patterns.

Activation of 125I-Factor IX and 125I-Factor X: Effect of tissue factor and Factor VII, Factor Xsub(a) and thrombin

International Nuclear Information System (INIS)

Oesterud, B.; Rapaport, S.I.

Activation of Factor IX and Factor X was studied by adding 125 I-Factor IX or 125 I-Factor X to reaction mixtures and quantitating cleavage products by reduced sodium dodecylsulfate gel electrophoresis. Thrombin failed to activate Factors IX or X; Factor Xsub(a) produced insignificant amounts of cleavage products of both factors. In contrast, the reaction product of tissue factor and Factor VII cleaved large amounts of both Factor IX and Factor X in purified systems and in plasma. In incubation mixtures of plasma containing added 125 I-Factor IX or 125 I-Factor X, tissue factor and Ca 2+ ions, the percentage of total radioactivity in the heavy chain peak of 125 I-IXsub(a) and the heavy chain of 125 I-Xsub(a) increased at a similar rate. When the tissue factor was diluted, similar curves were obtained for percent cleavage of 125 I-Factor IX and percent cleavage of 125 I-Factor X plotted against tissue factor concentration. These findings support the hypothesis that activation of Factor IX by the tissue factor-Factor VII reaction product represents a physiologically significant step in normal haemostasis. (author)

Raman and DSC studies of fragility in tellurium-zinc oxide glass formers

International Nuclear Information System (INIS)

Stavrou, Elissaios; Kripotou, Sotiria; Raptis, Constantine; Turrell, Sylvia; Syassen, Karl

2011-01-01

Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out in four mixed (TeO 2 ) 1-x (ZnO) x (x = 0.1, 0.2, 0.3, 0.4) glasses at high temperatures (Raman and DSC through the glass transition) and high pressures (Raman) with the aim of determining the fragility of these glass forming oxides. Four different criteria, corresponding to four parameters, were applied to assess the fragility of the glasses. From the DSC studies, we have obtained the fragility parameter m which corresponds to the slopes of Arrhenius (lnQ vs. 1/T g , were Q is the heating rate) plots, and the glass transition width ΔT g . Also, from the low-frequency Raman scattering, and in particular the boson peak intensity of the glasses at T g , we have estimated the fragility ratio r R (T g ) = I min /I max whose value serves as another (empirical) fragility criterion. Finally, from high pressure Raman measurements on the glasses, we have estimated the Grueneisen parameter γ T for each glass, which constitutes the fourth fragility parameter adopted in this work. Considering the four parameters ΔT g , m, r (T g ) and γ T and the generally accepted (empirical) fragility criteria, we conclude that the mixed tellurium-zinc oxides constitute strong-to-intermediate glass formers (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

The value of cancer antigen 125 (CA 125) during treatment and follow-up of patients with ovarian cancer

NARCIS (Netherlands)

deBruijn, HWA; vanderZee, AGJ; Aalders, JG

Although the nature of the cancer antigen 125 leaves many questions unanswered, the use of serum measurements as a means to assess the response to surgery and chemotherapy in ovarian cancer is now well documented. Good prognostic significance is attributed to a rapid decline in cancer antigen 125

1,25 dihydroxyvitamin D3 (1,25) regulation of c-myc mRNA in HL-60 leukemia cells

International Nuclear Information System (INIS)

Simpson, R.U.; Bresnick, E.H.; Begley, D.A.

1986-01-01

Recently, 1,25 was shown to induce differentiation and decrease c-myc levels in HL-60 cells. The authors have confirmed these observations by RNA dot blot analysis. Cells treated with 50 nM 1,25 for 4, 24 and 48 hr showed c-myc mRNA levels of 26, 17 and 15% of control respectively. β-Actin mRNA levels were not altered. To ascertain whether 1, 25 regulated c-myc transcriptionally, an HL-60 nuclear RNA runoff assay was developed. Assay of total nuclei transcriptional activity revealed that 50% of RNA elongation was α-amanitin (0.8 μg/ml) sensitive and was linear with nuclei concentration (0.1-1 x 10 7 nuclei). 1,25 (50 nM) treated (45-96 hr) cells had decreased (approx.40%) total transcription rate relative to control. Decreased total RNA synthesis occurred concomitant with NBT reducing activity. 32 P-RNA runoff transcripts from HL-60 nuclei were hybridized to excess (5 μg DNA was excess) Pst I linearized c-myc and β-actin clones (in pBR322) immobilized on nitrocellulose filter. 32 P-RNA input from 2 x 10 6 to 2 x 10 7 cpm yielded linear hybridization signal. Analysis of blot dot intensity revealed no difference in transcription of c-myc in nuclei from 1,25 dosed or control cells. (myc/actin ratios: 1,25 (50 nM, 72 hr) =1.1 +/- 0.3 and control (72 hr) = 1.0, N=3 or 2 or 3 dots ea). These preliminary data suggest 1,25 does not affect c-myc transcription in HL-60 nuclei and may regulate c-myc mRNA post-transcriptionally

Determination of radiochemical purity of 125I-TOC and 125I-F-PGA

International Nuclear Information System (INIS)

Yang Keya; Fan Wo; Zhang Youjiu; Xu Yujie; Zhu Ran; Hu Mingjiang

2006-01-01

To explore whether there is accordance among three determination methods of the radiochemical purity of [Tyr 3 ] octreotide (TOC) and folate-penicillin G amidase conjugate (F-PGA), which are both labeled with 125 I by Iodogen method, the RCP of the labelings are determined by high performance liquid chromatography (HPLC), paper chromatography and trichloroacetic acid (TCA) precipitation, in which four different concentrations of proteins are used to investigate the effect of them on the determination of RCP. It is shown that both HPLC and paper chromatography can separate the labelings from free iodine efficiently, though HPLC is the most precise and reliable method to determinate RCP of such labelings. In TCA precipitation, the RCP measured with 0.2%BSA is the lowest, but those with three other concentrations of the BSA are similar (P>0.05). When RCP 0.05), whereas higher than that with HPLC (P 10%, the RCP of 125 I-TOC obtained by TCA precipitation is a bit lower than those by two other methods (P 0.05), and there are no significant differences to determinate the RCP of 125 I-F-PGA (P>0.05). The three methods are correlated each other (r=0.0996-0.999, P<0.001). (authors)

16 CFR 1500.125 - Labeling requirements for accompanying literature.

Science.gov (United States)

2010-01-01

... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Labeling requirements for accompanying literature. 1500.125 Section 1500.125 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL... REGULATIONS § 1500.125 Labeling requirements for accompanying literature. When any accompanying literature...

Effects of lysosomal inhibitors on 125I-insulin and 125I-asialofetuin degradation by the isolated, perfused rat liver and isolated rat hepatocytes

International Nuclear Information System (INIS)

Ward, W.F.; Moss, A.L.

1985-01-01

To further evaluate the role of the lysosomal system in insulin degradation, the authors have compared the effects of inhibitors of lysosomal function on the degradation of 125 I-insulin with 125 I-asialofetuin, a lysosomally targeted molecule, by the intact, perfused rat liver and the isolated rat hepatocyte. The inhibitors employed were chloroquine ( 125 microM), NH 4 Cl (10 mM), and leupeptin (50 micrograms/ml). In the intact, perfused liver the observed inhibition of 125 I-asialofetuin degradation at 30 min was as follows: chloroquine, 38%; NH 4 Cl, 32%; and leupeptin, 86%. Chloroquine also inhibited 125 I-insulin degradation in the intact, perfused liver (29%), but NH 4 Cl and leupeptin had no effect. Using the isolated hepatocyte, the observed values for inhibition of 125I-asialofetuin at 60 min were: chloroquine, 85%; NH 4 Cl, 76%; and leupeptin, 81%. Chloroquine produced a 28% inhibition of 125I-insulin degradation, while NH 4 Cl and leupeptin had no effect. Chloroquine and NH 4 Cl decreased cell-associated radioactivity when isolated hepatocytes were incubated with 125I-asialofetuin (leupeptin had no effect), whereas chloroquine caused a 107% increase in cell-associated radioactivity when 125I-insulin was added to the incubation media (NH 4 Cl and leupeptin had no effect). These results indicate that the effects of chloroquine on insulin degradation are an extralysosomal action and that lysosomes appear not to be involved in the physiologic degradation of the insulin molecule

47 CFR 69.125 - Dedicated signalling transport.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 3 2010-10-01 2010-10-01 false Dedicated signalling transport. 69.125 Section... (CONTINUED) ACCESS CHARGES Computation of Charges § 69.125 Dedicated signalling transport. (a) Dedicated signalling transport shall consist of two elements, a signalling link charge and a signalling transfer point...

Measurement of circulating 1,25-dihydroxyvitamin D employing radioimmunoassay

International Nuclear Information System (INIS)

Yamamoto, Itsuo; Hamazu, Hisatoshi; Kigami, Yuusuke; Morita, Rikushi

1997-01-01

Measurement of serum 1,25-dihydroxyvitamin D levels is important for diagnosis of various calcium metabolism disorders. Conventional assays for 1,25-dihydroxyvitamin D employed specific 1,25-dihydroxyvitamin D receptor as binding site for the ligand and thus, biologically active 1,25-dihydroxyvitamin D ligand, which is labeled with 3 H, was required. Usage of 3 H made assays cumbersome works. A new assay which uses specific antibody as the binding site and the radioligand labeled with 125 I is now available as a commercial kit. Using these kits, we first studied basically the reproducibility, recovery, cross-reactivity and comparison with conventional assays. All of those results were satisfactory. Secondly, we measured clinically in 111 healthy adults and in patients with various disorders such as renal failure, primary hyperparathyroidism, hypoparathyroidism and sarcoidosis. This newly available kit for measurement of circulating 1,25-dihydroxyvitamin D is proved to be useful in clinical evaluation of calcium metabolic disorders. (author)

41 CFR 101-4.125 - Effect of other requirements.

Science.gov (United States)

2010-07-01

... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.125 Effect of... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Effect of other requirements. 101-4.125 Section 101-4.125 Public Contracts and Property Management Federal Property Management...

Characterization of Binding Epitopes of CA125 Monoclonal Antibodies

DEFF Research Database (Denmark)

Marcos-Silva, Lara; Narimatsu, Yoshiki; Halim, Adnan

2014-01-01

The most used cancer serum biomarker is the CA125 immunoassay for ovarian cancer that detects the mucin glycoprotein MUC16. Several monoclonal antibodies (mAbs) including OC125 and M11 are used in CA125 assays. However, despite considerable efforts, our knowledge of the molecular characteristics...

Study on the diagnostic values of changes of serum endometrium antibody (EMAb) and CA125 (CA125) levels in patients with endometriosis

International Nuclear Information System (INIS)

Yang Jingxiu; Shi Shaohong; Wang Yuping

2005-01-01

Objective: To explore the diagnostic values of changes of serum EMAb and CA125 levels in patients with endometriosis. Methods: Serum EMAb levels were measured with ELISA and CA125 levels with RIA in 54 patients with endometriosis and 35 controls. Results: Positive rate of serum EMAb was significantly higher in the patients with endometriosis than those in controls (P≤0.01). Serum CA125 levels were also significantly higher than those in controls (P<0.01). Conclusion: Combined detection of serum EMAb positive rate and CA125 levels was of diagnostic value in patients with endometriosis. (authors)

21 CFR 175.125 - Pressure-sensitive adhesives.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pressure-sensitive adhesives. 175.125 Section 175...) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADHESIVES AND COMPONENTS OF COATINGS Substances for Use Only as Components of Adhesives § 175.125 Pressure-sensitive adhesives. Pressure-sensitive...

24 CFR 125.401 - Private Enforcement Initiative.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Private Enforcement Initiative. 125... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.401 Private Enforcement Initiative. (a) The Private Enforcement Initiative provides funding on a single-year or multi-year basis, to investigate violations and...

Iodine-125 seeds for cancer treatment

Energy Technology Data Exchange (ETDEWEB)

Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Feher, Anselmo; Moura, Joao A.; Moura, Eduardo S.; Nagatomi, Helio R.; Manzoli, Jose E.; Souza, Carla D., E-mail: elisaros@ipen.b, E-mail: czeituni@pobox.co, E-mail: afeher@ipen.b, E-mail: jmoura31@yahoo.com.b, E-mail: esmoura@ipen.b, E-mail: hrnagato@ipen.b, E-mail: jemanzoli@ipen.b, E-mail: cdsouza@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Karam, Dib, E-mail: dib.karan@usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Escola de Artes, Ciencias e Humanidades

2009-07-01

In Brazil, cancer has become one of the major public health problems. An estimate by the Health Ministry showed that 466,430 people had the disease in the country in 2008. The prostate cancer is the second largest death cause among men. The National Institute of Cancer estimated the occurrence of 50,000 new cases for 2009. Some of these patients are treated with Brachytherapy, using Iodine-125 seeds. By this technique, small seeds with Iodine-125, a radioactive material, are implanted in the prostate. The advantages of radioactive seed implants are the preservation of healthy tissues and organs near the prostate, besides the low rate of impotence and urinary incontinence. The Energy and Nuclear Research Institute - IPEN, which belongs to the Nuclear Energy National Commission - CNEN, established a program for the development of the technique and production of Iodine-125 seeds in Brazil. The estimate for the 125-Iodine seeds demand is of 8,000 seeds/month and the laboratory to be implanted will need this production capacity. The purpose of this paper is to explain the project status and show some data about the seeds used in the country. The project will be divided in two phases: technological development of a prototype and a laboratory implementation for the seeds production. (author)

Smartphone-based immunosensor for CA125 detection.

Science.gov (United States)

Hosu, Oana; Ravalli, Andrea; Lo Piccolo, Giuseppe Mattia; Cristea, Cecilia; Sandulescu, Robert; Marrazza, Giovanna

2017-05-01

In this work, we report the design, the development and the characterization of the analytical performances of a colorimetric smartphone-based immunosensor for the detection of cancer antigen 125 (CA125). The immunosensor was based on a sandwich strategy in which the primary antibody was immobilized by spotting onto the 3D nitrocellulose membrane. The immunospots were subsequently incubated with CA125 solutions, followed by the affinity reaction with a secondary antibody labeled with gold nanoparticles (AuNPs). The antibody-AuNPs captured onto immunospots induced the silver deposition from a silver enhancer solution leading to the formation of gold-silver nanoparticles of different grey color spots depending on CA125 concentration. The 8 megapixels smartphone camera was integrated in a home-made dark box and used as transducer of color image acquisition and data handling. The pixel intensity of the captured images was determined by an image processing algorithm. The experimental parameters involved in each step of the immunosensor design were studied and optimized, obtaining a limit of detection of 30U/mL CA125. The selectivity of the immunoassay was proven against different concentration solutions of Vascular Endothelial Growth Factor (VEGF) antigen as an unspecific protein when a blank signal was obtained for all tested solutions. Finally, preliminary experiments in human serum samples spiked with CA125 protein were also performed. Therefore, the proposed system could represent a powerful point-of-care tool for the next generation technology for detecting and monitoring cancer biomarkers at early stages by taking advantage of nowadays gadgets with enhanced features such as smartphones. Copyright © 2017 Elsevier B.V. All rights reserved.

The contamination on farm products from 125I

International Nuclear Information System (INIS)

Zhao Wenhu; Xu Shiming; Hou Lanxin

1990-02-01

The 125 I contamination on 15 farm products have been investigated. The effects of 12 farm crops (wheat, bean, eggplants and other vegetables) contaminated by 125 I during the growing stage on their fruits and seeds have been studied. The results show that the 125 I radioactive substance is mainly concentrated on the fruit surface, and the radioactivity rapidly decreased towards its kernel. The fruits and seeds would not be contaminated when plants were contaminated in the seedling stage

32 CFR 701.125 - Computer matching program.

Science.gov (United States)

2010-07-01

... counterintelligence matches done in the course of performing a background check for security clearances of Federal... 32 National Defense 5 2010-07-01 2010-07-01 false Computer matching program. 701.125 Section 701... OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.125 Computer matching program...

14 CFR 125.265 - Flight engineer requirements.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...

31 CFR 1.25 - Accounting of disclosures.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Accounting of disclosures. 1.25... Privacy Act § 1.25 Accounting of disclosures. (a) Accounting of certain disclosures. Each component, with respect to each system of records under its control, shall: (1) Keep an accurate accounting of: (i) The...

14 CFR 125.75 - Airplane flight manual.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 125.75 Section 125... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Airplane flight manual. (a) Each certificate holder shall keep a current approved Airplane Flight Manual or...

21 CFR 14.125 - Procedures of TEPRSSC.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Procedures of TEPRSSC. 14.125 Section 14.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PUBLIC HEARING...) The agenda and other material to be considered at any meeting will be sent to members whenever...

[{sup 125}I]{beta}-CIT-FE and [{sup 125}I]{beta}-CIT-FP are superior to [{sup 125}I]{beta}-CIT for dopamine transporter visualization: Autoradiographic evaluation in the human brain

Energy Technology Data Exchange (ETDEWEB)

Guenther, Ilonka; Hall, Haakan; Halldin, Christer; Swahn, Carl-Gunnar; Farde, Lars; Sedvall, Goeran

1997-10-01

The binding of the three dopamine transporter radioligands ([{sup 125}I]{beta}-CIT, [{sup 125}I]{beta}-CIT-FE, and [{sup 125}I]{beta}-CIT-FP) was studied using whole-hemisphere autoradiography on postmortem human brains. The autoradiograms revealed an intense and homogeneous labeling of the nucleus caudatus and putamen but also to varying extent to serotonergic and noradrenergic transporters of neocortex and thalamus. The order of specificity estimated (striatum over neocortex ratios) was {beta}-CIT-FP > {beta}-CIT-FE >> {beta}-CIT, suggesting that {beta}-CIT-FE and {beta}-CIT-FP should be preferred for in vivo studies of the dopamine transporter in the human brain.

19 CFR 125.2 - Supervision of cartage and lighterage.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supervision of cartage and lighterage. 125.2 Section 125.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARTAGE AND LIGHTERAGE OF MERCHANDISE General Provisions § 125.2 Supervision of cartage and lighterage. All licensed vehicles or...

Cell cycle related /sup 125/IUDR-induced-division delay

International Nuclear Information System (INIS)

Scheniderman, M.H.; Hofer, K.G.

1987-01-01

A series of experiments were run to determine if /sup 125/I-decays, in /sup 125/IUdR labeled DNA, specifically accumulated at 1, 3, 5, 7 and 9 hours after plating labeled mitotic cells caused a change in the rate or time of cell entry into mitosis. To accomplish this, a pool of labeled mitotic cells was selected in mitosis and plated in replicate flasks. /sup 125/I decays were accumulated in groups of cells by cooling (4 0 C) for 2 hours starting at the designated times. After rewarding, colcemid was added to arrest cells in mitosis. The rate of cell progression into mitosis for each cell cycle time of accumulation was determined by scoring the mitotic index of cells sampled as a function of time after addition of the colcemid. The results are summarized: (1) Decays from /sup 125/I in /sup 125/I(UdR) labeled DNA reduced the rate of cell progression into mitosis and delayed the time of initiation of mitosis. (2) The reduced rate of progression and the delayed time of initiation of mitosis were independent of the cell cycle time that /sup 125/I-decays were accumulated. (3) The reduced rate of progression after cell cycle accumulation of /sup 125/I decay was statistically indistinguishable from the corresponding controls. (4) The delayed initiation of mitosis after specific cell cycle accumulation of /sup 125/I- decays was greater than the corresponding control. The relationship of these data to DNA and non-DNA division delay target(s) is emphasized

Preclinical pharmacological study on 125 I-IPPA

International Nuclear Information System (INIS)

Wu Chunying; Ji Shuren; Fang Ping; Zhou Xiang; He Yongjun; Cao Guoxian

1999-01-01

Myocardial uptake of 125 I-IPPA in rats showed a peak of 4.4% of injected dose per gram. The half elimination time of myocardium was 3.8 min and the maximal uptake of thyroid is only 0.005%ID/organ at 120 min. The initial half time of 2.7 min in rabbits was obtained from the elimination curve of radioactivity in blood. In vitro binding test for 125 I-IPPA to HSA showed rather constant level of activation during tow hours. The second peak of extraction was observed in major organs of rats, in rabbits' elimination of radioactivity and in binding test for 125 I-IPPA to albumin in vivo. Toxicity trial was up to standard. The tolerance of a mouse to IPPA was 560 times as high as that of a person to IPPA. It demonstrated that 125 I-IPPA could be quickly extracted by myocardium, and its catabolite were excreted in the urine with almost no iodine loss. All the results were found to agree with the expectations based on the principal metabolic path of phenyl fatty acid

Synthesis of radioiodinated N-succinimidyl 3-[125I] iodobenzoate

International Nuclear Information System (INIS)

Li Junling; Wang Lihua; Zhang Lan; Tian Haibin; Wang Yongxian

2003-01-01

N-Succinimidyl 3-(tri-n-butylstannyl) benzoate (ATE) was radioiodinated using Iodogen as oxidant and useful conjugate S 125 IB of labeling proteins was obtained. ATE and Iodogen affecting labeling proteins were successfully isolated from S 125 IB by Sep-Pak silica. The labeling efficiency was more than 93%. Several factors affecting labeling such as labeling time, the amount of Iodogen and the mole ratio of ATE to Na 125 I, were studied. The better labeling conditions were obtained as follows: mole ratio of ATE to Na 125 I=6:1, Iodogen=7 μg, labeling time=5 min in room temperature

Test of irradiation of tellurium oxide for obtaining iodine-131 by dry distillation; Prueba de irradiacion de dioxido de telurio para obtener yodo-131 por destilacion seca

Energy Technology Data Exchange (ETDEWEB)

Alanis M, J. [ININ, Departamento de Materiales Radiactivos, 52045 Ocoyoacac, Estado de Mexico (Mexico)

2003-07-15

With the purpose of optimizing to the maximum independently the work of the reactor of those mathematical calculations of irradiation that are already optimized, now it corresponds to carry out irradiation tests in the different positions with their respective neutron fluxes that it counts the reactor for samples irradiation. Then, it is necessary to carry out the irradiation of the tellurium dioxide through cycles, with the purpose of observing the activity that it goes accumulating in each cycle and this way to obtain an activity of the Iodine-131 obtained when finishing the last cycle. (Author)

26 CFR 1.25A-4 - Lifetime Learning Credit.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Lifetime Learning Credit. 1.25A-4 Section 1.25A-4... Rates During A Taxable Year § 1.25A-4 Lifetime Learning Credit. (a) Amount of the credit—(1) Taxable years beginning before January 1, 2003. Subject to the phaseout of the education tax credit described in...

Growth of PbTe nanorods controlled by polymerized tellurium anions and metal(II) amides via composite-hydroxide-mediated approach

International Nuclear Information System (INIS)

Wan Buyong; Hu Chenguo; Liu Hong; Xiong Yufeng; Li Feiyun; Xi Yi; He Xiaoshan

2009-01-01

The pure face-centered-cubic PbTe nanorods have been synthesized by the composite-hydroxide-mediated approach using hydrazine as a reducing agent. The method is based on reaction among reactants in the melts of potassium hydroxide and sodium hydroxide eutectic at 170-220 deg. C and normal atmosphere without using any organic dispersant or surface-capping agent. Scanning electron microscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy were used to characterize the structure, morphology and composition of the samples. The diameters of nanorods are almost fixed, while the lengths can be tunable under different growth time and temperatures. The growth mechanism of PbTe nanorods is investigated via UV-vis absorption, demonstrating that polymerized tellurium anions and metal(II) amides in the hydrazine hydroxide melts could control the crystallization and growth process of PbTe nanostructures. The band gap of as-synthesized PbTe nanorods has been calculated based on UV-vis-NIR optical diffuse reflectance spectra data.

Growth of PbTe nanorods controlled by polymerized tellurium anions and metal(II) amides via composite-hydroxide-mediated approach

Energy Technology Data Exchange (ETDEWEB)

Wan Buyong [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); College of Physics and Information Technology, Chongqing Normal University, Chongqing 400047 (China); Hu Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Liu Hong [State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China); Xiong Yufeng [National Center for Nanoscience and Technology, Beijing 100080 (China); Li Feiyun; Xi Yi; He Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

2009-09-15

The pure face-centered-cubic PbTe nanorods have been synthesized by the composite-hydroxide-mediated approach using hydrazine as a reducing agent. The method is based on reaction among reactants in the melts of potassium hydroxide and sodium hydroxide eutectic at 170-220 deg. C and normal atmosphere without using any organic dispersant or surface-capping agent. Scanning electron microscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy were used to characterize the structure, morphology and composition of the samples. The diameters of nanorods are almost fixed, while the lengths can be tunable under different growth time and temperatures. The growth mechanism of PbTe nanorods is investigated via UV-vis absorption, demonstrating that polymerized tellurium anions and metal(II) amides in the hydrazine hydroxide melts could control the crystallization and growth process of PbTe nanostructures. The band gap of as-synthesized PbTe nanorods has been calculated based on UV-vis-NIR optical diffuse reflectance spectra data.

MiR-125a TNF receptor-associated factor 6 to inhibit osteoclastogenesis

International Nuclear Information System (INIS)

Guo, Li-Juan; Liao, Lan; Yang, Li; Li, Yu; Jiang, Tie-Jian

2014-01-01

MicroRNAs (miRNAs) play important roles in osteoclastogenesis and bone resorption. In the present study, we found that miR-125a was dramatically down-regulated during macrophage colony stimulating factor (M-CSF) and receptor activator of nuclear factor-κB ligand (RANKL) induced osteoclastogenesis of circulating CD14+ peripheral blood mononuclear cells (PBMCs). Overexpression of miR-125a in CD14+ PBMCs inhibited osteoclastogenesis, while inhibition of miR-125a promoted osteoclastogenesis. TNF receptor-associated factor 6 (TRAF6), a transduction factor for RANKL/RANK/NFATc1 signal, was confirmed to be a target of miR-125a. EMSA and ChIP assays confirmed that NFATc1 bound to the promoter of the miR-125a. Overexpression of NFATc1 inhibited miR-125a transcription, and block of NFATc1 expression attenuated RANKL-regulated miR-125a transcription. Here, we reported that miR-125a played a biological function in osteoclastogenesis through a novel TRAF6/ NFATc1/miR-125a regulatory feedback loop. It suggests that regulation of miR-125a expression may be a potential strategy for ameliorating metabolic disease. - Highlights: • MiR-125a was significantly down-regulated in osteoclastogenesis of CD14+ PBMCs. • MiR-125a inhibited osteoclast differentiation by targeting TRAF6. • NFATc1 inhibited miR-125a transciption by binding to the promoter of miR-125a. • TRAF6/NFATc1 and miR-125a form a regulatory feedback loop in osteoclastogenesis

ENVIRONMENTAL RESEARCH BRIEF: THERMOPHYSICAL PROPERTIES OF HFE-125

Science.gov (United States)

Thermophysical properties of HFE-125 (pentafluorodimethylether) suggest that it could serve as an alternative non-ozone depleting refrigerant for certain low temperature applications. This Brief presents the thermophysical properties of HFE-125 (Tables 1-4) which have been obtai...

Criteria for safe working with iodine-125

International Nuclear Information System (INIS)

Linsley, G.S.

1977-01-01

Radio-immunoassay and other saturation assay tests involving the use of iodine-125 are finding wide application for the determination of hormone concentrations in biological fluids. In such tests, iodinations involving concentrations of a milli-curie per micro-litre are common. Iodine-125 presents a problem from the monitoring standpoint because of its low energy photon emission (27 and 35 keV). Iodine is preferentially taken up by the thyroid gland and work involving moderate amounts of radio-iodine may give rise to a significant hazard in an accident situation. The general precautions which should be taken in work with unsealed radioactive substances are briefly summarized, working limits for iodine-125 are identified, and methods of personal protection and monitoring in an emergency situation described. (author)

40 CFR 7.125 - Coordination with other agencies.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Coordination with other agencies. 7.125 Section 7.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL ASSISTANCE FROM THE ENVIRONMENTAL PROTECTION AGENCY Agency...

[125I]Iodopride

International Nuclear Information System (INIS)

Janowsky, A.; Ebert, M.H.; De Paulis, T.; Vanderbilt Univ., Nashville, TN; Kessler, R.M.; Vanderbilt Univ., Nashville, TN; Clanton, J.A.; Smith, H.E.

1988-01-01

Substituted benzamides are currently among the most selective antagonists at dopamine D-2 receptors, and high affinity ligands have been developed by substituting halogens into the aromatic ring of the benzamides. The authors report the high affinity, stereoselective, reversible, and sodium dependent binding of a new iodine-substituted benzamide, called [ 125 I]iodopride, to a membrane preparation from rat corpus striatum. 5 refs.; 1 figure

Distribution and levels of [125I]IGF-I, [125I]IGF-II and [125I]insulin receptor binding sites in the hippocampus of aged memory-unimpaired and -impaired rats

International Nuclear Information System (INIS)

Quirion, R.; Rowe, W.; Kar, S.; Dore, S.

1997-01-01

The insulin-like growth factors (IGF-I and IGF-II) and insulin are localized within distinct brain regions and their respective functions are mediated by specific membrane receptors. High densities of binding sites for these growth factors are discretely and differentially distributed throughout the brain, with prominent levels localized to the hippocampal formation. IGFs and insulin, in addition to their growth promoting actions, are considered to play important roles in the development and maintenance of normal cell functions throughout life. We compared the anatomical distribution and levels of IGF and insulin receptors in young (five month) and aged (25 month) memory-impaired and memory-unimpaired male Long-Evans rats as determined in the Morris water maze task in order to determine if alterations in IGF and insulin activity may be related to the emergence of cognitive deficits in the aged memory-impaired rat. In the hippocampus, [ 125 I]IGF-I receptors are concentrated primarily in the dentate gyrus (DG) and the CA3 sub-field while high amounts of [ 125 I]IGF-II binding sites are localized to the pyramidal cell layer, and the granular cell layer of the DG. [ 125 I]insulin binding sites are mostly found in the molecular layer of the DG and the CA1 sub-field. No significant differences were found in [ 125 I]IGF-I, [ 125 I]IGF-II or [ 125 I]insulin binding levels in any regions or laminae of the hippocampus of young vs aged rats, and deficits in cognitive performance did not relate to altered levels of these receptors in aged memory-impaired vs aged memory-unimpaired rats. Other regions, including various cortical areas, were also examined and failed to reveal any significant differences between the three groups studied.It thus appears that IGF-I, IGF-II and insulin receptor sites are not markedly altered during the normal ageing process in the Long-Evans rat, in spite of significant learning deficits in a sub-group (memory-impaired) of aged animals. Hence

α -decay chains of superheavy nuclei with Z =125

Science.gov (United States)

Santhosh, K. P.; Nithya, C.

