International Nuclear Information System (INIS)
Pyeon, Cheol Ho
2015-01-01
The proceedings describe the current status on research and development (R and D) of accelerator-driven system (ADS) and nuclear transmutation techniques (NTT), including nuclear data, accelerator techniques, Pb-Bi target, fuel technologies and reactor physics, in East Asian countries: China, Japan and Korea. The proceedings also include all presentation materials presented in 'the 12th International Workshop on Asian Network for ADS and NTT (ADS+NTT 2014)' held at the Institute of Nuclear Energy and Safety Technology, Chinese Academy of Sciences, Hefei, China on 15th and 16th December, 2014. The objective of this workshop is to make actual progress of ADS R and D especially in East Asian countries, as well as in European countries, through sharing mutual interests and conducting the information exchange each other. The report is composed of these following items: Presentation materials: ADS+NTT 2014. (author)
Deep Sky Diving with the ESO New Technology Telescope
1998-01-01
Preparations for future cosmological observations with the VLT Within a few months, the first 8.2-meter Unit Telescope of the ESO Very Large Telescope (VLT) array will open its eye towards the sky above the Atacama desert. As documented by recent Press Photos from ESO, the construction work at the Paranal VLT Observatory is proceeding rapidly. Virtually all of the telescope components, including the giant Zerodur mirror (cf. ESO PR Photos 35a-l/97 ), are now on the mountain. While the integration of the telescope and its many optical, mechanical and electronic components continues, astronomers in the ESO member countries and at ESO are now busy defining the observing programmes that will be carried out with the new telescope, soon after it enters into operation. In this context, new and exciting observations have recently been obtained with the 3.5-m New Technology Telescope at the ESO La Silla Observatory, 600 km to the south of Paranal. How to record the faintest and most remote astronomical objects With its very large mirror surface (and correspondingly great light collecting power), as well as an unsurpassed optical quality, the VLT will be able to look exceedingly far out into the Universe, well beyond current horizons. The best technique to record the faintest possible light and thus the most remote celestial objects, is to combine large numbers of exposures of the same field with slightly different telescope pointing. This increases the total number of photons recorded and by imaging the stars and galaxies on different areas (pixels) of the detector, the signal-to-noise ratio and hence the visibility of the faintest objects is improved. The famous Hubble Deep Field Images were obtained in this way by combining over 300 single exposures and they show myriads of faint galaxies in the distant realms of the Universe. The NTT as test bench for the VLT ESO is in the fortunate situation of possessing a `prototype' model of the Very Large Telescope, the 3.5-m New
International Nuclear Information System (INIS)
Pyeon, Cheol Ho
2016-09-01
The proceedings describe the current status on research and development (R and D) of accelerator-driven system (ADS) and nuclear transmutation techniques (NTT), including nuclear data, accelerator techniques, Pb-Bi target, fuel technologies and reactor physics, in East Asian countries: China, Korea and Japan. The proceedings also include all presentation materials presented in 'the 14th International Workshop on Asian Network for ADS and NTT (ADS-NTT2016)' held at Mito, Japan on 5th September, 2016. The objective of this workshop is to make actual progress of ADS R and D especially in East Asian countries, as well as in European countries, through sharing mutual interests and conducting the information exchange each other. The report is composed of these following items: Presentation materials: ADS-NTT 2016. (author)
International Nuclear Information System (INIS)
Pyeon, Cheol Ho
2014-01-01
The proceedings describe the current status on research and development (R and D) of accelerator-driven system (ADS) and nuclear transmutation techniques (NTT), including nuclear data, accelerator techniques, Pb-Bi target, fuel technologies and reactor physics, in East Asian countries: Korea, China and Japan. The proceedings also include all presentation materials presented in 'the 11th International Workshop on Asian Network for ADS and NTT (ADS+NTT 2013)' held at the Seoul National University, Seoul, Korea on 12th and 13th December, 2013. The objective of this workshop is to make actual progress of ADS R and D especially in East Asian countries, as well as in European countries, through sharing mutual interests and conducting the information exchange each other. The report is composed of these following items: Presentation materials: ADS+NTT 2013. (author)
Framework for parameterizing and validating APEX to support NTT
The Agricultural Policy Environmental eXtender (APEX) is the process model underlying the Nutrient Tracking Tool (NTT). The NTT provides users, primarily farmers and crop consultants, with the opportunity to compare the effects of two scenarios, practice combinations, or other alternative conditions...
The DAG project, a 4m class telescope: the telescope main structure performances
Marchiori, G.; Busatta, A.; Ghedin, L.; Marcuzzi, E.; Manfrin, C.; Battistel, C.; Pirnay, O.; Flebus, Carlo; Yeşilyaprak, C.; Keskin, O.; Yerli, S.
2016-07-01
Dogu Anatolu Gözlemevi (DAG-Eastern Anatolia Observatory) Project is a 4m class optical, near-infrared Telescope and suitable enclosure which will be located at an altitude of 3.170m in Erzurum, Turkey. The DAG telescope is a project fully funded by Turkish Ministry of Development and the Atatürk University of Astrophysics Research Telescope - ATASAM. The Project is being developed by the Belgian company AMOS (project leader), which is also the optics supplier and EIE GROUP, the Telescope Main Structure supplier and responsible for the final site integration. The design of the Telescope Main Structure fits in the EIE TBO Program which aims at developing a Dome/Telescope systemic optimization process for both performances and competitive costs based on previous project commitments like NTT, VLT, VST and ASTRI. The optical Configuration of the DAG Telescope is a Ritchey-Chretien with two Nasmyth foci and a 4m primary thin mirror controlled in shape and position by an Active Optic System. The main characteristics of the Telescope Main Structure are an Altitude-Azimuth light and rigid structure system with Direct Drive Systems for both axis, AZ Hydrostatic Bearing System and Altitude standard bearing system; both axes are equipped with Tape Encoder System. An innovative Control System characterizes the telescope performance.
A 16-m Telescope for the Advanced Technology Large Aperture Telescope (ATLAST) Mission
Lillie, Charles F.; Dailey, D. R.; Polidan, R. S.
2010-01-01
Future space observatories will require increasingly large telescopes to study the earliest stars and galaxies, as well as faint nearby objects. Technologies now under development will enable telescopes much larger than the 6.5-meter diameter James Webb Space Telescope (JWST) to be developed at comparable costs. Current segmented mirror and deployable optics technology enables the 6.5 meter JWST telescope to be folded for launch in the 5-meter diameter Ariane 5 payload fairing, and deployed autonomously after reaching orbit. Late in the next decade, when the Ares V Cargo Launch Vehicle payload fairing becomes operational, even larger telescope can be placed in orbit. In this paper we present our concept for a 16-meter JWST derivative, chord-fold telescope which could be stowed in the 10-m diameter Ares V fairing, plus a description of the new technologies that enable ATLAST to be developed at an affordable price.
Directory of Open Access Journals (Sweden)
Sergi Bermúdez i Badia
2012-01-01
Full Text Available After stroke, enduring rehabilitation is required for maximum recovery, and ideally throughout life to prevent functional deterioration. Hence we developed a new concept for at-home low-cost motor rehabilitation, the NTT, an Internet-based interactive system for upper-limb rehabilitation. In this paper we present the NTT design concepts, its implementation and a proof of concept study with 10 healthy participants. The NTT brings together concepts of optimal learning, engagement, and storytelling to deliver a personalized training to its users. In this study we evaluate the feasibility of NTT as a tool capable of automatically assessing and adapting to its user. This is achieved by means of a psychometric study where we show that the NTT is able to assess movement kinematics—movement smoothness, range of motion, arm displacement and arm coordination—in healthy users. Subsequently, a modeling approach is presented to understand how the measured movement kinematics relate to training parameters, and how these can be modified to adapt the training to meet the needs of patients. Finally, an adaptive algorithm for the personalization of training considering motivational and performance aspects is proposed. In the next phase we will deploy and evaluate the NTT with stroke patients at their homes.
Technological Aspects of Creating Large-size Optical Telescopes
Directory of Open Access Journals (Sweden)
V. V. Sychev
2015-01-01
Full Text Available A concept of the telescope creation, first of all, depends both on a choice of the optical scheme to form optical radiation and images with minimum losses of energy and information and on a choice of design to meet requirements for strength, stiffness, and stabilization characteristics in real telescope operation conditions. Thus, the concept of creating large-size telescopes, certainly, involves the use of adaptive optics methods and means.The level of technological capabilities to realize scientific and engineering ideas define a successful development of large-size optical telescopes in many respects. All developers pursue the same aim that is to raise an amount of information by increasing a main mirror diameter of the telescope.The article analyses the adaptive telescope designs developed in our country. Using a domestic ACT-25 telescope as an example, it considers creation of large-size optical telescopes in terms of technological aspects. It also describes the telescope creation concept features, which allow reaching marginally possible characteristics to ensure maximum amount of information.The article compares a wide range of large-size telescopes projects. It shows that a domestic project to create the adaptive ACT-25 super-telescope surpasses its foreign counterparts, and there is no sense to implement Euro50 (50m and OWL (100m projects.The considered material gives clear understanding on a role of technological aspects in development of such complicated optic-electronic complexes as a large-size optical telescope. The technological criteria of an assessment offered in the article, namely specific informational content of the telescope, its specific mass, and specific cost allow us to reveal weaknesses in the project development and define a reserve regarding further improvement of the telescope.The analysis of results and their judgment have shown that improvement of optical largesize telescopes in terms of their maximum
Basic and applied research at NTT and postgraduate education
International Nuclear Information System (INIS)
Kimura, Tatsuya
1995-01-01
Several current research topics, which are studied at NTT Basic Research Laboratories, are reviewed in the fields of semiconductor physics, quantum optics and biophysics. These topics include the surface structure transition of GaAs, InAs and Si, electron transport in low-dimensional structure, microcavity quantum-wire semiconductor lasers, quantum nondemolition measurement of fibre solitons, and artificial network development of cultivated neural cells. 32 refs., 33 fig
Using ISS to develop telescope technology
Saenz-Otero, Alvar; Miller, David W.
2005-08-01
Future space telescope missions concepts have introduced new technologies such as precision formation flight, optical metrology, and segmented mirrors. These new technologies require demonstration and validation prior to deployment in final missions such as the James Webb Space Telescope, Terrestrial Planet Finder, and Darwin. Ground based demonstrations do not provide the precision necessary to obtain a high level of confidence in the technology; precursor free flyer space missions suffer from the same problems as the final missions. Therefore, this paper proposes the use of the International Space Station as an intermediate research environment where these technologies can be developed, demonstrated, and validated. The ISS provides special resources, such as human presence, communications, power, and a benign atmosphere which directly reduce the major challenges of space technology maturation: risk, complexity, cost, remote operations, and visibility. Successful design of experiments for use aboard the space station, by enabling iterative research and supporting multiple scientists, can further reduce the effects of these challenges of space technology maturation. This paper presents results of five previous MIT Space Systems Laboratory experiments aboard the Space Shuttle, MIR, and the ISS to illustrate successful technology maturation aboard these facilities.
VLTI auxiliary telescopes: a full object-oriented approach
Chiozzi, Gianluca; Duhoux, Philippe; Karban, Robert
2000-06-01
The Very Large Telescope (VLT) Telescope Control Software (TCS) is a portable system. It is now in use or will be used in a whole family of ESO telescopes VLT Unit Telescopes, VLTI Auxiliary Telescopes, NTT, La Silla 3.6, VLT Survey Telescope and Astronomical Site Monitors in Paranal and La Silla). Although it has been developed making extensive usage of Object Oriented (OO) methodologies, the overall development process chosen at the beginning of the project used traditional methods. In order to warranty a longer lifetime to the system (improving documentation and maintainability) and to prepare for future projects, we have introduced a full OO process. We have taken as a basis the United Software Development Process with the Unified Modeling Language (UML) and we have adapted the process to our specific needs. This paper describes how the process has been applied to the VLTI Auxiliary Telescopes Control Software (ATCS). The ATCS is based on the portable VLT TCS, but some subsystems are new or have specific characteristics. The complete process has been applied to the new subsystems, while reused code has been integrated in the UML models. We have used the ATCS on one side to tune the process and train the team members and on the other side to provide a UML and WWW based documentation for the portable VLT TCS.
Determination of the Mean HI Absorption of the Intergalactic Medium ...
Indian Academy of Sciences (India)
4Inter-University Centre for Astronomy and Astrophysics, Post Bag 4, .... New Technology Telescope (NTT) of the European Southern Observatory (ESO) or .... Wavelengths were air-vacuum corrected using the Edlén (1966) formula.
Selling the Space Telescope - The interpenetration of science, technology, and politics
Smith, Robert W.
1991-01-01
Attention is given to the politics of initiating the Space Telescope program and to the manner in which the coalition, or working consensus, for the Telescope was assembled, in particular, the role played by astronomers. It is contended that what ensued was a case study in the influence of government patronage on a large-scale scientific and technological program. It is concluded that while a politically feasible Space Telescope did result, in the selling process the Telescope had been both oversold and underfunded.
Construction of the Advanced Technology Solar Telescope
Rimmele, T. R.; Keil, S.; McMullin, J.; Knölker, M.; Kuhn, J. R.; Goode, P. R.; Rosner, R.; Casini, R.; Lin, H.; Tritschler, A.; Wöger, F.; ATST Team
2012-12-01
The 4m Advance Technology Solar Telescope (ATST) will be the most powerful solar telescope and the world's leading ground-based resource for studying solar magnetism that controls the solar wind, flares, coronal mass ejections and variability in the Sun's output. The project has entered its construction phase. Major subsystems have been contracted. As its highest priority science driver ATST shall provide high resolution and high sensitivity observations of the dynamic solar magnetic fields throughout the solar atmosphere, including the corona at infrared wavelengths. With its 4m aperture, ATST will resolve features at 0.″03 at visible wavelengths and obtain 0.″1 resolution at the magnetically highly sensitive near infrared wavelengths. A high order adaptive optics system delivers a corrected beam to the initial set of state-of-the-art, facility class instrumentation located in the Coudé laboratory facility. The initial set of first generation instruments consists of five facility class instruments, including imagers and spectro-polarimeters. The high polarimetric sensitivity and accuracy required for measurements of the illusive solar magnetic fields place strong constraints on the polarization analysis and calibration. Development and construction of a four-meter solar telescope presents many technical challenges, including thermal control of the enclosure, telescope structure and optics and wavefront control. A brief overview of the science goals and observational requirements of the ATST will be given, followed by a summary of the design status of the telescope and its instrumentation, including design status of major subsystems, such as the telescope mount assembly, enclosure, mirror assemblies, and wavefront correction
Advanced UVOIR Mirror Technology Development (AMTD) for Very Large Space Telescopes
Stahl, H. Philip; Smith, W. Scott; Mosier, Gary; Abplanalp, Laura; Arnold, William
2014-01-01
ASTRO2010 Decadal stated that an advanced large-aperture ultraviolet, optical, near-infrared (UVOIR) telescope is required to enable the next generation of compelling astrophysics and exoplanet science; and, that present technology is not mature enough to affordably build and launch any potential UVOIR mission concept. AMTD builds on the state of art (SOA) defined by over 30 years of monolithic & segmented ground & space-telescope mirror technology to mature six key technologies. AMTD is deliberately pursuing multiple design paths to provide the science community with op-tions to enable either large aperture monolithic or segmented mirrors with clear engineering metrics traceable to science requirements.
Thin Mirror Shaping Technology for High-Throughput X-ray Telescopes
Schattenburg, Mark
This proposal is submitted to the NASA Research Opportunities in Space and Earth Sciences program (ROSES-2012) in response to NASA Research Announcement NNH12ZDA001N- APRA. It is targeted to the Astronomy and Astrophysics Research and Analysis (APRA) program element under the Supporting Technology category. Powerful x-ray telescope mirrors are critical components of a raft of small-to-large mission concepts under consideration by NASA. The science questions addressed by these missions have certainly never been more compelling and the need to fulfill NASA s core missions of exploring the universe and strengthening our nation s technology base has never been greater. Unfortunately, budgetary constraints are driving NASA to consider the cost/benefit and risk factors of new missions more carefully than ever. New technology for producing x-ray telescopes with increased resolution and collecting area, while holding down cost, are key to meeting these goals and sustaining a thriving high-energy astrophysics enterprise in the US. We propose to develop advanced technology which will lead to thin-shell x-ray telescope mirrors rivaling the Chandra x-ray telescope in spatial resolution but with 10-100X larger area all at significantly reduced weight, risk and cost. The proposed effort builds on previous research at MIT and complements NASA-supported research at other institutions. We are currently pursuing two thin-mirror technology development tracks which we propose to extend and accelerate with NASA support. The first research track utilizes rapidly-maturing thermal glass slumping technology which uses porous ceramic air-bearing mandrels to shape glass mirrors without touching, thus avoiding surface-induced mid-range spatial frequency ripples. A second research track seeks to remove any remaining mid- to long-range errors in mirrors by using scanning ion-beam implant to impart small, highly deterministic and very stable amounts of stress into thin glass, utilizing local
ATST telescope mount: telescope of machine tool
Jeffers, Paul; Stolz, Günter; Bonomi, Giovanni; Dreyer, Oliver; Kärcher, Hans
2012-09-01
The Advanced Technology Solar Telescope (ATST) will be the largest solar telescope in the world, and will be able to provide the sharpest views ever taken of the solar surface. The telescope has a 4m aperture primary mirror, however due to the off axis nature of the optical layout, the telescope mount has proportions similar to an 8 meter class telescope. The technology normally used in this class of telescope is well understood in the telescope community and has been successfully implemented in numerous projects. The world of large machine tools has developed in a separate realm with similar levels of performance requirement but different boundary conditions. In addition the competitive nature of private industry has encouraged development and usage of more cost effective solutions both in initial capital cost and thru-life operating cost. Telescope mounts move relatively slowly with requirements for high stability under external environmental influences such as wind buffeting. Large machine tools operate under high speed requirements coupled with high application of force through the machine but with little or no external environmental influences. The benefits of these parallel development paths and the ATST system requirements are being combined in the ATST Telescope Mount Assembly (TMA). The process of balancing the system requirements with new technologies is based on the experience of the ATST project team, Ingersoll Machine Tools who are the main contractor for the TMA and MT Mechatronics who are their design subcontractors. This paper highlights a number of these proven technologies from the commercially driven machine tool world that are being introduced to the TMA design. Also the challenges of integrating and ensuring that the differences in application requirements are accounted for in the design are discussed.
Telescopic Partial Dentures-Concealed Technology.
Bhagat, Tushar Vitthalrao; Walke, Ashwini Nareshchandra
2015-09-01
The ideal goal of good dentist is to restore the missing part of oral structure, phonetics, his look and the most important is restored the normal health of the patient, which is hampered due to less or insufficient intake of food. Removable partial denture (RPD) treatment option is considered as a notion, which precludes the inevitability of "floating plastic" in edentulous mouth, that many times fail to fulfill the above essential of the patients. In modern dentistry, though the dental implants or fixed partial denture is the better options, but they have certain limitations. However, overdentures and particularly telescopic denture is the overlooked technology in dentistry that would be a boon for such needy patients. Telescopic denture is especially indicated in the distal edentulous area with minimum two teeth bilaterally present with a good amount of periodontal support. This treatment modality is sort of preventive prosthodontics remedy, which in a conservative manner preserve the remaining teeth and helps in conservation of alveolar bone ultimately. There are two tenets related to this option, one is constant conservation edentulous ridge around the retained tooth and the most important is the endless existence of periodontal sensory action that directs and monitor gnathodynamic task. In this option the primary coping or inner coping are cemented on the prepared tooth, and a similar removable outer or inner telescopic crown placed tightly by using a mechanism of tenso-friction, this is firmly attached to a removable RPD in place without moving or rocking of the prosthesis, which is the common compliant of almost all patients of RPD. Copings are also protecting the abutment from tooth decay and also offers stabilization and maintaining of the outer crown. The outer crown engages the inner coping and gives as an anchor for the remainder of the dentition. This work is the review of telescopic prosthesis which is well supported by the case discussion, and
Enabling Telescopes of the Future: Long-Range Technology Investing
Thronson, Harley
2004-01-01
The Office of Space Science at NASA Headquarters has a current staff of about 60 professionals (aka, scientists, engineers, budget analysts) and an annual budget of $2.5 B out of NASA s $15.0 B. About 35 missions or programs in various stages of development or operation are managed by OSS, notable among them are Hubble Space Telescope, Mars Global Surveyor, Mars 2001 Odyssey, Chandra X-ray Observatory, TRACE (solar observatory), Cassini (mission to Saturn), Galileo (mission at Jupiter), and Next Generation Space Telescope. OSS has an annual technology budget of several hundred million dollars. So, what is it that we are doing?