2018-04-01

The decay properties of the isotopes of Z =125 within the range 303 ≤ A ≤ 339 are investigated. The calculation of proton separation energies reveals that isotopes 125-309303 may decay through proton emission. Four different mass tables are used to show the sensitivity of the mass models used to calculate the Q values as well as the α-decay half-lives. α -decay chains are predicted by comparing the α half-lives calculated within the Coulomb and proximity potential model for deformed nuclei (CPPMDN) [Nucl. Phys. A 850, 34 (2011), 10.1016/j.nuclphysa.2010.12.002] with the spontaneous fission half-lives using the shell-effect-dependent formula [Phys. Rev. C 94, 054621 (2016), 10.1103/PhysRevC.94.054621]. It is seen that isotopes 125,311310 show 6α chains. 5α chains can be seen from isotopes 125-318312. Isotopes 125,320319 exhibit 2α chains and 323125 exhibits 1α chain. All the other isotopes, that is, 125 321 ,322 ,324 -339 may decay through spontaneous fission. The α half-lives using CPPMDN are compared with five other theoretical formalisms and are seen to be matching with each other. We hope that our studies will be helpful in designing future experiments to explore the island of stability.

High level of CA 125 due to large endometrioma.

Science.gov (United States)

Phupong, Vorapong; Chen, Orawan; Ultchaswadi, Pornthip

2004-09-01

CA 125 is a tumor-associated antigen. Its high levels are usually associated with ovarian malignancies, whereas smaller increases in the levels were associated with benign gynecologic conditions. The authors report a high level of CA 125 in a case of large ovarian endometrioma. A 45-year-old nulliparous Thai woman, presented with an increase of her abdominal girth for 7 months. Transabdominal ultrasonogram demonstrated a large ovarian cyst and multiple small leiomyoma uteri, and serum CA 125 level was 1,006 U/ml. The preoperative diagnosis was ovarian cancer with leiomyoma uteri. Exploratory laparotomy was performed. There were a large right ovarian endometrioma, small left ovarian endometrioma and multiple small leiomyoma. Total abdominal hysterectomy and bilateral salpingo-oophorectomy was performed and histopathology confirmed the diagnosis of endometrioma and leiomyoma. The serum CA 125 level declined to non-detectable at the 4th week. She was well at discharge and throughout her 4th week follow-up period Although a very high level of CA 125 is associated with a malignant process, it can also be found in benign conditions such as a large endometrioma. The case emphasizes the association of high levels of CA 125 with benign gynecologic conditions.

Effect of increasing tellurium content on the electronic and optical properties of cadmium selenide telluride alloys CdSe{sub 1-x}Te{sub x}: An ab initio study

Energy Technology Data Exchange (ETDEWEB)

Reshak, Ali Hussain, E-mail: maalidph@yahoo.co.uk [Institute of Physical Biology-South Bohemia University, Nove Hrady 37333 (Czech Republic); School of Material Engineering, Malaysia University of Perlis, P.O Box 77, d/a Pejabat Pos Besar, 01007 Kangar, Perlis (Malaysia); Kityk, I.V. [Electrical Engineering Department, Technical University of Czestochowa, Al. Armii Krajowej 17/19, Czestochowa (Poland); Khenata, R. [Laboratoire de Physique Quantique et de Modelisation Mathematique de la Matiere (LPQ3 M), universite de Mascara, Mascara 29000 (Algeria); Department of Physics and Astronomy, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Auluck, S. [National Physical Laboratory Dr. K S Krishnan Marg, New Delhi 110012 (India)

2011-06-16

Highlights: > Theoretical study of effect of vary Te content on band structure, density of states, linear and nonlinear optical susceptibilities of CdSe{sub 1-x}Te{sub x}. > Increasing Te content leads to a decrease in the energy band gap. > Significant enhancement of the electronic properties as a function of tellurium concentration - Abstract: An all electron full potential linearized augmented plane wave method, within a framework of GGA (EV-GGA) approach, has been used for an ab initio theoretical study of the effect of increasing tellurium content on the band structure, density of states, and the spectral features of the linear and nonlinear optical susceptibilities of the cadmium-selenide-telluride ternary alloys CdSe{sub 1-x}Te{sub x} (x = 0.0, 0.25, 0.5, 0.75 and 1.0). Our calculations show that increasing Te content leads to a decrease in the energy band gap. We find that the band gaps are 0.95 (1.76), 0.89 (1.65), 0.83 (1.56), 0.79 (1.44) and 0.76 (1.31) eV for x = 0.0, 0.25, 0.5, 0.75 and 1.0 in the cubic structure. As these alloys are known to have a wurtzite structure for x less than 0.25, the energy gaps are 0.8 (1.6) eV and 0.7 (1.55) eV for the wurtzite structure (x = 0.0, 0.25) for the GGA (EV-GGA) exchange correlation potentials. This reduction in the energy gaps enhances the functionality of the CdSe{sub 1-x}Te{sub x} alloys, at least for these concentrations, leading to an increase in the effective second-order susceptibility coefficients from 16.75 pm/V (CdSe) to 18.85 pm/V (CdSe{sub 0.75}Te{sub 0.25}), 27.23 pm/V (CdSe{sub 0.5}Te{sub 0.5}), 32.25 pm/V (CdSe{sub 0.25}Te{sub 0.75}), and 37.70 pm/V (CdTe) for the cubic structure and from 12.65 pm/V (CdSe) to 21.11 pm/V (CdSe{sub 0.75}Te{sub 0.25}) in the wurtzite structure. We find a nonlinear relationship between the absorption/emission energies and composition, and a significant enhancement of the electronic properties as a function of tellurium concentration. This variation will help in

14 CFR 125.203 - Communication and navigation equipment.

Science.gov (United States)

2010-01-01

... within the degree of accuracy required for ATC; (ii) One marker beacon receiver providing visual and... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Communication and navigation equipment. 125... Equipment Requirements § 125.203 Communication and navigation equipment. (a) Communication equipment—general...

In Vivo Thyroid 125I Monitoring with Radioluminography

International Nuclear Information System (INIS)

Nishizawa, K.; Saze, T.; Yamashita, H.; Etoh, M.

1999-01-01

The counting features of an in vivo thyroid monitoring system with an imaging plate (IP) were investigated by using an anthropomorphic thyroid-neck phantom. The realistic thyroid phantoms loaded with 125 I solution were embedded in a neck phantom. The IP was fixed on the neck phantom and exposed to 125 I photons emitted from the thyroid phantom by changing the pre-thyroid tissue thickness at the front of the thyroid. A clear thyroid image was obtained at short tissue thicknesses. A region of interest (ROI) was set so that the ROI contained the thyroid image. The count within the ROI was regarded as the number of 125 I photons detected by the IP. The IP counting efficiency was about 0.6% at maximum. Monitoring with IP has the advantage of allowing the worker to move freely during the monitoring period by wearing the IP on his neck. Radioluminography with IP has shown itself to be useful when monitoring thyroid 125 I. (author)

Fragmentation of Nimotuzumab for Preparation of 125I-F(ab’)2-Nimotuzumab as a Precursor for Preparing 125I-F(ab’)2-Nimotuzumab-NLS Radiopharmaceutical for Cancer Therapy

International Nuclear Information System (INIS)

Haryuni, R.D.; Bahtiar, A.; Soenarjo, S.; Harahap, Y.; Mutalib, A.; Ramli, M.; Hermanto, S.; Ardiyatno, C.N.; Susilo, V.Y.; Haffid, D.

2014-01-01

Nimotuzumab is an anticancer agent which belongs to the inhibitor group of Epidermal Growth Factor Receptor (EGFR). This monoclonal antibody has a relatively high molecular weight which slows penetration on tumor cells, making it less attractive in imaging kinetics and potentially elicits antibodies responses. Therefore, in this study nimotuzumab was fragmented to form a bivalent antibody [F(ab’) 2 ] and then labeled with 125 I to form 125 I-F(ab’) 2 -nimotuzumab which can be used further as a precursor for preparing 125 I-F(ab’) 2 -nimotuzumab-NLS (NLS = nuclear localization sequence) radiopharmaceutical for radioimmunotherapy. The aims of this study was to obtain characteristics of 125 I-F(ab’) 2 -nimotuzumab by comparing with the 125 I labeled-intact nimotuzumab ( 125 I-nimotuzumab). This study was initiated by purifying nimotuzumab by mean of dialysis. The purified nimotuzumab was then fragmented by using pepsin. The F(ab') 2 -nimotuzumab formed was then purified from its by-products which formed in fragmentation process by using a PD-10 column (consisted Sephadex G25). The intact nimotuzumab and its F(ab’)2 fragment were then labeled with the 125 I to form 125 I-nimotuzumab and 125 I-F(ab’) 2 -nimotuzumab. The radiochemical purity are 98.27 % and 93.24 %, respectively. Stability test results show that, both 125 I-nimotuzumab and 125 I-F(ab’) 2 -nimotuzumab are more stable at 4 °C than at room temperature storage and 37 °C. (author)

49 CFR 37.125 - ADA paratransit eligibility: Process.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Process. 37.125... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.125 ADA... § 37.121 of this part shall establish a process for determining ADA paratransit eligibility. (a) The...

14 CFR 125.363 - Flight release over water.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight release over water. 125.363 Section 125.363 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Flight release over water. (a) No person may release an airplane for a flight that involves extended...

DNA strand breakage by 125I-decay in oligoDNA

International Nuclear Information System (INIS)

Lobachevsky, P.; Martin, R.F.

1996-01-01

Full text: A double-stranded oligodeoxynucleotide containing 125 I-dC in a defined location, with 5'- or 3'- 32 P-end-labelling of either strand, was used to investigate DNA strand breakage resulting from 125 I decay. Samples of the 32 P-end-labelled and 125 I-dC containing oligoDNA were incubated in 20 mM phosphate buffer (PB), or PB + 2 M dimethylsulphoxide (DMSO) at 4 deg during 18-20 days. The 32 P-end-labelled DNA fragments produced by 125 I decays were separated on denaturing polyacrylamide gels, and the 3P activity in each fragment was determined by scintillation counting after elution from the gel. The fragment size distribution was then converted to a distribution of single stranded break probabilities at each nucleotide position. The results indicate that each 125 I decay event produces at least one break in the 125 I-dC containing strand, and causes breakage of the opposite strand in 75-80% of events. Thus, the double stranded break is produced by 125 I decay with probability ∼0.8. Most of single stranded breaks (around 90%) occurred within 5-6 nucleotides of the 125 I-dC, however DNA breaks were detected up to 18-20 nucleotides from the decay site. The average numbers of single stranded breaks per decay are 3.7 (PB) and 3.3 (PB+DMSO) in 125 I-dC containing strand, and 1.5 (PB) and 1.3 (PB+DMSO) in the opposite strand. Deconvolution of strand break probabilities as a function of separation from the 125 I, in terms of both distance (to target deoxyribosyl carbon atoms, in B-DNA) and nucleotide number, show that the latter is an important parameter for the shorter-range damage. This could indicate a role for attenuation/dissipation of damage through the stacked bases. In summary, the results represent a much more extensive set of data than available from earlier experiments on DNA breakage from l25 I-decay, and may provide new mechanistic insights

40 CFR 125.99 - What are approved design and construction technologies?

Science.gov (United States)

2010-07-01

... construction technologies? 125.99 Section 125.99 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...) of the Act § 125.99 What are approved design and construction technologies? (a) The following....99 was suspended. ...

Electrical conduction in (Na0⋅ 125Bi0⋅ 125 Ba0⋅ 65Ca0⋅)(Nd0 ...

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science; Volume 29; Issue 1. Electrical conduction in (Na0.125Bi0.125Ba0.65Ca0.1)(Nd0.065Ti0.87Nb0.065)O3 ceramic. Syed Mahboob G Prasad G S Kumar. Ceramics and Glasses Volume 29 Issue 1 February 2006 pp 35-41 ...

Serum CA125 predicts extrauterine disease and survival in uterine carcinosarcoma

Science.gov (United States)

Huang, Gloria S.; Chiu, Lydia G.; Gebb, Juliana S.; Gunter, Marc J.; Sukumvanich, Paniti; Goldberg, Gary L.; Einstein, Mark H.

2009-01-01

Objective The purpose of this study was to determine the clinical utility of CA125 measurement in patients with uterine carcinosarcoma (CS). Methods Ninety-five consecutive patients treated for CS at a single institution were identified. All 54 patients who underwent preoperative CA125 measurement were included in the study. Data were abstracted from the medical records. Tests of association between preoperative CA125 and previously identified clinicopathologic prognostic factors were performed using Fisher’s exact test and Pearson chi-square test. To evaluate relationship of CA125 elevation and survival, a Cox proportional hazard model was used for multivariate analysis, incorporating all of prognostic factors identified by univariate analysis. Results Preoperative CA125 was significantly associated with the presence of extrauterine disease (P<0.001), deep myometrial invasion (P<0.001), and serous histology of the epithelial component (P=0.005). Using univariate survival analysis, stage (HR=1.808, P=0.004), postoperative CA125 level (HR=9.855, P<0.001), and estrogen receptor positivity (HR=0.314, P=0.029) were significantly associated with survival. In the multivariate model, only postoperative CA125 level remained significantly associated with poor survival (HR=5.725, P=0.009). Conclusion Preoperative CA125 elevation is a marker of extrauterine disease and deep myometrial invasion in patients with uterine CS. Postoperative CA125 elevation is an independent prognostic factor for poor survival. These findings indicate that CA125 may be a clinically useful serum marker in the management of patients with CS. PMID:17935762

1,25-Dihydroxyvitamin D3 (1,25(OH)2D3) Signaling Capacity and the Epithelial-Mesenchymal Transition in Non-Small Cell Lung Cancer (NSCLC): Implications for Use of 1,25(OH)2D3 in NSCLC Treatment

International Nuclear Information System (INIS)

Upadhyay, Santosh Kumar; Verone, Alissa; Shoemaker, Suzanne; Qin, Maochun; Liu, Song; Campbell, Moray; Hershberger, Pamela A.

2013-01-01

1,25-dihydroxyvitamin D 3 (1,25(OH) 2 D 3 ) exerts anti-proliferative activity by binding to the vitamin D receptor (VDR) and regulating gene expression. We previously reported that non-small cell lung cancer (NSCLC) cells which harbor epidermal growth factor receptor (EGFR) mutations display elevated VDR expression (VDR high ) and are vitamin D-sensitive. Conversely, those with K-ras mutations are VDR low and vitamin D-refractory. Because EGFR mutations are found predominately in NSCLC cells with an epithelial phenotype and K-ras mutations are more common in cells with a mesenchymal phenotype, we investigated the relationship between vitamin D signaling capacity and the epithelial mesenchymal transition (EMT). Using NSCLC cell lines and publically available lung cancer cell line microarray data, we identified a relationship between VDR expression, 1,25(OH) 2 D 3 sensitivity, and EMT phenotype. Further, we discovered that 1,25(OH) 2 D 3 induces E-cadherin and decreases EMT-related molecules SNAIL, ZEB1, and vimentin in NSCLC cells. 1,25(OH) 2 D 3 -mediated changes in gene expression are associated with a significant decrease in cell migration and maintenance of epithelial morphology. These data indicate that 1,25(OH) 2 D 3 opposes EMT in NSCLC cells. Because EMT is associated with increased migration, invasion, and chemoresistance, our data imply that 1,25(OH) 2 D 3 may prevent lung cancer progression in a molecularly defined subset of NSCLC patients

Correlation between ovarian chocolate cyst and serum carbohydrate antigen 125 level and the effect of ultrasound-guided interventional sclerotherapy on serum carbohydrate antigen 125 level.

Science.gov (United States)

Wang, Si-Ming; Cai, Huai-Qiu; Dong, Xiao-Qiu; Fan, Qiu-Lan; Wang, Lu-Lu; Shao, Xiao-Hui; Zhang, Li-Wei

2015-01-01

This study was to investigate the correlation between ovarian chocolate cysts and serum carbohydrate antigen (CA)-125 levels and to demonstrate the effect of ultrasound-guided interventional sclerotherapy (UGIS) on serum CA-125 levels. Based on the serum CA-125 level, as determined by chemiluminescence detection prior to UGIS, 105 patients with ovarian chocolate cysts were divided into the normal group (CA-125 ≤ 35 U/mL, 45 patients) and the abnormal group (35 U/mL history, child-bearing history, abortion history and surgical history. The ultrasonography characteristics were cyst diameter, cyst wall thickness and the side on which the cyst occurred. The correlations between serum CA-125 levels pretreatment and the clinical indicators and ultrasonography characteristics was analyzed. The serum CA-125 levels pretreatment, 3 months post-treatment and 6 months post-treatment were compared. The pretreatment serum CA-125 levels of the 105 patients positively correlated with disease duration (r = 0.3932, P = 0.0040), dysmenorrhea history (r = 0.2351, P = 0.0111), cyst diameter (r = 0.3415, P chocolate cysts. © 2014 The Authors. Journal of Obstetrics and Gynaecology Research © 2014 Japan Society of Obstetrics and Gynecology.

14 CFR 125.206 - Pitot heat indication systems.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pitot heat indication systems. 125.206... Equipment Requirements § 125.206 Pitot heat indication systems. (a) Except as provided in paragraph (b) of... flight instrument pitot heating system unless the airplane is equipped with an operable pitot heat...

23 CFR 771.125 - Final environmental impact statements.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Final environmental impact statements. 771.125 Section... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.125 Final environmental impact statements. (a)(1..., economic, or environmental impacts of the action may need to be more fully explored; (iii) the impacts of...

Use of (3H) and (125I) tracers in steroid radioimmunoassays

International Nuclear Information System (INIS)

Jeffcoate, S.L.

1975-01-01

The comparative use of 3 H and 125 I tracers in steroid radioimmunoassays will be discussed around the following points: - 3 H. Advantages: they can be purchased commercially and have a long shelf-life. Disadvantages: they may have reduced affinity for antibodies due to ''isotope effects''; the counting of β-emitters is more expensive and difficult; 3 H tracers are not available for all steroids. - 125 I. Advantages: gamma-counting is cheaper, simpler and more precise; 125 I tracers may have higher affinity for antibodies than unlabelled steroids; 125 I can be used to label any steroid. Disadvantages: 125 I tracers have a limited shelf-life (n.b. six months for 125 I histamine tracers). The high affinity of some tracers will be a big disadvantage if the unlabelled steroid cannot compete effectively

125I-β-CIT biodistribution study in animals

International Nuclear Information System (INIS)

Hu Ping

2000-01-01

The purpose is to study the preparation and biodistribution in animal of dopamine transporter imaging agent 125 I-β-CIT. β-CIT was 125 I radioiodinated with Iodogen method, the dynamic distribution of 125 I-β-CIT in brain and critical organs were studied with SD rat (autoradiography) and NIH mice respectively. The radiolabelling yield of 125 I-β-CIT was 84%, the radiochemical purity was better than 98%. Blood clearance could be explained by two-compartment model with a duration of 12h, (α = 3.87, T 1/2α = 0.179, β = 0.162, T 1/2β = 4.276) and three-compartment model in 24 h, (Pi = 5.28, T 1/2Pi = 0.131, α = 0.403, T 1/2α = 1.719, β 0.040, T 1/2β = 17.298). The maxim uptake rate of brain (9.1% +- 1.0%) was reaches at 1h, while at 24h, the target/noise ratio was higher . Critical organs liver, lung, spleen and kidney had high uptake rate [(9.88 +- 1.43) - (16.29 +- 1.72)], except liver, other organs showed quick clearance (T 1/2 125 I-β-CIT has a high striatum uptake and good stability in vivo, can provide good SPECT images, the best acquisition time of SPECT may be about 20h after i.v

Enhancement of Thermoelectric Properties of PEDOT:PSS and Tellurium-PEDOT:PSS Hybrid Composites by Simple Chemical Treatment

Science.gov (United States)

Jin Bae, Eun; Hun Kang, Young; Jang, Kwang-Suk; Yun Cho, Song

2016-01-01

The thermoelectric properties of poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) and tellurium-PEDOT:PSS (Te-PEDOT:PSS) hybrid composites were enhanced via simple chemical treatment. The performance of thermoelectric materials is determined by their electrical conductivity, thermal conductivity, and Seebeck coefficient. Significant enhancement of the electrical conductivity of PEDOT:PSS and Te-PEDOT:PSS hybrid composites from 787.99 and 11.01 to 4839.92 and 334.68 S cm-1, respectively was achieved by simple chemical treatment with H2SO4. The power factor of the developed materials could be effectively tuned over a very wide range depending on the concentration of the H2SO4 solution used in the chemical treatment. The power factors of the developed thermoelectric materials were optimized to 51.85 and 284 μW m-1 K-2, respectively, which represent an increase of four orders of magnitude relative to the corresponding parameters of the untreated thermoelectric materials. Using the Te-PEDOT:PSS hybrid composites, a flexible thermoelectric generator that could be embedded in textiles was fabricated by a printing process. This thermoelectric array generates a thermoelectric voltage of 2 mV using human body heat.

Eμ/miR-125b transgenic mice develop lethal B-cell malignancies.

Science.gov (United States)

Enomoto, Y; Kitaura, J; Hatakeyama, K; Watanuki, J; Akasaka, T; Kato, N; Shimanuki, M; Nishimura, K; Takahashi, M; Taniwaki, M; Haferlach, C; Siebert, R; Dyer, M J S; Asou, N; Aburatani, H; Nakakuma, H; Kitamura, T; Sonoki, T

2011-12-01

MicroRNA-125b-1 (miR-125b-1) is a target of a chromosomal translocation t(11;14)(q24;q32) recurrently found in human B-cell precursor acute lymphoblastic leukemia (BCP-ALL). This translocation results in overexpression of miR-125b controlled by immunoglobulin heavy chain gene (IGH) regulatory elements. In addition, we found that six out of twenty-one BCP-ALL patients without t(11;14)(q24;q32) showed overexpression of miR-125b. Interestingly, four out of nine patients with BCR/ABL-positive BCP-ALL and one patient with B-cell lymphoid crisis that had progressed from chronic myelogenous leukemia overexpressed miR-125b. To examine the role of the deregulated expression of miR-125b in the development of B-cell tumor in vivo, we generated transgenic mice mimicking the t(11;14)(q24;q32) (Eμ/miR-125b-TG mice). Eμ/miR-125b-TG mice overexpressed miR-125b driven by IGH enhancer and promoter and developed IgM-negative or IgM-positive lethal B-cell malignancies with clonal proliferation. B cells obtained from the Eμ/miR-125b-TG mice were resistant to apoptosis induced by serum starvation. We identified Trp53inp1, a pro-apoptotic gene induced by cell stress, as a novel target gene of miR-125b in hematopoietic cells in vitro and in vivo. Our results provide direct evidence that miR-125b has important roles in the tumorigenesis of precursor B cells.

Fragmentation of Nimotuzumab for Preparation of 125I-F(ab’2-Nimotuzumab as a Precursor for Preparing 125I-F(ab’2-Nimotuzumab-NLS Radiopharmaceutical for Cancer Therapy

Directory of Open Access Journals (Sweden)

R.D. Haryuni

2014-04-01

Full Text Available Nimotuzumab is an anticancer agent which belongs to the inhibitor group of Epidermal Growth Factor Receptor (EGFR. This monoclonal antibody has a relatively high molecular weight which makes slow penetration on tumor cell, as concequence, it is less attractive in imaging kinetics, and potentially elicits antibodies respons. Therefore in this study nimotuzumab was fragmented to form bivalent antibody [F(ab’2] and then labeled with 125I to form 125I-F(ab’2-nimotuzumab which can be used further as a precursor for preparing 125I-F(ab’2-nimotuzumab-NLS (NLS = nuclear localizing sequences radiopharmaceutical for radioimmunotherapy. The aims of this study were to obtain characteristics of 125I-F(ab’2-nimotuzumab by comparing with the 125I labeled-intact nimotuzumab (125I-nimotuzumab. This study was initiated by purifying nimotuzumab by mean of dialysis. The purified nimotuzumab was then fragmented by using pepsin. The F(ab'2-nimotuzumab formed was then purified from its by-products which formed in fragmentation process by using a PD-10 column (consisted Sephadex G25. The intact nimotuzumab and its F(ab’2 fragment were then labeled with the 125I to form 125I-nimotuzumab and 125I-F(ab’2-nimotuzumab. The radiochemical purity are 98.27 % and 93.24 % ,respectively. Stability test results show that, both of 125I-nimotuzumab and 125I-F(ab’2-nimotuzumab more stable at 4 °C than at room temperature storage and 37 °C

Preparation of 125I-labeled monoclonal antibody of bladder neoplasm using lactoperoxidase

International Nuclear Information System (INIS)

Li Huaifen; Niu Huisheng; Yuan Mingyue; Huang Yongzhi

1994-01-01

125 I-labelled monoclonal antibody of bladder neoplasm ( 125 I-L 4 B 4 ) is prepared using lactoperoxidase. The in-vivo radioactive distribution of 125 I-L 4 B 4 in bare mice shows that 125 I-L 4 B 4 concentrates in the tumour

Computerized dosimetry of I-125 sources model 6711

International Nuclear Information System (INIS)

Isturiz, J.

2001-01-01

It tries on: physical presentation of the sources; radiation protection; mathematical model of I-125 source model 6711; data considered for the calculation program; experimental com probation of the dose distribution; exposure rate and apparent activity; techniques of the use given to the sources I-125; and the calculation planning systems [es

14 CFR 125.311 - Flight crewmembers at controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight crewmembers at controls. 125.311... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Operations § 125.311 Flight crewmembers at controls. (a) Except as provided in paragraph (b) of this section, each...

Recovery of antimony-125 from tin-124 irradiated by neutrons

International Nuclear Information System (INIS)

Baluev, A.V.; Mityakhina, V.S.; Krasnikov, L.V.; Galkin, B.Ya.; Besnosyuk, V.I.

2003-01-01

Separation of 125 Sb from tin using highly basic, medium-basic, and weakly basic ion-exchangers was studied. The best results were obtained for AN-31 weakly basic anion exchanger. The yield of 125 Sb was 95 -98 % of the initial activity, the yield of tin, 98 ± 0.5% of the initial amount. The separation coefficient is 10 6 -10 7 for one cycle. A procedure based on ion exchange was developed. Extraction procedures of separation of 125 Sb from tin were studied. Isoamyl alcohol, ethyl acetate, and di-n-butyl ether were used as extracting agents. The most efficient extracting agent is di-n-butyl ether. Carrier-free radiochemically pure sample of 125 Sb was produced. More than 20 mCi of the target product was recovered. The extraction recovery procedure of 125 Sb has been developed. (author)

First symposium seed implant 125I and high rate of prostate

International Nuclear Information System (INIS)

2012-01-01

The First symposium seed implant 125 I and high rate of prostate, was organized by the Marie Curie Foundation, between the 12 to april 2012, in the Cordoba city of Argentina. In this event were presented several documents in different topics: patients selection for impacts of 125 I seeds; high doses radiation in radiotherapy; brachytherapy for prostate cancer; prostate implant technique with 125 I seeds; implant dosimetric aspects; radioprotection of 125 I seeds.

14 CFR 125.177 - Control of engine rotation.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Control of engine rotation. 125.177 Section... Requirements § 125.177 Control of engine rotation. (a) Except as provided in paragraph (b) of this section, each airplane must have a means of individually stopping and restarting the rotation of any engine in...

Quality asurance of iodinated (125 I) human fibrinogen

International Nuclear Information System (INIS)

Vines, E.J.

1980-05-01

The radiopharmaceutical iodinated ( 125 I) human fibrinogen is currently used for the detection of deep vein thrombosis in the legs, a fairly common post-surgical complication. A comprehensive quality assurance programme for ( 125 I) - human fibrinogen has been determined for routine use at the Australian Radiation Laboratory, with adaptions necessary for hospital quality control testing

50 CFR 12.5 - Seizure by other agencies.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Seizure by other agencies. 12.5 Section 12... SEIZURE AND FORFEITURE PROCEDURES General Provisions § 12.5 Seizure by other agencies. Any authorized... the laws listed in § 12.2 will, if so requested, deliver such seizure to the appropriate Special Agent...

Effect of fentanyl on 125I-β-CIT uptake in mice brain

International Nuclear Information System (INIS)

Liu Xingdang; Lin Xiangtong

2003-01-01

Objective: To investigate the effect of fentanyl on 125 I-2β-carbomethoxy-3β-(4-iodophenyl) tropane ( 125 I-β-CIT) uptake in mice brain. Methods: 1) KM mice groups of five were given different doses of fentanyl, and 10 min or 1 h later were given a dose of 125 I-β-CIT. 2)Two groups of animals were killed at 2 h after injection of 125 I-β-CIT. 3)One group of animals were killed at 1 h after injection of 125 I-β-CIT. Results: 1)In the striatum, frontal cortex, hippocampus, brain stem, cerebellum and whole brain, a dose-dependent increase in uptake (%ID/g or %ID) of 125 I-β-CIT was detected at the fentanyl doses ranging from 125 to 300 μg/kg, and the uptakes of hippocampus and cerebellum were higher than that of the controls. There was a great difference in the value of %ID/g or %ID between the group treated with 250 μg/kg fentanyl and the control group; while at the doses from 12.5 to 100 μg/kg, a dose-dependent decrease in uptake in the same regions was observed and all the uptake levels were lower (hippocampus: except 62.5 and 12.5 μg/kg groups; brain stem: except 62.5 μg/kg group) than that of the controls. 2)The uptakes of 125 I-β-CIT in the striatum, frontal cortex, hippocampus, brain stem, cerebellum and whole brain in the groups injected with 125 I-β-CIT 10 min after fentanyl treatment were higher than that in the groups injected with 125 I-β-CIT 1 h after fentanyl treatment. 3)The binding of 125 I-β-CIT in the striatum, frontal cortex, hippocampus, brain stem, cerebellum and whole brain in the groups killed at 1 h after injection of 125 I-β-CIT was higher than that in the control group, but without significant difference. Conclusion: Fentanyl may have different effects on 125 I-β-CIT at various time points and doses

Application of 125I in micropipettor check

International Nuclear Information System (INIS)

Qian Xiaoyu; Gao Yunchao; Yang Yadong; Lu Hankui

2006-01-01

Gravimetric test is one of authoritative methods for the measurement and validation of the accuracy and precision of micropipettors. The feasibility of radioactive measurement in the check of micropipettors is studied. There are no significant difference in radioactive count rates of 125 I aspirated between 2 qualified micropipettors, but significant difference are recorded between qualified and unqualified micropipettors. So 125 I radiometry agrees with gravimetric tests, and can be used as a laboratory constant test of micropipettors. (authors)

Preparation and dosimetry of reactor-produced Xe-125 for ventilation scintigraphy

International Nuclear Information System (INIS)

Junker, D.; Cordes, H.

1978-01-01

Xe-125 is produced in the reactor by the (n, γ)-reaction from Xe-124. The natural abundance of Xe-124, however, is only 0,1 percent. As the costs for Xe-124 enriched Xenon are considerable, natural Xenon is activated in the epithermal energy region. In contrast to the other stable isotopes of Xenon, Xe-124 shows a large resonance cross section in this energy region. The main activation product is Xe-125. In addition, a few nuclides (e.g. Xe-125m, Xe-127m, Xe-137) are produced, which due to their short half lives give no contribution to radiation dose. Radiocontaminants originating from parent-daughter decay (e.g. Cs-135 and Cs-137) are separated by filtration of the gas. I-125 produced by the decay of Xe-125 is removed by filtering of the gas before administration to the patient. Typical yields of a sample capsule are 20 to 30 mCi Xe-125 after irradiation of 4 hours in an epithermal flux of approximately 2.10 -11 s -1 cm -2 . The residual contaminants contributing to the radiation dose are Xe-135 and Xe-129m. Depending on the irradiation time they amount to a few percent of the total activity. Using Xe-125 for lung ventilation studies results in considerable reduction of radiation dose as compared to Xe-133. An additional advantage is the better tissue penetration of Xe-125 (γ-energies at 188 keV (55%) and 243 keV (29%)) permitting the reduction of the dose for a study. The daughter nuclide I-125 generated during the study causes only a few mrem of radiation dose if the thyroid is blocked. Altogether Xe-125 as compared to Xe-133 offers more suitable γ-energies for lung ventilation studies and in addition a reduced radiation dose to the patient. (author)

Preparation and evaluation of serotonin labelled with 125I

International Nuclear Information System (INIS)

Sivaprasad, N.; Geetha, R.; Ghodke, A.S.; Karmalkar, C.P.; Pilkhwal, N.S.; Sarnaik, J.S.; Borkute, S.D.; Nadkarni, G.D.

1999-01-01

Radiolabelled serotonin is an important tool for studying serotonin receptors and estimating serotonin levels in plants and animals. In this paper we report the synthesis of serotonin - 125 I. Tyrosine Methyl Ester (TME) was first labelled with 125 I using chloramine-T method. 125 I-TME was then conjugated with serotonin using carbodimide. The labelled conjugate was purified using gel filtration. Yield and radiochemical purity were estimated using electrophoresis and ITLC in different solvent systems. The binding of the purified tracer to serotonin receptors and serotonin antibodies was studied. (author)

Iodine-125 toxicity as a function of intranuclear radionuclide distribution

International Nuclear Information System (INIS)

Yasui, L.S.; Hofer, K.G.

1984-01-01

Chinese hamster ovary (CHO) cells were synchronized in the G/sub 1/ phase of the cell cycle by isoleucine deprivation and then subjected to 8 hr. labeling with /sup 125/I-iododeoxyuridine (/sup 125/IUdR) either in the presence or absence of aphidicolin. Cells labeled in the presence of aphidicolin showed a D/sub 0/ of 30 decays/cell as compared to a D/sub 0/ of 90-100 decays for control cells. Presumably, aphidicolin had shifted /sup 125/IUdR incorporation into a sensitive sub-fraction of the nuclear genome. However, no aphidicolin effect was seen in identical studies on asynchronous cell populations, i.e., both control and aphidicolin treated cells showed a D/sub 0/ of 90-100 decays/cell. An attempt was made to correlate /sup 125/I toxicity with intranuclear /sup 125/I distribution. Electron-microsopic autoradiography and Chi=squared analysis revealed that in all experimental groups grain density was highest in the heterochromatin region of the nucleus. However, isoleucine deprivation lead to a dramatic decrease in the nuclear area occupied by heterochromatin (19.5% in control cells, 0.7% in synchronized cells), resulting in a corresponding increase in area and grain density for the euchromatin containing portion of the nucleus. These observations suggest that any shift in intranuclear distribution of /sup 125/I causes a dramatic change in the toxic effects of intranuclear /sup 125/I decays

Synthesis of 125 I - Salicyl Hydroxamic Acid for Urinary Bladder Imaging

International Nuclear Information System (INIS)

Ibrahim, I.T.; Abou EL Zahab, M.; Hamed, M.

2015-01-01

Salicylhydroxamic acid is a salicylate derivative. Radiolabeling of Salicyl hydroxamic acid ( SHA ) with iodine-125 may have considerable interest for imaging of urinary bladder. This study is aimed to optimize the radiolabeling yield of Salicyl hydroxamic with radio iodine (125-123) using chloramine - T (CAT) as an oxidizing agent with respect to factors that affect the reaction conditions such as SHA amount, CAT amount, reaction time and ph of the reaction mixture. In - vitro stability of the radiolabeled complex was checked and it was found to be stable for up to 24 h. 125 I-SHA was injected via intravenous administration routes into normal male Sprague – Dawley rats. Bio - distribution studies have revealed that 125 I-SHA was excreted in urine with extent that it could give a clear image for urinary bladder especially if the bladder it tightly closed. The amount of 125 I - Salicyl hydroxamic excreted was increased in case of giving potassium bicarbonate to rat before injection of 125 I-SHA. The result of biodistribution study of 125 I - SHA in experimental animal suggest ed the possibility of using 123 I-SHA to image the urinary bladder

PPARγ inhibits ovarian cancer cells proliferation through upregulation of miR-125b

Energy Technology Data Exchange (ETDEWEB)

Luo, Shuang, E-mail: luoshuangsch@163.com [Department of Obstetrics and Gynecology, Suining Central Hospital, Suining (China); Wang, Jidong [Department of Gynecology and Obsterics, Jinan Central Hospital, Jinan (China); Ma, Ying [Department of Otorhinolaryngolgy, Suining Central Hospital, Suining (China); Yao, Zhenwei [Department of Gynecology and Obstetrics, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Pan, Hongjuan [Department of Gynecology and Obsterics, Zhongshan Hospital, Wuhan (China)

2015-06-26

miR-125b has essential roles in coordinating tumor proliferation, angiogenesis, invasiveness, metastasis and chemotherapy recurrence. In ovarian cancer miR-125b has been shown to be downregulated and acts as a tumor suppressor by targeting proto-oncogene BCL3. PPARγ, a multiple functional transcription factor, has been reported to have anti-tumor effects through inhibition of proliferation and induction of differentiation and apoptosis by targeting the tumor related genes. However, it is unclear whether miR-125b is regulated by PPARγ in ovarian cancer. In this study, we demonstrated that the miR-125b downregulated in ovarian cancer tissues and cell lines. Ligands-activated PPARγ suppressed proliferation of ovarian cancer cells and this PPARγ-induced growth inhibition is mediated by the upregulation of miR-125b. PPARγ promoted the expression of miR-125b by directly binding to the responsive element in miR-125b gene promoter region. Thus, our results suggest that PPARγ can induce growth suppression of ovarian cancer by upregulating miR-125b which inhibition of proto-oncogene BCL3. These findings will extend our understanding of the function of PPARγ in tumorigenesis and miR-125b may be a therapeutic intervention of ovarian cancer. - Highlights: • miR-125b is down-regulated in ovarian cancer tissues and cells. • PPARγ upregulates miR-125b and downregulates its target gene BCL3 expression. • Silence of miR-125b attenuates PPARγ-mediated growth suppression of ovarian cancer cells. • PPARγ promotes the transcription of miR-125b via binding to PPARE in miR-125b gene promoter region.

Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles as a janus electrode material for Li-ion batteries

Science.gov (United States)

Karegeya, Claude; Mahmoud, Abdelfattah; Hatert, Frédéric; Vertruyen, Bénédicte; Cloots, Rudi; Lippens, Pierre-Emmanuel; Boschini, Frédéric

2018-06-01

A solvothermal method was used to prepare Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles, a new promising electrode material for lithium-ion batteries. The composition and the crystal structure were determined by 57Fe Mössbauer spectroscopy and powder X-ray diffraction Rietveld refinements and confirmed by magnetic measurements. The structural formula □0.75Na1.25Ni1.25Fe1.75(PO4)3 was obtained showing a significant amount of Na vacancies, which enhances Li diffusion. Na1.25Ni1.25Fe1.75(PO4)3 was used as negative and positive electrode material and shows excellent electrochemical performances. As negative electrode in the voltage range 0.03-3.5 V vs. Li+/Li, the first discharge at current density of 40 mA g-1 delivers a specific capacity of 1186 mAh g-1, which is almost three times its theoretical capacity (428 mAh g-1). Then, reversible capacity of 550 mAh g-1 was obtained at 50 mA g-1 with high rate capability (150 mAh g-1 at 500 mA g-1) and capacity retention of 350 cycles. As positive electrode material, specific capacities of about 145 and 99 mAh g-1 were delivered at current densities of 5 and 50 mA g-1, respectively, in the voltage range of 1.5-4.5 V vs. Li+/Li. In addition, we show that the use of solvothermal synthesis contributes to the synthesis of small sized particles leading to good electrochemical performances.

Metabolism of (125I)tyramine cellobiose-labeled low density lipoproteins in squirrel monkeys

International Nuclear Information System (INIS)

Portman, O.W.; Alexander, Manfred

1985-01-01

Low density lipoproteins labeled with ( 125 I)tyramine cellobiose (( 125 I)TC-LDL) were removed from the circulation of squirrel monkeys at a similar but slightly slower rate than LDLs labeled with 125 I, ( 125 I)hydroxypenyl propionic acid, or ( 3 H)leucine. After the simultaneous injection of (( 125 I)TC-LDL) and ( 131 I)LDL labeled with 131 ICI, the 125 I was also removed at a slightly slower rate than 131 I. Most of the radioactivity was retained in tissues and not excreted during the 24 h after injection of ( 125 I)TC-LDL. This finding supports the claim of Pittman et al. (18) that ( 125 I)TC-LDL can be used to determine the irreversible uptake of LDL by different tissues. The liver cleared more LDL than any other organ, but the adrenals and ovaries were more active per gram. Trichloroacetic acid (TCA) precipitated more than 80% of the radioactivity in the tissues that had low 125 I uptake, but only about 50% of the 125 I in more active tissues (liver, adrenals, ovaries and spleen). Only a small percentage of 125 I in urine and bile was TCA-precipitable. In the dual label experiment with ( 125 I)TC-LDL and ( 131 I)LDL there was a selective retention of 125 I in samples from liver, spleen, adrenals, and perhaps testes, and an almost complete selectivity for 125 I in bile and feces. The aortic intima plus inner media (AIM) cleared much less LDL than other tissues, but the uptake by the entire AIM was proportional to the cholesterol concentration and weight of the total AIM. There was, however, no correlation between either of the latter two measurements and the uptake of LDL per pram of AIM. (author)

Production and characterization Te-peptide by induced autolysis of Saccharomyces cerevisiae.

Science.gov (United States)

Morya, V K; Dong, Shin Jae; Kim, Eun-ki

2014-04-01

Recently, the interest in mimicking functions of chalcogen-based catalytic antioxidants like selenoenzymes, has been increased. Various attempts had been done with selenium, but very few attempts were carried out with tellurium. Bio-complex formation and characterization of tellurium was not tried earlier by using any organism. The present study was focused on tellurium peptide production, characterization, and bioactivity assessment especially Mimetic to glutathione peroxidase (GPx). The production was achieved by the autolysis of total proteins obtained from Saccharomyces cerevisiae ATCC 7752 grown with inorganic tellurium. The GPx-like activity of the hydrolyzed tellurium peptide was increased when prepared by autolysis, but decreased when prepared by acid hydrolysis. Tellurium peptide produced by autolysis of the yeast cell showed increased GPx-like activity as well as tellurium content. Tellurium peptide showed little toxicity, compared to highly toxic inorganic tellurium. The results showed the potential of tellurium peptide as an antioxidant that can be produced by simple autolysis of yeast cells.

Validation of 125I-hCG as a marker for elimination of hCG and stability of 125I-hCG after in vivo injection in humans

OpenAIRE

Christensen, T B; Marqversen, J; Engbaek, F; Berger, P; Bacher, T; Maase, H von der

1999-01-01

We have recently introduced 125I-hCG as an elimination marker in patients with human chorionic gonadotrophin (hCG) producing testicular cancer. 125I-hCG is a well-known reagent in clinical biochemistry and is used extensively in hCG assays. Previous studies have shown that the iodination process leaves the hCG molecule mainly intact. The iodination, purification and stability of 125I-hCG tracer are described. The aim of the present study was to determine whether or not 125I is associated with...

Autoradiography for iodine-125 seeds

International Nuclear Information System (INIS)

Alberti, W.; Divoux, S.; Pothmann, B.; Tabor, P.; Hermann, K.P.; Harder, D.

1993-01-01

To study the interior design of model 6702 and 6711 iodine-125 seeds, contact autoradiographs were performed using mammography film. Improved resolution was obtained using a pin-hole camera with a hole of 0.1 mm x 0.1 mm. With these techniques, qualitative determination of the relative activity distribution within each seed was possible. The number of the activated resin spheres and the positions of the centers of these spheres can be exactly determined. A model calculation shows that variations in the arrangement of the activated spheres within a seed have a moderate influence on the dose distribution at source distances below 10 mm. Knowing the exact source configuration may be useful when comparing dose calculations with measured data for model 6702 125 I seeds which are currently employed in ophthalmic plaque and implant therapy of other tumors. 16 refs., 5 figs., 2 tabs

Synthesis and binding characteristics of N-(1-naphthyl)-N'-(3-[125I]-iodophenyl)-N'-methylguanidine ([125I]-CNS 1261): a potential SPECT agent for imaging NMDA receptor activation

International Nuclear Information System (INIS)

Owens, Jonathan; Tebbutt, Andrew A.; McGregor, Ailsa L.; Kodama, K.; Magar, Sharad S.; Perlman, Michael E.; Robins, David J.; Durant, Graham J.; McCulloch, James

2000-01-01

N-(1-Naphthyl)-N'-(3-[ 125 I]-iodophenyl)-N'-methylguanidine ([ 125 I]-CNS 1261) was synthesized as a potential radioligand to image N-methyl-D-aspartate (NMDA) receptor activation. [ 125 I]-CNS 1261 was prepared by radioiodination of N-(1-naphthyl)-N'-(3-tributylstannylphenyl)-N'-methylguanidine using Na 125 I and peracetic acid. [ 125 I]-CNS 1261 uptake in vivo reflected NMDA receptor distribution in normal rat brain, whereas in ischemic rat brain, uptake was markedly increased in areas of NMDA receptor activation. Radiolabeled CNS 1261 appears to be a good candidate for further development as a single photon emission computed tomography tracer in the investigation of NMDA receptor activation in cerebral ischemia

Formation and early hydration characteristics of C2.75B1.25A3$ in binary system of C2.75B1.25A3$-C2S

Directory of Open Access Journals (Sweden)

Wang, Shoude

2016-09-01

Full Text Available C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2O3• SO3 is one of the important minerals and it govern-directly the early-strength of belite-barium calcium sulphoaluminate cement. In this paper a binary system C2.75B1.25A3$-C2S is selected to investigate the formation of C2.75B1.25A3$. In the range of 1100 °C–1200 °C, the earlier formed C2S hinders the formation of C2.75B1.25A3$. On the contrary, when the temperature is in the range of 1200 °C–1350 °C, the initially formed C2S could provide a surface for the nucleation of C2.75B1.25A3$ and cut down the potential barrier (?Gk* for the heterogeneous nucleation of C2.75B1.25A3$, which contributes to its formation. Moreover, at 1350 °C, the large amount of previously formed C2S benefits the extent of formation of C2.75B1.25A3$. The possible reason was that it could prevent sulfur evaporation. In early hydration age, AFm and AFt originating from C2.75B1.25A3$ hydration are found within 2 h and 12 h under 95% RH at 1 °C, respectively, whereas C2S is unhydrated at this moment.En el cemento de sulfoaluminato de calcio y bario, el C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2 O3• SO3 es una de las principales fases, y regula directamente la resistencia inicial del cemento. En este trabajo, se ha seleccionado el sistema binario C2.75B1.25A3$-C2S para investigar la formación de C2.75B1.25A3$. En el rango de 1100 °C-1200 °C, el C2S formado anteriormente impide la formación de C2.75B1.25A3$, mientras que cuando la temperatura está entre 1200 °C-1350 °C, el C2S proporcionaría una superficie de nucleación de C2.75B1.25A3$ reduciendo la barrera de potencial (?Gk* para la nucleación heterogénea de C2.75B1.25A3$, lo que contribuye a su formación. Además, a 1350 °C, la gran cantidad de C2S formado beneficia la formación de C2.75B1.25A3$, ya que podía prevenir la evaporación del azufre. En las primeras etapas de la hidratación (entre 2 y 12h y 95% HR a 1 ºC se pueden encontrar AFM y AFt

m-[125I]iodoaniline: a useful reagent for radiolabeling biotin

International Nuclear Information System (INIS)

Khawli, L.A.; Kassis, A.I.

1992-01-01

Biotinyl-m-[ 125 I]iodoanilide (BIA) was synthesized by coupling biotin to m-[ 125 I]iodoaniline via a mixed anhydride reaction. m-[ 125 I]Iodoaniline was produced from the tin precursor, which was prepared using a palladium catalyzed reaction of hexabutylditin with m-bromoaniline. The radioiodinated BIA derivative is characterized by a stable amide and/or intact ureido group on the biotin molecule, it may thus be a useful carrier for targeting radionuclides to avidin-conjugated antibodies previously localized on tumors. (author)

Method of separating (125I)-L-thyroxine from mixture obtained by radioiodination

International Nuclear Information System (INIS)

Mucha, J.; Talan, P.; Dobias, M.

1982-01-01

( 125 I)-L-thyroxine is separated by gel filtration on a column from the mixture of ( 125 I)-L-thyroxine, ( 125 I)-L-3,5,3'-triiodothyronine and ( 125 I) - . The column is packed with a non-polar gel such as polydextran with particle size 25 to 100 μm. The mixture 1,2-propanediol/distilled water/concentrated (26%) aqueous ammonia solution, or 1,2-propanediol/concentrated (26%) aqueous ammonia solution is used as eluent. The concentration of the eluate containing ( 125 I)-L-thyroxine is adjusted with distilled water such as to establish a 50 vol.% concentration of 1,2-propanediol. (E.S.)

(B1-/sup 125/I-desaminotyrosine)-insulin - A novel homogeneous insulin tracer

Energy Technology Data Exchange (ETDEWEB)

Bahrami, S; Zahn, H; Brandenburg, D [Deutsches Wollforschungsinstitut, Aachen (Germany F.R.); Machulla, H -J; Dutschka, K [Institut fuer Medizinische Strahlenphysik und Strahlenbiologie des Universitaetsklinikum, Essen (Germany F.R.)

1980-10-28

(B1-/sup 125/I-desaminotyrosine)-insulin (/sup 125/I-MII) was prepared with high specific activities (420 Ci/mmole) by exchanging B1-phenylalanine for /sup 125/I-p-hydroxyphenyl-propionic acid N-hydroxysuccinimide ester (Bolton-Hunter reagent). Overall radiochemical yields were about 8%. Analytical quality control and purification were performed by means of radio high pressure liquid chromatography. The radiochemical purity of /sup 125/I-MII was >99%, and the immunoprecipitability was 97%.

Serum level of tumor marker CA-125 in ovarian pathology

International Nuclear Information System (INIS)

Bagni, B.; Feggi, L.M.; Prandini, N.; Pasini, S.; Mollica, G.

1987-01-01

The tumor marker CA-125 is an embrional glycoprotein detectable in tissues derived from celomatic epitelium. Serum Ca-125 was determined by RIA in 66 patients with various ovarian pathologies (16 malignant at stage III-IV and 50 benign). Six patients with ovarian carcinoma were monitored during the first week after surgery and chemiotherapy for a total of 150 days of treatment. It has been observed that CA-125 serum level is consistently above the normal range (>35 U/ml) in all malignant diseases. In benign pathology, levels above the normal were found to be represented almost exclusively by ovarian endometriosis. Furthermore, the results demonstrate that chemiotherapy alone is capable of lowering CA-125 serum levels. This tumor marker may be of great advantage in diagnosis and follow-up of ovarian malignancy

14 CFR 125.507 - Fuel tank system inspection program.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fuel tank system inspection program. 125... Airworthiness and Safety Improvements § 125.507 Fuel tank system inspection program. (a) Except as provided in... fuel tank is installed under a field approval, before June 16, 2008, the certificate holder must submit...

12 CFR 221.125 - Credit to brokers and dealers.

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Credit to brokers and dealers. 221.125 Section... SYSTEM CREDIT BY BANKS AND PERSONS OTHER THAN BROKERS OR DEALERS FOR THE PURPOSE OF PURCHASING OR CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.125 Credit to brokers and dealers. (a) The...

Immunoreactivity of 125I-papain labelled by different methods

International Nuclear Information System (INIS)

Rauch, P.; Fukal, L.; Kas, J.; Tykva, R.

1984-01-01

Three different methods of papain iodination (with chloramine-T, lactoperoxidase and conjugation with Bolton-Hunter reagent) have been compared. The highest yield of 125 I-papain could be obtained using lactoperoxidase which enabled to achieve the highest immunoreactivity. 125 I-papain, labelled this way, is suitable for the radioimmunoassay of papain. (author)

Comparative Analysis of Supply Risk-Mitigation Strategies for Critical Byproduct Minerals: A Case Study of Tellurium.

Science.gov (United States)

Bustamante, Michele L; Gaustad, Gabrielle; Alonso, Elisa

2018-01-02

Materials criticality assessment is a screening framework increasingly applied to identify materials of importance that face scarcity risks. Although these assessments highlight materials for the implicit purpose of informing future action, the aggregated nature of their findings make them difficult to use for guidance in developing nuanced mitigation strategy and policy response. As a first step in the selection of mitigation strategies, the present work proposes a modeling framework and accompanying set of metrics to directly compare strategies by measuring effectiveness of risk reduction as a function of the features of projected supply demand balance over time. The work focuses on byproduct materials, whose criticality is particularly important to understand because their supplies are inherently less responsive to market balancing forces, i.e., price feedbacks. Tellurium, a byproduct of copper refining, which is critical to solar photovoltaics, is chosen as a case study, and three commonly discussed byproduct-relevant strategies are selected: dematerialization of end-use product, byproduct yield improvement, and end-of-life recycling rate improvement. Results suggest that dematerialization will be nearly twice as effective at reducing supply risk as the next best option, yield improvement. Finally, due to its infrequent use at present and its dependence upon long product lifespans, recycling end-of-life products is expected to be the least effective option despite potentially offering other benefits (e.g., cost savings and environmental impact reduction).

Decay of /sup 125/Sb

Energy Technology Data Exchange (ETDEWEB)

Singh, K; Sahota, H S

1983-01-01

The 2.7 yr beta decay of /sup 125/Sb yields /sup 125/Te has been studied using Ge(Li), Si(Li) and Ge detectors and the directional correlation technique New lines at 58, 111, 642, 693 and 729 keV have been detected and fitted in the decay scheme in the already existing levels, besides the one suggested at 729 keV. The intensities of 20, 109, 111, 116, 172, 178 and 198 keV transitions have been measured more precisely than before. The ..gamma..-..gamma.. directional correlation measurements in the 208-463, 204-176 and 321-176 keV cascades have enabled to assign a uniquue spin 7/2/sup -/ to the 525 keV level. The multipole mixing ratios for the 204, 208 and 321 keV transitions have been found as M1 + (14.75 +- 3.55)%E2, M1 + (4.5 +- 2.0)%E2 and E1 + (2.70 +- 0.75)%M2, respectively.

Inhibition effects of 125I-triplex forming oligonucleotide to hepatoma cells

International Nuclear Information System (INIS)

Lv Zhongwei; Hou Min; Cai Haidong; Yuan Xueyu; Yang Yuehua; Yuan Shidong; He Junmin

2007-01-01

Objective: Triplex forming oligonucleotide (TFO) has been reported as a new antigene strategy. The purpose of this study was to observe the inhibition effects of 125 I-TFO on hepatoma cells and to investigate the possibility of using 125 I-TFO as an antigene radiotherapy technique for hepatocellular carcinoma (HCC) related to HBV. Methods: TFO complementary to the initiator of S gene of HBV was synthesized and labeled with 125 I. HepG2.2.15 cells, in which HBV genome was integrated, were incubated with 125 I-TFO, TFO and 125 I respectively. After incubation, hepatitis B e antigen (HBeAg) and hepatitis B surface antigen (HBsAg) of each group were assayed with ELISA and the survival rate of cells in each group was determined with 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenylte-trazolium bromide (MTT) reduction assay. Results: 125 I-TFO showed a high stability with a radiolabeling rate of >93%. The radiochemical purity of labeled compound was 90.8%, 81.1% and 73.2% respectively after 12, 48 and 72 h at 37 degree C. The peak inhibition effect of 125 I-TFO on synthesizing HBsAg and HBeAg by HepG2.2.15 cells were found at 48 h after transfection, with significantly the highest inhibition rate of 45.2% for HBsAg and 74.5% for HBeAg expression among the three groups(P 125 I-TFO may inhibit the antigen expression of HBV and the growth of hepatocarcinoma cells, thus it may provide a new approach to develop gene-based radiotherapeutic pharmaceuticals for anti-HBV and HCC. (authors)

Measurements of saturation densities in critical region and critical loci for binary R-32/125 and R-125/143a systems

Energy Technology Data Exchange (ETDEWEB)

Kishizawa, G.; Sato, H.; Watanabe, K.

1999-05-01

R-32/125 (difluoromethane/pentafluoroethane) and R-125/143a (pentafluoroethane/1,1,1-trifluoroethane) binary systems are promising alternative refrigerants to replace conventional refrigerants, i.e., R-22 and R-502. The saturated vapor- and liquid-density data in the critical region of these mixtures were measured using the visual observation of the miniscus disappearance in an optical cell. For the R-32/125 system, 35 saturation density data were measured at three compositions, 10, 35, and 50 mass % R-32. Nineteen saturation density data were also measured for R-125/143a (50/50 mass %). The critical temperatures and densities for these binary refrigerants were determined by taking into consideration the level and location of the meniscus disappearance as well as the intensity of the critical opalescence. Correlations to represent the critical loci of these binary refrigerants for an entire range of compositions have been developed. The experimental uncertainties of the saturation density data are estimated to be within 9 mK in temperature and 0.5 to 5.0 kg{center{underscore}dot}m{sup {minus}3} in density. The uncertainties of the critical temperature and density are estimated to be within 12 to 14 mK and 4 to 8 kg{center{underscore}dot}m{sup {minus}3}, respectively.

Preparation of {sup 125}I-labeled monoclonal antibody of bladder neoplasm using lactoperoxidase

Energy Technology Data Exchange (ETDEWEB)

Huaifen, Li; Huisheng, Niu; Mingyue, Yuan; Yongzhi, Huang [Chinese Acaolemy of Medical Sciences, Tianjin (China). Inst. of Radiation Medicine

1994-11-01

{sup 125}I-labelled monoclonal antibody of bladder neoplasm ({sup 125}I-L{sub 4}B{sub 4}) is prepared using lactoperoxidase. The in-vivo radioactive distribution of {sup 125}I-L{sub 4}B{sub 4} in bare mice shows that {sup 125}I-L{sub 4}B{sub 4} concentrates in the tumour.

Enrichment mechanisms of tellurium in ferromanganese crusts

Science.gov (United States)

Sakaguchi, A.; Sugiyama, T.; Usui, A.; Takahashi, Y.

2012-04-01

Marine ferromanganese crusts (FMCs) consist of iron (Fe) hydroxides and manganese (Mn) oxides with various minor and trace elements. Especially for tellurium (Te), which is recognized as one of the rare metals, it has been reported that this element is concentrated about 105 times in FMCs compared with earth's crust, and the host phase might be Fe (oxy)hydroxide (Hein et al., 2003). Actually, in our previous study, the high concentration of Te in very surface layers of FMCs was found from the top to halfway down of a seamount in the Pacific Ocean. However, the concentration of Te in surface layers through the seamount showed good correlation with that of Mn instead of Fe. In this study, we attempted to clarify the enrichment mechanism of Te in FMCs with some methods including X-ray absorption fine structure (XAFS) technique for synthesised /natural samples. Seventeen FMC samples were collected from the Takuyo-Daigo seamount, from 950 m (summit) to 3000 m in water depth, with hyper-dolphin (remotely operated vehicle) equipped with live video camera and manipulators. The growth rates of all FMC samples were estimated to be about 3 mm/Ma. Very surface layer (less than 1 mm) of all FMC was analyzed with XRD and XAFS to confirm the mineral composition and speciation of Te. Furthermore, to serve as an aid to clarify the adsorption mechanism of Te on FMCs, distribution coefficients (Kd) and oxidation states were determined through the adsorption experiments of Te(IV) and Te(VI) on ferrihydrite and δ-MnO2. In all the experiments, pH and ionic strength were adjusted to pH 7.5 and 0.7 M, respectively. The oxidation state of Te in water phase was determined with HPLC-ICP-MS. As for the analysis of oxidation and adsorption states on the solid phase, XAFS was employed. The major mineral composition of Fe and Mn had no significant variation through the water depth of Takuyo-Daigo seamount. The oxidation state of Te in all samples showed hexavalent, and there was no significant

Auger-electron cascades, charge potential and microdosimetry of iodine-125

Energy Technology Data Exchange (ETDEWEB)

Booz, J.; Pomplun, E.; Olko, P.; Paretzke, H.G.

1987-06-01

This paper is a contribution to the microdosimetry of I-125. It shows microdosimetric spectra of individual and average disintegrations of I-125 for various target sizes and gives evidence for the relative contributions of energy-depositon events of low and high LET. It further presents information on the relative efficiencies of Auger-electrons and multiple charges in terms of local energy deposition, e.g. to model targets of DNA, and discusses their radiobiological implications, e.g. the microdosimetric understanding of the different efficiencies of specific and random incorporations of I-125. When I-125 is specifically incorporated into DNA, most of the energy deposition events are very large, e.g. above 40 keV/..mu..m for a simulated target volume of 20 nm diameter, regardless of the number and energy of Auger electrons emitted. Therefore it is not necessary, for the discussion of the radiobiological implications, to distinguish between different classes of disintegrations. For unspecific, homogeneous incorporation of I-125 somewhere into tissue, about 20% of the dose to critical targets of 25 nm diameter is made up by disintegrations that happen to occur within these targets. When assuming that other critical targets and target structures can be neglected, this part of the dose will be equally effective as in the case of specific incorporation of I-125 into such target models. In addition, there are the normal, low-LET radiation effects from the other, 80% large fraction of the dose. With this information, for the biological systems and end points for which a short section of the elemental chromatine fiber can be taken as the relevant critical target, it is shown that the expected D/sub 37/ value for homogeneous unspecific incorporation of I-125 can be estimated when the D/sub 37/ for specific incorporation in DNA is known.