The space telescope: A study of NASA, science, technology, and politics
Smith, Robert William
1989-01-01
Scientific, technological, economic, and political aspects of NASA efforts to orbit a large astronomical telescope are examined in a critical historical review based on extensive interviews with participants and analysis of published and unpublished sources. The scientific advantages of large space telescopes are explained; early plans for space observatories are summarized; the history of NASA and its major programs is surveyed; the redesign of the original Large Space Telescope for Shuttle deployability is discussed; the impact of the yearly funding negotiations with Congress on the development of the final Hubble Space Telescope (HST) is described; and the implications of the HST story for the future of large space science projects are explored. Drawings, photographs, a description of the HST instruments and systems, and lists of the major contractors and institutions participating in the HST program are provided.
Bolcar, Matthew R.; Balasubramanian, Kunjithapatham; Clampin, Mark; Crooke, Julie; Feinberg, Lee; Postman, Marc; Quijada, Manuel; Rauscher, Bernard; Redding, David; Rioux, Norman; Shaklan, Stuart; Stahl, H. Philip; Stahle, Carl; Thronson, Harley
2015-09-01
The Advanced Technology Large Aperture Space Telescope (ATLAST) team has identified five key technologies to enable candidate architectures for the future large-aperture ultraviolet/optical/infrared (LUVOIR) space observatory envisioned by the NASA Astrophysics 30-year roadmap, Enduring Quests, Daring Visions. The science goals of ATLAST address a broad range of astrophysical questions from early galaxy and star formation to the processes that contributed to the formation of life on Earth, combining general astrophysics with direct-imaging and spectroscopy of habitable exoplanets. The key technologies are: internal coronagraphs, starshades (or external occulters), ultra-stable large-aperture telescopes, detectors, and mirror coatings. Selected technology performance goals include: 1x10-10 raw contrast at an inner working angle of 35 milli-arcseconds, wavefront error stability on the order of 10 pm RMS per wavefront control step, autonomous on-board sensing and control, and zero-read-noise single-photon detectors spanning the exoplanet science bandpass between 400 nm and 1.8 μm. Development of these technologies will provide significant advances over current and planned observatories in terms of sensitivity, angular resolution, stability, and high-contrast imaging. The science goals of ATLAST are presented and flowed down to top-level telescope and instrument performance requirements in the context of a reference architecture: a 10-meter-class, segmented aperture telescope operating at room temperature (~290 K) at the sun-Earth Lagrange-2 point. For each technology area, we define best estimates of required capabilities, current state-of-the-art performance, and current Technology Readiness Level (TRL) - thus identifying the current technology gap. We report on current, planned, or recommended efforts to develop each technology to TRL 5.
Advanced Mirror Technology Development for Very Large Space Telescopes
Stahl, H. P.
2014-01-01
Advanced Mirror Technology Development (AMTD) is a NASA Strategic Astrophysics Technology project to mature to TRL-6 the critical technologies needed to produce 4-m or larger flight-qualified UVOIR mirrors by 2018 so that a viable mission can be considered by the 2020 Decadal Review. The developed mirror technology must enable missions capable of both general astrophysics & ultra-high contrast observations of exoplanets. Just as JWST’s architecture was driven by launch vehicle, a future UVOIR mission’s architectures (monolithic, segmented or interferometric) will depend on capacities of future launch vehicles (and budget). Since we cannot predict the future, we must prepare for all potential futures. Therefore, to provide the science community with options, we are pursuing multiple technology paths. AMTD uses a science-driven systems engineering approach. We derived engineering specifications for potential future monolithic or segmented space telescopes based on science needs and implement constraints. And we are maturing six inter-linked critical technologies to enable potential future large aperture UVOIR space telescope: 1) Large-Aperture, Low Areal Density, High Stiffness Mirrors, 2) Support Systems, 3) Mid/High Spatial Frequency Figure Error, 4) Segment Edges, 5) Segment-to-Segment Gap Phasing, and 6) Integrated Model Validation Science Advisory Team and a Systems Engineering Team. We are maturing all six technologies simultaneously because all are required to make a primary mirror assembly (PMA); and, it is the PMA’s on-orbit performance which determines science return. PMA stiffness depends on substrate and support stiffness. Ability to cost-effectively eliminate mid/high spatial figure errors and polishing edges depends on substrate stiffness. On-orbit thermal and mechanical performance depends on substrate stiffness, the coefficient of thermal expansion (CTE) and thermal mass. And, segment-to-segment phasing depends on substrate & structure stiffness
Takefuji, K.; Sugiyama, K.; Yonekura, Y.; Saito, T.; Fujisawa, K.; Kondo, T.
2017-11-01
For the sake of high-sensitivity 6.7 GHz methanol maser observations, we developed a new technology for coherently combining the two signals from the Hitachi 32 m radio telescope and the Takahagi 32 m radio telescope of the Japanese Very long baseline interferometer Network (JVN), where the two telescopes were separated by about 260 m. After the two telescopes were phased as a twofold larger single telescope, the mean signal-to-noise ratio (S/N) of the 6.7 GHz methanol masers observed by the phased telescopes was improved to 1.254-fold higher than that of the single dish, through a very long baseline interferometry (VLBI) experiment on the 50 km baseline of the Kashima 34 m telescope and the 1000 km baseline of the Yamaguchi 32 m telescope. Furthermore, we compared the S/Ns of the 6.7 GHz maser spectra for two methods. One is a VLBI method and the other is the newly developed digital position switching that is a similar technology to that used in noise-canceling headphones. Finally, we confirmed that the mean S/N of method of the digital position switching (ON-OFF) was 1.597-fold higher than that of the VLBI method.
Gambicorti, Lisa; D'Amato, Francesco; Vettore, Christian; Duò, Fabrizio; Guercia, Alessio; Patauner, Christian; Biasi, Roberto; Lisi, Franco; Riccardi, Armando; Gallieni, Daniele; Lazzarini, Paolo; Tintori, Matteo; Zuccaro Marchi, Alessandro; Pereira do Carmo, Joao
2017-11-01
The aim of this work is to describe the latest results of new technological concepts for Large Aperture Telescopes Technology (LATT) using thin deployable lightweight active mirrors. This technology is developed under the European Space Agency (ESA) Technology Research Program and can be exploited in all the applications based on the use of primary mirrors of space telescopes with large aperture, segmented lightweight telescopes with wide Field of View (FOV) and low f/#, and LIDAR telescopes. The reference mission application is a potential future ESA mission, related to a space borne DIAL (Differential Absorption Lidar) instrument operating around 935.5 nm with the goal to measure water vapor profiles in atmosphere. An Optical BreadBoard (OBB) for LATT has been designed for investigating and testing two critical aspects of the technology: 1) control accuracy in the mirror surface shaping. 2) mirror survivability to launch. The aim is to evaluate the effective performances of the long stroke smart-actuators used for the mirror control and to demonstrate the effectiveness and the reliability of the electrostatic locking (EL) system to restraint the thin shell on the mirror backup structure during launch. The paper presents a comprehensive vision of the breadboard focusing on how the requirements have driven the design of the whole system and of the various subsystems. The manufacturing process of the thin shell is also presented.
Required Technologies for A 10-16 m UV-Visible-IR Telescope on the Moon
Johnson, Stewart W.; Wetzel, John P.
1989-01-01
A successor to the Hubble Space Telescope, incorporating a 10 to 16 meter mirror, and operating in the UV-Visible-IR is being considered for emplacement on the Moon in the 21st Century. To take advantage of the characteristics of the lunar environment, such a telescope requires appropriate advances in technology. These technologies are in the areas of contamination/interference control, test and evaluation, manufacturing, construction, autonomous operations and maintenance, power and heating/cooling, stable precision structures, optics, parabolic antennas, and communications/control. This telescope for the lunar surface needs to be engineered to operate for long periods with minimal intervention by humans or robots. What is essential for lunar observatory operation is enforcement of a systems engineering approach that makes compatible all lunar operations associated with habitation, resource development, and science.
Gianotti, F.; Tacchini, A.; Leto, G.; Martinetti, E.; Bruno, P.; Bellassai, G.; Conforti, V.; Gallozzi, S.; Mastropietro, M.; Tanci, C.; Malaguti, G.; Trifoglio, M.
2016-08-01
The Cherenkov Telescope Array (CTA) represents the next generation of ground-based observatories for very high energy gamma-ray astronomy. The CTA will consist of two arrays at two different sites, one in the northern and one in the southern hemisphere. The current CTA design foresees, in the southern site, the installation of many tens of imaging atmospheric Cherenkov telescopes of three different classes, namely large, medium and small, so defined in relation to their mirror area; the northern hemisphere array would consist of few tens of the two larger telescope types. The Italian National Institute for Astrophysics (INAF) is developing the Cherenkov Small Size Telescope ASTRI SST- 2M end-to-end prototype telescope within the framework of the International Cherenkov Telescope Array (CTA) project. The ASTRI prototype has been installed at the INAF observing station located in Serra La Nave on Mt. Etna, Italy. Furthermore a mini-array, composed of nine of ASTRI telescopes, has been proposed to be installed at the Southern CTA site. Among the several different infrastructures belonging the ASTRI project, the Information and Communication Technology (ICT) equipment is dedicated to operations of computing and data storage, as well as the control of the entire telescope, and it is designed to achieve the maximum efficiency for all performance requirements. Thus a complete and stand-alone computer centre has been designed and implemented. The goal is to obtain optimal ICT equipment, with an adequate level of redundancy, that might be scaled up for the ASTRI mini-array, taking into account the necessary control, monitor and alarm system requirements. In this contribution we present the ICT equipment currently installed at the Serra La Nave observing station where the ASTRI SST-2M prototype will be operated. The computer centre and the control room are described with particular emphasis on the Local Area Network scheme, the computing and data storage system, and the
Liverpool Telescope and Liverpool Telescope 2
Copperwheat, C. M.; Steele, I. A.; Barnsley, R. M.; Bates, S. D.; Clay, N. R.; Jermak, H.; Marchant, J. M.; Mottram, C. J.; Piascik, A.; Smith, R. J.
2016-12-01
The Liverpool Telescope is a fully robotic optical/near-infrared telescope with a 2-metre clear aperture, located at the Observatorio del Roque de los Muchachos on the Canary Island of La Palma. The telescope is owned and operated by Liverpool John Moores University, with financial support from the UK's Science and Technology Facilities Council. The telescope began routine science operations in 2004 and is a common-user facility with time available through a variety of committees via an open, peer reviewed process. Seven simultaneously mounted instruments support a broad science programme, with a focus on transient follow-up and other time domain topics well suited to the characteristics of robotic observing. Development has also begun on a successor facility, with the working title `Liverpool Telescope 2', to capitalise on the new era of time domain astronomy which will be brought about by the next generation of survey facilities such as LSST. The fully robotic Liverpool Telescope 2 will have a 4-metre aperture and an improved response time. In this paper we provide an overview of the current status of both facilities.
The ATHENA telescope and optics status
Bavdaz, Marcos; Wille, Eric; Ayre, Mark; Ferreira, Ivo; Shortt, Brian; Fransen, Sebastiaan; Collon, Maximilien; Vacanti, Giuseppe; Barriere, Nicolas; Landgraf, Boris; Haneveld, Jeroen; van Baren, Coen; Zuknik, Karl-Heintz; Della Monica Ferreira, Desiree; Massahi, Sonny; Christensen, Finn; Krumrey, Michael; Burwitz, Vadim; Pareschi, Giovanni; Spiga, Daniele; Valsecchi, Giuseppe; Vernani, Dervis; Oliver, Paul; Seidel, André
2017-08-01
The work on the definition and technological preparation of the ATHENA (Advanced Telescope for High ENergy Astrophysics) mission continues to progress. In parallel to the study of the accommodation of the telescope, many aspects of the X-ray optics are being evolved further. The optics technology chosen for ATHENA is the Silicon Pore Optics (SPO), which hinges on technology spin-in from the semiconductor industry, and uses a modular approach to produce large effective area lightweight telescope optics with a good angular resolution. Both system studies and the technology developments are guided by ESA and implemented in industry, with participation of institutional partners. In this paper an overview of the current status of the telescope optics accommodation and technology development activities is provided.
Gillespie, Richard
2011-01-01
Erected at Melbourne Observatory in 1869, the telescope was the second largest in the world, designed to explore the nature of the nebulae in the southern skies. Richard Gillespie, head of the History and Technology department at the Melbourne museum has written an entertaining account of the telescope's extraordinary history and tells the story through an amazing cast of characters whose lives intersected with the telescope.
PEPSI-feed: linking PEPSI to the Vatican Advanced Technology Telescope using a 450m long fibre
Sablowski, D. P.; Weber, M.; Woche, M.; Ilyin, I.; Järvinen, A.; Strassmeier, K. G.; Gabor, P.
2016-07-01
Limited observing time at large telescopes equipped with the most powerful spectrographs makes it almost impossible to gain long and well-sampled time-series observations. Ditto, high-time-resolution observations of bright targets with high signal-to-noise are rare. By pulling an optical fibre of 450m length from the Vatican Advanced Technology Telescope (VATT) to the Large Binocular Telescope (LBT) to connect the Potsdam Echelle Polarimetric and Spectroscopic Instrument (PEPSI) to the VATT, allows for ultra-high resolution time-series measurements of bright targets. This article presents the fibre-link in detail from the technical point-of-view, demonstrates its performance from first observations, and sketches current applications.
Observing the Sun with Coronado telescopes telescopes
Pugh, Philip
2007-01-01
The Sun provides amateur astronomers with one of the few opportunities for daytime astronomy. In order to see the major features of our nearest star, special telescopes that have a very narrow visible bandwidth are essential. The bandwidth has to be as narrow as 1 A- 10-10 m (1 Angstrom) and centred on the absorption line of neutral hydrogen. This makes many major features of the Suna (TM)s chromosphere visible to the observer. Such narrow-band "Fabry-Perot etalon filters" are high technology, and until the introduction of the Coronado range of solar telescopes, were too expensive for amateur use. The entry-level Coronado telescope, the PST (Personal Solar Telescope) costs under 500. Solar prominences (vast columns of plasma, best seen at the edge of the solar disk), filaments, flares, sunspots, plage and active regions are all visible and can be imaged to produce spectacular solar photographs. Philip Pugh has assembled a team of contributors who show just how much solar work can be done with Coronado telesco...
Parametric cost models for space telescopes
Stahl, H. Philip; Henrichs, Todd; Dollinger, Courtnay
2017-11-01
Multivariable parametric cost models for space telescopes provide several benefits to designers and space system project managers. They identify major architectural cost drivers and allow high-level design trades. They enable cost-benefit analysis for technology development investment. And, they provide a basis for estimating total project cost. A survey of historical models found that there is no definitive space telescope cost model. In fact, published models vary greatly [1]. Thus, there is a need for parametric space telescopes cost models. An effort is underway to develop single variable [2] and multi-variable [3] parametric space telescope cost models based on the latest available data and applying rigorous analytical techniques. Specific cost estimating relationships (CERs) have been developed which show that aperture diameter is the primary cost driver for large space telescopes; technology development as a function of time reduces cost at the rate of 50% per 17 years; it costs less per square meter of collecting aperture to build a large telescope than a small telescope; and increasing mass reduces cost.
Parametric Cost Models for Space Telescopes
Stahl, H. Philip; Henrichs, Todd; Dollinger, Courtney
2010-01-01
Multivariable parametric cost models for space telescopes provide several benefits to designers and space system project managers. They identify major architectural cost drivers and allow high-level design trades. They enable cost-benefit analysis for technology development investment. And, they provide a basis for estimating total project cost. A survey of historical models found that there is no definitive space telescope cost model. In fact, published models vary greatly [1]. Thus, there is a need for parametric space telescopes cost models. An effort is underway to develop single variable [2] and multi-variable [3] parametric space telescope cost models based on the latest available data and applying rigorous analytical techniques. Specific cost estimating relationships (CERs) have been developed which show that aperture diameter is the primary cost driver for large space telescopes; technology development as a function of time reduces cost at the rate of 50% per 17 years; it costs less per square meter of collecting aperture to build a large telescope than a small telescope; and increasing mass reduces cost.
International Nuclear Information System (INIS)
Pyeon, Cheol Ho
2013-01-01
This status report describes the current status on research and development (R and D) of accelerator-driven system (ADS) and nuclear transmutation techniques (NTT), including nuclear data, accelerator techniques, Pb-Bi target, fuel technologies and reactor physics, in East Asian countries: Japan, Korea and China. The report also includes all presentation materials presented in 'the 10th International Workshop on Asian Network for ADS and NTT (ADS+NTT 2012)' held at the Kyoto University Research Reactor Institute, Osaka, Japan on 6th and 7th December, 2012. The objective of this workshop is to make actual progress of ADS R and D especially in East Asian countries, as well as in European countries, through sharing mutual interests and conducting the information exchange each other. The 5 of 27 papers presented at the entitled report and meeting are indexed individually. (J.P.N.)
James Webb Space Telescope Optical Telescope Element Mirror Development History and Results
Feinber, Lee D.; Clampin, Mark; Keski-Kuha, Ritva; Atkinson, Charlie; Texter, Scott; Bergeland, Mark; Gallagher, Benjamin B.
2012-01-01
In a little under a decade, the James Webb Space Telescope (JWST) program has designed, manufactured, assembled and tested 21 flight beryllium mirrors for the James Webb Space Telescope Optical Telescope Element. This paper will summarize the mirror development history starting with the selection of beryllium as the mirror material and ending with the final test results. It will provide an overview of the technological roadmap and schedules and the key challenges that were overcome. It will also provide a summary or the key tests that were performed and the results of these tests.
POX 186: the ultracompact blue compact dwarf galaxy reveals its nature
Doublier, V.; Kunth, D.; Courbin, F.; Magain, P.
2000-01-01
High resolution, ground based R and I band observations of the ultra compact dwarf galaxy POX 186 are presented. The data, obtained with the ESO New Technology Telescope (NTT), are analyzed using a new deconvolution algorithm which allows one to resolve the innermost regions of this stellar-like object into three Super-Star Clusters (SSC). Upper limits to both masses (M ~ 105 Msun) and physical sizes (<=60pc) of the SSCs are set. In addition, and maybe most importantly, extended light emission underlying the compact star-forming region is clearly detected in both bands. The R-I color rules out nebular Hα contamination and is consistent with an old stellar population. This casts doubt on the hypothesis that Blue Compact Dwarf Galaxies (BCDG) are young galaxies. based on observations carried out at NTT in La Silla, operated by the European Southern Observatory, during Director's Discretionary Time.
The ATHENA telescope and optics status
DEFF Research Database (Denmark)
Bavdaz, Marcos; Wille, Eric; Ayre, Mark
2017-01-01
chosen for ATHENA is the Silicon Pore Optics (SPO), which hinges on technology spin-in from the semiconductor industry, and uses a modular approach to produce large effective area lightweight telescope optics with a good angular resolution. Both system studies and the technology developments are guided...... by ESA and implemented in industry, with participation of institutional partners. In this paper an overview of the current status of the telescope optics accommodation and technology development activities is provided....
Cost Modeling for Space Telescope
Stahl, H. Philip
2011-01-01
Parametric cost models are an important tool for planning missions, compare concepts and justify technology investments. This paper presents on-going efforts to develop single variable and multi-variable cost models for space telescope optical telescope assembly (OTA). These models are based on data collected from historical space telescope missions. Standard statistical methods are used to derive CERs for OTA cost versus aperture diameter and mass. The results are compared with previously published models.
Technology Advances at the NRAO Green Bank Telescope
Lockman, Felix James
2015-08-01
The 100 meter diameter Green Bank Telescope, with its large frequency coverage, great sensitivity, all-sky tracking, and location at a protected, radio-quiet site, offers a unique platform for technological advances in astronomical instrumentation that can yield an immediate scientific payoff.MUSTANG-1.5 is a feedhorn-coupled bolometer array for 3mm that has recently been installed on the telescope. It has 64 pixels (expandable to 223) and offers sensitivity to angular scales from 9" to more than 3' over a band from 75 GHz to 105 GHz. Its capabilities for science at 3mm are complimentary to, and in some cases superior to, those offered by ALMA. MUSTANG-1.5 is a collaboration between UPenn., NIST, NRAO, and other institutions.ARGUS is a 16-pixel focal plane array for millimeter spectroscopy that will be in use on the GBT in 2015. The array architecture is designed as a scalable technology pathfinder for larger arrays, but by itself it will provide major capabilities for spectroscopy from 75-107 GHz with 8" angular resolution over a wide field-of-view. It is a collaboration between Stanford Univ., Caltech, JPL, Univ. Maryland, Univ. Miami, and NRAO.FLAG is a prototype phased array receiver operating at 21cm wavelength that is under development for the GBT. It will produce multiple beams over a wide field of view with a sensitivity competitive with that of single-pixel receivers, allowing rapid astronomical surveys. FLAG is a collaboration between BYU, WVU, and NRAO.Also under development is a mm-wave phased array receiver for the GBT, designed to operate near 90 GHz as a prototype for very large format phased array receivers in the 3mm band. It is a collaboration between UMass and BYU.VEGAS is the new spectrometer for the GBT, offering multiple configurations well matched to GBT receivers from 1 to 100 GHz and suitable for use with focal plane arrays. It is a collaboration between UCal (Berkeley) and NRAO.The new receivers and spectrometers create extremely big data
Ideas for future large single dish radio telescopes
Kärcher, Hans J.; Baars, Jacob W. M.