Iodine-125 Chitosan-Vitamin C complex. Preparation, characterization and application

Energy Technology Data Exchange (ETDEWEB)

Elbarbary, Ahmed M. [National Center for Radiation Research and Technology, Cairo (Egypt). Polymer Chemistry Dept.; Shafik, H.M.; Ebeid, N.H.; Ayoub, S.M. [Atomic Energy Authority, Cairo (Egypt). Hot Lab. Center; Othman, Sameh H. [Atomic Energy Authority, Cairo (Egypt). Nuclear Research Center

2015-07-01

In heterogeneous conditions, water soluble Chitosan-Vitamin C Complex (CSVC) is successfully synthesized via the ionic interaction between γ-degraded CS and VC. Chitosan (CS) of low molecular weight (MW) is prepared using γ-irradiation method. The coupling of CS and vitamin C (VC) is carried out by the chemical treatment of VC with the γ-degraded CS. The formation of CSVC complex instead of physical mixture is confirmed by FT-IR and UV spectrometry. Characterization by transmission electron microscope (TEM) and dynamic light scattering (DLS) shows the formation of a nanostructure in 40 nm range. The preparation of labeled CSVC was performed using chloramines-T oxidation method. The labeling feasibility of CSVC nanostructure by Iodine-125 ({sup 125}I) is investigated. The optimized conditions of labeling are thought to be 50 μg of oxidizing agent, pH 3, and one minute reaction time. The Biodistribution activity of {sup 125}I radiolabeled CSVC nanostructure ({sup 125}I-CSVC) is examined on a group of different ascites tumor bearing mice. Calculation of the biodistribution percentages shows that the tumor, liver, and kidney are the targeting organs of {sup 125}I-CSVC nanostructure.

Iodine-125 Chitosan-Vitamin C complex. Preparation, characterization and application

International Nuclear Information System (INIS)

Elbarbary, Ahmed M.; Shafik, H.M.; Ebeid, N.H.; Ayoub, S.M.; Othman, Sameh H.

2015-01-01

In heterogeneous conditions, water soluble Chitosan-Vitamin C Complex (CSVC) is successfully synthesized via the ionic interaction between γ-degraded CS and VC. Chitosan (CS) of low molecular weight (MW) is prepared using γ-irradiation method. The coupling of CS and vitamin C (VC) is carried out by the chemical treatment of VC with the γ-degraded CS. The formation of CSVC complex instead of physical mixture is confirmed by FT-IR and UV spectrometry. Characterization by transmission electron microscope (TEM) and dynamic light scattering (DLS) shows the formation of a nanostructure in 40 nm range. The preparation of labeled CSVC was performed using chloramines-T oxidation method. The labeling feasibility of CSVC nanostructure by Iodine-125 ( 125 I) is investigated. The optimized conditions of labeling are thought to be 50 μg of oxidizing agent, pH 3, and one minute reaction time. The Biodistribution activity of 125 I radiolabeled CSVC nanostructure ( 125 I-CSVC) is examined on a group of different ascites tumor bearing mice. Calculation of the biodistribution percentages shows that the tumor, liver, and kidney are the targeting organs of 125 I-CSVC nanostructure.

Application of 125I seed permanent plantation in osseous metastases

International Nuclear Information System (INIS)

Zhang Fujun; Wu Peihong; Lu Mingjian; Li Kui; Zhang Liang; Huang Jinhua; Fan Weijun; Zhao Ming; Gu Yangkui; Liu Jian; Wang Junjie

2007-01-01

Objective: To evaluate the value of 125 I permanent plantation in treating osseous metastases. Methods: Twenty-two patients with osseous metastases were accepted radioactive seeds 125 I permanent plantation. The curative effect was appraised according to the degree of ostalgia relieving and the changing of the radiology imaging in patients. Results: Accepted radioactive seeds 125 I permanent plantation, relief of pain was obtained and the effective rate is 91% (20/22). However none of the patients showed severe side-effect. Among 32 lesions in 22 cases followed-up by CT in 2 months, 4 obtained CR, 18 obtained PR, 10 NC and 0 PD. The responsive rate was 68.7%. Conclusion: 125 I permanent plantation procedure can be a safe and effective method in treating osseous metastases and obtaining good clinical effects with minimal damage and few complications. (authors)

Variation in 125I-Insulin absorption and blood glucose concentration

International Nuclear Information System (INIS)

Lauritzen, T.; Faber, O.K.; Binder, C.

1979-01-01

The absorption of monocomponent porcine 125 I-insulin Monotard and Isophane was studied in six insulin dependent diabetic patients over a period of 12 days. The absorption of insulin was measured as the disappearance of radioactivity from sites of injection. The daily 125 I-insulin doses ranged from 20 to 48 IU between patients. The insulin absorbed varied considerably within and between patients. The range of individual daily absorbed insulin varied from 19 to 104 per cent of the 125 I-insulin dose. A significant correlation (p [de

miR-125/Pokemon auto-circuit contributes to the progression of hepatocellular carcinoma.

Science.gov (United States)

Kong, Jing; Liu, Xiaoping; Li, Xiangqian; Wu, Jinsheng; Wu, Ning; Chen, Jun; Fang, Fang

2016-01-01

Hepatocellular carcinoma (HCC) is a type of human malignant tumor occurring in hepatic tissues with high mortality. Patients benefit little from current therapeutic modalities, at least partially due to the lack of complete elucidation of molecular network regulating HCC. miR-125 and Pokemon are well-recognized tumor suppressor and oncogenes for HCC, respectively. However, the underlying mechanism by which the two genes exert their functions and the relationship between miR-125 and Pokemon is still unexplored yet. In this study, we found that there is an inverse association between miR-125 and Pokemon expression levels in HCC specimen and cell lines. Online database mining indicated that there are three putative mRNA recognition elements (MREs) of miR-125 within 3' untranslated region (3'UTR) of Pokemon. MREs of miR-125 confer the expression of luciferase with a miR-125-dependent fashion. The alteration in miR-125 abundance regulates the expression of Pokemon at both protein and mRNA levels. Overexpression of Pokemon is able to abrogate the inhibitory effect of miR-125 on HCC progression. Further study showed that Pokemon inhibits the expression of miR-125 by binding of recognition sites within its promoter. In conclusion, we found that there is an auto-regulatory circuit consisting of miR-125 and Pokemon, which promotes the progression of HCC and may be a promising therapeutic target in clinical HCC treatment.

32 CFR 935.125 - Citation in place of arrest.

Science.gov (United States)

2010-07-01

... 32 National Defense 6 2010-07-01 2010-07-01 false Citation in place of arrest. 935.125 Section 935... INSULAR REGULATIONS WAKE ISLAND CODE Peace Officers § 935.125 Citation in place of arrest. In any case in which a peace officer may make an arrest without a warrant, he may issue and serve a citation if he...

Enzymatic labelling of. gamma. -globulin and insulin with iodine-125

Energy Technology Data Exchange (ETDEWEB)

Lucka, B; Russin, K [Institute of Nuclear Physics, Krakow (Poland)

1979-01-01

The parameters of enzymatic labelling of proteins with iodine 125 were examined. The manner and sequence of reagent addition, the effects of reagent concentration, reaction time and total Na/sup 125/I activity on the labelling yield were determined.

Preparation of 125I FSH hormone

International Nuclear Information System (INIS)

Castro de Sabbatini, D.; Nieto de Nunez, G.; Mitta, A.E.A.

1976-01-01

Labelling of human FSH of pituitary origin with 125 I and its purification are described. Suitable parameters are selected for the use of radioimmunologic technique for FSH dosage in human serum. (author) [es

Perbandingan antara Kombinasi Bupivakain 0,125% dan Dexmedetomidin 1 µg/Kgbb dengan Bupivakain 0,125% Melalui Blok Kaudal Terhadap Lama Analgesi Pascaoperasi Hipospadia

Directory of Open Access Journals (Sweden)

Sardinata

2013-04-01

Full Text Available Caudal blockage is the most frequently used regional anestesia technique in pediatric surgery. Various local anesthetic agents have been frequently used in this technique. Bupivacaine is one of the most used local anesthetics due to its long duration of action. Dexmedetomidin is an α2agonist that is used as adjuvant in lengthening bupivacaine duration when it is administered via caudal blockage. In increasing its effectiveness, the combination of bupivacaine with dexmedetomidin in low concentrationd and low dose can be given. This study was performed to assess the postoperative analgesia duration using caudal blockage between the combined 0.125% bupivacaine-1µg/Kg BW dexmedetomidin and 0.125% bupivacaine solely in pediatric patients having hypospadic surgery. The study was applied to 30 pediatric patients with ASA I and II physical status, and aged 1-6 years that received hypospadic surgery with general anesthesia, to whom caudal blockage applied postoperatively. The patients were divided into two groups. One group (BD group was treated using the combined 0.125% bupivacaine-1 µg/Kg BW dexmedetomidin (0.5 cc/kg BW, the other group (B group was treated with 0.125% bupivacaine (0.5 cc/kb BW as control group. Postoperative analgesia duration was recorded. The data of the study results were assessed using Mann-Whitney test. Postoperative analgesia duration of BD group (863.0 [36.34] minutes was very significantly (p<0.001 longer than that in B group (378.08 [37.87] minutes. The conclusion of this study indicated that the use of combined 0.125% bupivacaine-1 µg/Kg BW dexmedetomidin for caudal blockage as analgetic agent after hypospadic surgery resulted longer analgesia duration than that of 0.125% bupivacaine solely

MicroRNA miR-125b induces senescence in human melanoma cells.

Science.gov (United States)

Glud, Martin; Manfé, Valentina; Biskup, Edyta; Holst, Line; Dirksen, Anne Marie Ahlburg; Hastrup, Nina; Nielsen, Finn C; Drzewiecki, Krzysztof T; Gniadecki, Robert

2011-06-01

MicroRNAs (miRNAs) are small noncoding RNA molecules involved in gene regulation. Aberrant expression of miRNA has been associated with the development or progression of several diseases, including cancer. In a previous study, we found that the expression of miRNA-125b (miR-125b) was two-fold lower in malignant melanoma producing lymph node micrometastases than in nonmetastasizing tumors. To get further insight into the functional role of miR-125b, we assessed whether its overexpression or silencing affects apoptosis, proliferation, or senescence in melanoma cell lines. We showed that overexpression of miR-125b induced typical senescent cell morphology, including increased cytoplasmatic/nucleus ratio and intensive cytoplasmatic β-galactosidase expression. In contrast, inhibition of miR-125b resulted in 30-35% decreased levels of spontaneous apoptosis. We propose that downregulation of miR-125b in an early cutaneous malignant melanoma can contribute to the increased metastatic capability of this tumor.

Cytotoxicity of an 125I-labelled DNA ligand

International Nuclear Information System (INIS)

Karagiannis, T.C.; Lobachevsky, P.N.; Martin, R.F.

2000-01-01

The subcellular distribution and cytotoxicity of a DNA-binding ligand [ 125 I]-Hoechst 33258 following incubation of K562 cells with the drug was investigated. The ability of a radical scavenger, dimethyl sulphoxide, to protect cells from the 125 I-decay induced cell death was also studied. Three different concentrations and specific activities of the drug were used to provide different ligand : DNA binding ratios. The results demonstrated a trend toward improved delivery of the ligand to the nucleus and to chromatin at higher ligand concentrations, with concomitant increased sensitivity to 125 I-decay induced cytotoxicity and decreased protection by dimethyl sulphoxide. This correlation of radiobiological parameters with subcellular drug distribution is consistent with the classical dogma that attributes cytotoxicity to DNA double-stranded breakage in the vicinity of the site of decay, where the high LET nature of the damage confers minimal sensitivity to radical scavenging

Keterkaitan Panhisterektomi dan Suplemen 1,25- Dihidroksivitamin D3 dengan Risiko Urolitiasis pada Tikus (CORRELATION BETWEEN PANHISTERCTOMY AND 1.25-DIHYDROXYVITAMIN D3 SUPPLEMENTATION ON RATS UROLITHIASIS RISK

Directory of Open Access Journals (Sweden)

Hartiningsih .

2013-07-01

Full Text Available The objective of this research was to study the correlation of panhisterectomy and supplement 1.25-dihydroxyvitamin D3 on urolithiasis risk in Wistar rats. Twenty female Wistar rats at 8 weeks of age, weredivided into four groups (control fed standard diet, control fed standard diet+1,25-dihydroxyvitamin D3 supplement, panhisterectomy fed standard diet and panhisterectomy fed standard diet +1,25-dihydroxyvitamin D3 supplement. Eleven weeks after treatment, each of rats was placed into individualmetabolic cage for balance study for a week. From day 4 to 11 of the balance study, every morning theremaining food, feces, and urine were collected and recorded for calcium (Ca analysis. At the end ofbalance study, blood samples were taken from canthus retroorbitalis medialis for estrogen analysis. Theresults showed urinary and fecal Ca excretions were not significantly different compared to the controlgroup. Calcium consumption was significantly higher (P<0.05 in panhisterectomized rats compared withthose in control rats. While, estrogen in panhisterectomized group was not significantly different to thosein control rats. Calcium urinary and Ca consumption in rats consuming 1,25-dihydroxyvitamin D3 supplement were significantly higher (P<0.05 compared with those in without 1,25-dihydroxyvitamin D3 supplementation, but Ca excretion in feses was not significantly different. Estrogen in rats consuming1.25-dihydroxyvitamin D3 supplement was significantly lower (P<0.05 compared with the rats that without1,25-dihydroxyvitamin D3 supplemention. It can be concluded that panhisterectomy does not seem to affecturolithiasis risk, while 1,25-dihydroxyvitamin D3 supplement may affect urolithiasis risk. There is likelyno association between panhisterectomy and 1.25-dihydroxyvitamin D3 supplementation on urolithiasisrisk in Wistar rats.

Reaction of 1-bromo-3-chloropropane with tellurium and dimethyl telluride in the system of hydrazine hydrate-alkali; Reaktsiya 1-brom-3-khlorpropana s tellurom i dimetilditelluridom v sisteme gidrazin-gidrat-shcheloch'

Energy Technology Data Exchange (ETDEWEB)

Russavskaya, N V; Levanova, E P; Sukhomazova, Eh N; Grabel' nykh, V A; Elaev, A V; Klyba, L V; Zhanchipova, E R; Albanov, A I; Korotaeva, I M; Toryashinova, D S.D.; Korchevin, N A [SO RAN, Irkutskij Inst. Khimii imeni A.E. Favorskogo, Irkutsk (Russian Federation)

2006-05-15

A synthesis of oligomeric substance of thiocol type, the poly(trimethyleneditelluride), from 1-bromo-3-chloropropane and elemental tellurium is performed using a hydrazine hydrate-alkali system. Reductive splitting of the tellurocol followed by alkylation with methyl iodide give rise to preparation of bis(methyltelluro)propane, which was synthesized also from dimethyl telluride and 1,3-dihalopropanes using the N{sub 2}H{sub 4}{center_dot}H{sub 2}O/KOH system. The reaction products were characterized by elementary analysis, NMR, and IR spectra. Mass spectra of the synthesized low molecular weight organotellurium compounds are considered.

NH125 kills methicillin-resistant Staphylococcus aureus persisters by lipid bilayer disruption.

Science.gov (United States)

Kim, Wooseong; Fricke, Nico; Conery, Annie L; Fuchs, Beth Burgwyn; Rajamuthiah, Rajmohan; Jayamani, Elamparithi; Vlahovska, Petia M; Ausubel, Frederick M; Mylonakis, Eleftherios

2016-01-01

NH125, a known WalK inhibitor kills MRSA persisters. However, its precise mode of action is still unknown. The mode of action of NH125 was investigated by comparing its spectrum of antimicrobial activity and its effects on membrane permeability and giant unilamellar vesicles (GUVs) with walrycin B, a WalR inhibitor and benzyldimethylhexadecylammonium chloride (16-BAC), a cationic surfactant. NH125 killed persister cells of a variety of Staphylococcus aureus strains. Similar to 16-BAC, NH125 killed MRSA persisters by inducing rapid membrane permeabilization and caused the rupture of GUVs, whereas walrycin B did not kill MRSA persisters or induce membrane permeabilization and did not affect GUVs. NH125 kills MRSA persisters by interacting with and disrupting membranes in a detergent-like manner.

Study on agroecology contamination from 125I gas and control measures in a simulated ecosystem

International Nuclear Information System (INIS)

Zhao Wenhu; Li Chuanzhao; Xu Shiming; Hou Lanxin; Shang Zhaorong; Li Xia

1995-09-01

The study was made in an air-tight space in which a simulated agricultural ecosystem was contaminated from 125 I gas. The contents of the study were summarized as follows: The space and time distribution of 125 I gas, contamination of foliage of the plants, accumulation and transfer of 125 I fallen on the soil and entered into the plants from the roots of crops and vegetables, the time distribution of 125 I in crops in water contaminated from 125 I fallout, distribution, accumulation and transfer of 125 I in chickens and rabbits which inhaled 125 I gas or fed the fodder contaminated from 125 I. The control measures of contamination in agroenvironment from 125 I were discussed. (7 refs., 20 figs., 29 tabs.)

1,25-Dihydroxyvitamin D{sub 3} (1,25(OH){sub 2}D{sub 3}) Signaling Capacity and the Epithelial-Mesenchymal Transition in Non-Small Cell Lung Cancer (NSCLC): Implications for Use of 1,25(OH){sub 2}D{sub 3} in NSCLC Treatment

Energy Technology Data Exchange (ETDEWEB)

Upadhyay, Santosh Kumar; Verone, Alissa; Shoemaker, Suzanne [Department of Pharmacology and Therapeutics, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263 (United States); Qin, Maochun; Liu, Song [Department of Biostatistics and Bioinformatics, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263 (United States); Campbell, Moray; Hershberger, Pamela A., E-mail: pamela.hershberger@roswellpark.org [Department of Pharmacology and Therapeutics, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263 (United States)

2013-11-08

1,25-dihydroxyvitamin D{sub 3} (1,25(OH){sub 2}D{sub 3}) exerts anti-proliferative activity by binding to the vitamin D receptor (VDR) and regulating gene expression. We previously reported that non-small cell lung cancer (NSCLC) cells which harbor epidermal growth factor receptor (EGFR) mutations display elevated VDR expression (VDR{sup high}) and are vitamin D-sensitive. Conversely, those with K-ras mutations are VDR{sup low} and vitamin D-refractory. Because EGFR mutations are found predominately in NSCLC cells with an epithelial phenotype and K-ras mutations are more common in cells with a mesenchymal phenotype, we investigated the relationship between vitamin D signaling capacity and the epithelial mesenchymal transition (EMT). Using NSCLC cell lines and publically available lung cancer cell line microarray data, we identified a relationship between VDR expression, 1,25(OH){sub 2}D{sub 3} sensitivity, and EMT phenotype. Further, we discovered that 1,25(OH){sub 2}D{sub 3} induces E-cadherin and decreases EMT-related molecules SNAIL, ZEB1, and vimentin in NSCLC cells. 1,25(OH){sub 2}D{sub 3}-mediated changes in gene expression are associated with a significant decrease in cell migration and maintenance of epithelial morphology. These data indicate that 1,25(OH){sub 2}D{sub 3} opposes EMT in NSCLC cells. Because EMT is associated with increased migration, invasion, and chemoresistance, our data imply that 1,25(OH){sub 2}D{sub 3} may prevent lung cancer progression in a molecularly defined subset of NSCLC patients.

Comparative study on biodistribution of domestic and imported 125I-β-CIT

International Nuclear Information System (INIS)

Liu Xingdang; Lin Xiangtong; Fang Ping; Chen Zhengping; Zhou Xiang; Wang Bocheng; Zhang Manda

2003-01-01

Objective: To characterize the kinetics and biodistribution of a domestically synthesized 125 I-2β-carbomethoxy-3β-4-iodopheny1tropane (β-CIT ) and to compare it with that of 125 I-β-CIT imported from RBI company. Methods: 1)The biodistribution of domestic and RBI company produced 125 I-β-CIT in KM mice. Twenty groups of mice (group of 5) were injected into the tail vein with either one of 125 I-β-CIT products. Each group of both products was killed at 5,15,30 and 45 min, and 1, 2, 4, 6, 8 and 24 h. 2)Autoradiography was performed on the brain of SD rats at 2 h after injection. Results: Domestic 125 I-β-CIT was primarily uptaked in the striatum, also in areas rich in 5-HTT such as the brain stem, frontal cortex, parietal cortex, temporal cortex, occipital cortex and hippocampus. Striatal uptake peaked at 2 h postinjection of 125 I-β-CIT. The ratio of specific to nonspecific binding in striatum peaked at 6 h. The highest radioactivity was in the lungs and the less radioactivity was in the liver, kidney, spleen and intestine. Autoradiography confirmed that 125 I-β-CIT primarily bound to striatum and lower room temperature significantly reduced the binding of the agent. Conclusion: The domestic 125 I-β-CIT binds primarily to dopamine transporters in the striatum in mice and rats and the maximum uptake is in the lungs

Acousto-optic control of internal acoustic reflection in tellurium dioxide crystal in case of strong elastic energy walkoff [Invited].

Science.gov (United States)

Voloshinov, Vitaly; Polikarpova, Nataliya; Ivanova, Polina; Khorkin, Vladimir

2018-04-01

Peculiar cases of acoustic wave propagation and reflection may be observed in strongly anisotropic acousto-optical crystals. A tellurium dioxide crystal serves as a prime example of such media, since it possesses record indexes of acoustic anisotropy. We studied one of the unusual scenarios of acoustic incidence and reflection from a free crystal-vacuum boundary in paratellurite. The directions of the acoustic waves in the (001) plane of the crystal were determined, and their basic characteristics were calculated. The carried-out acousto-optic experiment at the wavelength of light 532 nm and the acoustic frequency 73 MHz confirmed the theoretical predictions. The effects examined in the paper include the acoustic wave propagation with the record walkoff angle 74°. We also observed the incidence of the wave on the boundary at the angle exceeding 90°. Finally, we registered the close-to-back reflection of acoustic energy following the incidence. One of the stunning aspects is the distribution of energy between the incident and the back-reflected wave. The unusual features of the acoustic wave reflections pointed out in the paper are valuable for their possible applications in acousto-optic devices.

Exploration of dopamine transporter and D2 receptors in morphine dependent rats through 125I-β-CTT, 125I-IBZM cerebral autoradiography and the biodistribution study

International Nuclear Information System (INIS)

Lin Yansong; Fang Ping; Ding Shiyu; Chen Zhengping; Zhou Xiang; Hu Mingyang; Wang Bocheng; Zhang Manda; Wang Shizhen

2001-01-01

Objective: To explore the variation of cerebral dopamine (DA) transmitting system in morphine dependent (MD) rats using dopamine transporter (DAT) and D 2 receptors imaging agent. Methods: MD model rats were established by using a two-compartment (C1 and C2-morphine conditioned compartment) apparatus for assessing morphine conditioned place preferences in rats. 125 I-2β-carbomethoxy-3β-(4-iodophenyl) tropane ( 125 I-β-CIT) and 125 I-3-iodo-2-hydroxy-6-methoxy-N[(1-ethyl-2-pyrrolidinyl) methyl] benzamide ( 125 I-IBZM) cerebral DAT and D 2 receptor autoradiography and biodistribution study were used to evaluate the variation of DAT and D 2 receptors in morphine dependent rats. Results: The mean time of MD rats entering from C1 to C2 was (0.84 +- 0.50) min after 6 days' conditioned place preference training, shorter than that of the control group [(2.40 +- 1.10) min, P 125 I-β-CIT uptake ratio of striatum (ST)/cerebellum (CB) and nucleus acumens (NAC)/CB in MD group were 4.76 +- 0.92 and 2.72 +- 0.96, significantly lower than that of control group (5.92 +- 0.67 and 4.16 +- 0.56, P 125 I-IBZM uptake ratio in MD group were 4.11 +- 0.56 and 2.64 +- 0.25, lower than that in control group (5.43 +- 0.74 and 3.49 +- 0.65, P 125 I-β-CIT, 125 I-IBZM biodistribution study also showed that the DAT and D 2 binding sites were reduced in ST of MD group by (21.68 +- 11.11)% and (18.69 +- 9.97)% comparing to the controls, respectively. Conclusions: The DAT and D 2 receptors in both ST and NAC were all involved and reduced to some extent in morphine dependent model rats, the DAT and D 2 receptor imaging agent could reflect the variation of DAT and D 2 receptors, this would afford the theoretical basis for D 2 receptors and DAT imaging in study on preventing drug addiction and on its abstinence

(125I)Iodoazidococaine, a photoaffinity label for the haloperidol-sensitive sigma receptor

International Nuclear Information System (INIS)

Kahoun, J.R.; Ruoho, A.E.

1992-01-01

A carrier-free radioiodinated cocaine photoaffinity label, (-)-3-( 125 I)iodo-4-azidococaine [( 125 I)IACoc], has been synthesized and used as a probe for cocaine-binding proteins. Photoaffinity labeling with 0.5 nM ( 125 I)IACoc resulted in selective derivatization of a 26-kDa polypeptide with the pharmacology of a sigma receptor in membranes derived from whole rat brain, rat liver, and human placenta. ( 125 I)IACoc labeling of the 26-kDa polypeptide was also inhibited by 10 μM imipramine, amitriptyline, fluoxetine, benztropine, and tetrabenazine. The size of the ( 125 I)I-ACoc-labeled proteins is consistent with the size of proteins photolabeled in guinea pig brain and liver membranes by using the sigma photolabel azido-[ 3 H]DTG. Kinetic analysis of ( 125 I)IACoc binding to rat liver microsomes revealed two sites with K d values of 19 and 126 pM, respectively. The presence or absence of proteolytic inhibitors during membrane preparation did not alter the size of the photolabeled sigma receptor, indicating that the 26-kDa polypeptide was not derived from a larger protein. In summary, ( 125 I)IACoc is a potent and highly specific photoaffinity label for the haloperidol-sensitive sigma receptor and will be useful for its biochemical and molecular characterization

Iodine-125-labelled tamoxifen is differentially cytoxic to cells containing oestrogen receptors

International Nuclear Information System (INIS)

Bloomer, W.D.; McLaughlin, W.H.; Weichselbaum, R.R.

1980-01-01

Tamoxifen, a non-steroidal anti-oestrogen competes with 17 - oestradiol for oestrogen receptor protein and is translocated to the nucleus. Carrier-free 125 I-TAM was tested for cytotoxicity in oestrogen receptor rich (human breast cancer MCF-7) and poor (V-79 Chinese hamster) cells. 125 I-TAM was differentially cytotoxic to MCF-7 cells. The D 37 values for MCF-7 and V-79 cells were 0.5 and 1.5 pCi/cell respectively. No radiotoxicity was observed with Na 125 I at doses equal to 125 I-TAM; iodide was effectively excluded from both cell lines and remained in the extracellular space. Also, nonradioactive 127 I-TAM and TAM were both non-toxic when tested at levels comparable to 125 I-TAM. It is suggested that the marked cytotoxicity in MCF-7 cells results from close approximation of 125 I with the genetic apparatus as a result of direct charging of specific nuclear receptors and/or translocation of 125 I-TAM receptor complexes from the cytoplasm to the nucleus, and that the minimal toxicity in V-79 cells reflects transmitted cytoplasmic radiation effects, limited direct nuclear charging and/or limited nuclear translocation resulting from the relative paucity of oestrogen in the cells. (U.K.)

40 CFR 52.125 - Control strategy and regulations: Sulfur oxides.

Science.gov (United States)

2010-07-01

... to existing fuel burning equipment producing electrical energy will provide for the attainment and...: Sulfur oxides. 52.125 Section 52.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... since the control strategy does not analyze the impact of smelter fugitive emissions on ambient air...

Acute exposure to Iodine-125: a case study

Energy Technology Data Exchange (ETDEWEB)

Kol, R; Canfi, A; Dukhan, N; Pelled, O; Brikner, D; Laichter, Y; Gold, B [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev

1996-12-01

Radioiodines I-125 and I-131 are extremely volatile even in the form of the relatively stable Iodine anion. This property renders frequent airborne contamination and sometimes accidental inhalation of the radioiodine by personnel heavily involved with it`s handling. In order to detect radioiodine contamination as early as possible, the laboratory and its surroundings are constantly air monitored, surfaces are monitored according to a predetermined regime and personnel is being checked upon completion of a job or upon leaving the laboratory. Follow-up, routine or in special occasions, is performed by health-physics personnel who reports to the radiation medicine department. We report here the measures and means used to monitor a case of an accidental inhalation of I-125 due to an externally contaminated NaI[I-125] commercial package. The monitoring of the contamination is described, the dose to the thyroid and the Committed Effective Dose Equivalent (CEDE) are reported, and the medical evaluation is presented (authors).

A Nanoparticle-Lectin Immunoassay Improves Discrimination of Serum CA125 from Malignant and Benign Sources.

Science.gov (United States)

Gidwani, Kamlesh; Huhtinen, Kaisa; Kekki, Henna; van Vliet, Sandra; Hynninen, Johanna; Koivuviita, Niina; Perheentupa, Antti; Poutanen, Matti; Auranen, Annika; Grenman, Seija; Lamminmäki, Urpo; Carpen, Olli; van Kooyk, Yvette; Pettersson, Kim

2016-10-01

Measurement of serum cancer antigen 125 (CA125) is the standard approach for epithelial ovarian cancer (EOC) diagnostics and follow-up. However, the clinical specificity is not optimal because increased values are also detected in healthy controls and in benign diseases. CA125 is known to be differentially glycosylated in EOC, potentially offering a way to construct CA125 assays with improved cancer specificity. Our goal was to identify carbohydrate-reactive lectins for discriminating between CA125 originating from EOC and noncancerous sources. CA125 from the OVCAR-3 cancer cell line, placental homogenate, and ascites fluid from patients with cirrhosis were captured on anti-CA125 antibody immobilized on microtitration wells. A panel of lectins, each coated onto fluorescent europium-chelate-doped 97-nm nanoparticles (Eu(+3)-NPs), was tested for detection of the immobilized CA125. Serum samples from high-grade serous EOC or patients with endometriosis and healthy controls were analyzed. By using macrophage galactose-type lectin (MGL)-coated Eu(+3)-NPs, an analytically sensitive CA125 assay (CA125(MGL)) was achieved that specifically recognized the CA125 isoform produced by EOC, whereas the recognition of CA125 from nonmalignant conditions was reduced. Serum CA125(MGL) measurement better discriminated patients with EOC from endometriosis compared to conventional immunoassay. The discrimination was particularly improved for marginally increased CA125 values and for earlier detection of EOC progression. The new CA125(MGL) assay concept could help reduce the false-positive rates of conventional CA125 immunoassays. The improved analytical specificity of this test approach is dependent on a discriminating lectin immobilized in large numbers on Eu(+3)-NPs, providing both an avidity effect and signal amplification. © 2016 American Association for Clinical Chemistry.