2014-07-01
The existing large single dish radio telescopes of the 100m class (Effelsberg, Green Bank) were built in the 1970s and 1990s. With some active optics they work now down to 3 millimeter wavelength where the atmospheric quality of the site is also a limiting factor. Other smaller single dish telescopes (50m LMT Mexico, 30m IRAM Spain) are located higher and reach sub-millimeter quality, and the much smaller 12m antennas of the ALMA array reach at a very high site the Terahertz region. They use advanced technologies as carbon fiber structures and flexible body control. We review natural limits to telescope design and use the examples of a number of telescopes for an overview of the available state-of-the-art in design, engineering and technologies. Without considering the scientific justification we then offer suggestions to realize ultimate performance of huge single dish telescopes (up to 160m). We provide an outlook on design options, technological frontiers and cost estimates.
Woźniak, Przemysław
Robotic telescopes are revolutionizing the way astronomers collect their dataand conduct sky surveys. This chapter begins with a discussion of principles thatguide the process of designing, constructing, and operating telescopes andobservatories that offer a varying degree of automation, from instruments remotelycontrolled by observers to fully autonomous systems requiring no humansupervision during their normal operations. Emphasis is placed on designtrade-offs involved in building end-to-end systems intended for a wide range ofscience applications. The second part of the chapter contains descriptions ofseveral projects and instruments, both existing and currently under development.It is an attempt to provide a representative selection of actual systems thatillustrates state of the art in technology, as well as important ideas and milestonesin the development of the field. The list of presented instruments spans the fullrange in size starting from small all-sky monitors, through midrange robotic andsurvey telescopes, and finishing with large robotic instruments and surveys.Explosive growth of telescope networking is enabling entirely new modesof interaction between the survey and follow-up observing. Increasingimportance of standardized communication protocols and software is stressed.These developments are driven by the fusion of robotic telescope hardware,massive storage and databases, real-time knowledge extraction, and datacross-correlation on a global scale. The chapter concludes with examplesof major science results enabled by these new technologies and futureprospects.
International Nuclear Information System (INIS)
Sasa, Toshinobu
2016-03-01
The first topical meeting on Asian Network for Accelerator-driven System (ADS) and Nuclear Transmutation Technology (NTT) was held on 26-27 October 2015 at the J-PARC Center, Japan Atomic Energy Agency, Japan. The topical meeting was an optional one in-between the regular meeting, which is held in every two years. Instead of the regular meetings, which cover all research fields for ADS and NTT, such as accelerator, spallation target, subcritical reactor, fuel, and material, the topical meeting is focused on a specific topic to make technical discussions more deeply. In this meeting, the technology for lead-bismuth eutectic alloy was selected, as it was one of the hot issues in the world, and the topic was deeply discussed by specialists in Asian countries. This report summarizes all presentation materials discussed in the meeting. (author)
Guinan, Edward F.; Engle, Scott; Devinney, Edward J.
2012-04-01
Current and planned telescope systems (both on the ground and in space) as well as new technologies will be discussed with emphasis on their impact on the studies of binary star and exoplanet systems. Although no telescopes or space missions are primarily designed to study binary stars (what a pity!), several are available (or will be shortly) to study exoplanet systems. Nonetheless those telescopes and instruments can also be powerful tools for studying binary and variable stars. For example, early microlensing missions (mid-1990s) such as EROS, MACHO and OGLE were initially designed for probing dark matter in the halos of galaxies but, serendipitously, these programs turned out to be a bonanza for the studies of eclipsing binaries and variable stars in the Magellanic Clouds and in the Galactic Bulge. A more recent example of this kind of serendipity is the Kepler Mission. Although Kepler was designed to discover exoplanet transits (and so far has been very successful, returning many planetary candidates), Kepler is turning out to be a ``stealth'' stellar astrophysics mission returning fundamentally important and new information on eclipsing binaries, variable stars and, in particular, providing a treasure trove of data of all types of pulsating stars suitable for detailed Asteroseismology studies. With this in mind, current and planned telescopes and networks, new instruments and techniques (including interferometers) are discussed that can play important roles in our understanding of both binary star and exoplanet systems. Recent advances in detectors (e.g. laser frequency comb spectrographs), telescope networks (both small and large - e.g. Super-WASP, HAT-net, RoboNet, Las Combres Observatory Global Telescope (LCOGT) Network), wide field (panoramic) telescope systems (e.g. Large Synoptic Survey Telescope (LSST) and Pan-Starrs), huge telescopes (e.g. the Thirty Meter Telescope (TMT), the Overwhelming Large Telescope (OWL) and the Extremely Large Telescope (ELT
VizieR Online Data Catalog: Observed red supergiants in the inner Galaxy (Messineo+, 2016)
Messineo, M.; Zhu, Q.; Menten, K. M.; Ivanov, V. D.; Figer, D. F.; Kudritzki, R.-P.; Rosie, Chen C.-H.
2018-02-01
Spectroscopic observations were carried out with the Son of ISAAC (SofI; Moorwood et al. 1998Msngr..91....9M) Spectrograph on the ESO/New Technology Telescope (NTT) 3.58 m telescope of the La Silla Observatory, on the three nights from UT 2015 June 16 to 19-program ID 095.D-0252(A). Spectra with the low-resolution red grism, and the 0.6" wide slit, delivering resolution R~980 over the wavelength range λ=1.53-2.52 μm were obtained for 94 targets. For each target a minimum number of four exposures, nodded along the slit, were taken in an ABBA sequence. Typical integration times per frame ranged from 2 to 100 s (DITsxNDITs). (1 data file).
Straughn, Amber
2011-01-01
Over the past 20 years the Hubble Space Telescope has revolutionized our understanding of the Universe. Most recently, the complete refurbishment of Hubble in 2009 has given new life to the telescope and the new science instruments have already produced groundbreaking science results, revealing some of the most distant galaxy candidates ever discovered. Despite the remarkable advances in astrophysics that Hubble has provided, the new questions that have arisen demand a new space telescope with new technologies and capabilities. I will present the exciting new technology development and science goals of NASA's James Webb Space Telescope, which is currently being built and tested and will be launched this decade.
Preliminary Multi-Variable Cost Model for Space Telescopes
Stahl, H. Philip; Hendrichs, Todd
2010-01-01
Parametric cost models are routinely used to plan missions, compare concepts and justify technology investments. This paper reviews the methodology used to develop space telescope cost models; summarizes recently published single variable models; and presents preliminary results for two and three variable cost models. Some of the findings are that increasing mass reduces cost; it costs less per square meter of collecting aperture to build a large telescope than a small telescope; and technology development as a function of time reduces cost at the rate of 50% per 17 years.
Preliminary Cost Model for Space Telescopes
Stahl, H. Philip; Prince, F. Andrew; Smart, Christian; Stephens, Kyle; Henrichs, Todd
2009-01-01
Parametric cost models are routinely used to plan missions, compare concepts and justify technology investments. However, great care is required. Some space telescope cost models, such as those based only on mass, lack sufficient detail to support such analysis and may lead to inaccurate conclusions. Similarly, using ground based telescope models which include the dome cost will also lead to inaccurate conclusions. This paper reviews current and historical models. Then, based on data from 22 different NASA space telescopes, this paper tests those models and presents preliminary analysis of single and multi-variable space telescope cost models.
Sauvage, Marc; Amiaux, Jérome; Austin, James; Bello, Mara; Bianucci, Giovanni; Chesné, Simon; Citterio, Oberto; Collette, Christophe; Correia, Sébastien; Durand, Gilles A.; Molinari, Sergio; Pareschi, Giovanni; Penfornis, Yann; Sironi, Giorgia; Valsecchi, Giuseppe; Verpoort, Sven; Wittrock, Ulrich
2016-07-01
Astronomy is driven by the quest for higher sensitivity and improved angular resolution in order to detect fainter or smaller objects. The far-infrared to submillimeter domain is a unique probe of the cold and obscured Universe, harboring for instance the precious signatures of key elements such as water. Space observations are mandatory given the blocking effect of our atmosphere. However the methods we have relied on so far to develop increasingly larger telescopes are now reaching a hard limit, with the JWST illustrating this in more than one way (e.g. it will be launched by one of the most powerful rocket, it requires the largest existing facility on Earth to be qualified). With the Thinned Aperture Light Collector (TALC) project, a concept of a deployable 20 m annular telescope, we propose to break out of this deadlock by developing novel technologies for space telescopes, which are disruptive in three aspects: • An innovative deployable mirror whose topology, based on stacking rather than folding, leads to an optimum ratio of collecting area over volume, and creates a telescope with an eight times larger collecting area and three times higher angular resolution compared to JWST from the same pre-deployed volume; • An ultra-light weight segmented primary mirror, based on electrodeposited Nickel, Composite and Honeycomb stacks, built with a replica process to control costs and mitigate the industrial risks; • An active optics control layer based on piezo-electric layers incorporated into the mirror rear shell allowing control of the shape by internal stress rather than by reaction on a structure. We present in this paper the roadmap we have built to bring these three disruptive technologies to technology readiness level 3. We will achieve this goal through design and realization of representative elements: segments of mirrors for optical quality verification, active optics implemented on representative mirror stacks to characterize the shape correction
Update on Multi-Variable Parametric Cost Models for Ground and Space Telescopes
Stahl, H. Philip; Henrichs, Todd; Luedtke, Alexander; West, Miranda
2012-01-01
Parametric cost models can be used by designers and project managers to perform relative cost comparisons between major architectural cost drivers and allow high-level design trades; enable cost-benefit analysis for technology development investment; and, provide a basis for estimating total project cost between related concepts. This paper reports on recent revisions and improvements to our ground telescope cost model and refinements of our understanding of space telescope cost models. One interesting observation is that while space telescopes are 50X to 100X more expensive than ground telescopes, their respective scaling relationships are similar. Another interesting speculation is that the role of technology development may be different between ground and space telescopes. For ground telescopes, the data indicates that technology development tends to reduce cost by approximately 50% every 20 years. But for space telescopes, there appears to be no such cost reduction because we do not tend to re-fly similar systems. Thus, instead of reducing cost, 20 years of technology development may be required to enable a doubling of space telescope capability. Other findings include: mass should not be used to estimate cost; spacecraft and science instrument costs account for approximately 50% of total mission cost; and, integration and testing accounts for only about 10% of total mission cost.
Wayth, Randall; Sokolowski, Marcin; Booler, Tom; Crosse, Brian; Emrich, David; Grootjans, Robert; Hall, Peter J.; Horsley, Luke; Juswardy, Budi; Kenney, David; Steele, Kim; Sutinjo, Adrian; Tingay, Steven J.; Ung, Daniel; Walker, Mia; Williams, Andrew; Beardsley, A.; Franzen, T. M. O.; Johnston-Hollitt, M.; Kaplan, D. L.; Morales, M. F.; Pallot, D.; Trott, C. M.; Wu, C.
2017-08-01
We describe the design and performance of the Engineering Development Array, which is a low-frequency radio telescope comprising 256 dual-polarisation dipole antennas working as a phased array. The Engineering Development Array was conceived of, developed, and deployed in just 18 months via re-use of Square Kilometre Array precursor technology and expertise, specifically from the Murchison Widefield Array radio telescope. Using drift scans and a model for the sky brightness temperature at low frequencies, we have derived the Engineering Development Array's receiver temperature as a function of frequency. The Engineering Development Array is shown to be sky-noise limited over most of the frequency range measured between 60 and 240 MHz. By using the Engineering Development Array in interferometric mode with the Murchison Widefield Array, we used calibrated visibilities to measure the absolute sensitivity of the array. The measured array sensitivity matches very well with a model based on the array layout and measured receiver temperature. The results demonstrate the practicality and feasibility of using Murchison Widefield Array-style precursor technology for Square Kilometre Array-scale stations. The modular architecture of the Engineering Development Array allows upgrades to the array to be rolled out in a staged approach. Future improvements to the Engineering Development Array include replacing the second stage beamformer with a fully digital system, and to transition to using RF-over-fibre for the signal output from first stage beamformers.
Ground-Based Telescope Parametric Cost Model
Stahl, H. Philip; Rowell, Ginger Holmes
2004-01-01
A parametric cost model for ground-based telescopes is developed using multi-variable statistical analysis, The model includes both engineering and performance parameters. While diameter continues to be the dominant cost driver, other significant factors include primary mirror radius of curvature and diffraction limited wavelength. The model includes an explicit factor for primary mirror segmentation and/or duplication (i.e.. multi-telescope phased-array systems). Additionally, single variable models based on aperture diameter are derived. This analysis indicates that recent mirror technology advances have indeed reduced the historical telescope cost curve.
Stahl, H. Philip
2013-01-01
Per Astro2010, a new, larger UVO telescope is needed to answer fundamental scientific questions, such as: is there life on Earth-like exoplanets; how galaxies assemble stellar populations; how baryonic matter interacts with intergalactic medium; and how solar systems form and evolve. And, present technology is not mature enough to affordably build and launch any potential UVO concept. Advanced Mirror Technology Development (AMTD) is a funded SAT project. Our objective is to mature to TRL-6 the critical technologies needed to produce 4-m or larger flight-qualified UVOIR mirrors by 2018 so that a viable mission can be considered by the 2020 Decadal Review. AMTD uses a science-driven systems engineering approach. We mature technologies required to enable the highest priority science AND result in a high-performance low-cost low-risk system. To provide the science community with options, we are pursuing multiple technology paths. We have assembled an outstanding team from academia, industry, and government with extensive expertise in astrophysics and exoplanet characterization, and in the design/manufacture of monolithic and segmented space telescopes. One of our key accomplishments is that we have derived engineering specifications for advanced normal-incidence monolithic and segmented mirror systems needed to enable both general astrophysics and ultra-high contrast observations of exoplanets missions as a function of potential launch vehicle and its inherent mass and volume constraints. We defined and initiated a program to mature 6 key technologies required to fabricate monolithic and segmented space mirrors.
A virtual reality environment for telescope operation
Martínez, Luis A.; Villarreal, José L.; Ángeles, Fernando; Bernal, Abel
2010-07-01
Astronomical observatories and telescopes are becoming increasingly large and complex systems, demanding to any potential user the acquirement of great amount of information previous to access them. At present, the most common way to overcome that information is through the implementation of larger graphical user interfaces and computer monitors to increase the display area. Tonantzintla Observatory has a 1-m telescope with a remote observing system. As a step forward in the improvement of the telescope software, we have designed a Virtual Reality (VR) environment that works as an extension of the remote system and allows us to operate the telescope. In this work we explore this alternative technology that is being suggested here as a software platform for the operation of the 1-m telescope.
Optical fiber cable and wiring techniques for fiber to the home (FTTH)
Takai, Hirofumi; Yamauchi, Osamu
2009-08-01
NTT group's new medium-term management strategy calls for 20 million optical subscribers by 2010, and NTT Laboratories is pushing forward to meet this goal. Before that date, an efficient optical access network must be constructed, and afterwards, when the era of mass optical communications finally arrives, the facilities and equipment supporting the network will have to be effectively operated and maintained. At NTT Access Network Service Systems Laboratories, we are developing various technologies to correspond to the massive deployment of optical broadband services. We are also developing various new technologies for efficiently operating optical access network systems that will continue to expand in the future, and to supply our customers with good services. This paper provides an overview of the new optical access network system technologies that are being developed at NTT Access Network Service Systems Laboratories to address these issues.
An EUDET/AIDA Pixel Beam Telescope for Detector Development
Perrey, Hanno
2013-01-01
A high resolution ($\\sigma 2 \\sim \\mu$) beam telescope based on monolithic active pixel sensors (MAPS) was developed within the EUDET collaboration. The telescope consists of six sensor planes using Mimosa26 MAPS with a pixel pitch of $18.4 \\mu$ and thinned down to $50 \\mu$. The excellent resolution, readout rate and DAQ integration capabilities made the telescope a primary test beam tool for many groups including several CERN based experiments. Within the new European detector infrastructure project AIDA the test beam telescope will be further extended in terms of cooling infrastructure, readout speed and precision. In order to provide a system optimized for the different requirements by the user community, a combination of various pixel technologies is foreseen. In this report the design of this even more flexible telescope with three different pixel technologies (TimePix, Mimosa, ATLAS FE-I4) will be presented. First test beam results with the HitOR signal provided by the FE-I4 integrated into the trigger...
Marchiori, Gianpietro; Busatta, Andrea; Giacomel, Stefano; Folla, Ivan; Valsecchi, Marco; Canestrari, Rodolfo; Bonnoli, Giacomo; Cascone, Enrico; Conconi, Paolo; Fiorini, Mauro; Giro, Enrico; La Palombara, Nicola; Pareschi, Giovanni; Perri, Luca; Rodeghiero, Gabriele; Sironi, Giorgia; Stringhetti, Luca; Toso, Giorgio; Tosti, Gino; Pellicciari, Carlo
2014-07-01
The Cherenkov Telescope Array (CTA) observatory will represent the next generation of Imaging Atmospheric Cherenkov Telescope. Using a combination of large-, medium-, and small-scale telescopes (LST, MST, SST, respectively), it will explore the Very High Energy domain from a few tens of GeVup to about few hundreds of TeV with unprecedented sensitivity, angular resolution and imaging quality. In this framework, the Italian ASTRI program, led by the Italian National Institute of Astrophysics (INAF) developed a 4-meter class telescope, which will adopt an aplanatic, wide-field, double-reflection optical layout in a Schwarzschild- Couder configuration. Within this program INAF assigned to the consortium between Galbiati Group and EIE Group the construction, assembly and tests activities of the prototype named ASTRI SST-2M. On the basis of the lesson learnt from the prototype, other telescopes will be produced, starting from a re-design phase, in order to optimize performances and the overall costs and production schedule for the CTA-SST telescope. This paper will firstly give an overview of the concept for the SST prototype mount structure. In this contest, the technologies adopted for the design, manufacturing and tests of the entire system will be presented. Moreover, a specific focus on the challenges of the prototype and the strategies associated with it will be provided, in order to outline the near future performance goals for this type of Cherenkov telescopes employed for Gamma ray science.
LOBSTER: new space x-ray telescopes
Hudec, R.; Sveda, L.; Pína, L.; Inneman, A.; Semencova, V.; Skulinova, M.
2017-11-01
The LOBSTER telescopes are based on the optical arrangement of the lobster eye. The main difference from classical X-ray space telescopes in wide use is the very large field of view while the use of optics results in higher efficiency if compared with detectors without optics. Recent innovative technologies have enabled to design, to develop and to test first prototypes. They will provide deep sensitive survey of the sky in X-rays for the first time which is essential for both long-term monitoring of celestial high-energy sources as well as in understanding transient phenomena. The technology is now ready for applications in space.
Application of Technology on Improving Beef Cattle Productivity in East Nusa Tenggara
Directory of Open Access Journals (Sweden)
Wirdahayati R B
2010-03-01
Full Text Available The Province of East Nusa Tenggara (NTT had been one of the major beef cattle suppliers under traditional management system in Indonesia. The beef cattle farming that based on grazing native pasture and the introduction of shrub legumes (Leucaena leucocephala may contribute to around 15 – 50% of the farmers’ household income. In the last few years, supply of beef cattle tended to decline due to the decrease in cattle population in NTT. Some basic improvements in management and feeding toward increasing beef cattle productivities had been carried out in Nusa Tenggara, such as a baseline survey on Cattle Health and Productivity Survey (CHAPS conducted in 1990 – 1992. The objective of the program was to identify the existing beef cattle productivity and health condition throughout Nusa Tenggara. A collaborative research with the Ministry of Research and Technology (Integrated Prime Research had also been carried out and the result showed that early weaning in Bali calves that can be practised as early as 3 – 6 months to prevent calves losses during the dry season. A program of the Assessment on Beef Cattle Base Farming Activities had also been conducted to improve fattening and breeding practices through the improvement in beef cattle management and feeding systems. At the latest development, fattening scheme has been introduced under a partnership approach involving private sectors and cooperatives. This needs to be facilitated by the government to accelerate the program such as access to capital and intensive extension services to build farmers awareness toward profit oriented beef cattle farming. Optimalization of the available potential resources and technology in NTT, will be an opportunity to enhance beef cattle production and gains back the reputation as one of the major producing beef cattle in the past. This will also support the national livestock program nowadays, called Beef Cattle Self Sufficiency Program 2014.
EDUCATIONAL ASTRONOMICAL OBSERVATIONS ON REMOTE ACCESS TELESCOPES
Directory of Open Access Journals (Sweden)
Ivan P. Kriachko
2016-01-01
Full Text Available The purpose of this article is to show the way of overcoming one of the major problems of astronomy teaching methods in upper secondary school – organization of educational astronomical observations. Nowadays it became possible to perform such observations on remote access telescopes. By using up-to-date informational and communicational technologies, having an opportunity to work with robotic telescopes allows us to organize a unique cognitive and research oriented activities for students while conducting their specialized astronomical studies. Below here is given a brief description of the most significant robotic telescopes and the way of the usage of open remote access telescopic network which was created by professors and scientists of Harvard-Smithsonian Center for Astrophysics, USA.
The Submillimeter Telescope (SMT) project
International Nuclear Information System (INIS)
Martin, R.N.; Baars, J.W.M.
1990-01-01
To exploit the potential of submillimeter astronomy, the Submillimeter Telescope (SMT) will be located at an altitude of 3178 meters on Emerald Peak 75 miles northeast of Tucson in Southern Arizona. The instrument is an altazimuth mounted f/13.8 Cassegrain homology telescope with two Nasmyth and bent Cassegrain foci. It will have diffraction limited performance at a wavelength of 300 microns and an operating overall figure accuracy of 15 microns rms. An important feature of the SMT is the construction of the primary and secondary reflectors out of aluminum-core CFRP face sheet sandwich panels, and the reflector backup structure and secondary support out of CFRP structural elements. This modern technology provides both a means for reaching the required precision of the SMT for both night and day operation (basically because of the low coefficient of thermal expansion and high strength-to-weight ratio of CFRP) and a potential route for the realization of lightweight telescopes of even greater accuracy in the future. The SMT will be the highest accuracy radio telescope ever built (at least a factor of 2 more accurate than existing telescopes). In addition, the SMT will be the first 10 m-class submillimeter telescope with a surface designed for efficient measurements at the important 350 microns wavelength atmospheric window. 9 refs
Telescope Networks in Education: Where We Are Now and Where We Are Headed
Freed, R.
2017-12-01
Remote telescopes have become more common and accessible over the past 20 years as technology has evolved, and there has been a corresponding interest in bringing telescopes and astronomy into the educational arena. Numerous telescope networks (i.e. Las Cumbres Observatory, the Faulkes Telescopes, Skynet, the Harvard-Smithsonian Center for Astrophysics MicroObservatory, the SPIRIT Telescopes, iTelescope, telescope.org and others) as well as curriculum development groups and national and international programs have been developed during this time to connect students and the public with the technology and the science. While some programs and networks have come and gone, we are now at a time where sustainable communities of practice around astronomical research, ground-based telescope networks, and education can take hold and grow. The global connectivity that today's technology affords makes possible many more types of astronomical studies than in previous decades as we now have the capacity for continual sky coverage in both hemispheres by larger numbers of people and larger telescopes. Astronomy is one of few scientific fields that captures the imagination of the masses and as an undergraduate general science course it is often the last exposure to formal science that students will have and as such can play a critical role in STEM education. As the advances in computer and space exploration technologies continue, and the amount of data coming from remote observatories and space exploration missions increases astronomically, integrating remote telescope networks into educational settings, in tandem with teaching students and the general public about the nature and processes of scientific inquiry is vital not only for the field of astronomy but in helping to develop a generation of critical thinkers and informed citizens.
Hopkins, Randall C.; Capizzo, Peter; Fincher, Sharon; Hornsby, Linda S.; Jones, David
2010-01-01
The Advanced Concepts Office at Marshall Space Flight Center completed a brief spacecraft design study for the 8-meter monolithic Advanced Technology Large Aperture Space Telescope (ATLAST-8m). This spacecraft concept provides all power, communication, telemetry, avionics, guidance and control, and thermal control for the observatory, and inserts the observatory into a halo orbit about the second Sun-Earth Lagrange point. The multidisciplinary design team created a simple spacecraft design that enables component and science instrument servicing, employs articulating solar panels for help with momentum management, and provides precise pointing control while at the same time fast slewing for the observatory.
New technology allows closer study of neutrinos; researchers credit specialized telescope
Huang, N
2002-01-01
With the help of a newly designed telescope, University of California-Berkeley scientists and an international team of researchers have made a recent breakthrough in the study of neutrino emissions from the sun. The turning point is the Sudbury Neutrino Observatory in Canada. This telescope is the first of its kind to be sensitive enough to detect all types of neutrinos (1 page).
Toward Adaptive X-Ray Telescopes
O'Dell, Stephen L.; Atkins, Carolyn; Button, Tim W.; Cotroneo, Vincenzo; Davis, William N.; Doel, Peer; Feldman, Charlotte H.; Freeman, Mark D.; Gubarev, Mikhail V.; Kolodziejczak, Jeffrey J.;
2011-01-01
Future x-ray observatories will require high-resolution (less than 1 inch) optics with very-large-aperture (greater than 25 square meter) areas. Even with the next generation of heavy-lift launch vehicles, launch-mass constraints and aperture-area requirements will limit the surface areal density of the grazing-incidence mirrors to about 1 kilogram per square meter or less. Achieving sub-arcsecond x-ray imaging with such lightweight mirrors will require excellent mirror surfaces, precise and stable alignment, and exceptional stiffness or deformation compensation. Attaining and maintaining alignment and figure control will likely involve adaptive (in-space adjustable) x-ray optics. In contrast with infrared and visible astronomy, adaptive optics for x-ray astronomy is in its infancy. In the middle of the past decade, two efforts began to advance technologies for adaptive x-ray telescopes: The Generation-X (Gen-X) concept studies in the United States, and the Smart X-ray Optics (SXO) Basic Technology project in the United Kingdom. This paper discusses relevant technological issues and summarizes progress toward adaptive x-ray telescopes.
The ARC (Astrophysical Research Consortium) telescope project.
Anderson, K. S.
A consortium of universities intends to construct a 3.5 meter optical-infrared telescope at a site in south-central New Mexico. The use of innovative mirror technology, a fast primary, and an alt-azimuth mounting results in a compact and lightweight instrument. This telescope will be uniquely well-suited for addressing certain observational programs by virtue of its capability for fully remote operation and rapid instrument changes.
International Nuclear Information System (INIS)
Finkel, Elizabeth
2017-01-01
On a flat, red mulga plain in the outback of Western Australia, preparations are under way to build the most audacious telescope astronomers have ever dreamed of - the Square Kilometre Array (SKA). Next-generation telescopes usually aim to double the performance of their predecessors. The Australian arm of SKA will deliver a 168-fold leap on the best technology available today, to show us the universe as never before. It will tune into signals emitted just a million years after the Big Bang, when the universe was a sea of hydrogen gas, slowly percolating with the first galaxies. Their starlight illuminated the fledgling universe in what is referred to as the “cosmic dawn”.
A balloon borne telescope for planetary observations with a fine pointing technology
Shoji, Yasuhiro; Onishi, Tomoya; Battazzo, Steve; Yoshimura, Atsushi; Sakamoto, Yuji; Yoshida, Kazuya; Takahashi, Yukihiro; Taguchi, Makoto
A balloon borne telescope is one of the effective observation methods for planets under space environment. A telescope is carried up to the stratosphere at an altitude of higher than 32 km where the air density is as thin as 1/100 of that at the ground. The thin atmosphere gives a telescope better observation conditions: fine seeing, stable weather, and high transmittance especially in the infrared region. Moreover there is a chance that a planet can be continuously seen for a window longer than 24 hours from the polar stratosphere. The authors have been developing a balloon borne telescope system for years to take finer images of planets in the solar system., The first object is Venus, of which atmospheric motions are derived by tracking the changes of cloud patterns with bands of UV, visible and NIR. Highly precise pointing control within the error of sub-arcseconds is required so that the balloon borne telescope achieves its diffraction-limited spatial resolution. The flight system is equipped with a three-stage attitude and pointing control system in order to realize the desired pointing control precision. In 2009, the flight system was built and tested in various ground tests and an actual balloon flight. Although the balloon experiment failed due to trouble with an onboard computer, the ground tests before the flight operation have verified that the pointing control system can achieve pointing error of less than 0.2 arcseconds. The balloon borne telescope is being redesigned for a sequential observation of Venus, Mars and Jupiter in the summer of 2011. This flight will be a step for a long-duration observation in the polar stratosphere. Additionally, an observation of the sodium tail of Mercury with a small telescope and a wide field of view has been under consideration. Mercury has very thin atmosphere called a surface-bounded exosphere. Past observations by spacecraft and ground-based telescopes revealed that one of the atmospheric components, gaseous
Otte, A N; Dickinson, H.; Funk, S.; Jogler, T.; Johnson, C.A.; Karn, P.; Meagher, K.; Naoya, H.; Nguyen, T.; Okumura, A.; Santander, M.; Sapozhnikov, L.; Stier, A.; Tajima, H.; Tibaldo, L.; Vandenbroucke, J.; Wakely, S.; Weinstein, A.; Williams, D.A.
2015-01-01
We present the development of a novel 11328 pixel silicon photomultiplier (SiPM) camera for use with a ground-based Cherenkov telescope with Schwarzschild-Couder optics as a possible medium-sized telescope for the Cherenkov Telescope Array (CTA). The finely pixelated camera samples air-shower images with more than twice the optical resolution of cameras that are used in current Cherenkov telescopes. Advantages of the higher resolution will be a better event reconstruction yielding improved background suppression and angular resolution of the reconstructed gamma-ray events, which is crucial in morphology studies of, for example, Galactic particle accelerators and the search for gamma-ray halos around extragalactic sources. Packing such a large number of pixels into an area of only half a square meter and having a fast readout directly attached to the back of the sensors is a challenging task. For the prototype camera development, SiPMs from Hamamatsu with through silicon via (TSV) technology are used. We give ...
Overview of diffraction gratings technologies for spaceflight satellites and ground-based telescopes
Cotel, A.; Liard, A.; Desserouer, F.; Pichon, P.
2017-11-01
The diffraction gratings are widely used in Space-flight satellites for spectrograph instruments or in ground-based telescopes in astronomy. The diffraction gratings are one of the key optical components of such systems and have to exhibit very high optical performances. HORIBA Jobin Yvon S.A.S. (part of HORIBA Group) is in the forefront of such gratings development for more than 40 years. During the past decades, HORIBA Jobin Yvon (HJY) has developed a unique expertise in diffraction grating design and manufacturing processes for holographic, ruled or etched gratings. We will present in this paper an overview of diffraction grating technologies especially designed for space and astronomy applications. We will firstly review the heritage of the company in this field with the space qualification of different grating types. Then, we will describe several key grating technologies developed for specific space or astronomy projects: ruled blazed low groove density plane reflection grating, high-groove density holographic toroidal and spherical grating, and finally transmission Fused Silica Etched (FSE) grism-assembled grating. We will not present the Volume Phase Holographic (VPHG) grating type which is used in Astronomy.
Engineering and science highlights of the KAT-7 radio telescope
Foley, A. R.; Alberts, T.; Armstrong, R. P.; Barta, A.; Bauermeister, E. F.; Bester, H.; Blose, S.; Booth, R. S.; Botha, D. H.; Buchner, S. J.; Carignan, C.; Cheetham, T.; Cloete, K.; Coreejes, G.; Crida, R. C.; Cross, S. D.; Curtolo, F.; Dikgale, A.; de Villiers, M. S.; du Toit, L. J.; Esterhuyse, S. W. P.; Fanaroff, B.; Fender, R. P.; Fijalkowski, M.; Fourie, D.; Frank, B.; George, D.; Gibbs, P.; Goedhart, S.; Grobbelaar, J.; Gumede, S. C.; Herselman, P.; Hess, K. M.; Hoek, N.; Horrell, J.; Jonas, J. L.; Jordaan, J. D. B.; Julie, R.; Kapp, F.; Kotzé, P.; Kusel, T.; Langman, A.; Lehmensiek, R.; Liebenberg, D.; Liebenberg, I. J. V.; Loots, A.; Lord, R. T.; Lucero, D. M.; Ludick, J.; Macfarlane, P.; Madlavana, M.; Magnus, L.; Magozore, C.; Malan, J. A.; Manley, J. R.; Marais, L.; Marais, N.; Marais, S. J.; Maree, M.; Martens, A.; Mokone, O.; Moss, V.; Mthembu, S.; New, W.; Nicholson, G. D.; van Niekerk, P. C.; Oozeer, N.; Passmoor, S. S.; Peens-Hough, A.; Pińska, A. B.; Prozesky, P.; Rajan, S.; Ratcliffe, S.; Renil, R.; Richter, L. L.; Rosekrans, D.; Rust, A.; Schröder, A. C.; Schwardt, L. C.; Seranyane, S.; Serylak, M.; Shepherd, D. S.; Siebrits, R.; Sofeya, L.; Spann, R.; Springbok, R.; Swart, P. S.; Thondikulam, Venkatasubramani L.; Theron, I. P.; Tiplady, A.; Toruvanda, O.; Tshongweni, S.; van den Heever, L.; van der Merwe, C.; van Rooyen, R.; Wakhaba, S.; Walker, A. L.; Welz, M.; Williams, L.; Wolleben, M.; Woudt, P. A.; Young, N. J.; Zwart, J. T. L.
2016-01-01
The construction of the seven-dish Karoo Array Telescope (KAT-7) array in the Karoo region of the Northern Cape in South Africa was intended primarily as an engineering prototype for technologies and techniques applicable to the MeerKAT telescope. This paper looks at the main engineering and
Telescopes in Near Space: Balloon Exoplanet Nulling Interferometer (BigBENI)
Lyon, Richard G.; Clampin, Mark; Petrone, Peter; Mallik, Udayan; Mauk, Robin
2012-01-01
A significant and often overlooked path to advancing both science and technology for direct imaging and spectroscopic characterization of exosolar planets is to fly "near space" missions, i.e. balloon borne exosolar missions. A near space balloon mission with two or more telescopes, coherently combined, is capable of achieving a subset of the mission science goals of a single large space telescope at a small fraction of the cost. Additionally such an approach advances technologies toward flight readiness for space flight. Herein we discuss the feasibility of flying two 1.2 meter telescopes, with a baseline separation of 3.6 meters, operating in visible light, on a composite boom structure coupled to a modified visible nulling coronagraph operating to achieve an inner working angle of 60 milli-arcseconds. We discuss the potential science return, atmospheric residuals at 135,000 feet, pointing control and visible nulling and evaluate the state-or-art of these technologies with regards to balloon missions.
First results of the Test-Bed Telescopes (TBT) project: Cebreros telescope commissioning
Ocaña, Francisco; Ibarra, Aitor; Racero, Elena; Montero, Ángel; Doubek, Jirí; Ruiz, Vicente
2016-07-01
The TBT project is being developed under ESA's General Studies and Technology Programme (GSTP), and shall implement a test-bed for the validation of an autonomous optical observing system in a realistic scenario within the Space Situational Awareness (SSA) programme of the European Space Agency (ESA). The goal of the project is to provide two fully robotic telescopes, which will serve as prototypes for development of a future network. The system consists of two telescopes, one in Spain and the second one in the Southern Hemisphere. The telescope is a fast astrograph with a large Field of View (FoV) of 2.5 x 2.5 square-degrees and a plate scale of 2.2 arcsec/pixel. The tube is mounted on a fast direct-drive mount moving with speed up to 20 degrees per second. The focal plane hosts a 2-port 4K x 4K back-illuminated CCD with readout speeds up to 1MHz per port. All these characteristics ensure good survey performance for transients and fast moving objects. Detection software and hardware are optimised for the detection of NEOs and objects in high Earth orbits (objects moving from 0.1-40 arcsec/second). Nominal exposures are in the range from 2 to 30 seconds, depending on the observational strategy. Part of the validation scenario involves the scheduling concept integrated in the robotic operations for both sensors. Every night it takes all the input needed and prepares a schedule following predefined rules allocating tasks for the telescopes. Telescopes are managed by RTS2 control software, that performs the real-time scheduling of the observation and manages all the devices at the observatory.1 At the end of the night the observing systems report astrometric positions and photometry of the objects detected. The first telescope was installed in Cebreros Satellite Tracking Station in mid-2015. It is currently in the commissioning phase and we present here the first results of the telescope. We evaluate the site characteristics and the performance of the TBT Cebreros
Ghost telescope and ghost Fourier telescope with thermal light
International Nuclear Information System (INIS)
Gong Wenlin; Han Shensheng
2011-01-01
As important observation tools, telescopes are very useful in remote observations. We report a proof-of-principle experimental demonstration of ghost telescope scheme and show that, by measuring the intensity correlation of two light fields and only changing the position of the detector in the reference path, ghost telescope and ghost Fourier telescope can be obtained even if a single-pixel detector is fixed in Fresnel region of the object. Differences between conventional telescope and ghost telescope are also discussed.
Deployment of a Pair of 3 M telescopes in Utah
Energy Technology Data Exchange (ETDEWEB)
Finnegan, G; Adams, B; Butler, K; Cardoza, J; Colin, P; Hui, C M; Kieda, D; Kirkwood, D; Kress, D; Kress, M; LeBohec, S; McGuire, C; Newbold, M; Nunez, P; Pham, K [University of Utah, Department of Physics, Salt Lake City, Utah 84112 (United States)
2008-12-24
Two 3 m telescopes are being installed in Grantsville Utah. They are intended for the testing of various approaches to the implementation of intensity interferometry using Cherenkov Telescopes in large arrays as receivers as well as for the testing of novel technology cameras and electronics for ground based gamma-ray astronomy.
Modular Orbital Demonstration of an Evolvable Space Telescope (MODEST)
Baldauf, Brian; Conti, Alberto
2016-01-01
The "Search for Life" via imaging of exoplanets is a mission that requires extremely stable telescopes with apertures in the 10 m to 20 m range. The High Definition Space Telescope (HDST) envisioned for this mission would have an aperture >10 m, which is a larger payload than what can be delivered to space using a single launch vehicle. Building and assembling the mirror segments enabling large telescopes will likely require multiple launches and assembly in space. Space-based telescopes with large apertures will require major changes to system architectures.The Optical Telescope Assembly (OTA) for HDST is a primary mission cost driver. Enabling and affordable solutions for this next generation of large aperture space-based telescope are needed.This paper reports on the concept for the Modular Orbital Demonstration of an Evolvable Space Telescope (MODEST), which demonstrates on-orbit robotic and/or astronaut assembly of a precision optical telescope in space. It will also facilitate demonstration of active correction of phase and mirror shape. MODEST is proposed to be delivered to the ISS using standard Express Logistics Carriers (ELCs) and can mounted to one of a variety of ISS pallets. Post-assembly value includes space, ground, and environmental studies, and a testbed for new instruments. This demonstration program for next generation mirror technology provides significant risk reduction and demonstrates the technology in a six-mirror phased telescope. Other key features of the demonstration include the use of an active primary optical surface with wavefront feedback control that allows on-orbit optimization and demonstration of precise surface control to meet optical system wavefront and stability requirements.MODEST will also be used to evaluate advances in lightweight mirror and metering structure materials such as SiC or Carbon Fiber Reinforced Polymer that have excellent mechanical and thermal properties, e.g. high stiffness, high modulus, high thermal
LOBSTER - New Space X-Ray telescopes
International Nuclear Information System (INIS)
Hudec, R.; Pina, L.; Simon, V.; Sveda, L.; Inneman, A.; Semencova, V.; Skulinova, M.