A laser system for the spectroscopy on highly charged ions, tellurium molecules, and Rydberg states of rubidium atoms; Ein Lasersystem zur Spektroskopie von hochgeladenen Ionen, Tellurmolekuelen und Rubidium-Rydberg-Zustaenden

Energy Technology Data Exchange (ETDEWEB)

Albrecht, Sebastian

2014-08-15

Optical measuring methods allow the detection and identification of the atomic structure with extraordinary precision. Deviations to theoretical predictions can indicate unknown physical effects. Therefore, precise measurements on the atomic structure continue to be of large relevance. In this work, a laser system for precision spectroscopy on Bismuth ({sup 209}Bi{sup 82+}), Tellurium ({sup 130}Te{sub 2}) and Rydberg states of Rubidium ({sup 85}Rb) has been built and characterized. Spectroscopic measurements on Tellurium and Rubidium have been achieved with this setup. The system consists of a two-stage frequency doubled diode laser, stabilized via a cavity and an RF-offsetlock to arbitrary wavelengths with absolute high stability. The setup of the laser system will be presented and the systematic error caused by the refractive index of air inside the transfer cavity will be discussed. A stability of better then 6.14 MHz at 244 nm is obtained for planned experiments on the ground state hyperfine splitting of {sup 209}Bi{sup 82+}. This will allow an increase in precision of more then four orders of magnitude for this measurement. Further increase in precision can be achieved by using an evacuated cavity. The obtained stability is measured by comparison of the laser frequency to absorption lines of Tellurium ({sup 130}Te{sub 2}). Eight reference lines, known from literature, spanning the region from 613720.717 GHz to 616803.545 GHz have been measured. The frequency measurements of three lines, coinciding with the emission spectrum of an argon-ion-laser, show deviations with respect to the published frequencies. Further inconsistencies in literature are cleared. Part of this work is also the precise measurement of 843 Doppler-free {sup 130}Te{sub 2} reference lines spanning the frequency range from 613881.150 GHz to 616614.258 GHz at a precision of better then 4 MHz for most lines. Additionally, measurements on electromagnetically induced transparency (EIT) using

Experimental study on the killing effects of 125IUdR to human glioma cells in vitro

International Nuclear Information System (INIS)

Li Jinquan; Bao Yaodong; Zhou Dai; Cui Gang; Wang Bocheng; Jiang Yimin; Wang Haiqiu; Wu Yiwei

2001-01-01

The 125 IUdR-uptake profile and the cytocidal effects of 125 IUdR on human cerebral glioma (SHG44) cells were estimated after incubation with 125 IUdR. The killing effects of 125 IUdR comparing with Na 125 I on SHG44 were estimated by colony forming method. The results showed that the amounts of 125 IUdR uptake by SHG44 were growing with the rate of dose of 125 IUdR in the medium, relation factor r = 0.9917. Also the concentration of 125 IUdR uptake by SHG44 was time-dependent, relation factor r = 0.9859. As the concentration in SHG44 growing, the inhibition effects became stronger, relation factor r = - 0.9736. The LD 50 was 8.7 +- 0.12 kBq/ml. The concentration of radioactivity ingestion was significantly stronger in 125 IUdR group than that in Na 125 I group. The surviving fraction was significantly different between in the 125 IUdR group and in Na 125 I group at the concentration point 9.0 kBq/ml. 125 IUdR may be incorporated in SHG44 cell, and the concentration of 125 IUdR ingestion by SHG44 was influenced with the dose in the medium and the culturing time. The prohibitive effects of 125 IUdR on SHG44 cell were obvious. The prohibition effects were significantly stronger in 125 IUdR group than that in Na 125 I group. 125 IUdR may be a kind of potential drug in the therapy of human cerebral glioma

Permanent interstitial implantation of 125Iodine seed for thoracic malignant tumors

International Nuclear Information System (INIS)

Xu Zhongheng; Qian Yongyue; Wu Jinchang; Liu Zengli

2002-01-01

Objective: To observe effect of 125 Iodine sed on interstitial brachytherapy of patient with thoracic malignant tumor. Methods: 125 Iodine seed were inserted into the target tissue and permanent left there for brachytherapy in 6 cases of thoracic malignant tumors, which including lung cancer, Pancoast's tumour, mediastinal malignant schwannoma. Results: All cases were rehabilitated shortly after operation. The implanted lesions remained controlled now and in dead patients. No radiation-related and 125 Iodine seed-related complications occurred. Conclusion: Brachytherapy by implantation of 125 Iodine seeds of remained tumor tissue in patients with thoracic malignant tumor after operation has a satisfactory outcome. This therapy can control local recurrent of thoracic malignant tumor. But the results in long term should be studied further

Development of thyroid monitoring system for the measurement of 125I

International Nuclear Information System (INIS)

Sankhla, Rajesh; Singh, I.S.; Rao, D.D.; Pradeepkumar, K.S.

2015-01-01

Iodine-125 has gained wide acceptance in medical science for diagnosis and therapeutic applications. A considerable number of radiation workers of BARC and BRIT are involved in the production of 125 I and preparation of radio immunoassay (RIA) kits to meet medical requirement of the country. A state of the art Thyroid Monitoring System incorporated with 51 mm diameter x 3 mm thick NaI(Tl) detector is developed for in-vivo monitoring of 125 I in radiation workers handling this radioisotope. The developed system also has provision to accommodate variable body sizes (child to adult). This paper presents the different aspects of the system and its calibration using IAEA neck phantom for estimation of thyroidal content of 125 I. (author)

miR-125b induces cellular senescence in malignant melanoma

DEFF Research Database (Denmark)

Nyholm, Anne Marie; Lerche, Catharina M; Manfé, Valentina

2014-01-01

transfected melanoma cell line Mel-Juso and then investigated the effect of the presence of a stable overexpression of miR-125b on growth by western blotting, flow cytometry and β-galactosidase staining. The tumourogenicity of the transfected cells was tested using a murine model and the tumours were further...... examined with in-situ-hybridization. RESULTS: In primary human tumours and in lymph node metastases increased expression of miR-125b was found in single, large tumour cells with abundant cytoplasm. A stable overexpression of miR-125b in human melanoma cell line Mel-Juso resulted in a G0/G1 cell cycle block...... and emergence of large cells expressing senescence markers: senescence-associated beta-galactosidase, p21, p27 and p53. Mel-Juso cells overexpressing miR-125b were tumourigenic in mice, but the tumours exhibited higher level of cell senescence and decreased expression of proliferation markers, cyclin D1 and Ki...

Occupational exposure in prostate permanent implants with I-125 seeds

Energy Technology Data Exchange (ETDEWEB)

Fdez Garcia, J.; Luna, V.; Sancho, J. M. g.; Martinez, J.; Galiano, P. S.; Jimenez, I.; Prada, P.; Juan, G.; Vivanco, J.

2002-07-01

Prostate brachytherapy is one of the techniques increasing faster in the environment of the radiotherapy and will probably go on increasing in the future. There are two forms in their use; by means of remote afterloading high dose rate (HDR) with Ir-192 radioactive sources or by means of permanent implant by manual/automatic afterloading of low dose rate (LDR) with seeds of I-125 or Pd-103. Iodine-125 has a half life of 59.4 days and it decays by electron capture with emissions of characteristic photons and electrons. The electrons are absorbed by the titanium wall of the I-125 seed. The principal photon emissions are 27.4 and 31.4 keV X-rays and a 35.5 keV gamma ray. Besides 22.1 and 25.2 keV fluorescent X-rays are also emitted resulting from interactions of the iodine-125 photons with the silver rod. The resulting average photon energy is approximately 27.4 keV. (Author)

Extremely Elevated CA 125 and CA 19-9 in Endometrioma; A Case Series

Directory of Open Access Journals (Sweden)

Vugar Bayramov

2010-03-01

Full Text Available Although endometriosis is a benign condition, increased levels of the tumor markers CA 125 and CA 19-9 may be seen. However, these tumor markers reach to very high levels, rarely. In this report, 4 patients between 20 and 43 year-old with extremely elevated CA 125, CA 19-9 and CA 15-3 levels are discussed. In endometriosis extremely increased tumor markers are determined in the case of ruptured endometrioma cyst. There are two mechanisms to clarify extremely elevated levels of CA 125 in endometriosis. First, the peritoneal irritation of CA 125 molecule after the rupture of endometioma cyst and CA 125 secretion from the periton. And the second is penetration of the CA 125 moecule easily to the circulation through the peritoneal endothelial surface after the cyst rupture. In conclusion, the diagnosis of ruptured endometrioma cyst should be kept in mind especially in young patients with extremely elevated serum CA 125 levels with regard to the history and ultrasonographical signs and invasive procedures should be avoided.

125I-iomazenil-benzodiazepine receptor binding during psychological stress in rats

International Nuclear Information System (INIS)

Fukumitsu, Nobuyoshi; Tsuchida, Daisuke; Ogi, Shigeyuki; Uchiyama, Mayuki; Mori, Yutaka

2002-01-01

We investigated the changes in 125 I-iomazenil ( 125 I-IMZ) benzodiazepine receptor (BZR) binding with psychological stress in a rat model. Six male Wistar rats were placed under psychological stress for 1 hour by using a communication box. No physical stress was not received. 1.85 MBq of 125 I-IMZ was injected into the lateral tail vein and the rat was killed 3 hours later. Twenty-micormeter-thick sections of the brain were collected and % injected dose per body weight (% ID/BW) of eleven regions (frontal, parietal, temporal, occipital cortices, caudate putamen, accumubens nuclei, globus pallidus, amygdala, thalamus, hippocampus and hypothalamus) were calculated by autoradiography. The %ID/BW of rats which were placed under psychological stress was compared with that of 6 control rats. The %ID/BW of rats which were placed under psychological stress diffusely tended to show a reduction in 125 I-IMZ-BZR binding. A significant decrease in BZR binding was observed in the hippocampus of the rats which were placed under psychological stress. 125 I-IMZ-BZR binding tended to decrease throughout the brain. (author)

Radioimmunoassay of salivary cyclosporine with use of 125I-labeled cyclosporine

International Nuclear Information System (INIS)

Coates, J.E.; Lam, S.F.; McGaw, W.T.

1988-01-01

We prepared 125 I-labeled cyclosporine ( 125 I-CS) by modifying the procedure of Mahoney and Orf and characterized it with regards to maximal immunoreactivity (greater than 90%), trichloroacetic acid precipitability (greater than 90%), and stability (90% immunoreactive after five half-lives of 125 I). For a particular preparation of 125 I-CS, we estimated its immunoreaction concentration (50 pmol/L) and the equilibrium constant for its reaction with Sandoz polyclonal antiserum (K = 3.9 X 10(9) L/mol). By substituting 125 I-CS as tracer in the Sandoz radioimmunoassay and by modifying other aspects of the assay, we developed a procedure that is sufficiently sensitive (0.34 micrograms/L) to allow measurement of trough (lowest inter-dose) cyclosporine concentrations in parotid saliva. Of 38 kidney-transplant patients, 35 had measurable concentrations in saliva (mean 8.3, SD 5.2 micrograms/L), and these correlated moderately with paired serum concentrations (r = 0.68, P less than 0.001). We believe that measurement of salivary cyclosporine may offer a simple way of estimating the free fraction of the drug in serum or plasma

Raman scattering boson peak and differential scanning calorimetry studies of the glass transition in tellurium-zinc oxide glasses.

Science.gov (United States)

Stavrou, E; Tsiantos, C; Tsopouridou, R D; Kripotou, S; Kontos, A G; Raptis, C; Capoen, B; Bouazaoui, M; Turrell, S; Khatir, S

2010-05-19

Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out on four mixed tellurium-zinc oxide (TeO(2))(1 - x)(ZnO)(x) (x = 0.1, 0.2, 0.3, 0.4) glasses under variable temperature, with particular attention being given to the respective glass transition region. From the DSC measurements, the glass transition temperature T(g) has been determined for each glass, showing a monotonous decrease of T(g) with increasing ZnO content. The Raman study is focused on the low-frequency band of the glasses, the so-called boson peak (BP), whose frequency undergoes an abrupt decrease at a temperature T(d) very close to the respective T(g) values obtained by DSC. These results show that the BP is highly sensitive to dynamical effects over the glass transition and provides a means for an equally reliable (to DSC) determination of T(g) in tellurite glasses and other network glasses. The discontinuous temperature dependence of the BP frequency at the glass transition, along with the absence of such a behaviour by the high-frequency Raman bands (due to local atomic vibrations), indicates that marked changes of the medium range order (MRO) occur at T(g) and confirms the correlation between the BP and the MRO of glasses.

Raman scattering boson peak and differential scanning calorimetry studies of the glass transition in tellurium-zinc oxide glasses

International Nuclear Information System (INIS)

Stavrou, E; Tsiantos, C; Tsopouridou, R D; Kripotou, S; Kontos, A G; Raptis, C; Capoen, B; Bouazaoui, M; Turrell, S; Khatir, S

2010-01-01

Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out on four mixed tellurium-zinc oxide (TeO 2 ) 1-x (ZnO) x (x = 0.1, 0.2, 0.3, 0.4) glasses under variable temperature, with particular attention being given to the respective glass transition region. From the DSC measurements, the glass transition temperature T g has been determined for each glass, showing a monotonous decrease of T g with increasing ZnO content. The Raman study is focused on the low-frequency band of the glasses, the so-called boson peak (BP), whose frequency undergoes an abrupt decrease at a temperature T d very close to the respective T g values obtained by DSC. These results show that the BP is highly sensitive to dynamical effects over the glass transition and provides a means for an equally reliable (to DSC) determination of T g in tellurite glasses and other network glasses. The discontinuous temperature dependence of the BP frequency at the glass transition, along with the absence of such a behaviour by the high-frequency Raman bands (due to local atomic vibrations), indicates that marked changes of the medium range order (MRO) occur at T g and confirms the correlation between the BP and the MRO of glasses.

CA-125 AUC as a predictor for epithelial ovarian cancer relapse.

Science.gov (United States)

Mano, António; Falcão, Amílcar; Godinho, Isabel; Santos, Jorge; Leitão, Fátima; de Oliveira, Carlos; Caramona, Margarida

2008-01-01

The aim of the present work was to evaluate the usefulness of CA-125 normalized in time area under the curve (CA-125 AUC) to signalise epithelial ovarian cancer relapse. Data from a hundred and eleven patients were submitted to two different approaches based on CA-125 AUC increase values to predict patient relapse. In Criterion A total CA-125 AUC normalized in time value (AUC(i)) was compared with the immediately previous one (AUC(i-1)) using the formulae AUC(i) > or = F * AUC(i-1) (several F values were tested) to find the appropriate close related increment associated to patient relapse. In Criterion B total CA-125 AUC normalised in time was calculated and several cut-off values were correlated with patient relapse prediction capacity. In Criterion A the best accuracy was achieved with a factor (F) of 1.25 (increment of 25% from the previous status), while in Criterion B the best accuracies were achieved with cut-offs of 25, 50, 75 and 100 IU/mL. The mean lead time to relapse achieved with Criterion A was 181 days, while with Criterion B they were, respectively, 131, 111, 63 and 11 days. Based on our results we believe that conjugation and sequential application of both criteria in patient relapse detection should be highly advisable. CA-125 AUC rapid burst in asymptomatic patients should be firstly evaluated using Criterion A with a high accuracy (0.85) and with a substantial mean lead time to relapse (181 days). If a negative answer was obtained then Criterion B should performed to confirm the absence of relapse.

7 CFR 1260.125 - Industry information.

Science.gov (United States)

2010-01-01

... Promotion and Research Order Definitions § 1260.125 Industry information. Industry information means information and programs that will lead to the development of new markets, marketing strategies, increased... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING...

Serum tumor marker CA 125 for monitoring ovarian cancer during follow-up

DEFF Research Database (Denmark)

Tuxen, Malgorzata K.; Sölétormos, G; Dombernowsky, P

2002-01-01

CA 125 is currently widely applied in the management of patients with ovarian cancer. However, a change in results of CA 125, which should be considered significant, has not been defined. The aim of this study was to investigate the ability of CA 125 to signal progressive ovarian cancer during fo...... utility of serological tumor markers in patients with ovarian cancer....

Synthesis of [125I]iodoDPA-713: A new probe for imaging inflammation

International Nuclear Information System (INIS)

Wang, Haofan; Pullambhatla, Mrudula; Guilarte, Tomas R.; Mease, Ronnie C.; Pomper, Martin G.

2009-01-01

[ 125 I]IodoDPA-713 [ 125 I]1, which targets the translocator protein (TSPO, 18 kDa), was synthesized in seven steps from methyl-4-methoxybenzoate as a tool for quantification of inflammation in preclinical models. Preliminary in vitro autoradiography and in vivo small animal imaging were performed using [ 125 I]1 in a neurotoxicant-treated rat and in a murine model of lung inflammation, respectively. The radiochemical yield of [ 125 I]1 was 44 ± 6% with a specific radioactivity of 51.8 GBq/μmol (1400 mCi/μmol) and >99% radiochemical purity. Preliminary studies showed that [ 125 I]1 demonstrated increased specific binding to TSPO in a neurotoxicant-treated rat and increased radiopharmaceutical uptake in the lungs of an experimental inflammation model of lung inflammation. Compound [ 125 I]1 is a new, convenient probe for preclinical studies of TSPO activity.

1,25-Dihydroxyvitamin-D3 Induces Avian β-Defensin Gene Expression in Chickens.

Directory of Open Access Journals (Sweden)

Long Zhang

Full Text Available Host defense peptides (HDPs play a critical role in innate immunity. Specific modulation of endogenous HDP synthesis by dietary compounds has been regarded as a novel approach to boost immunity and disease resistance in animal production. 1,25-dihydroxy vitamin D3 (1,25D3 is well known as a powerful HDP inducer in humans, but limited information about the effect of 1,25D3 on HDPs in poultry is available. Here, we sought to examine whether 1,25D3 could stimulate avian β-defensin (AvBD expression in chickens. We used chicken embryo intestinal epithelial cells (CEIEPCs and peripheral blood mononuclear cells (PBMCs to study the effect of 1,25D3 on the expression of AvBDs. We observed that 1,25D3 is able to up-regulate the expression of several AvBDs in CEIEPCs and PBMCs, whereas it increased the amounts of AvBD4 mRNA in CEIEPCs only in the presence of lipopolysaccharide (LPS. On the other hand, LPS treatment not only inhibited the expression of CYP24A1 but also altered the expression pattern of VDR in CEIEPCs. Furthermore, AvBDs were not directly regulated by 1,25D3, as cycloheximide completely blocked 1,25D3-induced expression of AvBDs. Our observations suggest that 1,25D3 is capable of inducing AvBD gene expression and is a potential antibiotic alternative through augmentation of host innate immunity as well as disease control in chickens.

Fate of thymic radioactivity after local labeling with 125Iododeoxyuridine

International Nuclear Information System (INIS)

Laissue, J.A.; Chanana, A.D.; Cottier, H.; Cronkite, E.P.; Joel, D.D.

1976-01-01

The thymic cortex was locally labeled with 125 Iododeoxyuridine ( 125 IUdR) in young adult mice in an attempt to provide a simple quantitative assessment of the fate of cortical thymocytes. Similarly operated and nonoperated mice given 125 IUdR intravenously were used for comparison. Analogous experiments were performed in adrenalectomized animals. More than 90 percent of thymic activity present 1 day after labeling had been lost by day 8. That proportion of radioactivity contributed to a given organ by accumulation of labeled thymic migrants was estimated by comparison of values obtained after local labeling with those acquired after systemic labeling. Thymic cell accumulation was apparent in the intestine, spleen, mesenteric lymph node, and femurs of locally labeled mice; however, only a few percent of the total activity lost from the thymus was accounted for in these lymphoid organs. The pattern of fecal and urinary elimination of 125 I did not markedly differ in the various experimental groups, the bulk of the activity being recovered in the urine. The intestine could not be ruled out as a major site of thymocyte loss. Since significant radiation or pharmacologic toxicity was unlikely with the doses of 125 IUdR used, the data indicated that the vast majority of newly formed thymocytes dies after a short life and only a small fraction of thymic migrants is longer lived

Correlation of CA-125 serum level and clinico-pathological characteristic of patients with endometriosis.

Science.gov (United States)

Karimi-Zarchi, Mojgan; Dehshiri-Zadeh, Najmeh; Sekhavat, Leili; Nosouhi, Fahime

2016-11-01

Cancer antigen 125 (CA-125) is a glycoprotein biomarker that is used in women with pelvic masses such as endometriosis and maybe is useful in practice of patients suspicious to endometriosis. The aim of this study was to evaluate the association between preoperative serum CA-125 levels and clinic pathological characteristic in women with endometriosis, and find out the best serum CA-125 levels cut-off in pre and post menopause women. Serum CA-125 levels in 87 women aged 21-54 years suspected to endometriosis with pelvic pain, dysmenorrhea, or dyspareunia were measured preoperatively. Also the association between clinic pathological characteristic and serum CA-125 level were analyzed. The mean age of women was 32.22±6.91. The mean serum CA-125 level was 49.93±4.30 U/mL. There was a significant correlation between the endometriosis stage, lesion size, adhesion score and preoperative CA-125 plasma concentration. However, we did not found significant differences in age, marital status, patient's complaints, and pelvic pain associated to Ca125 serum level. The suggested preoperative serum cut-off levels in premenopausal and postmenopausal patients were 37 U/ml and 35 U/ml, respectively. According to the results, preoperative serum CA-125 is an important predictor for patients with endometriosis and it should be taken into consideration when surgical management is suspected, especially if stage of disease, lesion size and adhesion score are undertaken.

Closure certification report: TA-35 TSL-125 surface impoundment

International Nuclear Information System (INIS)

1991-01-01

This closure report documents closure activities for the TA-35 TSL-125 surface impoundment and associated structures at Los Alamos National Laboratory (the Laboratory). Prior to formal approval of the closure plan, the decision was made to proceed with closure activities to prevent any further releases from the site following informal discussions with New Mexico Environment Department (NMED) personnel. The closure plan is a revision of the previously submitted draft dated July 1988. Clean closure of the TSL-125 site was accomplished through: Removal and proper disposal of all wastes contained within the surface impoundment system; Decontamination and/or removal and proper disposal of the surface impoundment, its associated structures, and contaminated soil underlying the impoundment area; Sampling and analysis of soil to determine the presence and concentrations of any hazardous constituents remaining in the soil at the TSL-125 site; and Demonstration through a risk assessment that any constituents remaining in the soil at the TSL-125 site pose no threat to human health and the environment. All remaining soil concentrations of hazardous constituents were below health-based action levels. Analytical results indicated that benzidine, n-nitrosodimethylamine, and n-nitrosodi-n-propylamine were not detected at or above their limits of quantitation and beryllium was not present at or above its laboratory detection limit. However, the limits of quantitation and detection for these constituents were greater than their calculated health-based action levels. To demonstrate that these constituents were not present, historical data was researched and it was determined that the constituents were not utilized at the Building 125 site. 4 refs., 8 figs., 1 tab

40 CFR 1042.125 - Maintenance instructions.

Science.gov (United States)

2010-07-01

... Section 1042.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION... this section: (i) For EGR-related filters and coolers, PCV valves, and fuel injector tips (cleaning... sensors and actuators, the minimum interval is 3,000 hours: Fuel injectors, turbochargers, catalytic...

Expression of CA125 in Tissue and Serum of Uterine Serous Carcinoma Patients

Directory of Open Access Journals (Sweden)

Joseph Menczer

2015-09-01

Conclusion: The higher proportion of USC patients with positive CA125 immunohistochemical tissue staining than with elevated serum CA125 levels indicates the presence of some mechanism that prevents the access of CA125 into the circulation. [J Interdiscipl Histopathol 2015; 3(3.000: 102-104

33 CFR 149.125 - What are the requirements for the malfunction detection system?

Science.gov (United States)

2010-07-01

... malfunction detection system? 149.125 Section 149.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Pollution Prevention Equipment § 149.125 What are the requirements for the malfunction detection system? (a... Commandant (CG-5) will evaluate proposed leak-detection systems for natural gas on an individual basis. ...

Study on preparation and brain distribution of 125I-β-CIT

International Nuclear Information System (INIS)

Liu Xingdang; Lin Xiangtong

2002-01-01

Objective: To develop a relatively simpler and faster method for the routine preparation of 125 I-β-CIT and animal brain distribution of 125 I-β-CIT. Methods: Peracetic acid or Iodogen as an oxidant was used to prepare 125 I-β-CIT and comparison was made between them. The HPLC purification technique was used to identify the labeled tracer. Stability and safety of the radioiodinated β-CIT were also studied. Groups of mice (n=5) were injected i.v. into the tail vein with 125 I-β-CIT . Animals were killed at 5, 15, 30 and 45 minutes, and 1, 2, 4, 6, 8 and 24 hours. Autoradiography was performed on brains of mice at 4 hours after injection. Results: Two kinds of labeling methods using Iodogen or peracetic acid produced 125 I-β-CIT of radiochemical yields 91.10% ± 8.09%, 54.70 ± 9.81% respectively, with high radiochemical purity (RCP) 99.33% ± 0.15%, 18-25 degree C and pH 1 or 2 is the best for Iodogen preparation. The labeled product was stable for at least 23 days when kept in room temperature, and stable for at least 10 weeks when kept in -4 degree C refrigerator. The peak time of uptake of 125 I-β-CIT in striatum was at four hours after injection and the highest value was 22.93% ± 3.11% ID/g. It's highest uptake rate is 20.09 ± 2.11. Conclusions: The Iodogen preparation method is simpler and has a higher labeling yield than peracetic acid labeling method and the labeling yield is higher than which ever reported abroad. The labeled radiopharmaceutical is stable. 125 I-β-CIT showed the highest accumulation in striatum with high densities of dopamine transporters in brain

Microdosimetry of astatine-211 and comparison with that of iodine-125

International Nuclear Information System (INIS)

Unak, T.

2001-01-01

211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

40 CFR 125.61 - Existence of and compliance with applicable water quality standards.

Science.gov (United States)

2010-07-01

... applicable water quality standards. 125.61 Section 125.61 Protection of Environment ENVIRONMENTAL PROTECTION... Water Act § 125.61 Existence of and compliance with applicable water quality standards. (a) There must exist a water quality standard or standards applicable to the pollutant(s) for which a section 301(h...

Inhibition effects of {sup 125}I-triplex forming oligonucleotide to hepatoma cells

Energy Technology Data Exchange (ETDEWEB)

Zhongwei, Lv; Min, Hou; Haidong, Cai; Xueyu, Yuan; Yuehua, Yang; Shidong, Yuan [Department of Nuclear Medicine, 10th People' s Hospital, Tongji Univ., Shanghai (China); Junmin, He

2007-08-15

Objective: Triplex forming oligonucleotide (TFO) has been reported as a new antigene strategy. The purpose of this study was to observe the inhibition effects of {sup 125}I-TFO on hepatoma cells and to investigate the possibility of using {sup 125}I-TFO as an antigene radiotherapy technique for hepatocellular carcinoma (HCC) related to HBV. Methods: TFO complementary to the initiator of S gene of HBV was synthesized and labeled with {sup 125}I. HepG2.2.15 cells, in which HBV genome was integrated, were incubated with {sup 125}I-TFO, TFO and {sup 125}I respectively. After incubation, hepatitis B e antigen (HBeAg) and hepatitis B surface antigen (HBsAg) of each group were assayed with ELISA and the survival rate of cells in each group was determined with 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenylte-trazolium bromide (MTT) reduction assay. Results: {sup 125}I-TFO showed a high stability with a radiolabeling rate of >93%. The radiochemical purity of labeled compound was 90.8%, 81.1% and 73.2% respectively after 12, 48 and 72 h at 37 degree C. The peak inhibition effect of {sup 125}I-TFO on synthesizing HBsAg and HBeAg by HepG2.2.15 cells were found at 48 h after transfection, with significantly the highest inhibition rate of 45.2% for HBsAg and 74.5% for HBeAg expression among the three groups(P<0.01 ). As the transfection time prolonged its inhibition effects were stronger. Conclusion: {sup 125}I-TFO may inhibit the antigen expression of HBV and the growth of hepatocarcinoma cells, thus it may provide a new approach to develop gene-based radiotherapeutic pharmaceuticals for anti-HBV and HCC. (authors)

Prognostic value of repeated serum CA 125 measurements in first trimester pregnancy.

Science.gov (United States)

Schmidt, T; Rein, D T; Foth, D; Eibach, H W; Kurbacher, C M; Mallmann, P; Römer, T

2001-08-01

To assess the diagnostic value of maternal CA 125 in patients with symptomatic first trimester pregnancy and to evaluate the prognostic significance of CA 125 versus beta-hCG in early pregnancies with intact fetal heartbeat, complicated by vaginal bleeding. Two prospective open-label studies with longitudinal follow-up in the second trial. Academic Department of Obstetrics and Gynecology, University of Cologne. Study 1: 168 patients presenting between gestational weeks 6 and 12 with: extrauterine pregnancy, 29; missed abortion, 50; incomplete spontaneous abortion, 38; imminent abortion, 33; and normal pregnancy (no history of endometriosis or ovarian mass), 18. Study 2: Fifty consecutive patients with vaginal bleeding during gestational weeks 6-12 all of whom having demostrable fetal heartbeat. Eighteen patients finally aborted whereas the remainder had normally continuing pregnancy until term. Study 1: Single serum determinations of CA 125 and beta-hCG were correlated with the different disorders observed. Study 2: Two sequential measurements of serum CA 125 and beta-hCG performed within a 5-7 days interval were related to the outcome of pregnancy as indicated by changes of the ultrasound presentation, miscarriage, future hospitalization, or delivery. Study 1: Patients with vaginal bleeding generally had higher median CA 125 values (38 IU/ml; range 1.3-540) compared to non-bleeding patients (17.8 IU/ml; range 1.0-157). No statistically significant differences in regard to median serum CA 125 levels between symptomatic and normal pregnancies occurred: normal pregnancy, 25.5 IU/ml (range 3.2-97); ectopic pregnancy, 26 IU/ml (range 1.3-157); missed abortion, 19.1IU/ml (range 1-242); threatened abortion, 48 IU/ml (range 5.2-540); spontaneous abortion, 40 IU/ml (range 5.4-442). Study 2: Initial CA 125 levels did not differ significantly between both groups of patients with 27/32 non-aborters and 13/18 aborters showing concentrations below 65 IU/ml. After 5-7 days, CA

The role of preoperative serum cancer antigen 125 in malignant ovarian germ cell tumors

Directory of Open Access Journals (Sweden)

Ju-Hyun Kim

2018-04-01

Full Text Available Objective: To determine the role of preoperative serum cancer antigen 125 (CA 125 in malignant ovarian germ cell tumors (MOGCTs. Materials and methods: Using information from medical databases of Asan Medical Center (Seoul, Korea, we investigated 161 patients with histologically diagnosed MOGCTs and whose preoperative serum CA 125 had been checked. We determined the optimal cutoff value of CA 125 as > 249.5 U/mL in MOGCTs using a receiver operating characteristic curve. Results: The median patient age was 24 years (range, 6–52 years. The most common histologic type was immature teratoma. Most patients had stage I disease. Thirty-two patients (19.9% had elevated preoperative serum CA 125 levels over 249.5 U/mL. On univariate analysis, tumor size, advanced stage, the presence of ascites, ovarian surface involvement, and tumor rupture were significantly associated with elevated preoperative CA 125 levels (>249.5 U/mL. In the median follow-up time of 87 months (range, 9–271 months, 14 patients had a recurrence, and 5 died of the disease. Patients with an elevated serum preoperative CA 125 level (>249.5 U/mL had poorer disease-free survival, but this was not statistically significant. However, elevated preoperative CA 125 (>249.5 U/mL was significantly associated with poorer overall survival. Conclusions: Elevated preoperative serum CA 125 may have prognostic value in patients with MOGCTs. Keywords: CA-125 antigen, Ovarian germ cell cancer, Prognosis

Adjuvant iodine-125 brachytherapy for hepatocellular carcinoma after complete hepatectomy: a randomized controlled trial.