2007-01-01
We discuss the technological and scientific aspects of fully innovative very wide-field X-ray telescopes with high sensitivity. The prototypes of Lobster telescopes designed, developed and tested are very promising, allowing the proposals for space projects with very wide-field Lobster Eye X-ray optics to be considered for the first time. The novel telescopes will monitor the sky with unprecedented sensitivity and angular resolution of order of 1 arcmin. They are expected to contribute essentially to study of various astrophysical objects such as AGN, SNe, Gamma-ray bursts (GRBs), X-ray flashes (XRFs), galactic binary sources, stars, CVs, X-ray novae, various transient sources, etc. For example, the Lobster optics based X-ray All Sky Monitor is capable to detect around 20 GRBs and 8 XRFs yearly and this will surely significantly contribute to the related science
ESO Telescope Designer Raymond Wilson Wins Prestigious Kavli Award for Astrophysics
2010-06-01
Raymond Wilson, whose pioneering optics research at ESO made today's giant telescopes possible thanks to "active optics" technology, has been awarded the 2010 Kavli Prize in astrophysics. The founder and original leader of the Optics and Telescopes Group at ESO, Wilson shares the million-dollar prize with two American scientists, Jerry Nelson and Roger Angel. The biennial prize, presented by the Norwegian Academy of Science and Letters, the Kavli Foundation, and the Norwegian Ministry of Education and Research, was instituted in 2008 and is given to researchers who significantly advance knowledge in the fields of nanoscience, neuroscience, and astrophysics, acting as a complement to the Nobel Prize. The award is named for and funded by Fred Kavli, the Norwegian entrepreneur and philanthropist who later founded the Kavlico Corporation in the US - today one of the world's largest suppliers of sensors for aeronautic, automotive and industrial applications. Wilson, who joined ESO in 1972, strived to achieve optical perfection, developing the concept of active optics as a way to enhance the size of telescopic primary mirrors. It is the size of these mirrors that determines the ability of a telescope to gather light and study faint and distant objects. Before active optics, mirrors over six metres in diameter were impossible, being too heavy, costly, and likely to bend from gravity and temperature changes. The use of active optics, which preserves optimal image quality by continually adjusting the mirror's shape during observations, made lighter, thinner so-called "meniscus mirrors" possible. Wilson first led the implementation of active optics in the revolutionary New Technology Telescope at ESO's La Silla Observatory, and continued to develop and improve the technology until his retirement in 1993. Since then, active optics have become a standard part of modern astronomy, applied in every big telescope including ESO's Very Large Telescope (VLT), a telescope array
CFRP solutions for the innovative telescopes design
Rampini, Francesco; Marchiori, Gianpietro
2006-02-01
The new frontiers of the research in the astronomic field require the use of more and more advanced high-performance structures. Only an adequate technological innovation of conventional telescopes and radio-telescopes allow to obtain structures able to meet the new specification of the projects. Besides, technological innovation is founded not only on the identification of more and more sophisticated mechanisms and optical instruments, but also on the development of new materials and manufacturing processes for the entire structure that constitute an instrument such as a telescope or a radio-telescope. Among these materials, the use of the carbon fibre is highly important. This material, which is already widely used in the aerospace and automotive fields, shall join also the astronomic field for ground instruments. Thanks to the experience acquired with instruments like ALMA, the industry of composites is now able to guarantee different solutions at relatively low costs that allow the instruments of new generation to move extremely important steps in the development of scientific research. Not just materials, but also processes, through which the materials are worked and manufactured, are extremely important. The use of technologies, such as hand lay-up vacuum bag, compression moulding, table rolling of composite tubes, filament winding, poltrusion and Resin Transfer Moulding (RTM), allow to identify the ideal solution both for big dimension objects, such as backup structure, main mirror structure of quadripod legs, and relatively small objects, such as actuators, adjusters system, etc. The wide choice, concerning the use of composite materials, and their techniques of production, allow the technicians to satisfy the exigencies of astronomers be they addressed to simple control of the weights or of the stiffness of the structures, or to specific thermal behaviour of the piece itself.
WorldWide Telescope and Google Sky: New Technologies to Engage Students and the Public
Landsberg, R. H.; Subbarao, M. U.; Dettloff, L.
2010-08-01
New, visually rich, astronomical software environments coupled with large web-accessible data sets hold the promise of new and exciting ways to teach, collaborate, and explore the universe. These freeware tools provide contextual views of astronomical objects, real time access to multi-wavelength sky surveys, and, most importantly, the ability to incorporate new data and to produce user created content. This interactive panel examined the capabilities of Google Sky and WorldWide Telescope, and explored case studies of how these tools have been used to create compelling and participatory educational experiences in both formal (i.e., K-12 and undergraduate non-science majors classrooms), and informal (e.g., museum) settings. The overall goal of this session was to stimulate a discussion about future uses of these technologies. Substantial time was allotted for participants to create conceptual designs of learning experiences for use at their home institutions, with feedback provided by the panel members. Activities included technical discussions (e.g., mechanisms for incorporating new data and dissemination tools), exercises in narrative preparation, and a brainstorming session to identify potential future uses of these technologies.
Spectroscopy of near-Earth asteroids
DEFF Research Database (Denmark)
Michelsen, René; Nathues, Andreas; Lagerkvist, Claes-Ingvar
2006-01-01
We present spectra and taxonomic classifications of 12 Near-Earth Asteroids (NEAs) and 2 inner Main Belt asteroids. The observations were carried out with the ESO 3.5 m NTT and the Danish 1.54 m telescope at La Silla, Chile. Eleven of the investigated NEAs belong to the S class while only one C-t...
Femtosecond laser-assisted cataract surgery and implantable miniature telescope
Directory of Open Access Journals (Sweden)
Randal Pham
2017-09-01
Conclusions and importance: To our knowledge and confirmed by the manufacturer of the implantable miniature telescope this is the first case ever reported of a patient who has undergone femtosecond laser cataract surgery with corneal astigmatism correction and implantation of the implantable miniature telescope. This is also the first case report of the preoperative use of microperimetry and visual electrophysiology to evaluate a patient's postoperative potential visual acuity. The success of the procedure illustrated the importance of meticulous preoperative planning, the combined use of state-of-the-art technologies and the seamless teamwork in order to achieve the best clinical outcome for patients who undergo implantation of the implantable miniature telescope.
Using the ISS as a testbed to prepare for the next generation of space-based telescopes
Postman, Marc; Sparks, William B.; Liu, Fengchuan; Ess, Kim; Green, Joseph; Carpenter, Kenneth G.; Thronson, Harley; Goullioud, Renaud
2012-09-01
The infrastructure available on the ISS provides a unique opportunity to develop the technologies necessary to assemble large space telescopes. Assembling telescopes in space is a game-changing approach to space astronomy. Using the ISS as a testbed enables a concentration of resources on reducing the technical risks associated with integrating the technologies, such as laser metrology and wavefront sensing and control (WFS&C), with the robotic assembly of major components including very light-weight primary and secondary mirrors and the alignment of the optical elements to a diffraction-limited optical system in space. The capability to assemble the optical system and remove and replace components via the existing ISS robotic systems such as the Special Purpose Dexterous Manipulator (SPDM), or by the ISS Flight Crew, allows for future experimentation as well as repair if necessary. In 2015, first light will be obtained by the Optical Testbed and Integration on ISS eXperiment (OpTIIX), a small 1.5-meter optical telescope assembled on the ISS. The primary objectives of OpTIIX include demonstrating telescope assembly technologies and end-to-end optical system technologies that will advance future large optical telescopes.
Greger, R.; Rugi, E.; Hausner, Th.; Jahnen, W.; Frei, S.; Pellaton, D.; Mueller, P.; Hollenbach, I.
2017-11-01
This paper gives an overview on the development of a light weighted Cassegrain telescope with a 200 mm optical aperture as one key element of the Laser Altimeter which will fly on the BepiColombo mission to Mercury (BELA).The Receiver Telescope (RTL) collects the light pulse transmitted to Mercury and reflected from the planet's surface. Mercury's challenging thermal environment, the thermo-mechanical stability of the telescope and the stringent instrument's mass budget require the implementation of an innovative design solution to achieve the requested optical performance over an extended temperature range.
Hase, H.; Dassing, R.; Kronschnabl, G.; Schlüter, W.; Schwarz, W.; Lauber, P.; Kilger, R.
2007-07-01
Following the recommendations made by the VLBI2010 vision report of the IVS, a proposal has been made to construct a Twin Telescope for the Fundamental Station Wettzell in order to meet the future requirements of the next VLBI generation. The Twin Telescope consists of two identical radiotelescopes. It is a project of the Federal Agency for Cartography and Geodesy (BKG). This article summarizes the project and some design ideas for the Twin-Telescope. %ZALMA (2005). Technical Specification for Design, Manufacturing, Transport and Integration on Site of the ALMA ANTENNAS, Doc. ALMA-34.00.00.00.006-BSPE. Behrend, D. (2006). VLBI2010 Antenna Specs, Data sheet. DeBoer, D. (2001). The ATA Offset Gregorian Antenna, ATA Memo #16, February 10. Imbriale, W.A. (2006). Design of a Wideband Radio Telescope, Jet Propulsion Laboratory and S. Weinreb and H. Mandi, California Institute of Technology. Kilger, R. (2007). TWIN-Design studies, Presentation for the IVS board members (internal document),Wettzell. Kronschnabl, G. (2006). Subject: Memo from Bill Petrachenko, E-mail to the Twin-Working Group (in German), July. Lindgren, ETS-Lindgren (2005). The Model 3164-05 Open Boundary Quadridge Horn, Data Sheet. Niell, A., A. Whitney, W. Petrachenko, W. Schlüter, N. Vandenberg, H.Hase, Y. Koyama, C. Ma, H. Schuh, G. Tucari (2006). in: IVS Annual Report 2005, pg. 13-40, NASA/TP-2006-214136, April. Olsson, R., Kildal, P.-S., and Weinreb, S. (2006). IEEE Transactions on Antennas and Propagation, Vol. 54, No. 2, February. Petrachenko, B. (2006). The Case For and Against Multiple Antennas at a Site, IVS Memorandum, 2006-019v01. Petrachenko, B. (2006). IVS Memorandum, 2006-016v01. RFSpin (2004). Double Ridged Waveguide Horn-Model DRH20, Antenna Specifications, Data Sheet. Rohde&Schwarz (2004). SHF Antennas Crossed Log- Periodic Antennas HL024A1/S1, Data Sheet. Rohde&Schwarz (2004). SHF Antennas Log-Periodic Antennas HL050/HL050S1, Data Sheet. Rogers, A.E.E. (2006). Simulations of broadband
Using New Media to Spread the Word About the James Webb Space Telescope
Masetti, Maggie; Krishnamurthi, A.
2008-05-01
The James Webb Space Telescope is a 6.5 m infrared telescope that will be launched in 2013. This modern telescope will look very different from the simple telescope Galileo used to look up at the skies 400 years ago. Modern technology, coupled with scientific curiosity, is enabling science to help us understand a Universe Galileo had not dreamed of in his time. The International Year of Astronomy presents an excellent opportunity to take the public along on the journey of the development of the Webb Telescope and its technological innovations. In keeping with the cutting-edge nature of the Webb, its education and public outreach (EPO) team is using a variety of new media to engage the public. We will discuss several of our EPO projects including our website, exhibits and displays in Second Life (an internet-based virtual world), and involvement in podcasts. Webb's EPO team is looking to expand past a passive web presence to engage the new and growing internet-savvy audiences. We are making our website more interactive through a variety of means, including a Flash game that allows the user to compare the Webb to a common reflecting telescope. This will enable the user to learn about the changes in telescopes that have come about since Galileo's time. We are also taking advantage of other new media opportunities as they present themselves - we participate in podcasts and have an engaging presence for the Webb Telescope on NASA's "islands” in Second Life.
Large fully retractable telescope enclosures still closable in strong wind
Bettonvil, Felix C. M.; Hammerschlag, Robert H.; Jägers, Aswin P. L.; Sliepen, Guus
2008-07-01
Two prototypes of fully retractable enclosures with diameters of 7 and 9 m have been built for the high-resolution solar telescopes DOT (Dutch Open Telescope) and GREGOR, both located at the Canary Islands. These enclosures protect the instruments for bad weather and are fully open when the telescopes are in operation. The telescopes and enclosures also operate in hard wind. The prototypes are based on tensioned membrane between movable but stiff bows, which fold together to a ring when opened. The height of the ring is small. The prototypes already survived several storms, with often snow and ice, without any damage, including hurricane Delta with wind speeds up to 68 m/s. The enclosures can still be closed and opened with wind speeds of 20 m/s without any problems or restrictions. The DOT successfully demonstrated the open, wind-flushing concept for astronomical telescopes. It is now widely recognized that also large future telescopes benefit from wind-flushing and retractable enclosures. These telescopes require enclosures with diameters of 30 m until roughly 100 m, the largest sizes for the ELTs (Extreme Large Telescopes), which will be built in the near future. We discuss developments and required technology for the realization of these large sizes.
Cooray, Asantha; Origins Space Telescope Study Team
2018-01-01
The Origins Space Telescope (OST) is the mission concept for the Far-Infrared Surveyor, a study in development by NASA in preparation for the 2020 Astronomy and Astrophysics Decadal Survey. Origins is planned to be a large aperture, actively-cooled telescope covering a wide span of the mid- to far-infrared spectrum. Its spectrographs will enable 3D surveys of the sky that will discover and characterize the most distant galaxies, Milky-Way, exoplanets, and the outer reaches of our Solar system. Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s. The Science and Technology Definition Team (STDT) would like to hear your science needs and ideas for this mission. The team can be contacted at firsurveyor_info@lists.ipac.caltech.edu. This presentation will provide a summary of the OST STDT, our completed first mission concept and an introduction to the second concept that will be studied at the study center in 2018. This presentation will also summarize key science drivers and the key study milestones between 2018 and 2020.
San Pedro Martir Telescope: Mexican design endeavor
Toledo-Ramirez, Gengis K.; Bringas-Rico, Vicente; Reyes, Noe; Uribe, Jorge; Lopez, Aldo; Tovar, Carlos; Caballero, Xochitl; Del-Llano, Luis; Martinez, Cesar; Macias, Eduardo; Lee, William; Carramiñana, Alberto; Richer, Michael; González, Jesús; Sanchez, Beatriz; Lucero, Diana; Manuel, Rogelio; Segura, Jose; Rubio, Saul; Gonzalez, German; Hernandez, Obed; García, Mary; Lazaro, Jose; Rosales-Ortega, Fabian; Herrera, Joel; Sierra, Gerardo; Serrano, Hazael
2016-08-01
The Telescopio San Pedro Martir (TSPM) is a new ground-based optical telescope project, with a 6.5 meters honeycomb primary mirror, to be built in the Observatorio Astronomico Nacional on the Sierra San Pedro Martir (OAN-SPM) located in Baja California, Mexico. The OAN-SPM has an altitude of 2830 meters above sea level; it is among the best location for astronomical observation in the world. It is located 1830 m higher than the atmospheric inversion layer with 70% of photometric nights, 80% of spectroscopic nights and a sky brightness up to 22 mag/arcsec2. The TSPM will be suitable for general science projects intended to improve the knowledge of the universe established on the Official Mexican Program for Science, Technology and Innovation 2014-2018. The telescope efforts are headed by two Mexican institutions in name of the Mexican astronomical community: the Universidad Nacional Autonoma de Mexico and the Instituto Nacional de Astrofisica, Optica y Electronica. The telescope has been financially supported mainly by the Consejo Nacional de Ciencia y Tecnologia (CONACYT). It is under development by Mexican scientists and engineers from the Center for Engineering and Industrial Development. This development is supported by a Mexican-American scientific cooperation, through a partnership with the University of Arizona (UA), and the Smithsonian Astrophysical Observatory (SAO). M3 Engineering and Technology Corporation in charge of enclosure and building design. The TSPM will be designed to allow flexibility and possible upgrades in order to maximize resources. Its optical and mechanical designs are based upon those of the Magellan and MMT telescopes. The TSPM primary mirror and its cell will be provided by the INAOE and UA. The telescope will be optimized from the near ultraviolet to the near infrared wavelength range (0.35-2.5 m), but will allow observations up to 26μm. The TSPM will initially offer a f/5 Cassegrain focal station. Later, four folded Cassegrain and
The TOTEM GEM Telescope (T2) at the LHC
International Nuclear Information System (INIS)
Quinto, M.; Berretti, M.; David, E.; Garcia, F.; Greco, V.; Heino, J.; Hilden, T.; Kurvinen, K.; Lami, S.; Latino, G.; Lauhakangas, R.; Oliveri, E.; Ropelewski, L.; Scribano, A.; Turini, N.; Stenis, M. van
2011-01-01
The TOTEM T2 telescope will measure inelastically produced charged particles in the forward region of the LHC Interaction Point 5. Each arm of the telescope consists in a set of 20 triple-GEM (Gas Electron Multiplier) detectors with tracking and trigger capabilities. The GEM technology has been considered for the design of TOTEM very forward T2 telescopes thanks to its characteristics: large active areas, good position and timing resolution, excellent rate capability and radiation hardness. Each of the four T2 half arms has been fully assembled and equipped with electronics at CERN and systematically tested in the SPS beam line H8 in 2008/09. After some optimization, the operation of the GEM chambers was fully satisfactory and the T2 telescopes were installed and commissioned in their final positions at the LHC interaction point. During the first LHC run (December 2009) the T2 telescopes have collected data, at 900 GeV and 2.36 TeV. We will present here the performances of the detector and the preliminary results obtained using the data collected.
The TOTEM GEM Telescope (T2) at the LHC
Energy Technology Data Exchange (ETDEWEB)
Quinto, M. [INFN Sezione di Bari, Via E.Orabona n 4, 70126 Bari (Italy); Berretti, M. [University of Siena, Physics Department, Via Roma 56, I-53100 Siena (Italy); INFN Sezione di Pisa, Largo B. Pontecorvo, 3. I-56127. Pisa (Italy); David, E. [CERN, PH Department, 1211 Geneva 23, Geneva (Switzerland); Garcia, F. [University of Helsinki, Institute of Physics and Department of Physical Sciences, Helsinki (Finland); Greco, V. [University of Siena, Physics Department, Via Roma 56, I-53100 Siena (Italy); INFN Sezione di Pisa, Largo B. Pontecorvo, 3. I-56127. Pisa (Italy); Heino, J.; Hilden, T.; Kurvinen, K. [University of Helsinki, Institute of Physics and Department of Physical Sciences, Helsinki (Finland); Lami, S. [INFN Sezione di Pisa, Largo B. Pontecorvo, 3. I-56127. Pisa (Italy); Latino, G. [University of Siena, Physics Department, Via Roma 56, I-53100 Siena (Italy); INFN Sezione di Pisa, Largo B. Pontecorvo, 3. I-56127. Pisa (Italy); Lauhakangas, R. [University of Helsinki, Institute of Physics and Department of Physical Sciences, Helsinki (Finland); Oliveri, E. [University of Siena, Physics Department, Via Roma 56, I-53100 Siena (Italy); INFN Sezione di Pisa, Largo B. Pontecorvo, 3. I-56127. Pisa (Italy); Ropelewski, L. [CERN, PH Department, 1211 Geneva 23, Geneva (Switzerland); Scribano, A.; Turini, N. [University of Siena, Physics Department, Via Roma 56, I-53100 Siena (Italy); INFN Sezione di Pisa, Largo B. Pontecorvo, 3. I-56127. Pisa (Italy); Stenis, M. van [CERN, PH Department, 1211 Geneva 23, Geneva (Switzerland)
2011-06-15
The TOTEM T2 telescope will measure inelastically produced charged particles in the forward region of the LHC Interaction Point 5. Each arm of the telescope consists in a set of 20 triple-GEM (Gas Electron Multiplier) detectors with tracking and trigger capabilities. The GEM technology has been considered for the design of TOTEM very forward T2 telescopes thanks to its characteristics: large active areas, good position and timing resolution, excellent rate capability and radiation hardness. Each of the four T2 half arms has been fully assembled and equipped with electronics at CERN and systematically tested in the SPS beam line H8 in 2008/09. After some optimization, the operation of the GEM chambers was fully satisfactory and the T2 telescopes were installed and commissioned in their final positions at the LHC interaction point. During the first LHC run (December 2009) the T2 telescopes have collected data, at 900 GeV and 2.36 TeV. We will present here the performances of the detector and the preliminary results obtained using the data collected.
An EUDET/AIDA Pixel Beam Telescope for Detector Development
Rubinskiy, I
2015-01-01
Ahigh resolution(σ< 2 μm) beam telescope based on monolithic active pixel sensors (MAPS) was developed within the EUDET collaboration. EUDET was a coordinated detector R&D programme for the future International Linear Collider providing test beam infrastructure to detector R&D groups. The telescope consists of six sensor planes with a pixel pitch of either 18.4 μm or 10 μmand canbe operated insidea solenoidal magnetic fieldofupto1.2T.Ageneral purpose cooling, positioning, data acquisition (DAQ) and offine data analysis tools are available for the users. The excellent resolution, readout rate andDAQintegration capabilities made the telescopea primary beam tests tool also for several CERN based experiments. In this report the performance of the final telescope is presented. The plans for an even more flexible telescope with three differentpixel technologies(ATLASPixel, Mimosa,Timepix) withinthenew European detector infrastructure project AIDA are presented.
Schwartz, Daniel A.; Allured, Ryan; Bookbinder, Jay A.; Cotroneo, Vincenzo; Forman, William R.; Freeman, Mark D.; McMuldroch, Stuart; Reid, Paul B.; Tananbaum, Harvey; Vikhlinin, Alexey A.;
2014-01-01
Addressing the astrophysical problems of the 2020's requires sub-arcsecond x-ray imaging with square meter effective area. Such requirements can be derived, for example, by considering deep x-ray surveys to find the young black holes in the early universe (large redshifts) which will grow into the first super-massive black holes. We have envisioned a mission, the Square Meter Arcsecond Resolution Telescope for X-rays (SMART-X), based on adjustable x-ray optics technology, incorporating mirrors with the required small ratio of mass to collecting area. We are pursuing technology which achieves sub-arcsecond resolution by on-orbit adjustment via thin film piezoelectric "cells" deposited directly on the non-reflecting sides of thin, slumped glass. While SMART-X will also incorporate state-of-the-art x-ray cameras, the remaining spacecraft systems have no requirements more stringent than those which are well understood and proven on the current Chandra X-ray Observatory.
Dynamic Model and Analysis of Asymmetric Telescopic Wing for Morphing Aircraft
Directory of Open Access Journals (Sweden)
Chen Lili
2016-01-01
Full Text Available Morphing aircraft has been the research hot topics of new concept aircrafts in aerospace engineering. Telescopic wing is an important morphing technology for morphing aircraft. This paper describes the dynamic equations and kinematic equations based on theorem of momentum and theorem of moment of momentum, which are available for all morphing aircrafts. Meanwhile,as simplified , dynamic equations for rectangular telescopic wing are presented. In order to avoid the complexity using aileron to generate rolling moment , an new idea that asymmetry of wings can generate roll moment is introduced. Finally, roll performance comparison of asymmetric wing and aileron deflection shows that asymmetric telescopic wing can provide the required roll control moment as aileron, and in some cases, telescopic wing has the superior roll performance.
Focusing Telescopes in Nuclear Astrophysics
Ballmoos, Peter von
2007-01-01
This volume is the first of its kind on focusing gamma-ray telescopes. Forty-eight refereed papers provide a comprehensive overview of the scientific potential and technical challenges of this nascent tool for nuclear astrophysics. The book features articles dealing with pivotal technologies such as grazing incident mirrors, multilayer coatings, Laue- and Fresnel-lenses - and even an optic using the curvature of space-time. The volume also presents an overview of detectors matching the ambitious objectives of gamma ray optics, and facilities for operating such systems on the ground and in space. The extraordinary scientific potential of focusing gamma-ray telescopes for the study of the most powerful sources and the most violent events in the Universe is emphasized in a series of introductory articles. Practicing professionals, and students interested in experimental high-energy astrophysics, will find this book a useful reference
Aluminum Mirror Coatings for UVOIR Telescope Optics Including the Far UV
Balasubramanian, Kunjithapatha; Hennessy, John; Raouf, Nasrat; Nikzad, Shouleh; Ayala, Michael; Shaklan, Stuart; Scowen, Paul; Del Hoyo, Javier; Quijada, Manuel
2015-01-01
NASA Cosmic Origins (COR) Program identified the development of high reflectivity mirror coatings for large astronomical telescopes particularly for the far ultra violet (FUV) part of the spectrum as a key technology requiring significant materials research and process development. In this paper we describe the challenges and accomplishments in producing stable high reflectance aluminum mirror coatings with conventional evaporation and advanced Atomic Layer Deposition (ALD) techniques. We present the current status of process development with reflectance of approx. 55 to 80% in the FUV achieved with little or no degradation over a year. Keywords: Large telescope optics, Aluminum mirror, far UV astrophysics, ALD, coating technology development.
The Argonne beamline-B telescope control system: A study of adaptability
International Nuclear Information System (INIS)
Fuka, M.A.; Clout, P.N.; Conley, A.P.; Hill, J.O.; Rothrock, R.B.; Trease, L.L.; Zander, M.E.
1987-01-01
A beam-expanding telescope to study high-precision H - particle optics and beam sensing was designed by the Accelerator Technology Division at Los Alamos National Laboratory and will be installed on beamline-B at Argonne National Laboratory. The control system for this telescope was developed in a relatively short period of time using experience gained from building the Proton Storage Ring (PSR) control system. The designers modified hardware and software to take advantage of new technology as well as to meet the requirements of the new system. This paper discusses lessons learned in the process of adapting hardware and software from an existing control system to one with rather different requirements
Wise, Peter; Hodgson, Alan
2006-06-01
Since the launch of the Hubble Space Telescope there has been widespread popular interest in astronomy. A further series of events, most notably the recent Deep Impact mission and Mars oppositions have served to fuel further interest. As a result more and more amateurs are coming into astronomy as a practical hobby. At the same time more sophisticated optical equipment is becoming available as the price to performance ratio become more favourable. As a result larger and better optical telescopes are now in use by amateurs. We also have the explosive growth in digital imaging technologies. In addition to displacing photographic film as the preferred image capture modality it has made the capture of high quality astronomical imagery more accessible to a wider segment of the astronomy community. However, this customer requirement has also had an impact on telescope design. There has become a greater imperative for wide flat image fields in these telescopes to take advantage of the ongoing advances in CCD imaging technology. As a result of these market drivers designers of consumer astronomical telescopes are now producing state of the art designs that result in wide, flat fields with optimal spatial and chromatic aberrations. Whilst some of these designs are not scalable to the larger apertures required for professional ground and airborne telescope use there are some that are eminently suited to make this transition.
The Advanced Gamma-ray Imaging System (AGIS): Telescope Optical System Designs
Vassiliev, Vladimir; Buckley, Jim; Falcone, Abe; Fegan, Steven; Finley, John; Gaurino, Victor; Hanna, David; Kaaret, Philip; Konopelko, Alex; Krawczynski, Henric; Romani, Roger; Weekes, Trevor
2008-04-01
AGIS is a conceptual design for a future ground-based gamma-ray observatory based on an array of ˜100 imaging atmospheric Cherenkov telescopes (IACTs) with a sensitivity to gamma-rays in the energy range 40 GeV-100 TeV. The anticipated improvement of AGIS sensitivity, angular resolution, and reliability of operation imposes demanding technological and cost requirements on the design of the IACTs. In this submission we focus on the optical system (OS) of the AGIS telescopes and consider options which include traditional Davies-Cotton and the other prime- focus telescope designs, as well as a novel two-mirror aplanatic OS originally proposed by Schwarzschild. Emerging new mirror production technologies based on replication processes such as cold and hot glass slumping, cured CFRP, and electroforming provide new opportunities for cost effective solutions for the design of the OS. We evaluate the capabilities of these mirror fabrication methods for the AGIS project.
Lunar-based optical telescopes: Planning astronomical tools of the twenty-first century
Hilchey, J. D.; Nein, M. E.
1995-02-01
A succession of optical telescopes, ranging in aperture from 1 to 16 m or more, can be deployed and operated on the lunar surface over the next half-century. These candidates to succeed NASA's Great Observatories would capitalize on the unique observational advantages offered by the Moon. The Lunar Telescope Working Group and the LUTE Task Team of the George C. Marshall Space Flight Center (MSFC) have assessed the feasibility of developing and deploying these facilities. Studies include the 16-m Large Lunar Telescope (LLT); the Lunar Cluster Telescope Experiment (LCTE), a 4-m precursor to the LLT; the 2-m Lunar Transit Telescope (LTT); and its precursor, the 1-m Lunar Ultraviolet Telescope Experiment (LUTE). The feasibility of developing and deploying each telescope was assessed and system requirements and options for supporting technologies, subsystems, transportation, and operations were detailed. Influences of lunar environment factors and site selection on telescope design and operation were evaluated, and design approaches and key tradeoffs were established. This paper provides an overview of the study results. Design concepts and brief system descriptions are provided, including subsystem and mission options selected for the concepts.
Active x-ray optics for high resolution space telescopes
Doel, Peter; Atkins, Carolyn; Brooks, D.; Feldman, Charlotte; Willingale, Richard; Button, Tim; Rodriguez Sanmartin, Daniel; Meggs, Carl; James, Ady; Willis, Graham; Smith, Andy
2017-11-01
The Smart X-ray Optics (SXO) Basic Technology project started in April 2006 and will end in October 2010. The aim is to develop new technologies in the field of X-ray focusing, in particular the application of active and adaptive optics. While very major advances have been made in active/adaptive astronomical optics for visible light, little was previously achieved for X-ray optics where the technological challenges differ because of the much shorter wavelengths involved. The field of X-ray astronomy has been characterized by the development and launch of ever larger observatories with the culmination in the European Space Agency's XMM-Newton and NASA's Chandra missions which are currently operational. XMM-Newton uses a multi-nested structure to provide modest angular resolution ( 10 arcsec) but large effective area, while Chandra sacrifices effective area to achieve the optical stability necessary to provide sub-arc second resolution. Currently the European Space Agency (ESA) is engaged in studies of the next generation of X-ray space observatories, with the aim of producing telescopes with increased sensitivity and resolution. To achieve these aims several telescopes have been proposed, for example ESA and NASA's combined International X-ray Observatory (IXO), aimed at spectroscopy, and NASA's Generation-X. In the field of X-ray astronomy sub 0.2 arcsecond resolution with high efficiency would be very exciting. Such resolution is unlikely to be achieved by anything other than an active system. The benefits of a such a high resolution would be important for a range of astrophysics subjects, for example the potential angular resolution offered by active X-ray optics could provide unprecedented structural imaging detail of the Solar Wind bowshock interaction of comets, planets and similar objects and auroral phenomena throughout the Solar system using an observing platform in low Earth orbit. A major aim of the SXO project was to investigate the production of thin
MROI Array telescopes: the relocatable enclosure domes
Marchiori, G.; Busatta, A.; Payne, I.
2016-07-01
The MROI - Magdalena Ridge Interferometer is a project which comprises an array of up to 10 1.4m diameter mirror telescopes arranged in a "Y" configuration. Each of these telescopes will be housed inside a Unit Telescope Enclosure (UTE) which are relocatable onto any of 28 stations. EIE GROUP Srl, Venice - Italy, was awarded the contract for the design, the construction and the erection on site of the MROI by the New Mexico Institute of Mining and Technology. The close-pack array of the MROI - including all 10 telescopes, several of which are at a relative distance of less than 8m center to center from each other - necessitated an original design for the Unit Telescope Enclosure (UTE). This innovative design enclosure incorporates a unique dome/observing aperture system to be able to operate in the harsh environmental conditions encountered at an altitude of 10,460ft (3,188m). The main characteristics of this Relocatable Enclosure Dome are: a Light insulated Steel Structure with a dome made of composites materials (e.g. glass/carbon fibers, sandwich panels etc.), an aperture motorized system for observation, a series of louvers for ventilation, a series of electrical and plants installations and relevant auxiliary equipment. The first Enclosure Dome is now under construction and the completion of the mounting on site id envisaged by the end of 2016. The relocation system utilizes a modified reachstacker (a transporter used to handle freight containers) capable of maneuvering between and around the enclosures, capable of lifting the combined weight of the enclosure with the telescope (30tons), with minimal impacts due to vibrations.
Robotic telescopes for high energy astrophysics in Ondřejov
Czech Academy of Sciences Publication Activity Database
Nekola, Martin; Hudec, René; Jelínek, M.; Kocka, Matúš; Münz, F.; Kubánek, P.; Polášek, Cyril; Šimon, Vojtěch; Štrobl, Jan
2010-01-01
Roč. 28, č. 1 (2010), s. 79-85 ISSN 0922-6435. [400 Years of Astronomical Telescopes: A Review of History, Science and Technology. Noordwijk, 29.09.2008-02.10.2008] R&D Projects: GA ČR GA205/08/1207 Grant - others:ESA(XE) ESA-PECS project No. 98023 Institutional research plan: CEZ:AV0Z10030501 Keywords : robotic telescopes * BART * D50 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.140, year: 2010
Active Surface Compensation for Large Radio Telescope Antennas
Directory of Open Access Journals (Sweden)
Congsi Wang
2018-01-01
Full Text Available With the development of radio telescope antennas with large apertures, high gain, and wide frequency bands, compensation methods, such as mechanical or electronic compensation, are obviously essential to ensure the electrical performance of antennas that work in complex environments. Since traditional compensation methods can only adjust antenna pointing but not the surface accuracy, which are limited for obtaining high surface precision and aperture efficiency, active surface adjustment has become an indispensable tool in this field. Therefore, the development process of electrical performance compensation methods for radio telescope antennas is introduced. Further, a series of analyses of the five key technologies of active surface adjustment is presented. Then, four typical large antennas that have been designed with active main reflector technology are presented and compared. Finally, future research directions and suggestions for reflector antenna compensation methods based on active surface adjustment are presented.
8 Meter Advanced Technology Large-Aperture Space Telescope (ATLAST-8m)
Stahl, H. Philip
2010-01-01
ATLAST-8m (Advanced Technology Large Aperture Space Telescope) is a proposed 8-meter monolithic UV/optical/NIR space observatory (wavelength range 110 to 2500 nm) to be placed in orbit at Sun-Earth L2 by NASA's planned Ares V heavy lift vehicle. Given its very high angular resolution (15 mas @ 500 nm), sensitivity and performance stability, ATLAST-8m is capable of achieving breakthroughs in a broad range of astrophysics including: Is there life elsewhere in the Galaxy? An 8-meter UVOIR observatory has the performance required to detect habitability (H2O, atmospheric column density) and biosignatures (O2, O3, CH4) in terrestrial exoplanet atmospheres, to reveal the underlying physics that drives star formation, and to trace the complex interactions between dark matter, galaxies, and intergalactic medium. The ATLAST Astrophysics Strategic Mission Concept Study developed a detailed point design for an 8-m monolithic observatory including optical design; structural design/analysis including primary mirror support structure, sun shade and secondary mirror support structure; thermal analysis; spacecraft including structure, propulsion, GN&C, avionics, power systems and reaction wheels; mass and power budgets; and system cost. The results of which were submitted by invitation to NRC's 2010 Astronomy & Astrophysics Decadal Survey.
Revisiting the Effectiveness of Large Optical Telescopes
Directory of Open Access Journals (Sweden)
V. V. Sychev
2015-01-01
Full Text Available To create large-size optical telescopes, various design concepts have been used. Each concept inevitably faced the challenge to optimize technical characteristics and parameters of the telescope. There was always a question: what concept to choose, how to estimate efficiency of such telescopes and by what criteria and how to estimate expediency of this or that project of the large-size telescope. It is, obviously, insufficient to make a resolution-based estimation. An estimate by the angular field size is inappropriate too. Well, it may be also an estimate by the stellar magnitude. All these criteria are related to each other. Improvement of one of these parameters inevitably leads to deterioration of the others. Obviously, the certain generalized criterion considering all parameters and features of the design concept of the large-size telescope is necessary here. As such can serve the criterion of informational content of the telescope.The article offers a complex criterion allowing not only to estimate efficiency of large-size optical telescopes, but also to compare their conceptual and technological level among themselves in terms of obtaining information.The article suggests a new term, i.e. the informational content invariant to characterize informative capacities of the chosen concept and of the realizing technology. It will allow us to avoid unjustified complications of technical solutions, wrong accents in designing and excess material inputs when developing the project.The informational content criterion-based analysis of the existing projects of large-size telescopes has been convincingly shown that, conceptually, there are three best telescopes, namely: GSMT, CELT, and ACT-25. And, in terms of informational content, the АCТ-25 is 10 times more than GSMT and CELT, and the existing Keck-telescope exceeds by 30 times. Hence, it is hard to escape a conclusion that it is more favourable to implement one ACT-25, than to do 10 GSMT or CELT
Goldstone-Apple Valley Radio Telescope System Theory of Operation
Stephan, George R.
1997-01-01
The purpose of this learning module is to enable learners to describe how the Goldstone-Apple Valley Radio Telescope (GAVRT) system functions in support of Apple Valley Science and Technology Center's (AVSTC) client schools' radio astronomy activities.
Stray light characteristics of the diffractive telescope system
Liu, Dun; Wang, Lihua; Yang, Wei; Wu, Shibin; Fan, Bin; Wu, Fan
2018-02-01
Diffractive telescope technology is an innovation solution in construction of large light-weight space telescope. However, the nondesign orders of diffractive optical elements (DOEs) may affect the imaging performance as stray light. To study the stray light characteristics of a diffractive telescope, a prototype was developed and its stray light analysis model was established. The stray light characteristics including ghost, point source transmittance, and veiling glare index (VGI) were analyzed. During the star imaging test of the prototype, the ghost images appeared around the star image as the exposure time of the charge-coupled device improving, consistent with the simulation results. The test result of VGI was 67.11%, slightly higher than the calculated value 57.88%. The study shows that the same order diffraction of the diffractive primary lens and correcting DOE is the main factor that causes ghost images. The stray light sources outside the field of view can illuminate the image plane through nondesign orders diffraction of the primary lens and contributes to more than 90% of the stray light flux on the image plane. In summary, it is expected that these works will provide some guidance for optimizing the imaging performance of diffractive telescopes.
Sironi, Giorgia
2017-09-01
At the beginning of XX century Karl Schwarzschild defined a method to design large-field aplanatic telescopes based on the use of two aspheric mirrors. The approach was then refined by Couder (1926) who, in order to correct for the astigmatic aberration, introduced a curvature of the focal plane. By the way, the realization of normal-incidence telescopes implementing the Schwarzschild aplanatic configuration has been historically limited by the lack of technological solutions to manufacture and test aspheric mirrors. On the other hand, the Schwarzschild solution was recovered for the realization of coma-free X-ray grazing incidence optics. Wolter-like grazing incidence systems are indeed free of spherical aberration, but still suffer from coma and higher order aberrations degrading the imaging capability for off-axis sources. The application of the Schwarzschild's solution to X-ray optics allowed Wolter to define an optical system that exactly obeys the Abbe sine condition, eliminating coma completely. Therefore these systems are named Wolter-Schwarzschild telescopes and have been used to implement wide-field X-ray telescopes like the ROSAT WFC and the SOHO X-ray telescope. Starting from this approach, a new class of X-ray optical system was proposed by Burrows, Burg and Giacconi assuming polynomials numerically optimized to get a flat field of view response and applied by Conconi to the wide field x-ray telescope (WFXT) design. The Schwarzschild-Couder solution has been recently re-discovered for the application to normal-incidence Cherenkov telescopes, thanks to the suggestion by Vassiliev and collaborators. The Italian Institute for Astrophysics (INAF) realized the first Cherenkov telescope based on the polynomial variation of the Schwarzschild configuration (the so-called ASTRI telescope). Its optical qualification was successfully completed in 2016, demonstrating the suitability of the Schwarzschild-like configuration for the Cherenkov astronomy requirements
Silicon pore optics for future x-ray telescopes
Wille, Eric; Bavdaz, Marcos; Wallace, Kotska; Shortt, Brian; Collon, Maximilien; Ackermann, Marcelo; Günther, Ramses; Olde Riekerink, Mark; Koelewijn, Arenda; Haneveld, Jeroen; van Baren, Coen; Erhard, Markus; Kampf, Dirk; Christensen, Finn; Krumrey, Michael; Freyberg, Michael; Burwitz, Vadim
2017-11-01
Lightweight X-ray Wolter optics with a high angular resolution will enable the next generation of X-ray telescopes in space. The candidate mission ATHENA (Advanced Telescope for High Energy Astrophysics) required a mirror assembly of 1 m2 effective area (at 1 keV) and an angular resolution of 10 arcsec or better. These specifications can only be achieved with a novel technology like Silicon Pore Optics, which is being developed by ESA together with a consortium of European industry. Silicon Pore Optics are made of commercial Si wafers using process technology adapted from the semiconductor industry. We present the recent upgrades made to the manufacturing processes and equipment, ranging from the manufacture of single mirror plates towards complete focusing mirror modules mounted in flight configuration, and results from first vibration tests. The performance of the mirror modules is tested at X-ray facilities that were recently extended to measure optics at a focal distance up to 20 m.
A Scientific Revolution: The Hubble and James Webb Space Telescopes
Gardner, Jonathan P.