Directory of Open Access Journals (Sweden)

Kaiyun Chen

Full Text Available BACKGROUND: Tumor recurrence is a major problem after curative resection of hepatocellular carcinoma (HCC. The current study evaluated the effects of adjuvant iodine-125 ((125I brachytherapy on postoperative recurrence of HCC. METHODOLOGY/PRINCIPAL FINDINGS: From July 2000 to June 2004, 68 HCC patients undergoing curative hepatectomy were randomly assigned into a (125I adjuvant brachytherapy group (n = 34 and a group of best care (n = 34. Patients in the (125I adjuvant brachytherapy group received (125I seed implantation on the raw surface of resection. Patients in the best care control group received identical treatments except for the (125I seed implantation. Time to recurrence (TTR and 1-, 3- and 5-year overall survival (OS were compared between the two groups. The follow-up ended in January 2010, and lasted for 7.7-106.4 months with a median of 47.6 months. TTR was significantly longer in the (125I group (mean of 60.0 months vs. 36.7 months in the control. The 1-, 3- and 5-year recurrence-free rates of the (125I group were 94.12%, 76.42%, and 73.65% vs. 88.24%, 50.00%, and 29.41% compared with the control group, respectively. The 1-, 3- and 5-year OS rates of the (125I group were 94.12%, 73.53%, and 55.88% vs. 88.24%, 52.94%, and 29.41% compared with the control group, respectively. The (125I brachytherapy decreased the risk of recurrence (HR = 0.310 and the risk of death (HR = 0.364. Most frequent adverse events in the (125I group included nausea, vomiting, arrhythmia, decreased white blood cell and/or platelet counts, and were generally mild and manageable. CONCLUSIONS/SIGNIFICANCE: Adjuvant (125I brachytherapy significantly prolonged TTR and increased the OS rate after curative resection of HCC. TRIAL REGISTRATION: Australian New Zealand Clinical Trials Registry ACTRN12610000081011.

Sensitive radioimmunoassay for somatostatin using N-(/sup 125/I)-tyr-somatostatin as labelled antigen

Energy Technology Data Exchange (ETDEWEB)

Dupont, A [CHUL, Quebec (Canada). Lab. of Molecular Endocrinology and Service of Gastro-Enterology; Coy, D H; Alvarado-Urbina, G; Cote, J; Meyers, C A; McManus, J; Barden, N; De Lean, A; Labrie, F

1979-01-01

A sensitive radioimmunoassay for somatostatin using N-(/sup 125/I)-Tyr-somatostatin is described and compared with using (/sup 125/I)-Tyr/sup 1/-somatostatin. The minimum detectable amount of somatostatin using N-(/sup 125/I)-Tyr-somatostatin as tracer was 0.1 to 0.5 pg, which is approximately 10-fold lower detection limit of the RIA using (/sup 125/I)-Tyr/sup 1/-somatostatin. Moreover, it was found that the shelf-life of N-(/sup 125/I)-Tyr-somatostatin was prolonged in comparison with labelled Tyr/sup 1/-somatostatin. Human pancreatic and gastric extracts displayed immunological similarity to synthetic somatostatin tetradecapeptide.

Labeling Lanreotide with 125I and 188Re. China

International Nuclear Information System (INIS)

Bai Hongsheng

2000-01-01

Lanreotide (D-β-Nal-Cys-Try-D-Trp-Lys-Val-Cys-Thr-NH2) is a new somatostatin analogue. It can bind to human somatostatin receptor (hSSTR) subtype 2 through 5 with high affinity and to hSSTR subtype 1 with low affinity. We investigate labeling condition, quality control and stability in vitro of 125 I-Lanreotide and 188 Re-lanreotide respectively. (A) Lanreotide is labeled with 125 I using Chloramine T. The effect of reaction condition (such as reaction time, pH value, Lanreotide amount, quantity of Chloramine T and reaction volume) on labeling yield is investigated in detail. (B) The labeling yield and radiochemical purity (RP) is measured with paper chromatography (PC) and Sep-Pak C 18 Cartridge. For PC method, 125 I-Lanreotide is spotted on the Whatman No.1 paper and developed in the mixture of CH 3 CH 2 CH 2 CH 2 OH and CH 3 CH 2 OH and NH 4 OH (v/v/v=5:2:1), the Rf value of every component in the mobile phase is given in table 1. For Sep-Pak C 18 Cartridge methods each cartridge is washed with 10 ml of ethanol followed by 10 ml of iso-CH 3 CH 2 CH 2 OH solution. Aliquots of 0.1 mI sample is loaded onto the cartridge, unbound peptide (sodium iodine-125) is eluted with 5 ml of 0.5mol/L sodium acetate solution, 125 I-Lanreotide is eluted with 5 mI of 95% aqueous ethanol solution. (C) The stability of 125 I-Lanreotide in vitro is investigated by labeling compound incubating for 48 hours at 37 deg. C in the 0.9% sodium chloride solution and RP is tested by PC at specific time intervals. (D) Lanreotide is labeled directly with 188 Re via the mixture of citrate and tartate using stannous chloride as reduced agent. The influence of reaction conditions such as pH, temperature, amount of stannous chloride, amount of Lanreotide and reaction time on labeling yield is investigated in detail. At the time, the stability in vitro quality control and animal test are evaluated

[125I] radioiodinated metaraminol: A new platelet-specific labeling agent

International Nuclear Information System (INIS)

Ohmomo, Y.; Yokoyama, A.; Kawai, K.; Arano, Y.; Horiuchi, K.; Saji, H.; Torizuka, K.

1985-01-01

In our search for a platelet-specific labeling agent, metaraminol (MA), a low-toxic pharmaceutical for the treatment of hypotension and cardiogenic shock, attracted our attention. Its active incorporation and accumulation by platelets have been recognized. At first, the preparation of 125 I radioiodinated metaraminol ( 125 I-MA) was carried out using the chloramine-T method. Then, upon the harvest of platelets as platelet-rich plasma (PRP), their labeling with this new radiopharmaceutical was easily performed by incubation for 10 min at 37 0 C. The cell-labeling efficiency was dependent on cell density, reaching 63.0%+-3.1% at 2.4x10 9 cells/ml. The specific incorporation of 125 I-MA by an active transport system similar to that of 5-hydroxytryptamine (5-HT) as well as by passive diffusion was demonstrated. In vitro studies, the unaltered state of 125 I-MA-labeled platelets with their cellular functions fully retained was estimated. In vivo studies carried out in rabbits with induced thrombi in the femoral artery showed a rather rapid disappearance of the radioactivity from circulating blood, reaching a high thrombus-to-blood activity ratio of 19.8+-4.3 within 30 min of the administration of 125 I-MA-labeled autologous platelets. Thus, with the potential availability of 123 I, 123 I-MA-labeled platelets appear to be a promising agent for thrombus imaging using single-emission computed tomography (CT) studies. (orig.)

Synthetic α subunit peptide 125-147 of human nicotinic acetylcholine receptor induces antibodies to native receptor

International Nuclear Information System (INIS)

McCormick, D.J.; Griesmann, G.E.; Huang, Z.; Lennon, V.A.

1986-01-01

A synthetic peptide corresponding to residues 125-147 of the Torpedo acetylcholine receptor (AChR) α subunit proved to be a major antigenic region of the AChR. Rats inoculated with 50 μg of peptide (T α 125-147) developed T cell immunity and antibodies to native AChR and signs of experimental autoimmune myasthenia gravis. They report the synthesis and preliminary testing of a disulfide-looped peptide comprising residues 125-147 of the human AChR α subunit. Peptide H α 125-147 differs from T α 125-147 at residues 139 (Glu for Gln) and 143 (Ser for Thr). In immunoprecipitation assays, antibodies to Torpedo AChR bound 125 I-labelled Hα 125-147 antibody bound Hα 125-147, but monoclonal antibodies to an immunodominant region of native AChR bound neither Hα 125-147 nor T α 125-147. Rats immunized with H α 125-147 produced anti-mammalian muscle AChR antibodies that induced modulation of AChRs from cultured human myotubes. Thus, region 125-147 of the human AChR α subunit is extracellular in muscle, and is both antigenic and immunogenic. It remains to be determined whether or not autoantibodies to this region may in part cause the weakness or myasthenia gravis in man

Inhomogeneity of the nucleus to 125IUdR cytotoxicity

International Nuclear Information System (INIS)

Yasui, L.S.; Hofer, K.G.; Warters, R.L.

1985-01-01

Synchronized suspension cultures of Chinese hamster ovary (CHO) cells were used to determine the lethal effects produced by the decay of 125 I incorporated into different subfractions of the nuclear genome. Such a shift in nuclear incorporation pattern was achieved by using the drug aphidicolin, which inhibits 95% of all nuclear DNA synthesis, is nontoxic to cells in a colony-forming assay, and does not modify the radiation response of CHO cells to X irradiation. These data in combination with survival curves of CHO cells labeled with 125 I-iododeoxyuridine ( 125 IUdR) either with or without aphidicolin showed a dramatic change in the survival response (D 0 : 30 decays/cell and 96 decays/cell, respectively). It is concluded, therefore, that the nucleus is not a homogeneous target for radiation-induced cell death because when subfractions of the nuclear genome are labeled, radically different levels in cell survival are obtained

7 CFR 28.125 - No voiding or modifying claims for payment.

Science.gov (United States)

2010-01-01

... Section 28.125 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD... Standards Act Fees and Costs § 28.125 No voiding or modifying claims for payment. Nothing in this subpart...

(E)-[125I]-5-AOIBV: a SPECT radioligand for the vesicular acetylcholine transporter

International Nuclear Information System (INIS)

Emond, Patrick; Mavel, Sylvie; Zea-Ponce, Yolanda; Kassiou, Michael; Garreau, Lucette; Bodard, Sylvie; Drossard, Marie-Laure; Chalon, Sylvie; Guilloteau, Denis

2007-01-01

The premise that, over the course of Alzheimer's disease (AD), changes in the levels of the vesicular acetylcholine transporter (VAChT) occur in parallel with changes to other cholinergic marker proteins provides the basis for the applicability of benzovesamicol derivatives as radioligands for AD studies by single photon emission computed tomography or positron emission tomography. We report the synthesis of enantiopure benzovesamicol derivatives: (R,R) or (S,S)-(E)-2-hydroxy-5-(3-iodoprop-2-en-1-oxy)-3- (4-phenylpiperidino)tetralin [(R,R)-AOIBV: K d =0.45 nM or (S,S)-5-AOIBV: K d =4.3 nM] and their corresponding tributyltin precursors for radioiodination. (R,R or S,S)-5-AOIBV was labeled with iodine-125 from their corresponding n-tributyltin precursors. Both compounds were obtained with radiochemical and optical purity greater than 97% and in radiochemical yields ranging 34-36%. To determine if these compounds could provide an advantage when compared to [ 125 I]-iodo benzovesamicol (IBVM), IBVM was also labeled and used as the reference compound in all ex vivo experiments. Ex vivo biodistribution experiments in rats revealed that [ 125 I]-(R,R)-5-AOIBV displayed the most suitable pharmacological profile as the radioactivity distribution corresponded well with the known VAChT brain density. Moreover, pre-injection of vesamicol prevented the uptake of [ 125 I]-(R,R)-5-AOIBV in striatum, cortex and hippocampus, demonstrating selectivity for the VAChT. However, even if time activity curves of [ 125 I]-(R,R)-5-AOIBV confirmed that this compound could be used to visualize the VAChT in vivo, at each point of the kinetic study, [ 125 I]-(R,R)-5-AOIBV showed a lower specific binding compared to [ 125 I]-IBVM. These results made [ 125 I]-( R,R)-5-AOIBV inferior to [ 125 I]-IBVM for the VAChT exploration in vivo

The preparation of 125I-β-CIT and its biological distribution in animal

International Nuclear Information System (INIS)

Sun Wenshan; Liu Zhenguo; Shen Minghua; Qian Juan; Li Peiyong; Zhu Chengmo; Chen Shengdi

2000-01-01

Objective: To prepare and label the 125 I-β-CIT and study its biological distribution in animal. Methods: 125 I-β-CIT was prepared by the peracetic acid method and the chloramine-T method, and dopamine transporter (DAT) binding properties of 125 I-β-CIT were examined by in vivo biodistribution and inhibition studies in mice and whole body autoradiography in rats. Results: The radiolabelling yields of the peracetic acid and the chloramine-T methods were (53.4 +- 7.9)% and (88.4 +- 3.49)%, respectively. Following intravenous injection in mice, 125 I-β-CIT showed high accumulation in striatum, time to peak level uptake was 2 h after injection. GBR12909 significantly inhibited 125 I-β-CIT binding in striatum, while clomipramine significantly inhibited 125 I-β-CIT binding in hippocampus and cerebral cortex. The rat whole body autoradiography showed that the clearance of the tracer occurred through the hepatobiliary route. Conclusions: The results indicate β-CIT is an agent suitable for DAT imaging and can be used for the study of Parkinson's disease

On the study of proton-irradiated Tellurium targets relevant for production of medical radioisotopes 123I and 124I

International Nuclear Information System (INIS)

Imam Kambali; Hari Suryanto; Daya Agung Sarwono; Cahyana Amiruddin

2014-01-01

The energy loss distribution and range of energetic proton beams in tellurium (Te) target have been simulated using the Stopping and Range of Ion in Matter (SRIM 2013) codes. The calculated data of the proton's range were then used to determine the optimum thickness of Te targets for future production of 123 I and 124 I from 123 Te(p,n) 123 I, 124 Te(p,n) 124 I and 124 Te(p,2n) 123 I nuclear reactions using the BATAN's Cs-30 cyclotron. It was found that for an incidence angle of 0° with respect to the target normal, the optimum thickness of 123 Te and 124 Te targets for 123 I production should be 644 µm and 1.8 mm respectively, whereas a 649 µm thick 124 Te target would be Required for 124 I production. In addition, the thickness should be decreased with increasing incidence angle. The EOB yield could theoretically reach up to 13.62 Ci of 123 I at proton energy of 22 Me V and beam current of 30 µA if the 124 Te is irradiated over a period of 3 hours. The theoretical EOB yield is comparable to the experimental data with accuracy within 10%. (author)

33 CFR 162.125 - Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc. 162.125 Section 162.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY INLAND WATERWAYS NAVIGATION REGULATIONS § 162.125 Sturgeon Bay and the Sturgeon Bay Ship...

MicroRNA-125a Inhibits Autophagy Activation and Antimicrobial Responses during Mycobacterial Infection.

Science.gov (United States)

Kim, Jin Kyung; Yuk, Jae-Min; Kim, Soo Yeon; Kim, Tae Sung; Jin, Hyo Sun; Yang, Chul-Su; Jo, Eun-Kyeong

2015-06-01

MicroRNAs (miRNAs) are small noncoding nucleotides that play critical roles in the regulation of diverse biological functions, including the response of host immune cells. Autophagy plays a key role in activating the antimicrobial host defense against Mycobacterium tuberculosis. Although the pathways associated with autophagy must be tightly regulated at a posttranscriptional level, the contribution of miRNAs and whether they specifically influence the activation of macrophage autophagy during M. tuberculosis infection are largely unknown. In this study, we demonstrate that M. tuberculosis infection of macrophages leads to increased expression of miRNA-125a-3p (miR-125a), which targets UV radiation resistance-associated gene (UVRAG), to inhibit autophagy activation and antimicrobial responses to M. tuberculosis. Forced expression of miR-125a significantly blocked M. tuberculosis-induced activation of autophagy and phagosomal maturation in macrophages, and inhibitors of miR-125a counteracted these effects. Both TLR2 and MyD88 were required for biogenesis of miR-125a during M. tuberculosis infection. Notably, activation of the AMP-activated protein kinase significantly inhibited the expression of miR-125a in M. tuberculosis-infected macrophages. Moreover, either overexpression of miR-125a or silencing of UVRAG significantly attenuated the antimicrobial effects of macrophages against M. tuberculosis. Taken together, these data indicate that miR-125a regulates the innate host defense by inhibiting the activation of autophagy and antimicrobial effects against M. tuberculosis through targeting UVRAG. Copyright © 2015 by The American Association of Immunologists, Inc.

Clinical application of permanent implantation of iodine 125 seeds for osseous metastases

International Nuclear Information System (INIS)

Li Jinxin; Zhang Qizhou; Li Guoliang

2010-01-01

Objective: To evaluate the clinical efficacy of permanent implantation of iodine 125 seeds in the treatment of osseous metastases. Methods: Radioactive iodine 125 seeds were implanted permanently in 32 lesions of 25 patients with osseous metastases of different origins. The ostalgia-relieving degree and the imaging alterations of the osseous metastasis lesions were observed. Results: The effective pain-relieving rate was 92% caused by permanent implantation of iodine 125 seeds. Of al 1 the patients, 15 patients achieved complete response, 8 patients obtained partial response (PR), and 2 patients had no change. The pain grade was decreased significantly after the treatment (P 125 I seeds has a definite effect on tumor metastasis and caused minimal damage and few complications. It is worthy of popularization in clinic. (authors)

A comparative study of 19-iodo cholesterol-125I 3-acetate and Na 125I in liquid scintillation measurements; Estudio comparativo del acetato de 19-iodocolesterol- -125I con Nal25I en medidas por centelleo liquido

Energy Technology Data Exchange (ETDEWEB)

Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J. M.; Grau Carles, A.

1994-07-01

A comparative study of performance of 19-iodo cholesterol {sup 1}25I 3-acetate and sodium iodide samples labeled with 125I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I concentration of 0-90 {mu}g and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol 1 I 3-acetate samples in Tolue ne-alcohol and 0 .04% for Na 125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs.

Binding of in vivo administrated 125-I-triiodothyronine by the rat liver mitochondria

International Nuclear Information System (INIS)

Fiedorowicz, K.; Nauman, A.; Nauman, J.

1979-01-01

In vivo administrated 125 I-triiodothyronine ( 125 I-T 3 ) was bound by the rat liver mitochondria. About 10 % of hormone was bound with external mitochondrial membrane while the remaining part with matrix and inner mitochondrial membrane. The highest accumulation of 125 I-T 3 in mitochondria was observed 30 min after injection while in the whole liver homogenate the highest hormone accumulation appeared 15 min post injection. Mitochondrial binding sites have a great capacity for T 3 which makes impossible estimation of the kinetic parameters of triiodothyronine-mitochondrium interaction by means of saturation and displacement of 125 I-T 3 . (author)

Iodine-123 program at the TRIUMF laboratory

International Nuclear Information System (INIS)

Vincent, J.S.

1985-01-01

A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

14 CFR 125.375 - Fuel supply: Nonturbine and turbopropeller-powered airplanes.

Science.gov (United States)

2010-01-01

...) Thereafter, to fly for 45 minutes at normal crusing fuel consumption. (b) If the airplane is released for any...-powered airplanes. 125.375 Section 125.375 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... AND OPERATIONS CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE...

The relative biological effectiveness of I-125 and Pd-103

International Nuclear Information System (INIS)

Ling, C. Clifton; Li, William X.; Anderson, Lowell L.

1995-01-01

Purpose: To determine the relative biological effectiveness (RBE) of I-125 and Pd-103 relative to Co-60. Methods and Materials: A cell line REC:ras, derived from rat embryo cells, was used. Cells in exponential or plateau phase were irradiated at dose rates of about 0.07 Gy/h and 0.14 Gy/h. To circumvent the interface effect, cells were grown and irradiated on membranes made of cellulose acetate, which has an effective Z of 7.5. I-125 and Pd-103 seeds were placed in a custom designed template that yielded a homogeneous dose distribution in the plane of the cell culture. The dose rates of irradiation were measured by calibrated thermoluminescence dosimetry (TLD) chips. Results and Conclusions: Our measurements yielded an RBE of about 1.4 for I-125 at dose rates of about 0.07 Gy/h, and an RBE of about 1.9 for Pd-103 at dose rates of about 0.07 Gy/h and 0.14 Gy/h. The RBE of I-125 is similar to those measured by other investigators, the RBE for Pd-103 is being reported for the first time

Cytotoxic effects of 125I-labeled PBZr ligand PK 11195 in prostatic tumor cells: therapeutic implications

International Nuclear Information System (INIS)

Alenfall, J.; Kant, R.; Batra, S.

1998-01-01

The effect of [ 125 I]PK 11195 was examined in human prostatic tumor cells (DU 145) in culture and compared with Na[ 125 I] and non-radioactive PK 11195. [ 125 I]PK 11195 was clearly cytocidal. The data for dose-related cell survival with [ 125 I]PK 11195 showed a linear relationship. Na[ 125 I] or non-labeled PK 11195 at similar concentrations did not lead to any cell killing. The uptake of [ 125 I]PK 11195 and [ 3 H]PK 11195 in cells was very similar. Fragmentation of DNA measured by agarose gel electrophoresis showed that exposure of DU 145 cells to [ 125 I]PK 11195 for 1, 4 or 24 h caused no fragmentation. These results indicate that nuclear DNA is not the prime binding site for [ 125 I]PK 11195, which is consistent with the presence of specific peripheral benzodiazepine receptors (PBZr) in the mitochondria. The cell killing effect of [ 125 I]PK 11195 suggests the use of PBZr ligand for radiotherapy

Report of a minor 125I exposure in a research laboratory

International Nuclear Information System (INIS)

Lambert, J.P.

1981-01-01

In routine thyroid scanning of personnel whose work involved the use of 125 I in biological research, it was discovered that an individual who had been iodinating proteins periodically for over 6 months showed a high thyroid count rate. It was decided to monitor the individual's thyroid weekly and to curtail his work in the laboratory until the cause of the thyroid uptake could be determined. Initially the 125 I concentration in his thyroid decreased as expected but a subsequent scan on the 21st day showed an 125 I concentration even greater than the initial level despite his absence from the laboratory. However on monitoring his office space, it was discovered that a felt pen was grossly contaminated and that the individual habitually put the pen in his mouth during moments of cogitation. It was concluded that a contaminated glove had transferred some 125 I to the pen during the course of the experiment. (U.K.)

Study of o-125I-benzoate excretion mechanisms in the rabbit

International Nuclear Information System (INIS)

Richter, R.; Laznicek, M.; Kvetina, J.; Laznickova, A.

1990-01-01

An analysis of the mechanisms of renal clearance of o- 125 I-benzoate in the rabbit based on the inhibition of the secretory transport by probenecid showed that o- 125 I-benzoate was eliminated in the kidneys not only by glomerular filtration but also by tubular secretion. The total amount of the drug excreted in the urine was affected by tubular resorption (apparently by the process of passive diffusion), which exceeded tubular secretion. A comparison of the chromatograms of the plasma and the urine before and after the competitive inhibition of the tubular active transport by probenecid revealed a higher amount of o- 125 I-benzoylglucuronide in the urine in the case of inhibition. The results suggest that the kidneys participated in the total biotransformation of o- 125 I-benzoate. The excretion of the original drug and metabolites in the bile contributed less than 1% to the total clearance in rabbits. (author). 3 figs., 3 tabs., 10 refs

Synthesis and binding characteristics of N-(1-naphthyl)-N'-(3-[{sup 125}I]-iodophenyl)-N'-methylguanidine ([{sup 125}I]-CNS 1261): a potential SPECT agent for imaging NMDA receptor activation

Energy Technology Data Exchange (ETDEWEB)

Owens, Jonathan E-mail: j.owens@clinmed.gla.ac.uk; Tebbutt, Andrew A.; McGregor, Ailsa L.; Kodama, K.; Magar, Sharad S.; Perlman, Michael E.; Robins, David J.; Durant, Graham J.; McCulloch, James

2000-06-01

N-(1-Naphthyl)-N'-(3-[{sup 125}I]-iodophenyl)-N'-methylguanidine ([{sup 125}I]-CNS 1261) was synthesized as a potential radioligand to image N-methyl-D-aspartate (NMDA) receptor activation. [{sup 125}I]-CNS 1261 was prepared by radioiodination of N-(1-naphthyl)-N'-(3-tributylstannylphenyl)-N'-methylguanidine using Na{sup 125}I and peracetic acid. [{sup 125}I]-CNS 1261 uptake in vivo reflected NMDA receptor distribution in normal rat brain, whereas in ischemic rat brain, uptake was markedly increased in areas of NMDA receptor activation. Radiolabeled CNS 1261 appears to be a good candidate for further development as a single photon emission computed tomography tracer in the investigation of NMDA receptor activation in cerebral ischemia.

Highly efficient method for 125I-radiolabeling of biomolecules using inverse-electron-demand Diels-Alder reaction.

Science.gov (United States)

Choi, Mi Hee; Shim, Ha Eun; Yun, Seong-Jae; Kim, Hye Rim; Mushtaq, Sajid; Lee, Chang Heon; Park, Sang Hyun; Choi, Dae Seong; Lee, Dong-Eun; Byun, Eui-Baek; Jang, Beom-Su; Jeon, Jongho

2016-04-19

In this report, we present a rapid and highly efficient method for radioactive iodine labeling of trans-cyclooctene group conjugated biomolecules using inverse-electron-demand Diels-Alder reaction. Radioiodination reaction of the tetrazine structure was carried out using the stannylated precursor 2 to give 125 I-labeled azide ([ 125 I]1) with high radiochemical yield (65±8%) and radiochemical purity (>99%). For radiolabeling application of [ 125 I]1, trans-cyclooctene derived cRGD peptide and human serum albumin were prepared. These substrated were reacted with [ 125 I]1 under mild condition to provide the radiolabeled products [ 125 I]6 and [ 125 I]8, respectively, with excellent radiochemical yields. The biodistribution study of [ 125 I]8 in normal ICR mice showed significantly lower thyroid uptake values than that of 125 I-labeled human serum albumin prepared by a traditional radiolabeling method. Therefore [ 125 I]8 will be a useful radiolabeled tracer in various molecular imaging and biological studies. Those results clearly demonstrate that [ 125 I]1 will be used as a valuable prosthetic group for radiolabeling of biomolecules. Copyright © 2016 Elsevier Ltd. All rights reserved.

Tellurium sulfates from reactions in oleum and sulfur trioxide: syntheses and crystal structures of TeO(SO_4), Te_4O_3(SO_4)_5, and Te(S_2O_7)_2

International Nuclear Information System (INIS)

Logemann, Christian; Bruns, Joern; Schindler, Lisa Verena; Zimmermann, Vanessa; Wickleder, Mathias S.

2015-01-01

The reaction of K_2TeO_4 with fuming sulfuric acid (65 % SO_3) in sealed glass ampoules at 250 C led to colorless single crystals of TeO(SO_4) [triclinic, P anti 1, Z = 8, a = 819.89(3) pm, b = 836.95(4) pm, c = 1179.12(5) pm, α = 82.820(2) , β = 70.645(2) , γ = 81.897(2) , V = 753.11(6) x 10"6 pm"3]. A horseshoe type [Te_4O_3] fragment is the basic motif in the layer structure of the compound. The [Te_4O_3] moieties are linked to infinite chains by further oxide ions. Monomeric [Te_4O_3] horseshoes are found in the crystal structure of Te_4O_3(SO_4)_5 [trigonal, P3_221, Z = 3, a = 859.05(2) pm, c = 2230.66(7) pm, V = 1425.61(6) x 10"6 pm"3], which was obtained from TeO_2 and fuming sulfuric acid (65 % SO_3) at 200 C as colorless single crystals. By switching to neat SO_3 as reaction medium colorless crystals of Te(S_2O_7)_2 [P2_1/n, Z = 4, a = 1065.25(3) pm, b = 818.50(2) pm, c = 1206.27(3) pm, β = 102.097(1) , V = 1028.40(5) x 10"6 pm"3] form when ortho-telluric acid, H_6TeO_6, is used as the tellurium source. The compound was reported previously, however, obviously with a wrong crystallographic description. In the crystal structure the tellurium atoms are coordinated by two chelating disulfate ions. Further Te-O contacts link the [Te(S_2O_7)_2] units to an extended network. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Regulation of 1,25-dihydroxyvitamin D, receptors by [3H]-1,25-dihydroxyvitamin D3 in cultured cells (T-47D): evidence for receptor upregulation

International Nuclear Information System (INIS)

Reinhardt, T.A.; Horst, R.L.

1986-01-01

The authors examined the effect of 1,25-(OH) 2 D 3 on receptor concentration in cultured cells (T-47D). Two days prior to experiment, cells were fed with RPMI 1640 + 10% serum and 24-32 hours prior to experiment the media was replaced with RPMI 1640 + 25 mM Hepes + 1% serum. [ 3 H]-1,25-(OH) 2 D 3 +/- 100-fold molar excess cold hormone was used to treat the cells. Occupied receptors were measured in freshly prepared cytosols. Total receptors were measured following a 16-hour incubation of cytosols in the presence of 0.6 nM [ 3 H]-1,25-(OH) 2 D 3 +/- 100-fold molar excess of cold hormone at 4 0 C. Treatment of cell cultures for 16-18 hours with 0.5-1.0 nM [ 3 H]-1,25-(OH) 2 D 3 resulted in a 30-40% receptor occupancy by the hormone and a 2- to 3-fold increase in total cell receptor as compared to vehicle-treated controls. Time course studies showed a rapid increase in total receptors up to 16 hours post-treatment in the face of declining receptor occupancy. Actinomycin D blocked the [ 3 H]-1,25-(OH) 2 D 3 -dependent rise in cell receptor. The physiological significance of this receptor upregulation is not known nor is it known whether upregulation results from synthesis of new receptors and/or is the result of the activation of preformed receptors by a inducible activator protein

Iodine-125 metaraminol: A new platelet specific labeling agent

International Nuclear Information System (INIS)

Ohmomo, Y.; Yokoyama, A.; Kawaii, K.; Horiuchi, K.; Saji, H.; Torizuka, K.