2010-01-01
Astronomy is going through a scientific revolution, responding to a flood of data from the Hubble Space Telescope, other space missions, and large telescopes on the ground. In this talk, I will discuss some of the important discoveries of the last decade, from dwarf planets in the outer Solar System to the mysterious dark energy that overcomes gravity to accelerate the expansion of the Universe. The next decade will be equally bright with the newly refurbished Hubble and the promise of its successor, the James Webb Space Telescope. An infrared-optimized 6.5m space telescope, Webb is designed to find the first galaxies that formed in the early universe and to peer into the dusty gas clouds where stars and planets are born. With MEMS technology, a deployed primary mirror and a tennis-court sized sunshield, the mission presents many technical challenges. I will describe Webb's scientific goals, its design and recent progress in constructing the observatory. Webb is scheduled for launch in 2014.
The STAR-X X-Ray Telescope Assembly (XTA)
McClelland, Ryan S.; Bautz, Mark W.; Bonafede, Joseph A.; Miller, Eric D.; Saha, Timo T.; Solly, Peter M.; Zhang, William W.
2017-01-01
The Survey and Time-domain Astrophysical Research eXplorer (STAR-X) science goals are to discover what powers the most violent explosions in the Universe, understand how black holes grow across cosmic time and mass scale, and measure how structure formation heats the majority of baryons in the Universe. To achieve these goals, STAR-X requires a powerful X-ray telescope with a large field of view, large collecting area, and excellent point spread function. The STAR-X instrument, the X-Ray Telescope Assembly (XTA), meets these requirements using a powerful X-ray mirror technology based on precision-polished single crystal silicon and a mature CCD detector technology. The XTA is composed of three major subsystems: an X-ray Mirror Assembly (MA) of high resolution, lightweight mirror segments fabricated out of single crystal silicon; a Focal Plane Assembly (FPA) made of back-illuminated CCD's capable of detecting X-rays with excellent quantum efficiency; and a composite Telescope Tube that structurally links the MA and FPA. The MA consists of 5,972 silicon mirror segments mounted into five subassemblies called meta-shells. A meta-shell is constructed from an annular central structural shell covered with interlocking layers of mirror segments. This paper describes the requirements, design, and analysis of the XTA subsystems with particular focus on the MA.
CTA-A project for a new generation of Cherenkov telescopes
International Nuclear Information System (INIS)
Doro, Michele
2011-01-01
Gamma-rays provide a powerful insight into the non-thermal universe and perhaps a unique probe for new physics beyond the standard model. Current experiments are already giving results in the physics of acceleration of cosmic rays in supernova remnants, pulsar and active galactic nuclei with a 100 sources detected at very-high-energies so far. Despite its relatively recent appearance, very high-energy gamma-ray astronomy has proven to have reached a mature technology with fast assembling, relatively cheap and reliable telescopes. The goal of future installation is to increase the sensitivity by a factor 10 compared to current installations, and enlarge the energy domain from few 10s of GeV to a 100 TeV. Gamma-ray spectra of astrophysical origin are rather soft thus hardly one single size telescope can cover more than 1.5 decades in energy, therefore an array of telescopes of 2-3 different sizes is required. Hereafter, we present design considerations for a Cherenkov Telescope Array (CTA), a project for a new generation of highly automated telescopes for gamma-ray astronomy. The status of the project, technical solutions and an insight in the involved physics will be presented.
Albin, Edward
2018-01-01
We report on the American Public University System’s new robotic telescope, located in Charles Town, WV -- an innovative observatory deployed in an online institution of higher education. The instrument is operated by the Department of Space Studies and is situated atop the university’s new Information Technology building. At the heart of the observatory is a Planewave CDK24 telescope, equipped with a SBIG STX-16803 CCD camera. The telescope is a key technological component in the Department's new undergraduate / graduate astronomy concentration. Since the university is a dedicated online educational institution, the acquisition of a fully remote controlled telescope ties closely into the program's philosophy of quality online instruction. Our robotic observatory is intimately integrated into our astronomy curriculum, with the telescope being utilized for original astronomical education and research purposes. For instance, not only is imagery used in the classroom and for laboratory instruction, graduate students in our MS degree program have an opportunity to collect original telescopic data for research / thesis projects. Examples of ongoing investigations with the telescope include observations of exoplanet transits and variable star photometry. When not in use for specific observing projects, the telescope is scripted to conduct autonomous supernova searches by patrolling dozens of galaxies throughout the night. Our goal is to have the instrument scheduled for continuous observing of the heavens throughout the year on all clear evenings.
The Advanced Gamma-ray Imaging System (AGIS) Telescope Optical System Designs
Bugaev, V.; Buckley, J.; Diegel, S.; Falcone, A.; Fegan, S.; Finley, J.; Guarino, V.; Hanna, D.; Kaaret, P.; Konopelko, A.; Krawczynski, H.; Ramsey, B.; Romani, R.; Vassiliev, V.; Weekes, T.
2008-12-01
AGIS is a conceptual design for a future ground-based gamma-ray observatory operating in the energy range 25 GeV-100 TeV, which is based on an array of ~20-100 imaging atmospheric Cherenkov telescopes (IACTs). The desired improvement in sensitivity, angular resolution, and reliability of operation of AGIS imposes demanding technological and cost requirements on the design of the IACTs. We are considering several options for the optical system (OS) of the AGIS telescopes, which include the traditional Davies-Cotton design as well as novel two-mirror design. Emerging mirror production technologies based on replication processes such as cold and hot glass slumping, cured carbon fiber reinforced plastic (CFRP), and electroforming provide new opportunities for cost-effective solutions for the design of the OS.
A New Observing Tool for the James Clerk Maxwell Telescope
Folger, Martin; Bridger, Alan; Dent, Bill; Kelly, Dennis; Adamson, Andy; Economou, Frossie; Hirst, Paul; Jenness, Tim
A new Observing Tool (OT) has been developed at the UK Astronomy Technology Centre, Edinburgh, UK and the Joint Astronomy Centre, Hilo, Hawaii, USA. It is based on the Gemini Observing Tool and provides the first graphical observation preparation tool for the James Clerk Maxwell Telescope (JCMT) as well as being the first use of the OT for a non-optical/IR telescope. The OT allows the observer to assemble high level Science Programs using graphical representations of observation components such as instrument, target, and filter. This is later translated into low level control sequences for telescope and instruments. The new OT is designed to work on multiple telescopes: currently the UK Infrared Telescope (UKIRT) and JCMT. Object-oriented design makes the inclusion of telescope and instrument specific packages easy. The OT is written in Java using GUI packages such as Swing and JSky. A new component for the JCMT OT is the graphical Frequency Editor for Heterodyne instruments. It can be used to specify parameters such as frequencies, bandwidths, and sidebands of multiple subsystems, while graphically displaying the front-end frequency, emission lines and atmospheric transmission. In addition, Flexible Scheduling support has been added to the OT. The observer can define scheduling constraints by arranging observations graphically. Science Programs can be saved as XML or sent directly from the OT to a database (via SOAP).
Towards a Multi-Variable Parametric Cost Model for Ground and Space Telescopes
Stahl, H. Philip; Henrichs, Todd
2016-01-01
Parametric cost models can be used by designers and project managers to perform relative cost comparisons between major architectural cost drivers and allow high-level design trades; enable cost-benefit analysis for technology development investment; and, provide a basis for estimating total project cost between related concepts. This paper hypothesizes a single model, based on published models and engineering intuition, for both ground and space telescopes: OTA Cost approximately (X) D(exp (1.75 +/- 0.05)) lambda(exp(-0.5 +/- 0.25) T(exp -0.25) e (exp (-0.04)Y). Specific findings include: space telescopes cost 50X to 100X more ground telescopes; diameter is the most important CER; cost is reduced by approximately 50% every 20 years (presumably because of technology advance and process improvements); and, for space telescopes, cost associated with wavelength performance is balanced by cost associated with operating temperature. Finally, duplication only reduces cost for the manufacture of identical systems (i.e. multiple aperture sparse arrays or interferometers). And, while duplication does reduce the cost of manufacturing the mirrors of segmented primary mirror, this cost savings does not appear to manifest itself in the final primary mirror assembly (presumably because the structure for a segmented mirror is more complicated than for a monolithic mirror).
Multiple Etalon Systems for the Advanced Technology Solar Telescope
Gary, G. Allen; Balasubramaniam, K. S.; Sigwarth, Michael; Six, N. Frank (Technical Monitor)
2002-01-01
Multiple etalons systems are discussed that meet the 4-meter NSO/Advance Technology Solar Telescope (http://www.nso.edu/ATST/index.html) instrument and science requirements for a narrow bandpass imaging system. A multiple etalon system can provide an imaging interferometer working in four distinct modes: as a spectro-polarimeter, a filter-vector magnetograph, and a wide-band and broad-band high-resolution imager. Specific dual and triple etalon configurations will be described that provides spectrographic passband of 2.0-3.5nm and reduces parasitic light levels to 1/10000 as required by precise polarization measurement, e.g., Zeeman measurements of magnetic sensitive lines. A TESOS-like triple etalon system provides for spectral purity of 100 thousandths. The triple designs have the advantage of reducing the finesse requirement on each etalon, allowing much more stable blocking filters, and can have very high spectral purity. A dual-etalon double-pass Cavallini-like configuration can provide a competing configuration. This design can provide high contrast with only a double etalon. The selection of the final focal plan instrument will depend on a trade-off of the ideal instrument versus reality, the number of etalons, the aperture of etalons, the number of blocking filters the electronic control system and computer interfaces, the temperature control and controllers for the etalons and the electronics. The use of existing experience should provide significant cost savings. The heritage of use of etalons and multiple etalon systems in solar physics come from a number of observatories, which includes MSFC Solar Observatory (NASA), Sac Peak Observatory (NSO), and Kiepenheuer Institute for Solar Physics (Germany), Mees Solar Observatory (University of Hawaii), and Arcetri Astrophysical Observatory (Italy). The design of the ATST multiple etalon system will reply on the existing experience from these observatories.
Multiple-etalon systems for the Advanced Technology Solar Telescope
Gary, G. Allen; Balasubramaniam, K. S.; Sigwarth, Michael
2003-01-01
Multiple etalon systems are discussed that meet the science requirements for a narrow-passband imaging system for the 4-meter National Solar Observatory (NSO)/Advance Technology Solar Telescope (ATST). A multiple etalon system can provide an imaging interferometer that works in four distinct modes: as a spectro-polarimeter, a filter-vector magnetograph, an intermediate-band imager, and broadband high-resolution imager. Specific dual and triple etalon configurations are described that provide a spectrographic passband of 2.0-3.5 micron and reduce parasitic light levels to 10(exp -4) as required for precise polarization measurement, e.g., Zeeman measurements of magnetic sensitive lines. A TESOS-like (Telecentric Etalon SOlar Spectrometer) triple etalon system provides a spectral purity of 10(exp -5). The triple designs have the advantage of reducing the finesse requirement on each etalon; allow the use of more stable blocking filters, and have very high spectral purity. A dual-etalon double-pass (Cavallini-like) system can provide a competing configuration. Such a dual-etalon design can provide high contrast. The selection of the final focal plane instrument will depend on a trade-off between an ideal instrument and practical reality. The trade study will include the number of etalons, their aperture sizes, complexities of the optical train, number of blocking filters, configuration of the electronic control system, computer interfaces, temperature controllers, etalon controllers, and their associated feedback electronics. The heritage of single and multiple etalon systems comes from their use in several observatories, including the Marshall Space Flight Center (MSFC) Solar Observatory, Sacramento Peak Observatory (NSO), and Kiepenheuer-Institut fur Sonnenphysik (KIS, Germany), Mees Solar Observatory (University of Hawaii), and Arcetri Astrophysical Observatory (Italy). The design of the ATST multiple etalon system will benefit from the experience gained at these
A large fiber sensor network for an acoustic neutrino telescope
Directory of Open Access Journals (Sweden)
Buis Ernst-Jan
2017-01-01
Full Text Available The scientific prospects of detecting neutrinos with an energy close or even higher than the GKZ cut-off energy has been discussed extensively in literature. It is clear that due to their expected low flux, the detection of these ultra-high energy neutrinos (Ev > 1018 eV requires a telescope larger than 100 km3. Acoustic detection may provide a way to observe these ultra-high energy cosmic neutrinos, as sound that they induce in the deep sea when neutrinos lose their energy travels undisturbed for many kilometers. To realize a large scale acoustic neutrino telescope, dedicated technology must be developed that allows for a deep sea sensor network. Fiber optic hydrophone technology provides a promising means to establish a large scale sensor network [1] with the proper sensitivity to detect the small signals from the neutrino interactions.
Anggraini, Citrae Permata Kusuma; Sasongko, Nugroho Adi; Kuntjoro, Yanif Dwi
2018-02-01
NTT is a province located in strategic areas between Bali and South Sulawesi which has economic growth 5,08% in 2016. This causes air transportation in NTT to grow rapidly so the need for avtur is increased by 6% per year. To meet the needs of avtur in NTT would require energy diversification with bioavtur development in which one of them comes from microalgae. The content of lipid and hydrocarbon in microalgae can be used as a source of bioavtur feedstock. The suitability of location for cultivation will influence the success of microalgae cultivation that will be used as a source of bioavtur feedstock. The purpose of this research is to choose the best location for microalgae cultivation in NTT by AHP method. The criteria used in this research are nutrient, water and technology. Sub criteria of nutrient elements are coal power plant emission, cement industry emission and synthetic fertilizers, sub criteria from water that is sea water, brackish water and fresh water, while sub criteria of technology are Photobioreactor, Open Raceway Pond and membrane. The result of AHP analysis shows the selection of microalgae cultivation location in Kupang with the weight of 0.308, with the source of nutrient derived from coal power plant emission, the type of water used is sea water and the technology used is Photobioreactor. Microalgae species used were Nannochloropsis sp with a lipid content of 31-68%. Based on the author assumption, microalgae have the productivity for bioavtur manufacture which amount of 24.489kL/ha/ yr. That can be used to meet the needs of 2% avtur in NTT which amount of 1.052,22 kL/yr and the area requirement for microalgae cultivation is 2,14 hectare.
X-ray telescope mirrors made of slumped glass sheets
Winter, A.; Breunig, E.; Friedrich, P.; Proserpio, L.
2017-11-01
For several decades, the field of X-ray astronomy has been playing a major role in understanding the processes in our universe. From binary stars and black holes up to galaxy clusters and dark matter, high energetic events have been observed and analysed using powerful X-ray telescopes like e.g. Rosat, Chandra, and XMM-Newton [1,2,3], giving us detailed and unprecedented views of the high-energy universe. In November 2013, the theme of "The Hot and Energetic Universe" was rated as of highest importance for future exploration and in June 2014 the ATHENA Advanced Telescope for High Energy Astrophysics was selected by ESA for the second large science mission (L2) in the ESA Cosmic Vision program, with launch foreseen in 2028 [4]. By combining a large X-ray telescope with state-of-the-art scientific instruments, ATHENA will address key questions in astrophysics, including: How and why does ordinary matter assemble into the galaxies and galactic clusters that we see today? How do black holes grow and influence their surroundings? In order to answer these questions, ATHENA needs a powerful mirror system which exceed the capabilities of current missions, especially in terms of collecting area. However, current technologies have reached the mass limits of the launching rocket, creating the need for more light-weight mirror systems in order to enhance the effective area without increasing the telescope mass. Hence new mirror technologies are being developed which aim for low-weight systems with large collecting areas. Light material like glass can be used, which are shaped to form an X-ray reflecting system via the method of thermal glass slumping.
Design of an x-ray telescope optics for XEUS
Graue, Roland; Kampf, Dirk; Wallace, Kotska; Lumb, David; Bavdaz, Marcos; Freyberg, Michael
2017-11-01
The X-ray telescope concept for XEUS is based on an innovative high performance and light weight Silicon Pore Optics technology. The XEUS telescope is segmented into 16 radial, thermostable petals providing the rigid optical bench structure of the stand alone XRay High Precision Tandem Optics. A fully representative Form Fit Function (FFF) Model of one petal is currently under development to demonstrate the outstanding lightweight telescope capabilities with high optically effective area. Starting from the envisaged system performance the related tolerance budgets were derived. These petals are made from ceramics, i.e. CeSiC. The structural and thermal performance of the petal shall be reported. The stepwise alignment and integration procedure on petal level shall be described. The functional performance and environmental test verification plan of the Form Fit Function Model and the test set ups are described in this paper. In parallel to the running development activities the programmatic and technical issues wrt. the FM telescope MAIT with currently 1488 Tandem Optics are under investigation. Remote controlled robot supported assembly, simultaneous active alignment and verification testing and decentralised time effective integration procedures shall be illustrated.
Wiseman, Jennifer
2012-01-01
The Hubble Space Telescope has unified the world with a sense of awe and wonder for 2 I years and is currently more scientifically powerful than ever. I will present highlights of discoveries made with the Hubble Space Telescope, including details of planetary weather, star formation, extra-solar planets, colliding galaxies, and a universe expanding with the acceleration of dark energy. I will also present the unique technical challenges and triumphs of this phenomenal observatory, and discuss how our discoveries in the cosmos affect our sense of human unity, significance, and wonder.
Ground-based VHE γ ray astronomy with air Cherenkov imaging telescopes
International Nuclear Information System (INIS)
Mirzoyan, R.
2000-01-01
The history of astronomy has been one of the scientific discovery following immediately the introduction of new technology. In this report, we will review shortly the basic development of the atmospheric air Cherenkov light detection technique, particularly the imaging telescope technique, which in the last years led to the firm establishment of a new branch in experimental astronomy, namely ground-based very high-energy (VHE) γ ray astronomy. Milestones in the technology and in the analysis of imaging technique will be discussed. The design of the 17 m diameter MAGIC Telescope, being currently under construction, is based on the development of new technologies for all its major parts and sets new standards in the performance of the ground-based γ detectors. MAGIC is one of the next major steps in the development of the technique being the first instrument that will allow one to carry out measurements also in the not yet investigated energy gap i.e. between 10 and 300 GeV
The large binocular telescope.
Hill, John M
2010-06-01
The Large Binocular Telescope (LBT) Observatory is a collaboration among institutions in Arizona, Germany, Italy, Indiana, Minnesota, Ohio, and Virginia. The telescope on Mount Graham in Southeastern Arizona uses two 8.4 m diameter primary mirrors mounted side by side. A unique feature of the LBT is that the light from the two Gregorian telescope sides can be combined to produce phased-array imaging of an extended field. This cophased imaging along with adaptive optics gives the telescope the diffraction-limited resolution of a 22.65 m aperture and a collecting area equivalent to an 11.8 m circular aperture. This paper describes the design, construction, and commissioning of this unique telescope. We report some sample astronomical results with the prime focus cameras. We comment on some of the technical challenges and solutions. The telescope uses two F/15 adaptive secondaries to correct atmospheric turbulence. The first of these adaptive mirrors has completed final system testing in Firenze, Italy, and is planned to be at the telescope by Spring 2010.
Real-time vibration compensation for large telescopes
Böhm, M.; Pott, J.-U.; Sawodny, O.; Herbst, T.; Kürster, M.
2014-08-01
We compare different strategies for minimizing the effects of telescope vibrations to the differential piston (optical pathway difference) for the Near-InfraRed/Visible Adaptive Camera and INterferometer for Astronomy (LINC-NIRVANA) at the Large Binocular Telescope (LBT) using an accelerometer feedforward compensation approach. We summarize, why this technology is important for LINC-NIRVANA, and also for future telescopes and already existing instruments. The main objective is outlining a solution for the estimation problem in general and its specifics at the LBT. Emphasis is put on realistic evaluation of the used algorithms in the laboratory, such that predictions for the expected performance at the LBT can be made. Model-based estimation and broad-band filtering techniques can be used to solve the estimation task, and the differences are discussed. Simulation results and measurements are shown to motivate our choice of the estimation algorithm for LINC-NIRVANA. The laboratory setup is aimed at imitating the vibration behaviour at the LBT in general, and the M2 as main contributor in particular. For our measurements, we introduce a disturbance time series which has a frequency spectrum comparable to what can be measured at the LBT on a typical night. The controllers' ability to suppress vibrations in the critical frequency range of 8-60 Hz is demonstrated. The experimental results are promising, indicating the ability to suppress differential piston induced by telescope vibrations by a factor of about 5 (rms), which is significantly better than any currently commissioned system.