1984-01-01

In the search for a platelet specific labeling agent, Metaraminol (MA), which is a sympatomimetic amine used for the treatment of hypotension, cardiogenic shock and well recognized as a drug actively incorporated and accumulated in platelet, attracted the authors' attention. Using the classical chloramine-T iodination method, a high labeling efficiency near 98%, reaching a specific activity up to about 1000 Ci/mmole was obtained. Upon the harvest of platelet, only as platelet rich plasma (PRP), the labeling with this radiopharmaceutical was easily performed by incubation at 37 0 C for 10 min. Labeling efficiency as high as 63.0 +- 3.1% at 24 x 10/sup 8/ cells/ml was obtained. In in-vitro studies, the unaltered state of I-125 MA labeled platelet, with their cellular functions fully retained was demonstrated. Pharmacological study indicated a specific incorporation of I-125 MA by active transport system similar to that of 5-HT, along with passive diffusion. Then the in-vivo study carried out in rabbits with induced thrombi on the femoral artery, showed rather rapid disappearance of the I-125 MA labeled autologous platelet radioactivity, from circulating blood reaching as high thrombus-to-blood activity ratio as 19.8+-4.3 within 30 min post-administration. This new platelet labeling agent, I-125 MA, has many advantages over the use of IN-111 oxine and holds considerable promise for thrombus imaging with single photon emission CT upon the availability of I-123 MA

Synthesis and biologic studies of iodinated (125I/127I) ethidium

International Nuclear Information System (INIS)

Ho Nanhui; Tumeh, Paul C.; Kassis, Amin I.

2001-01-01

An iodinated ( 125 I/ 127 I) ethidium derivative (3,8-diamino-5-[6'-(p-iodobenzoylamino)-4'-azahexyl]-6 -phenylphenanthridinium chloride hydrochloride) was synthesized and characterized. The labeling yield of the 125 I-labeled derivative was 75% for carrier-free 125 I, with a radiochemical purity of 95%. The incubation of iodoethidium with calf thymus DNA resulted in a substantial enhancement of fluorescence yield, indicating the intercalation of this compound into DNA. In the presence of iodoethidium, the nuclei of methanol-treated mammalian cells fluoresced, while those of viable cells did not (since the plasma membrane is impermeable to iodoethidium). When viable cells were incubated with the reduced form of the derivative, 125 I/ 127 I-dihydroethidium traversed the plasma membrane, was oxidized in the cytoplasm, and intercalated into nuclear DNA. Finally, we tested the hypothesis that larger malignant solid tumors, containing a relatively greater percentage of degenerating permeable cells, can be targeted with 125 I-ethidium. In-vivo studies demonstrated a small but positive correlation (R = 0.72) between tumor volume and the uptake of the derivative. Because of the ubiquitous presence of abnormal permeable cells and necrosis in tumors, our results support the belief that radiolabeled DNA-intercalating or DNA-binding molecules may be of diagnostic and therapeutic value for a variety of solid tumors in humans

Iodine-125 radiation of posterior uveal melanoma

International Nuclear Information System (INIS)

Packer, S.

1987-01-01

Twenty-eight cases of posterior choroidal melanoma were treated with iodine-125 in gold eye plaques. Eleven cases were located within 3.0 mm of the optic nerve (group A), nine were within 3.0 mm of the fovea (group B), and eight were within 3.0 mm of the optic nerve and fovea (group C). The mean follow-up of group A was 46.3 months; group B, 25.5 months; and group C, 42.7 months. Complications included macular edema, cataract and tumor growth. Visual acuity remained within two lines of that tested preoperatively for 4 of 11 patients in group A, 4 of 9 in group B, and 5 of 8 in group C. These results with iodine-125 suggest it as an appropriate treatment for patients with choroidal melanoma located near optic nerve and/or macula

Iodine-125 radiation of posterior uveal melanoma

Energy Technology Data Exchange (ETDEWEB)

Packer, S.

1987-12-01

Twenty-eight cases of posterior choroidal melanoma were treated with iodine-125 in gold eye plaques. Eleven cases were located within 3.0 mm of the optic nerve (group A), nine were within 3.0 mm of the fovea (group B), and eight were within 3.0 mm of the optic nerve and fovea (group C). The mean follow-up of group A was 46.3 months; group B, 25.5 months; and group C, 42.7 months. Complications included macular edema, cataract and tumor growth. Visual acuity remained within two lines of that tested preoperatively for 4 of 11 patients in group A, 4 of 9 in group B, and 5 of 8 in group C. These results with iodine-125 suggest it as an appropriate treatment for patients with choroidal melanoma located near optic nerve and/or macula.

Vitamin D and 1,25(OH2D Regulation of T cells

Directory of Open Access Journals (Sweden)

Margherita T. Cantorna

2015-04-01

Full Text Available Vitamin D is a direct and indirect regulator of T cells. The mechanisms by which vitamin D directly regulates T cells are reviewed and new primary data on the effects of 1,25 dihydroxyvitamin D (1,25(OH2D on human invariant natural killer (iNKT cells is presented. The in vivo effects of vitamin D on murine T cells include inhibition of T cell proliferation, inhibition of IFN-γ, IL-17 and induction of IL-4. Experiments in mice demonstrate that the effectiveness of 1,25(OH2D requires NKT cells, IL-10, the IL-10R and IL-4. Comparisons of mouse and human T cells show that 1,25(OH2D inhibits IL-17 and IFN-γ, and induces T regulatory cells and IL-4. IL-4 was induced by 1,25(OH2D in mouse and human iNKT cells. Activation for 72h was required for optimal expression of the vitamin D receptor (VDR in human and mouse T and iNKT cells. In addition, T cells are potential autocrine sources of 1,25(OH2D but again only 48–72h after activation. Together the data support the late effects of vitamin D on diseases like inflammatory bowel disease and multiple sclerosis where reducing IL-17 and IFN-γ, while inducing IL-4 and IL-10, would be beneficial.

Strong inverse correlation between microRNA-125b and human papillomavirus DNA in productive infection.

Science.gov (United States)

Nuovo, Gerard J; Wu, Xin; Volinia, Stefano; Yan, Fengting; di Leva, Gianpiero; Chin, Nena; Nicol, Alcina F; Jiang, Jinmai; Otterson, Gregory; Schmittgen, Thomas D; Croce, Carlo

2010-09-01

Infection by the human papillomavirus (HPV) is a cause of cervical intraepithelial neoplasia (CIN) and cancer. microRNA (miRNA) in situ analysis of the transformation zone epithelia, the site of initial cervical HPV infection, showed that miRNAs let-7c, -99a, 26a, and 125b were the most abundantly expressed. In situ testing of CIN 1 showed a dramatic reduction in miR-125b expression in the koilocytes, the cytologic marker of productive HPV infection. A marked reduction in miR-125b was likewise observed in the HPV-infected cells of the condyloma acuminatum, verruca vulgaris, and epidermodysplasia verruciformis. Reverse transcriptase in situ polymerase chain reaction (PCR) showed that the pre-miRNA 125b was present in the koilocyte, suggesting direct inactivation of the mature miRNA. HEK cells transfected with only the antimiR-125b showed perinuclear halos equivalent to HPV-infected koilocytes. NIH 3T3 cells transfected with the HPV 16 full-length genome and mimetic miR-125b showed a marked reduction in viral DNA and protein synthesis by quantitative PCR and in situ-based analyses, respectively (P=0.002). Alternatively, cotransfection with anti-miR-125b and HPV 16 markedly increased HPV DNA (P=0.002). Sequence analyses showed strong homology between L2 of different HPV genotypes and miR-125b. Transfection with HPV 16 L2 resulted in a marked reduction in miR-125b levels in the NIH 3T3 cells. HPV L2-induced inactivation of miR-125b is associated with the classic cytologic changes of the koilocyte, and the exogenous application of mimetic miR-125b markedly inhibits HPV DNA synthesis.

MicroRNA-125 family members exert a similar role in the regulation of murine hematopoiesis.

Science.gov (United States)

Wojtowicz, Edyta E; Walasek, Marta A; Broekhuis, Mathilde J C; Weersing, Ellen; Ritsema, Martha; Ausema, Albertina; Bystrykh, Leonid V; de Haan, Gerald

2014-10-01

MicroRNAs (miRNAs) are crucial for proper functioning of hematopoietic stem and progenitor cells (HSPCs). Members of the miRNA-125 family (consisting of miR-125a, miR-125b1, and miR-125b2) are known to confer a proliferative advantage on cells upon overexpression, to decrease the rate of apoptosis by targeting proapoptotic genes, and to promote differentiation toward the myeloid lineage in mice. However, many distinct biological effects of the three miR-125 species have been reported as well. In the current study, we set out to assess whether the three miRNA-125s that carry identical seed sequences could be functionally different. Our data show that overexpression of each of the three miR-125 family members preserves HSPCs in a primitive state in vitro, results in a competitive advantage upon serial transplantation, and promotes skewing toward the myeloid lineage. All miR-125 family members decreased the pool of phenotypically defined Lin(-)Sca(+)Kit(+)CD48(-)CD150(+) long-term hematopoietic stem cells, simultaneously increasing the self-renewal activity upon secondary transplantation. The downregulation of miR-125s in hematopoietic stem cells abolishes these effects and impairs long-term contribution to blood cell production. The introduction of a point mutation within the miRNA-125 seed sequence abolishes all abovementioned effects and leads to the restoration of normal hematopoiesis. Our results show that all miR-125 family members are similar in function, they likely operate in a seed-sequence-dependent manner, and they induce a highly comparable hematopoietic phenotype. Copyright © 2014 ISEH - International Society for Experimental Hematology. Published by Elsevier Inc. All rights reserved.

{sup 125}I-iomazenil-benzodiazepine receptor binding during psychological stress in rats

Energy Technology Data Exchange (ETDEWEB)

Fukumitsu, Nobuyoshi; Tsuchida, Daisuke; Ogi, Shigeyuki; Uchiyama, Mayuki; Mori, Yutaka [Jikei Univ., Tokyo (Japan). School of Medicine

2002-05-01

We investigated the changes in {sup 125}I-iomazenil ({sup 125}I-IMZ) benzodiazepine receptor (BZR) binding with psychological stress in a rat model. Six male Wistar rats were placed under psychological stress for 1 hour by using a communication box. No physical stress was not received. 1.85 MBq of {sup 125}I-IMZ was injected into the lateral tail vein and the rat was killed 3 hours later. Twenty-micormeter-thick sections of the brain were collected and % injected dose per body weight (% ID/BW) of eleven regions (frontal, parietal, temporal, occipital cortices, caudate putamen, accumubens nuclei, globus pallidus, amygdala, thalamus, hippocampus and hypothalamus) were calculated by autoradiography. The %ID/BW of rats which were placed under psychological stress was compared with that of 6 control rats. The %ID/BW of rats which were placed under psychological stress diffusely tended to show a reduction in {sup 125}I-IMZ-BZR binding. A significant decrease in BZR binding was observed in the hippocampus of the rats which were placed under psychological stress. {sup 125}I-IMZ-BZR binding tended to decrease throughout the brain. (author)

1,25D3 enhances antitumor activity of gemcitabine and cisplatin in human bladder cancer models

Science.gov (United States)

Ma, Yingyu; Yu, Wei-Dong; Trump, Donald L.; Johnson, Candace S.

2010-01-01

Background 1,25 dihydroxyvitamin D3 (1,25D3) potentiates the cytotoxic effects of several common chemotherapeutic agents. The combination of gemcitabine and cisplatin (GC) is a current standard chemotherapy regimen for bladder cancer. We investigated whether 1,25D3 could enhance the antitumor activity of GC in bladder cancer model systems. Methods Human bladder cancer T24 and UMUC3 cells were pretreated with 1,25D3 followed by GC. Apoptosis were assessed by annexin V staining. Caspase activation was examined by immunoblot analysis and substrate-based caspase activity assay. The cytotoxic effects were examined using MTT and in vitro clonogenic assay. p73 protein levels were assessed by immunoblot analysis. Knockdown of p73 was achieved by siRNA. The in vivo antitumor activity was assessed by in vivo excision clonogenic assay and tumor regrowth delay in the T24 xenograft model. Results 1,25D3 pretreatment enhanced GC-induced apoptosis and the activities of caspases- 8, 9 and 3 in T24 and UMUC3 cells. 1,25D3 synergistically reduced GC-suppressed surviving fraction in T24 cells. 1,25D3, gemcitabine, or cisplatin induced p73 accumulation, which was enhanced by GC or 1,25D3 and GC. p73 expression was lower in human primary bladder tumor tissue compared with adjacent normal tissue. Knockdown of p73 increased clonogenic capacity of T24 cells treated with 1,25D3, GC or 1,25D3 and GC. 1,25D3 and GC combination enhanced tumor regression compared with 1,25D3 or GC alone. Conclusions 1,25D3 potentiates GC-mediated growth inhibition in human bladder cancer models in vitro and in vivo, which involves p73 induction and apoptosis. PMID:20564622

MicroRNA-125b Affects Vascular Smooth Muscle Cell Function by Targeting Serum Response Factor

Directory of Open Access Journals (Sweden)

Zhibo Chen

2018-04-01

Full Text Available Background/Aims: Increasing evidence links microRNAs to the pathogenesis of peripheral vascular disease. We recently found microRNA-125b (miR-125b to be one of the most significantly down‑regulated microRNAs in human arteries with arteriosclerosis obliterans (ASO of the lower extremities. However, its function in the process of ASO remains unclear. This study aimed to investigate the expression, regulatory mechanisms, and functions of miR-125b in the process of ASO. Methods: Using the tissue explants adherent method, vascular smooth muscle cells (VSMCs were prepared for this study. A rat carotid artery balloon injury model was constructed to simulate the development of vascular neointima, and a lentiviral transduction system was used to overexpress serum response factor (SRF or miR-125b. Quantitative real‑time PCR (qRT‑PCR was used to detect the expression levels of miR‑125b and SRF mRNA. Western blotting was performed to determine the expression levels of SRF and Ki67. In situ hybridization analysis was used to analyze the location and expression levels of miR-125b. CCK-8 and EdU assays were used to assess cell proliferation, and transwell and wound closure assays were performed to measure cell migration. Flow cytometry was used to evaluate cell apoptosis, and a dual-luciferase reporter assay was conducted to examine the effects of miR‑125b on SRF. Immunohistochemistry and immunofluorescence analyses were performed to analyze the location and expression levels of SRF and Ki67. Results: miR-125b expression was decreased in ASO arteries and platelet-derived growth factor (PDGF-BB-stimulated VSMCs. miR-125b suppressed VSMC proliferation and migration but promoted VSMC apoptosis. SRF was determined to be a direct target of miR-125b. Exogenous miR-125b expression modulated SRF expression and inhibited vascular neointimal formation in balloon-injured rat carotid arteries. Conclusions: These findings demonstrate a specific role of the mi

Biodistribution analysis of 125I-albumin-IFN-alpha2b fusion protein in rats

International Nuclear Information System (INIS)

Zhou Yaoyuan; Zhang Rongjun; Cai Gangming; Gu Xiaobo; Jiang Mengjun; Zhang Bo; Yang Min; Cao Guoxian; Yang Jianliang

2009-01-01

125 I-albumin-IFN-alpha2b was prepared with the methods of Ch-T and purified with PD-10 column. The radiochemical purity was measured with TCA (trichloroacetic acid) precipitation. The antiviral activities of 125 I-albumin-IFN-alpha2b and albumin-IFN-alpha2b were compared with WISH/VSV system in vitro. SD rats were injected with 125 I-albumin-IFN-alpha2b subcutaneously and sacrificed at 0.5, 2, 6, 24, 48, 90, 180 and 300 h post-injection. Selected organs were dissected, weighed and their radioactivity was measured using γ-counter. The accumulated radioactivity in the tissues was calculated in terms of percentage of injected dose per gram organ (%ID·g -1 ). The labeling yield was 82.72%. The radiochemical purity of 125 I-albumin-IFN-alpha2b was 95.53%, and its radioactivity was 0.26 MBq/μg. The antiviral bioactivities of albumin-IFN-alpha2b and 125 I-albumin- IFN-alpha2b did not change. Biodistribution analysis of 125 I-albumin-IFN-alpha2b in rats showed that concentrated 125 I-albumin-IFN-alpha2b in blood reached maximum at 6 h post injection, and eliminated slowly. No specific accumulation was seen in other tissues. 125 I-albumin-IFN-alpha2b could maintain in peripheral blood for a long time and it meant albumin-IFN-alpha2b would be an effective long-term interferon. (authors)

Chemical processes for the extreme enrichment of tellurium into marine ferromanganese oxides

Science.gov (United States)

Kashiwabara, Teruhiko; Oishi, Yasuko; Sakaguchi, Aya; Sugiyama, Toshiki; Usui, Akira; Takahashi, Yoshio

2014-04-01

Tellurium, an element of growing economic importance, is extremely enriched in marine ferromanganese oxides. We investigated the mechanism of this enrichment using a combination of spectroscopic analysis and adsorption/coprecipitation experiments. X-ray Absorption Near-Edge Structure (XANES) analysis showed that in adsorption/coprecipitation systems, Te(IV) was oxidized on δ-MnO2 and not oxidized on ferrihydrite. Extended X-ray Absorption Fine Structure (EXAFS) analysis showed that both Te(IV) and Te(VI) were adsorbed on the surface of δ-MnO2 and ferrihydrite via formation of inner-sphere complexes. In addition, Te(VI) can be structurally incorporated into the linkage of Fe octahedra through a coprecipitation process because of its molecular geometry that is similar to the Fe octahedron. The largest distribution coefficient obtained in the adsorption/coprecipitation experiments was for the Te(VI)/ferrihydrite coprecipitation system, and it was comparable to those calculated from the distribution between natural ferromanganese oxides and seawater. Our XAFS and micro-focused X-ray fluorescence (μ-XRF) mapping of natural ferromanganese oxides showed that Te was structurally incorporated as Te(VI) in Fe (oxyhydr)oxide phases. We conclude that the main process for the enrichment of Te in ferromanganese oxides is structural incorporation of Te(VI) into Fe (oxyhydr)oxide phases through coprecipitation. This mechanism can explain the unique degree of enrichment of Te compared with other oxyanions, which are mainly enriched via adsorption on the surface of the solid structures. In particular, the great contrast in the distributions of Te and Se is caused by their oxidized species: (i) the similar geometry of the Te(VI) molecule to Fe octahedron, and (ii) quite soluble nature of Se(VI). Coexisting Mn oxide phases may promote structural incorporation of Te(VI) by oxidation of Te(IV), although the surface oxidation itself may not work as the critical enrichment process as

Methodology of quality control for brachytherapy {sup 125}I seeds

Energy Technology Data Exchange (ETDEWEB)

Moura, Eduardo S.; Zeituni, Carlos A.; Manzoli, Jose E.; Rostelato, Maria Elisa C.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mail: esmoura@ipen.br

2007-07-01

This paper presents the methodology of quality control of {sup 125}I seeds used for brachytherapy. The {sup 125}I seeds are millimeter titanium capsules widely used in permanent implants of prostate cancer, allowing a high dose within the tumour and a low dose on the surrounding tissues, with very low harm to the other tissues. Besides, with this procedure, the patients have a low impotence rate and a small incidence of urinary incontinence. To meet the medical standards, an efficient quality control is necessary, showing values with the minimum uncertainness possible, concerning the seeds dimensions and their respective activities. The medical needles are used to insert the seeds inside the prostate. The needles used in brachytherapy have an internal diameter of 1.0 mm, so it is necessary {sup 125}I seeds with an external maximum diameter of 0.85 mm. For the seeds and the spacer positioning on the planning sheet, the seeds must have a length between 4.5 and 5.0 mm. The activities must not vary more than 5% in each batch of {sup 125}I seeds. For this methodology, we used two ionization chamber detectors and one caliper. In this paper, the methodology using one control batch with 75 seeds manufactured by GE Health care Ltd is presented. (author)

Ovarian Fibroma with Meigs Syndrome associated with Elevated CA125 - A Rare Case

Directory of Open Access Journals (Sweden)

Prasad. K. Shetty

2010-07-01

Full Text Available Postmenopausal women with solid adnexal masses, ascites and pleural effusion with elevated CA 125 are highly suggestive for malignant ovarian tumor. However in literature 28 cases Meigs syndrome (Benign ovarian tumor, ascites and right pleural effusion with raised CA 125 have been reported. We report a case of Meigs syndrome caused by right ovarian fibroma with elevated serum CA125 level in a postmenopausal woman

Lifetime measurements in odd-even 125La, 127La isotopes

International Nuclear Information System (INIS)

Starosta, K.; Droste, Ch.; Gundel, S.

1995-01-01

Recoil Distance Method (RDM); lifetime measurements have been carried out for the 125 La and 127 La nuclei to examine the collective structure of the decoupled band based on the unique parity πh 11/2 [550]1/2 orbital. The Stony Brook array of five BGO-suppressed Ge detectors placed at +/- 30, 90, 125 and 150 degree relative to the beam direction in conjunction with the Notre Dame/Argonne plunger was used to measure the stopped and shifted γ-ray peaks as a function of target-stopper distance. The 94 Mo( 35 Cl,2p2n) reaction at beam energy of 155 MeV was used to populate the excited states of 125 La and the 112 Cd( 19 F, 4n) reaction for the 127 La. The preliminary results of lifetime measurements are presented

Study and parameters survey for iodine-125 source dosimetry to be applied in brachytherapy; Estudo e levantamentos de parametros para dosimetria de fontes de iodo-125 aplicadas em braquiterapia

Energy Technology Data Exchange (ETDEWEB)

Moura, Eduardo Santana de

2011-07-01

The use of brachytherapy technique with iodine-125 seeds to prostate cancer treatment has been used for decades with good clinical outcomes. To aim the Brazilian population necessities, IPEN-CNEN/SP developed the iodine-125 seed prototype with national technology. The objectives of this work are the development and the study of dosimetric procedures associates with the experimental acquisition of the useful parameters for the iodine-125 dosimetric characterization and to evaluate if the developed procedures, in this work, have the basic conditions to determinate the dosimetric analysis, that are fundamental for clinical procedures. The dosimeters selected for the analysis are the TLD-100 (LiF:Mg,Ti), initially these dosimeters were submitted for two selection steps to choose the dosimeters more reproducible for the dosimetric analysis. The two steps were the selection by the mass of the dosimeters and the reproducibility after four irradiation series in a Cobalt-60 irradiator (CTR-IPEN). Afterwards these steps, the dosimeters were irradiated in linear accelerator with 6 MV energy (Service of Radiotherapy - Hospital Israelita Albert Einstein) to yield the individual calibration factors to each dosimeter. After, the dosimeters were used to the irradiations with iodine-125 seed, 6711 model, (GE-Healthcare). The irradiations and others analysis with iodine-125 seeds yield the useful values for the determination of the parameters suggested by the AAPM (American Association of Physicists in Medicine): constant of dose rate, geometry function, dose radial function and anisotropy function. The results showed good agreement with the values published by the literature, for the same iodine- 125 model, this fact confirms that the realized parameters will be able to be used for the IPEN-CNEN iodine-125 seeds dosimetry and quality control. (author)

Labeling Lanreotide with 125I and 188Re

International Nuclear Information System (INIS)

Bai Hongsheng

2000-01-01

Lanreotide is a new somatostatin analogue. It can bind to human somatostatin receptor (hSSTR) subtype 2 through 5 with high affinity and to hSSTR subtype I with low affinity. We investigate labeling condition, quality control and stability in vitro of 125 I-Lanreotide and 188 Re-lanreotide respectively. (A) Lanreotide is labeled with 125 I using Chloramine T. The effect of reaction condition (such as reaction time, pH value, Lanreotide amount, quantity of Chloramine T and reaction volume) on labeling yield is investigated in detail. (B) The labeling yield and radiochemical purity (RP) is measured with paper chromatography (PC) and Sep-Pak C 18 Cartridge. (C) The stability of 125 I-Lanreotide in vitro is investigated by labeling compound incubating for 48 hours at 37 deg C in the 0.9% sodium chloride solution and RP is tested by PC at specific time intervals. (D) Lanreotide is labeled directly with 188 Re via the mixture of citrate and tartate using stannous chloride as reduced agent. The influence of reaction conditions such as pH, temperature, amount of stannous chloride, amount of Lanreotide and reaction time on labeling yield is investigated in detail. At the time, the stability in vitro quality control and animal test are evaluated

Microdosimetry of 125I and 3H in the cell nucleus

International Nuclear Information System (INIS)

Booz, J.; Fidorra, J.; Smit, T.; Charlton, D.E.

1978-01-01

The dosimetry and microdosimetry of iodine-125 and Tritium were analyzed. In particular, a detailed examination of the number and energies of the electrons emitted by iodine-125 was performed and the result considerably changed the currently available data. In this paper, the result of this examination will be summarized and the radiobiological implications will be discussed. A new model of the radiation mechanism of iodine-125 is proposed, which takes the high energy deposition at the molecular level and the high number of emitted Auger-electrons into consideration. On the basis of this model it is concluded that about 40 primary lesions are needed in the DNA for the cellular inactivation of T-cells. (orig./AJ) [de

Microchemical synthesis of the serotonin receptor ligand, 125I-LSD

International Nuclear Information System (INIS)

Hartig, P.R.; Krohn, A.M.; Hirschman, S.A.

1985-01-01

The synthesis and properties of 2-[ 125 I]-lysergic acid diethylamide, the first 125 I-labeled serotonin receptor ligand, are described. A novel microsynthesis apparatus was developed for this synthesis. The apparatus employs a micromanipulator and glass micro tools to handle microliter to nanoliter volumes on a microscope stage. This apparatus should be generally useful for the synthesis of radioligands and other compounds when limited amounts of material must be handled in small volumes

Chloroquine allows the secretion of internalized 125I-epidermal growth factor from fibroblasts

International Nuclear Information System (INIS)

Wakshull, E.; Cooper, J.L.; Wharton, W.

1985-01-01

Incubation of cells with labelled hormone in the presence of the lysosomotropic agent chloroquine produces an enhanced intracellular accumulation of hormone and receptor. Using a pulse-chase paradigm in which cell surface receptors were labelled with 125 I-EGF at 4 degrees C, it was found that when 100 microM chloroquine was present in the 37 degrees C chase medium intact hormone was accumulated in the medium. Without chloroquine, low molecular weight (mw) degradation products were found in the medium. The processes of receptor-mediated endocytosis and subcellular distribution of 125 I-EGF-receptor complexes were unchanged by chloroquine. The source of the intact hormone accumulating in the medium was therefore an intracellular compartment(s). The 125 I-EGF released from the cells could rebind to surface receptors and be re-internalized; rebinding was inhibited by unlabelled EGF or Concanavalin A in the incubation medium. The concentration of unlabelled EGF required to inhibit rebinding was more than three orders of magnitude greater than the amount of 125 I-EGF whose rebinding was inhibited. Thus, the 125 I-EGF released from intracellular sites was rebound preferentially over exogenous EGF. The possible pathways for secretion of intact 125 I-EGF and mechanisms of its preferential rebinding are discussed

Synthetic. cap alpha. subunit peptide 125-147 of human nicotinic acetylcholine receptor induces antibodies to native receptor

Energy Technology Data Exchange (ETDEWEB)

McCormick, D.J.; Griesmann, G.E.; Huang, Z.; Lennon, V.A.

1986-03-05

A synthetic peptide corresponding to residues 125-147 of the Torpedo acetylcholine receptor (AChR) ..cap alpha.. subunit proved to be a major antigenic region of the AChR. Rats inoculated with 50 ..mu..g of peptide (T ..cap alpha.. 125-147) developed T cell immunity and antibodies to native AChR and signs of experimental autoimmune myasthenia gravis. They report the synthesis and preliminary testing of a disulfide-looped peptide comprising residues 125-147 of the human AChR ..cap alpha.. subunit. Peptide H ..cap alpha.. 125-147 differs from T ..cap alpha.. 125-147 at residues 139 (Glu for Gln) and 143 (Ser for Thr). In immunoprecipitation assays, antibodies to Torpedo AChR bound /sup 125/I-labelled H..cap alpha.. 125-147 antibody bound H..cap alpha.. 125-147, but monoclonal antibodies to an immunodominant region of native AChR bound neither H..cap alpha.. 125-147 nor T ..cap alpha.. 125-147. Rats immunized with H ..cap alpha.. 125-147 produced anti-mammalian muscle AChR antibodies that induced modulation of AChRs from cultured human myotubes. Thus, region 125-147 of the human AChR ..cap alpha.. subunit is extracellular in muscle, and is both antigenic and immunogenic. It remains to be determined whether or not autoantibodies to this region may in part cause the weakness or myasthenia gravis in man.

Investigation of internalization and cytotoxicity of 125I-[Tyr3]-octreotide in NCI-H446 cell line

International Nuclear Information System (INIS)

Sun Junjie; Fan Wo; Xu Yujie; Zhang Youjiu; Zhu Ran; Hu Mingjiang

2004-01-01

Objective: To investigate the [Tyr 3 ]-octreotide (TOC) internalizing capacity of NCI-H446 cell line, and the cytotoxicity of 125 I-TOC in NCI-H446 cell line. To assess the therapeutic radiopharmaceutical potentiality of 125 I-TOC for the somatostatin receptor (SSTR) positive tumor. Methods: NCI-H446 cells were incubated together with 125 I-TOC for different periods of time, the amount of internalized 125 I-TOC and the 125 I-TOC bound on the cellular nucleus were detected with γ counter, respectively. The viability of the cells was analyzed by a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay at different time points with various doses of 125 I-TOC, free 125 I and TOC. Results: 125 I-TOC was internalized into the nucleus and bound on the nucleus in a time-dependent manner. 125 I-TOC bound on the nucleus increased to the highest level at 24 h, the amount of nucleus bound 125 I-TOC at 24 h was 7 times higher than that at 0.5 h. Cytotoxicity of 125 I-TOC in SSTR positive NCI-H446 cells was also dose- and time-dependent. The supreme effect of cytotoxicity was found at 96 h with 74 kBq 125 I-TOC, the survival ratio of cells was reduced to (44.8 ± 7.2)%. Conclusions: 125 I-TOC can be internalized into SSTR positive cells mediated by SSTR. The NCI-H446 cells can be killed by Auger electron emitting from 125 I-TOC. Effect of cytotoxicity showed dose- and time-dependent

21 CFR 201.125 - Drugs for use in teaching, law enforcement, research, and analysis.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs for use in teaching, law enforcement, research, and analysis. 201.125 Section 201.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... § 201.125 Drugs for use in teaching, law enforcement, research, and analysis. A drug subject to § 201...

Synthesis, in vitro pharmacologic characterization, and preclinical evaluation of N-[2-(1'-piperidinyl)ethyl]-3-[125I]iodo-4-methoxybenzamide (P[125I]MBA) for imaging breast cancer

International Nuclear Information System (INIS)

John, Christy S.; Bowen, Wayne D.; Fisher, Susan J.; Lim, Benjamin B.; Geyer, Brian C.; Vilner, Bertold J.; Wahl, Richard L.

1999-01-01

The goal of this study was to investigate the potential use of a radioiodinated benzamide, N-[2-(1'-piperidinyl)ethyl]-3-iodo[ 125 I]-4-methoxybenzamide (P[ 125 I]MBA), a sigma receptor binding radioligand for imaging breast cancer. The chemical and radiochemical syntheses of PIMBA are described. The pharmacological evaluation of PIMBA was carried out for sigma-1 and sigma-2 receptor sites. The in vivo pharmacokinetics of the radioiodinated benzamide were determined in rats and comparison of P[ 125 I]MBA with Tc-99m sestamibi were made in a rat mammary tumor model. Sigma-1 affinity (K i ) for PIMBA in guinea pig brain membranes using [ 3 H](+)pentazocine was found to be 11.82±0.68 nM, whereas sigma-2 affinity in rat liver using [ 3 H]DTG (1,3-o-di-tolylguanidine) was 206±11 nM. Sites in guinea pig brain membranes labeled by P[ 125 I]MBA showed high affinity for haloperidol, (+)-pentazocine, BD1008, and PIMBA ( K i =4.87±1.49,8.81±1.97,0.057±0.005,46.9±1.8 nM, respectively). Competition binding studies were carried out in human ductal breast carcinoma cells (T47D). A dose-dependent inhibition of specific binding was observed with several sigma ligands. K i values for the inhibition of P[ 125 I]MBA binding in T47D cells for haloperidol, N-[2-(1'-piperidinyl)]ethyl]4-iodobenzamide (IPAB), N-(N-benzylpiperidin-4-yl)-4-iodobenzamide (4-IBP), and PIMBA were found to be 1.30±0.07, 13±1.5, 5.19±2.3, 1.06±0.5 nM, respectively. The in vitro binding data in guinea pig brain membranes and breast cancer cells confirmed binding to sigma sites. The saturation binding of P[ 125 I]MBA in T47D cells as studied by Scatchard analysis showed saturable binding, with a K d =94±7 nM and a B max =2035±305 fmol/mg of proteins. Biodistribution studies in Sprague-Dawley rats showed a rapid clearance of P[ 125 I]MBA from the normal organs. The potential of PIMBA in imaging breast cancer was evaluated in Lewis rats bearing syngeneic RMT breast cancers, a cancer that closely mimics

Organic Linker Defines the Excited-State Decay of Photocatalytic MIL-125(Ti)-Type Materials.

Science.gov (United States)

Santaclara, Jara G; Nasalevich, Maxim A; Castellanos, Sonia; Evers, Wiel H; Spoor, Frank C M; Rock, Kamila; Siebbeles, Laurens D A; Kapteijn, Freek; Grozema, Ferdinand; Houtepen, Arjan; Gascon, Jorge; Hunger, Johannes; van der Veen, Monique A

2016-02-19

Recently, MIL-125(Ti) and NH2 -MIL-125(Ti), two titanium-based metal-organic frameworks, have attracted significant research attention in the field of photocatalysis for solar fuel generation. This work reveals that the differences between these structures are not only based on their light absorption range but also on the decay profile and topography of their excited states. In contrast to MIL-125(Ti), NH2 -MIL-125(Ti) shows markedly longer lifetimes of the charge-separated state, which improves photoconversion by the suppression of competing decay mechanisms. We used spectroelectrochemistry and ultrafast spectroscopy to demonstrate that upon photoexcitation in NH2 -MIL-125(Ti) the electron is located in the Ti-oxo clusters and the hole resides on the aminoterephthalate unit, specifically on the amino group. The results highlight the role of the amino group in NH2 -MIL-125(Ti), the electron donation of which extends the lifetime of the photoexcited state substantially. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

40 CFR 1045.125 - What maintenance instructions must I give to buyers?

Science.gov (United States)

2010-07-01

... give to buyers? 1045.125 Section 1045.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... maintenance within the useful life period for aftertreatment devices, pulse-air valves, fuel injectors, oxygen... to address problems related to special situations, such as atypical engine operation. You must...

5 CFR 1201.125 - Administrative law judge.

Science.gov (United States)

2010-01-01

... PRACTICES AND PROCEDURES Procedures for Original Jurisdiction Cases Special Counsel Disciplinary Actions § 1201.125 Administrative law judge. (a) An administrative law judge will hear a disciplinary action... complaint seeking disciplinary action against a Federal or District of Columbia government employee for a...

A description of odd mass Xe and Te isotopes in the Interacting Boson–Fermion Model

Energy Technology Data Exchange (ETDEWEB)

Abu-Musleh, S. [National Center of Research, Gaza, Palestine (Country Unknown); Phys. Dep., Faculty of Women for Art, Science and Education, Ain Shams University, Cairo (Egypt); Abu-Zeid, H.M. [Phys. Dep., Faculty of Women for Art, Science and Education, Ain Shams University, Cairo (Egypt); Scholten, O. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA, Groningen (Netherlands)

2014-07-15

Recent interest in spectroscopic factors for single-neutron transfer in low-spin states of the even–odd Xenon {sup 125,127,129.131}Xe and even–odd Tellurium, {sup 123,125,127,129,131}Te isotopes stimulated us to study these isotopes within the framework of the Interacting Boson–Fermion Model. The fermion that is coupled to the system of bosons is taken to be in the positive parity 3s{sub 1/2}, 2d{sub 3/2}, 2d{sub 5/2}, 1g{sub 7/2} and in the negative 1h{sub 11/2} single-particle orbits, the complete 50–82 major shell. The calculated energies of low-spin energy levels of the odd isotopes are found to agree well with the experimental data. Also, B(E2), B(M1) values and spectroscopic factors for single-neutron transfer are calculated and compared with experimental data.

Interstitially implanted I125 for prostate cancer using transrectal ultrasound

International Nuclear Information System (INIS)

Greenburg, S.; Petersen, J.; Hansen-Peters, I.; Baylinson, W.

1990-01-01

Prostate cancer is the third leading cause of death from cancer among men in the United States. Traditional treatments for prostate cancer are prostatectomy, external beam irradiation, and interstitial implantation of Iodine125 (I125) via laparotomy. These treatments are associated with significant morbidity and limitations. Based on experience with I125 interstitial implantation by transrectal ultrasound guidance for early-stage prostate cancer, it seems that this newer method of treatment has greater accuracy of placement and distribution of the isotope and has had few reported complications. The need for a surgical incision has been eliminated. Hospitalization time also has been decreased, creating the need for ambulatory and inpatient nurses to understand the importance of their respective roles in providing coordinated quality care for these patients. Nurses in these departments must have knowledge of the procedure, radiation safety, and common side effects related to the implant

Proteolytic activity of beef liver determined by natural /sup 125/I-labelled substrates

Energy Technology Data Exchange (ETDEWEB)

Blahovec, J; Ondrus, I [Vysoka Skola Veterinarska, Kosice (Czechoslovakia)

1975-07-01

The method of determining the enzymatic activity of acid proteinases is described. The method is based on the use of /sup 125/I-labelled natural protein substrates. /sup 125/I-labelled albumin, /sup 125/I-globulin and /sup 125/I-insulin were tested for the determination of activities. All the substrates were hydrolyzed with the enzymes of the supernatant fraction (106,000 g) of beef liver homogenate in the acid pH zone. Optimum enzymatic reaction conditions were tested, the dependence of the reaction on the enzyme concentration, time and temperature was determined, pH optimum was ascertained for the individual substrates, and pH stability was determined. The results show that the method is suitable for determining the enzymatic activity of proteinases of cathepsin character.

40 CFR 125.122 - Determination of unreasonable degradation of the marine environment.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Determination of unreasonable degradation of the marine environment. 125.122 Section 125.122 Protection of Environment ENVIRONMENTAL... environment. (a) The director shall determine whether a discharge will cause unreasonable degradation of the...

Role of TPS in 125I brachytherapy for orbital tumors

International Nuclear Information System (INIS)

Ren Ling; Dai Haojie; Li Quan

2012-01-01

Objective: To investigate the role of TPS in 125 I brachytherapy for orbital tumors. Methods: Sixty-six patients with orbital tumor treated with 125 I seeds from 2005 to 2009 were retrospectively analyzed. Forty-three patients were treated using TPS guided brachytherapy and the prescribed dose was 140 Gy. Other 23 patients were treated without TPS but simply implanted with 125 I seeds at 1 cm intervals in parallel with each other intraoperatively. CT and TPS quality verification were performed postoperatively in all patients. Also, CT and (or) MRI examination were performed at 3, 6, 12 and 24 months after brachytherapy for follow-up. χ 2 test and Kaplan-Meier survival analysis with log-rank significance test were used with SPSS 17.0. Results: A total of 1070 125 I seeds were implanted in 66 cases, on average, (16.2 ± 7.3) seeds for each patient. The satisfaction rates of postoperative quality verification in patients with and without TPS pre-plans were 79.07% (34/43) and 43.48% (10/23) respectively (χ 2 =8.542, P=0.003). Ten patients were lost in follow-up. Local recurrence rates in patients with favorable postoperative quality verification were 0 (0/37) in 3 months, 6.25% (2/32) in 6 months, 13.64% (3/22) in 12 months and 3/9 in 24 months respectively, which were significantly different from those (5.26% (1/19), 16.67% (3/18), 30.77% (4/13), 6/6) in the patients with inferior postoperative quality verification (χ 2 =9.017, P=0.0003). Conclusions: TPS plays an important role in 125 I brachytherapy for orbital tumors. Also, postoperative quality verification by TPS may help predict the local recurrence after brachytherapy. (authors)

Inulin-125I-tyramine, an improved residualizing label for studies on sites of catabolism of circulating proteins

International Nuclear Information System (INIS)

Maxwell, J.L.; Baynes, J.W.; Thorpe, S.R.

1988-01-01

Residualizing labels for protein, such as dilactitol-125I-tyramine (125I-DLT) and cellobiitol-125I-tyramine, have been used to identify the tissue and cellular sites of catabolism of long-lived plasma proteins, such as albumin, immunoglobulins, and lipoproteins. The radioactive degradation products formed from labeled proteins are relatively large, hydrophilic, resistant to lysosomal hydrolases, and accumulate in lysosomes in the cells involved in degradation of the carrier protein. However, the gradual loss of the catabolites from cells (t1/2 approximately 2 days) has limited the usefulness of residualizing labels in studies on longer lived proteins. We describe here a higher molecular weight (Mr approximately 5000), more efficient residualizing glycoconjugate label, inulin-125I-tyramine (125I-InTn). Attachment of 125I-InTn had no effect on the plasma half-life or tissue sites of catabolism of asialofetuin, fetuin, or rat serum albumin in the rat. The half-life for hepatic retention of degradation products from 125I-InTn-labeled asialofetuin was 5 days, compared to 2.3 days for 125I-DLT-labeled asialofetuin. The whole body half-lives for radioactivity from 125I-InTn-, 125I-DLT-, and 125I-labeled rat serum albumin were 7.5, 4.3, and 2.2 days, respectively. The tissue distribution of degradation products from 125I-InTn-labeled proteins agreed with results of previous studies using 125I-DLT, except that a greater fraction of total degradation products was recovered in tissues. Kinetic analyses indicated that the average half-life for retention of 125I-InTn degradation products in tissues is approximately 5 days and suggested that in vivo there are both slow and rapid routes for release of degradation products from cells

Radioimmunoassay for etorphine in horses with a 125I analog of etorphine

International Nuclear Information System (INIS)

Tai, C.L.; Wang, C.; Weckman, T.J.; Popot, M.A.; Woods, W.E.; Yang, J.M.; Blake, J.; Tai, H.H.; Tobin, T.

1988-01-01

To improve the sensitivity and specificity of screening for etorphine in horses, an 125 I-labeled etorphine analog was synthesized and an antibody to etorphine was raised in rabbits. A radioimmunoassay (RIA) for etorphine was developed, using these reagents. Bound and free 125 I-labeled etorphine was separated by a double-antibody method that reduced interference from materials associated with equine urine. The 125 I-labeled etorphine binding was rarely greater than 250 pg of background etorphine equivalents/ml in raw urine and was 100 pg/ml in hydrolyzed urine. The 125 I-RIA was capable of detecting etorphine equivalents in urine above these background values. Etorphine equivalents were detected in equine urine samples for about 7 days after 4 mares were dosed with 0.22 microgram of etorphine/kg of body weight, IV. The stability of etorphine in urine from these mares was evaluated. Urine from these dosed mares was held in constant -20 C storage, and aliquots were repeatedly frozen and thawed. When analyzed for etorphine equivalents using an 125 I-RIA, etorphine and its metabolites in urine samples were stable for less than or equal to 38 days if continuously frozen and also were resistant to repeated freezing and thawing

Analysis of 125Xe electron-photon coincidence decay

International Nuclear Information System (INIS)

Klingberg, F.J.; Biegalski, S.R.

2016-01-01

As part of the verification component of the Comprehensive Nuclear-Test-Ban Treaty (CTBT), environmental gas samples originating from nuclear fission are analyzed for the presence of 131m Xe, 133m Xe, 133 Xe, and 135 Xe. In this work, the non-traditional radioxenon isotope 125 Xe was investigated. The isotope was produced as an isotopically pure sample via neutron activation of 124 Xe at the University of Texas at Austin Nuclear Engineering Teaching Lab's TRIGA MARK II Reactor. The sample was then measured using a HPGe detector as well as an ARSA-style b-c coincidence detector. Potential sources and sensitivities for production of 125 Xe are also considered for relevance to the CTBT verification mission. (author)

Iodine-125 implants for carcinoma of the prostate

International Nuclear Information System (INIS)

Peschel, R.E.; Fogel, T.D.; Kacinski, B.M.; Kelly, K.; Mate, T.P.

1985-01-01

One hundred-thirteen patients underwent Iodine-125 prostate implant and lymphadenectomy at Yale-New Haven Hospital from 1974 through 1980. The distribution by clinical stage was: 7 Stage A2, 86 Stage B, and 20 Stage C patients. Ninety-four patients had a negative lymphadenectomy and 19 patients (17%) had metastatic disease in the pelvic lymph nodes (N+). The actuarial 5-year survival for all 113 patients was 87%. Local tumor control was 85% for all Stage B patients and 75% for all Stage C patients. Only 10 patients (9%) have developed long-term gastrointestinal or genitourinary complications following their implant. Iodine-125 implant appears to be a reasonable alternate form of therapy in highly selected groups of patients with carcinoma of the prostate

Identification of beta 2-adrenoceptors on guinea pig alveolar macrophages using (-)-3-[125I]iodocyanopindolol

International Nuclear Information System (INIS)

Leurs, R.; Beusenberg, F.D.; Bast, A.; Van Amsterdam, J.G.; Timmerman, H.

1990-01-01

The beta-adrenoceptor antagonist (-)-3-[ 125 I]iodocyanopindolol ([ 125 I]ICYP) binds with high affinity and in saturable way to membranes of guinea pig alveolar macrophages. The equilibrium dissociation constant for [ 125 I]ICYP is 24.3 +/- 1.2 pM, and the number of binding sites is 166.3 +/- 13.7 fmol/mg protein (N = 4, +/- SEM). Displacement studies with selective antagonists showed that [ 125 I]ICYP labels beta 2-adrenoceptors on guinea pig alveolar macrophages

Substitution of 125-I-T3, 125-I-T4 and 125-I-TSH produced in the ININ, in commercial boxes for radioimmunoessay; Substitucion de 125-I-T3, 125-I-T4 y 125-I-TSH producidas en el ININ, en estuches comerciales para radioinmunoanalisis

Energy Technology Data Exchange (ETDEWEB)

Delgado S, B; Zambrano A, F; Lavalley E, C; Ferro F, G; Lezama C, J

1991-03-15

Due to the half, relatively short life, of the I-125 used in the radioinmunoanalisis (he/she LAUGHS) of hormones realcionadas with the thyroid, frequently it is observed that they are the other reagents of commercial cases without using, reason for the one which you piede the possibility to use in their entirety statements kits for the CREEK, what causes lost economic and another type of deficiencies. Presently work the results are presented obtained on the characteristics of quality of commercial stuches for the CREEK of hormones of the thyroid profile (T3, T4 and TSH), after substituting to the different radiotrazadores in this cases. The marcaje of the hormones with I-125 was made by means of the method of the cloramina T with 25 seconds of reaction for each hormone, purifying the T3 and the T4 for cromatografia liquidates of high efficiency and to the TSH for cromatografia of likeness in a column of cellulose microcristalina of 6 x 0.8 cm. the substitution of the radiotrazador is made in the commercial cases and the protocol was continued proposed by the makers, giving a coefficient of correlation of -0-997, as a result after the comparison of the straight line among the cases without and with substitution of the radiotrazador; besides certain parameters of quality of the such rehearsals as: the maximum unions (50%+-5) and inespecifica (<5%), slope of the straight line (-2.1 + - 0.2), and other coming from the use of samples of control of quality. We can conclude that at the moment we have in the ININ radiotrazadores of T3, T4 and TSH of good quality, like to be substituted in commercial cases and to use this way to the maximum these games of reagents that are so expensive. (Author)

Study on apoptosis of prostate cancer cell induced by 125I seed irradiation

International Nuclear Information System (INIS)

Liao Anyan; Wang Junjie; Wang Jidong; Zhuang Hongqing; Zhao Yong

2007-01-01

Objective: To explore the mechanism of apoptosis induced by 125 I seed irradiation on PC3 cells. Methods: Human prostate cancer cell line PC3 was treated by irradiation of 125 I (2.77 cGy/h) with various dose. Agarose gel electrophoresis of DNA and flows cytometry were used to detect the apoptosis of PC3 cells and indirect immunofluorescence assay was used to detect the expression of Bcl-2. The activity of Caspase-3 was measured by Caspase Colorimetric Assay Kits. Results: Apoptosis of PC3 cells could be efficiently induced by 125 I seed irradiation. The apoptotic peaks were found by flow cytometry and DNA ladder appeared on 1.8% agarose gel. The activity of Caspase-3 on PC3 cells treated by 125 I seed irradiation was not changed significantly. Bcl-2 gene expression was down-regulated with the sample concentration increased. Conclusion: 125 I irradiation can induce the apoptosis of PC3 cells and the mechanism of apoptosis is related with down regulation of Bcl-2 gene expression and is not related with Caspase-3 activity. (authors)

A comparative study of 19-iodo cholesterol-125I 3-acetate and Na 125I in liquid scintillation measurements

International Nuclear Information System (INIS)

Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J. M.; Grau Carles, A.

1994-01-01

A comparative study of performance of 19-iodo cholesterol 1 25I 3-acetate and sodium iodide samples labeled with 125I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I concentration of 0-90 μg and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol 1 I 3-acetate samples in Tolue ne-alcohol and 0 .04% for Na 125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs

In vivo binding of 125I-LSD to serotonin 5-HT2 receptors in mouse brain

International Nuclear Information System (INIS)

Hartig, P.R.; Scheffel, U.; Frost, J.J.; Wagner, H.N. Jr.

1985-01-01

The binding of 125 I-LSD (2-[ 125 I]-lysergic acid diethylamide) was studied in various mouse brain regions following intravenous injection of the radioligand. The high specific activity of 125 I-LSD enabled the injection of low mass doses (14ng/kg), which are well below the threshold for induction of any known physiological effect of the probe. The highest levels of 125 I-LSD binding were found in the frontal cortex, olfactory tubercles, extra-frontal cortex and striatum while the lowest level was found in the cerebellum. Binding was saturable in the frontal cortex but increased linearly in the cerebellum with increasing doses of 125 I-LSD. Serotonergic compounds potently inhibited 125 I-LSD binding in cortical regions, olfactory tubercles, and hypothalamus but had no effect in the cerebellum. Dopaminergic compounds caused partial inhibition of binding in the striatum while adrenergic compounds were inactive. From these studies the authors conclude that 125 I-LSD labels serotonin 5-HT 2 receptor sites in cortical regions with no indication that other receptor sites are labeled. In the olfactory tubercles and hypothalamus, 125 I-LSD labeling occurs predominantly or entirely at serotonic 5-HT 2 sites. In the striatum, 125 I-LSD labels approximately equal proportions of serotonergic and dopaminergic sites. These data indicate that 125 I-LSD labels serotonin receptors in vivo and suggests that appropriate derivatives of 2I-LSD may prove useful for tomographic imaging of serotonin 5-HT 2 receptors in the mammalian cortex

The expression of miR-125b regulates angiogenesis during the recovery of heat-denatured HUVECs.

Science.gov (United States)

Zhou, Situo; Zhang, Pihong; Liang, Pengfei; Huang, Xiaoyuan

2015-06-01

In previous studies we found that miR-125b was down-regulated in denatured dermis of deep partial thickness burn patients. Moreover, miR-125b inhibited tumor-angiogenesis associated with the decrease of ERBB2 and VEGF expression in ovarian cancer cells and breast cancer cells, etc. In this study, we investigated the expression patterns and roles of miR-125b during the recovery of denatured dermis and heat-denatured human umbilical vein endothelial cells (HUVECs). Deep partial thickness burns in Sprague-Dawley rats and the heat-denatured cells (52°C, 35 s) were used for analysis. Western blot analysis and real-time PCR were applied to evaluate the expression of miR-125b and ERBB2 and VEGF. The ability of angiogenesis in heat-denatured HUVECs was analyzed by scratch wound healing and tube formation assay after pri-miR-125b or anti-miR-125b transfection. miR-125b expression was time-dependent during the recovery of heat-denatured dermis and HUVECs. Moreover, miR-125b regulated ERBB2 mRNA and Protein Expression and regulated angiogenesis association with regulating the expression of VEGF in heat-denatured HUVECs. Taken together our results show that the expression of miR-125b is time-dependent and miR-125b plays a regulatory role of angiogenesis during wound healing after burns. Copyright © 2014 Elsevier Ltd and ISBI. All rights reserved.

Targeted radiotherapy of multicell neuroblastoma spheroids with high specific activity [125I]meta-iodobenzylguanidine

International Nuclear Information System (INIS)

Roa, Wilson H.Y.; Miller, Gerald G.; McEwan, Alexander J.B.; McQuarrie, Steve A.; Tse, Jeanie; Wu, Jonn; Wiebe, Leonard I.

1998-01-01

Purpose: Iodine-125 induces cell death by a mechanism similar to that of high linear energy transfer (high-LET) radiation. This study investigates the cytotoxicity of high-specific-activity [ 125 I]meta-iodobenzylguanidine ( 125 I-mIBG) in human SK-N-MC neuroblastoma cells grown as three-dimensional multicellular spheroids. Materials and Methods: Spheroids were incubated with high-specific-activity 125 I-mIBG (6 mCi/μg, 1000 times that of the conventional specific activity used for autoradiography). Cytotoxicity was assessed by fluorescence viability markers and confocal microscopy for intact spheroids, fluorescence-activated cell sorting and clonogenic assay, and clonogenic assays for dispersed whole spheroids. Distribution of radioactive mIBG was determined by quantitative light-microscope autoradiography of spheroid cryostat sections. Dose estimation was based on temporal knowledge of the retained radioactivity inside spheroids, and of the radiolabel's emission characteristics. Findings were compared with those of spheroids treated under the same conditions with 131 I-mIBG, cold mIBG, and free iodine-125. Results: 125 I-mIBG exerted significant cell killing. Complete spheroids were eradicated when they were treated with 500 μCi of 125 I-mIBG, while those treated with 500 μCi or 1000 μCi of 131 I-mIBG were not. The observed difference in cytotoxicity between treatments with 125 I- and 131 I-mIBG could not be accounted for by the absorbed dose of spheroid alone. The peripheral, proliferating cell layer of the spheroids remained viable at the moderate radioactivity of 100 μCi for both isotopes. Cytotoxicity induced by 125 I-mIBG was quantitatively comparable by the peripheral rim thickness to that of 131 I-mIBG at the dose of 100 μCi. The peripheral rim thickness decreased most significantly in the first 17 hours after initial treatment. There was no statistical decrease in the rim thickness identified afterwards for the second, third, and fourth days of

40 CFR 1048.125 - What maintenance instructions must I give to buyers?

Science.gov (United States)

2010-07-01

... using fuel that causes substantially more engine performance problems than commercial fuels of the same... give to buyers? 1048.125 Section 1048.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... intervals, except as specified in paragraphs (a)(3), (b) and (c) of this section: (i) For catalysts, fuel...

Prokofiev: Sinfonia Concertante Op. 125 / Pierre-E. Barbier

Index Scriptorium Estoniae

Barbier, Pierre-E.

1998-01-01

Uuest heliplaadist "Prokofiev: Sinfonia Concertante Op. 125; Miaskowsky: Cello Concerto Op. 66, sellisti Truls Mörk ja City of Birmingham Symphony Orchestra, joht. Paavo Järvi" Virgin Classics 5 45282 2. (1988)

7 CFR 929.125 - Committee review procedures.

Science.gov (United States)

2010-01-01

... MASSACHUSETTS, RHODE ISLAND, CONNECTICUT, NEW JERSEY, WISCONSIN, MICHIGAN, MINNESOTA, OREGON, WASHINGTON, AND LONG ISLAND IN THE STATE OF NEW YORK Rules and Regulations § 929.125 Committee review procedures... Committee within 30 days after receipt of the Committee's determination of sales history, a request for a...

I-125 seed dose estimates in heterogeneous phantom

International Nuclear Information System (INIS)

Branco, Isabela S.L.; Antunes, Paula C.G.; Cavalieri, Tassio A.; Moura, Eduardo S.; Zeituni, Carlos A.; Yoriyaz, Helio

2015-01-01

Brachytherapy plays an important role in the healing process involving tumors in a variety of diseases. Several studies are currently conducted to examine the heterogeneity effects of different tissues and organs in brachytherapy clinical situations and a great effort has been made to incorporate new methodologies to estimate doses with greater accuracy. The objective of this study is to contribute to the assessment of heterogeneous effects on dose due to I-125 brachytherapy source in the presence of different materials with different densities and chemical compositions. The study was performed in heterogeneous phantoms using materials that simulate human tissues. Among these is quoted: breast, fat, muscle, lungs (exhaled and inhaled) and bones with different densities. Monte Carlo simulations for dose calculation in these phantoms were held and subsequently validated. The model 6711 I-125 seed was considered because it is widely used as a brachytherapy permanent implant and the one used in clinics and hospitals in Brazil. Thermoluminescent dosimeters TLD-700 (LiF: Mg, Ti) were simulated for dose assess. Several tissue configurations and positioning of I-125 sources were studied by simulations for future dose measurements. The methodology of this study so far shall be suitable for accurate dosimetric evaluation for different types of brachytherapy treatments, contributing to brachytherapy planning systems complementation allowing a better assessment of the dose actually delivered to the patient. (author)

I-125 seed dose estimates in heterogeneous phantom

Energy Technology Data Exchange (ETDEWEB)

Branco, Isabela S.L.; Antunes, Paula C.G.; Cavalieri, Tassio A.; Moura, Eduardo S.; Zeituni, Carlos A.; Yoriyaz, Helio, E-mail: isabela.slbranco@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2015-07-01

Brachytherapy plays an important role in the healing process involving tumors in a variety of diseases. Several studies are currently conducted to examine the heterogeneity effects of different tissues and organs in brachytherapy clinical situations and a great effort has been made to incorporate new methodologies to estimate doses with greater accuracy. The objective of this study is to contribute to the assessment of heterogeneous effects on dose due to I-125 brachytherapy source in the presence of different materials with different densities and chemical compositions. The study was performed in heterogeneous phantoms using materials that simulate human tissues. Among these is quoted: breast, fat, muscle, lungs (exhaled and inhaled) and bones with different densities. Monte Carlo simulations for dose calculation in these phantoms were held and subsequently validated. The model 6711 I-125 seed was considered because it is widely used as a brachytherapy permanent implant and the one used in clinics and hospitals in Brazil. Thermoluminescent dosimeters TLD-700 (LiF: Mg, Ti) were simulated for dose assess. Several tissue configurations and positioning of I-125 sources were studied by simulations for future dose measurements. The methodology of this study so far shall be suitable for accurate dosimetric evaluation for different types of brachytherapy treatments, contributing to brachytherapy planning systems complementation allowing a better assessment of the dose actually delivered to the patient. (author)

Effects of 1,25-dihydroxycholecalciferol on 47calcium absorption in post-menopausal osteoporosis.

Science.gov (United States)

Caniggia, A; Vattimo, A

1979-07-01

Measurement of 47Calcium absorption was performed on eleven women with post-menopausal osteoporosis. The study was repeated after 10 days treatment with 1 microgram daily of 1,25(OH)2D3. These patients showed a statistically significant improvement of fractional calcium absorption that was inversely correlated to the basal values. The prompt improvement of the intestinal calcium transport in post-menopausal osteoporotic women, a few days after the administration of physiological doses of 1,25(OH)2D3, suggests that these patients synthesize inappropriately small amounts of 1,25(OH)2D3 because of their oestrogen deficiency. This could be an important pathogenetic factor in post-menopausal osteoporosis, as the efficiency of the adaptation of calcium absorption to low calcium intakes is dependent on 1,25(OH)2D3.

Leaching of cadmium and tellurium from cadmium telluride (CdTe) thin-film solar panels under simulated landfill conditions.

Science.gov (United States)

Ramos-Ruiz, Adriana; Wilkening, Jean V; Field, James A; Sierra-Alvarez, Reyes

2017-08-15

A crushed non-encapsulated CdTe thin-film solar cell was subjected to two standardized batch leaching tests (i.e., Toxicity Characteristic Leaching Procedure (TCLP) and California Waste Extraction Test (WET)) and to a continuous-flow column test to assess cadmium (Cd) and tellurium (Te) dissolution under conditions simulating the acidic- and the methanogenic phases of municipal solid waste landfills. Low levels of Cd and Te were solubilized in both batch leaching tests (<8.2% and <3.6% of added Cd and Te, respectively). On the other hand, over the course of 30days, 73% of the Cd and 21% of the Te were released to the synthetic leachate of a continuous-flow column simulating the acidic landfill phase. The dissolved Cd concentration was 3.24-fold higher than the TCLP limit (1mgL -1 ), and 650-fold higher than the maximum contaminant level established by the US-EPA for this metal in drinking water (0.005mgL -1 ). In contrast, the release of Cd and Te to the effluent of the continuous-flow column simulating the methanogenic phase of a landfill was negligible. The remarkable difference in the leaching behavior of CdTe in the columns is related to different aqueous pH and redox conditions promoted by the microbial communities in the columns, and is in agreement with thermodynamic predictions. Copyright © 2017 Elsevier B.V. All rights reserved.