The challenge of developing thin mirror shells for future x-ray telescopes
Döhring, Thorsten; Stollenwerk, Manfred; Gong, Qingqing; Proserpio, Laura; Winter, Anita; Friedrich, Peter
2015-09-01
Previously used mirror technologies are not able to fulfil the requirements of future X-ray telescopes due to challenging requests from the scientific community. Consequently new technical approaches for X-ray mirror production are under development. In Europe the technical baseline for the planned X-ray observatory ATHENA is the radical new approach of silicon pore optics. NASÁs recently launched NuSTAR mission uses segmented mirrors shells made from thin bended glasses, successfully demonstrating the feasibility of the glass forming technology for X-ray mirrors. For risk mitigation also in Europe the hot slumping of thin glasses is being developed as an alternative technology for lightweight X-ray telescopes. The high precision mirror manufacturing requires challenging technical developments; several design trades and trend-setting decisions need to be made and are discussed within this paper. Some new technical and economic aspects of the intended glass mirror serial production are also studied within the recently started interdisciplinary project INTRAAST, an acronym for "industry transfer of astronomical mirror technologies". The goal of the project, embedded in a cooperation of the Max-Planck-Institute for extraterrestrial Physics and the University of Applied Sciences Aschaffenburg, is to master the challenge of producing thin mirror shells for future X-ray telescopes. As a first project task the development of low stress coatings for thin glass mirror substrates have been started, the corresponding technical approach and first results are presented.
The Timepix Telescope for High Performance Particle Tracking
Akiba, Kazuyoshi; van Beuzekom, Martin; van Beveren, Vincent; Borghi, Silvia; Boterenbrood, Henk; Buytaert, Jan; Collins, Paula; Dosil Suárez, Alvaro; Dumps, Raphael; Eklund, Lars; Esperante, Daniel; Gallas, Abraham; Gordon, Hamish; van der Heijden, Bas; Hombach, Christoph; Hynds, Daniel; John, Malcolm; Leflat, Alexander; Li, Yi Ming; Longstaff, Ian; Morton, Alexander; Nakatsuka, Noritsugu; Nomerotski, Andre; Parkes, Chris; Perez Trigo, Eliseo; Plackett, Richard; Reid, Matthew M; Rodriguez Perez, Pablo; Schindler, Heinrich; Szumlak, Tomasz; Tsopelas, Panagiotis; Vázquez Sierra, Carlos; Velthuis, Jaap; Wysokinski, Michal
2013-01-01
The Timepix particle tracking telescope has been developed as part of the LHCb VELO Upgrade project, supported by the Medipix Collaboration and the AIDA framework. It is a primary piece of infrastructure for the VELO Upgrade project and is being used for the development of new sensors and front end technologies for several upcoming LHC trackers and vertexing systems. The telescope is designed around the dual capability of the Timepix ASICs to provide information about either the deposited charge or the timing information from tracks traversing the 14 x 14mm matrix of 55 x 55 um pixels. The rate of reconstructed tracks available is optimised by taking advantage of the shutter driven readout architecture of the Timepix chip, operated with existing readout systems. Results of tests conducted in the SPS North Area beam facility at CERN show that the telescope typically provides reconstructed track rates during the beam spills of between 3.5 and 7.5 kHz, depending on beam conditions. The tracks are time stamped wi...
Guinan, Edward; Gelderman, Richard; Strolger, Louis-Gregory; Carini, Michael T.; McGruder, Charles, III; Campbell, Rachel; Walter, Donald K.; Davis, Donald R.; Tedesco, Edward F.; Engle, Scott G.
2011-03-01
The 1.3 m Robotically Controlled Telescope (RCT) on Kitt Peak has a rich history, including its role as a prototype for remotely controlled telescopes during the 1960s. As such, the RCT could be considered one of the first - Telescopes from Afar. The telescope, originally called the Remotely Controlled Telescope, has been renamed the Robotically Controlled Telescope to reflect the change in operational control and mode of use. The RCT was a conceptual precursor of today's robotic telescopes, but the actual operation of a remotely controlled telescope was technologically premature for its time, and was subsequently manually operated primarily to conduct optical and infrared observations as well being used as a test bed for new spectroscopic and photometric instruments. In 1995 budget constraints forced the closing of the telescope as part of the Kitt Peak National Observatory (KPNO), following nearly 30 years of distinguished service to KPNO. A request for proposals to operate this telescope was issued to the science community. The RCT consortium, lead by Western Kentucky University, was the successful proposer for operation of the telescope. After several difficult years of retrofitting, refurbishing, and automating the telecope and observatory dome, the telescope has returned to routine science operations in November 2009. The RCT has operated smoothly since that time, with no major interruptions. Observations of objects of interest to the consortium partners (including: comets & asteroids, variable & binary stars, exoplanets, supernovae, quasars & blazars) are being routinely obtained and evaluated. One of the distinguishing features of the RCT is that it is an autonomous observatory designed to handle diverse optical imaging and photometry programs. These include being able to automatically deal with a wide range of observing parameters such as -integration time, sky conditions, repetitions, return visits, filters, air mass, non-sidereal objects, transients etc
First Steps Toward K-12 Teacher Professional Development Using Internet-based Telescopes
Berryhill, K. J.; Gershun, D.; Slater, T. F.; Armstrong, J. D.
2012-12-01
How can science teachers become more familiar with emerging technology, excite their students and give students a taste of astronomy research? Astronomy teachers do not always have research experience, so it is difficult for them to convey to students how researchers use telescopes. The nature of astronomical observation (e.g., remote sites, expensive equipment, and odd hours) has been a barrier to providing teachers with insight into the process. Robotic telescopes (operated automatically with queued observing schedules) and remotely controlled telescopes (controlled by the user via the Internet) allow scientists to conduct observing sessions on research-grade telescopes half a world away. The same technology can now be harnessed by STEM educators to engage students and reinforce what is being taught in the classroom, as seen in some early research in elementary schools (McKinnon and Mainwaring 2000 and McKinnon and Geissinger 2002), and middle/high schools (Sadler et al. 2001, 2007 and Gehret et al. 2005). However, teachers need to be trained to use these resources. Responding to this need, graduate students and faculty at the University of Wyoming and CAPER Center for Astronomy & Physics Education Research are developing teacher professional development programs using Internet-based telescopes. We conducted an online course in the science education graduate program at the University of Wyoming. This course was designed to sample different types of Internet-based telescopes to evaluate them as resources for teacher professional development. The 10 participants were surveyed at the end of the course to assess their experiences with each activity. In addition, pre-test/post-test data were collected focusing specifically on one of the telescopes (Gershun, Berryhill and Slater 2012). Throughout the course, the participants learned to use a variety of robotic and remote telescopes including SLOOH Space Camera (www.slooh.com), Sky Titan Observatory (www
Feinberg, Lee; Rioux, Norman; Bolcar, Matthew; Liu, Alice; Guyon, Oliver; Stark, Chris; Arenberg, Jon
2016-01-01
Key challenges of a future large aperture, segmented Ultraviolet Optical Infrared (UVOIR) Telescope capable of performing a spectroscopic survey of hundreds of Exoplanets will be sufficient stability to achieve 10^-10 contrast measurements and sufficient throughput and sensitivity for high yield Exo-Earth spectroscopic detection. Our team has collectively assessed an optimized end to end architecture including a high throughput coronagraph capable of working with a segmented telescope, a cost-effective and heritage based stable segmented telescope, a control architecture that minimizes the amount of new technologies, and an Exo-Earth yield assessment to evaluate potential performance. These efforts are combined through integrated modeling, coronagraph evaluations, and Exo-Earth yield calculations to assess the potential performance of the selected architecture. In addition, we discusses the scalability of this architecture to larger apertures and the technological tall poles to enabling it.
Energy Technology Data Exchange (ETDEWEB)
Dournaux, J.L., E-mail: jean-laurent.dournaux@obspm.fr [GEPI, Observatoire de Paris, PSL Research University, CNRS, Sorbonne Paris Cité, Université Paris Diderot, Place J. Janssen, 92190 Meudon (France); De Franco, A. [Department of Physics, University of Oxford, Keble Road, Oxford OX1 3RH (United Kingdom); Laporte, P. [GEPI, Observatoire de Paris, PSL Research University, CNRS, Sorbonne Paris Cité, Université Paris Diderot, Place J. Janssen, 92190 Meudon (France); White, R. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Greenshaw, T. [University of Liverpool, Oliver Lodge Laboratory, P.O. Box 147, Oxford Street, Liverpool L69 3BX (United Kingdom); Sol, H. [LUTH, Observatoire de Paris, PSL Research University, CNRS, Université Paris Diderot, Place J. Janssen, 92190 Meudon (France); Abchiche, A. [CNRS, Division technique DT-INSU, 1 Place Aristide Briand, 92190 Meudon (France); Allan, D. [Department of Physics and Centre for Advanced Instrumentation, Durham University, South Road, Durham DH1 3LE (United Kingdom); Amans, J.P. [GEPI, Observatoire de Paris, PSL Research University, CNRS, Sorbonne Paris Cité, Université Paris Diderot, Place J. Janssen, 92190 Meudon (France); Armstrong, T.P. [Department of Physics and Centre for Advanced Instrumentation, Durham University, South Road, Durham DH1 3LE (United Kingdom); Balzer, A.; Berge, D. [GRAPPA, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands); Boisson, C. [LUTH, Observatoire de Paris, PSL Research University, CNRS, Université Paris Diderot, Place J. Janssen, 92190 Meudon (France); and others
2017-02-11
The Cherenkov Telescope Array (CTA) consortium aims to build the next-generation ground-based very-high-energy gamma-ray observatory. The array will feature different sizes of telescopes allowing it to cover a wide gamma-ray energy band from about 20 GeV to above 100 TeV. The highest energies, above 5 TeV, will be covered by a large number of Small-Sized Telescopes (SSTs) with a field-of-view of around 9°. The Gamma-ray Cherenkov Telescope (GCT), based on Schwarzschild–Couder dual-mirror optics, is one of the three proposed SST designs. The GCT is described in this contribution and the first images of Cherenkov showers obtained using the telescope and its camera are presented. These were obtained in November 2015 in Meudon, France.
The KM3NeT deep-sea neutrino telescope
Energy Technology Data Exchange (ETDEWEB)
Margiotta, Annarita
2014-12-01
KM3NeT is a deep-sea research infrastructure being constructed in the Mediterranean Sea. It will host the next generation Cherenkov neutrino telescope and nodes for a deep sea multidisciplinary observatory, providing oceanographers, marine biologists, and geophysicists with real time measurements. The neutrino telescope will complement IceCube in its field of view and exceed it substantially in sensitivity. Its main goal is the detection of high energy neutrinos of astrophysical origin. The detector will have a modular structure with six building blocks, each consisting of about 100 Detection Units (DUs). Each DU will be equipped with 18 multi-PMT digital optical modules. The first phase of construction has started and shore and deep-sea infrastructures hosting the future KM3NeT detector are being prepared in offshore Toulon, France and offshore Capo Passero on Sicily, Italy. The technological solutions for the neutrino detector of KM3NeT and the expected performance of the neutrino telescope are presented and discussed. - Highlights: • A deep-sea research infrastructure is being built in the Mediterranean Sea. • It will host a km{sup 3}-size neutrino telescope and a deep-sea multidisciplinary observatory. • The main goal of the neutrino telescope is the search for Galactic neutrino sources. • A major innovation is adopted in the design of the optical module. • 31 3 in. photomultiplier tubes (PMTs) will be hosted in the same glass sphere.
Thompson, S. J.; Doel, A. P.; Whalley, M.; Edeson, R.; Edeson, R.; Tosh, I.; Poyntz-Wright, O.; Atad-Ettedgui, E.; Montgomery, D.; Nawasra, J.
2017-11-01
Large aperture telescope technology (LATT) is a design study for a differential lidar (DIAL) system; the main investigation being into suitable methods, technologies and materials for a 4-metre diameter active mirror that can be stowed to fit into a typical launch vehicle (e.g. ROKOT launcher with 2.1-metre diameter cargo) and can self-deploy - in terms of both leaving the space vehicle and that the mirrors unfold and self-align to the correct optical form within the tolerances specified. The primary mirror requirements are: main wavelength of 935.5 nm, RMS corrected wavefront error of λ/6, optical surface roughness better than 5 nm, areal density of less than 16 kg/m2 and 1-2 mirror shape corrections per orbit. The primary mirror consists of 7 segments - a central hexagonal mirror and 6 square mirror petals which unfold to form the 4-meter diameter aperture. The focus of the UK LATT consortium for this European Space Agency (ESA) funded project is on using lightweighted aluminium or carbon-fibre-composite materials for the mirror substrate in preference to more traditional materials such as glass and ceramics; these materials have a high strength and stiffness to weight ratio, significantly reducing risk of damage due to launch forces and subsequent deployment in orbit. We present an overview of the design, which includes suitable actuators for wavefront correction, petal deployment mechanisms and lightweight mirror technologies. Preliminary testing results from manufactured lightweight mirror samples will also be summarised.
Preliminary Multivariable Cost Model for Space Telescopes
Stahl, H. Philip
2010-01-01
Parametric cost models are routinely used to plan missions, compare concepts and justify technology investments. Previously, the authors published two single variable cost models based on 19 flight missions. The current paper presents the development of a multi-variable space telescopes cost model. The validity of previously published models are tested. Cost estimating relationships which are and are not significant cost drivers are identified. And, interrelationships between variables are explored
A Low Cost Light Weight Polymer Derived Ceramic Telescope Mirror, Phase I
National Aeronautics and Space Administration — The primary purpose of this proposal is to develop and demonstrate a new technology for manufacturing an ultra-low-cost precision optical telescope mirror which can...
Hornsby, Linda; Stahl, H. Philip; Hopkins, Randall C.
2010-01-01
The Advanced Technology Large Aperture Space Telescope (ATLAST) preliminary design concept consists of an 8 meter diameter monolithic primary mirror enclosed in an insulated, optical tube with stray light baffles and a sunshade. ATLAST will be placed in orbit about the Sun-Earth L2 and will experience constant exposure to the sun. The insulation on the optical tube and sunshade serve to cold bias the telescope which helps to minimize thermal gradients. The primary mirror will be maintained at 280K with an active thermal control system. The geometric model of the primary mirror, optical tube, sun baffles, and sunshade was developed using Thermal Desktop(R) SINDA/FLUINT(R) was used for the thermal analysis and the radiation environment was analyzed using RADCAD(R). A XX node model was executed in order to characterize the static performance and thermal stability of the mirror during maneuvers. This is important because long exposure observations, such as extra-solar terrestrial planet finding and characterization, require a very stable observatory wave front. Steady state thermal analyses served to predict mirror temperatures for several different sun angles. Transient analyses were performed in order to predict thermal time constant of the primary mirror for a 20 degree slew or 30 degree roll maneuver. This paper describes the thermal model and provides details of the geometry, thermo-optical properties, and the environment which influences the thermal performance. All assumptions that were used in the analysis are also documented. Parametric analyses are summarized for design parameters including primary mirror coatings and sunshade configuration. Estimates of mirror heater power requirements are reported. The thermal model demonstrates results for the primary mirror heated from the back side and edges using a heater system with multiple independently controlled zones.
Knowledge-based engineering of a PLC controlled telescope
Pessemier, Wim; Raskin, Gert; Saey, Philippe; Van Winckel, Hans; Deconinck, Geert
2016-08-01
As the new control system of the Mercator Telescope is being finalized, we can review some technologies and design methodologies that are advantageous, despite their relative uncommonness in astronomical instrumentation. Particular for the Mercator Telescope is that it is controlled by a single high-end soft-PLC (Programmable Logic Controller). Using off-the-shelf components only, our distributed embedded system controls all subsystems of the telescope such as the pneumatic primary mirror support, the hydrostatic bearing, the telescope axes, the dome, the safety system, and so on. We show how real-time application logic can be written conveniently in typical PLC languages (IEC 61131-3) and in C++ (to implement the pointing kernel) using the commercial TwinCAT 3 programming environment. This software processes the inputs and outputs of the distributed system in real-time via an observatory-wide EtherCAT network, which is synchronized with high precision to an IEEE 1588 (PTP, Precision Time Protocol) time reference clock. Taking full advantage of the ability of soft-PLCs to run both real-time and non real-time software, the same device also hosts the most important user interfaces (HMIs or Human Machine Interfaces) and communication servers (OPC UA for process data, FTP for XML configuration data, and VNC for remote control). To manage the complexity of the system and to streamline the development process, we show how most of the software, electronics and systems engineering aspects of the control system have been modeled as a set of scripts written in a Domain Specific Language (DSL). When executed, these scripts populate a Knowledge Base (KB) which can be queried to retrieve specific information. By feeding the results of those queries to a template system, we were able to generate very detailed "browsable" web-based documentation about the system, but also PLC software code, Python client code, model verification reports, etc. The aim of this paper is to
The Sardinia Radio Telescope . From a technological project to a radio observatory
Prandoni, I.; Murgia, M.; Tarchi, A.; Burgay, M.; Castangia, P.; Egron, E.; Govoni, F.; Pellizzoni, A.; Ricci, R.; Righini, S.; Bartolini, M.; Casu, S.; Corongiu, A.; Iacolina, M. N.; Melis, A.; Nasir, F. T.; Orlati, A.; Perrodin, D.; Poppi, S.; Trois, A.; Vacca, V.; Zanichelli, A.; Bachetti, M.; Buttu, M.; Comoretto, G.; Concu, R.; Fara, A.; Gaudiomonte, F.; Loi, F.; Migoni, C.; Orfei, A.; Pilia, M.; Bolli, P.; Carretti, E.; D'Amico, N.; Guidetti, D.; Loru, S.; Massi, F.; Pisanu, T.; Porceddu, I.; Ridolfi, A.; Serra, G.; Stanghellini, C.; Tiburzi, C.; Tingay, S.; Valente, G.
2017-12-01
Context. The Sardinia Radio Telescope (SRT) is the new 64 m dish operated by the Italian National Institute for Astrophysics (INAF). Its active surface, comprised of 1008 separate aluminium panels supported by electromechanical actuators, will allow us to observe at frequencies of up to 116 GHz. At the moment, three receivers, one per focal position, have been installed and tested: a 7-beam K-band receiver, a mono-feed C-band receiver, and a coaxial dual-feed L/P band receiver. The SRT was officially opened in September 2013, upon completion of its technical commissioning phase. In this paper, we provide an overview of the main science drivers for the SRT, describe the main outcomes from the scientific commissioning of the telescope, and discuss a set of observations demonstrating the scientific capabilities of the SRT. Aims: The scientific commissioning phase, carried out in the 2012-2015 period, proceeded in stages following the implementation and/or fine-tuning of advanced subsystems such as the active surface, the derotator, new releases of the acquisition software, etc. One of the main objectives of scientific commissioning was the identification of deficiencies in the instrumentation and/or in the telescope subsystems for further optimization. As a result, the overall telescope performance has been significantly improved. Methods: As part of the scientific commissioning activities, different observing modes were tested and validated, and the first astronomical observations were carried out to demonstrate the science capabilities of the SRT. In addition, we developed astronomer-oriented software tools to support future observers on site. In the following, we refer to the overall scientific commissioning and software development activities as astronomical validation. Results: The astronomical validation activities were prioritized based on technical readiness and scientific impact. The highest priority was to make the SRT available for joint observations as
An innovative telescope control system architecture for SST-GATE telescopes at the CTA Observatory
Fasola, Gilles; Mignot, Shan; Laporte, Philippe; Abchiche, Abdel; Buchholtz, Gilles; Jégouzo, Isabelle
2014-07-01
SST-GATE (Small Size Telescope - GAmma-ray Telescope Elements) is a 4-metre telescope designed as a prototype for the Small Size Telescopes (SST) of the Cherenkov Telescope Array (CTA), a major facility for the very high energy gamma-ray astronomy of the next three decades. In this 100-telescope array there will be 70 SSTs, involving a design with an industrial view aiming at long-term service, low maintenance effort and reduced costs. More than a prototype, SST-GATE is also a fully functional telescope that shall be usable by scientists and students at the Observatoire de Meudon for 30 years. The Telescope Control System (TCS) is designed to work either as an element of a large array driven by an array controller or in a stand-alone mode with a remote workstation. Hence it is built to be autonomous with versatile interfacing; as an example, pointing and tracking —the main functions of the telescope— are managed onboard, including astronomical transformations, geometrical transformations (e.g. telescope bending model) and drive control. The core hardware is a CompactRIO (cRIO) featuring a real-time operating system and an FPGA. In this paper, we present an overview of the current status of the TCS. We especially focus on three items: the pointing computation implemented in the FPGA of the cRIO —using CORDIC algorithms— since it enables an optimisation of the hardware resources; data flow management based on OPCUA with its specific implementation on the cRIO; and the use of an EtherCAT field-bus for its ability to provide real-time data exchanges with the sensors and actuators distributed throughout the telescope.
Classic Telescopes A Guide to Collecting, Restoring, and Using Telescopes of Yesteryear
English, Neil
2013-01-01
Classic Telescopes explores the exciting world of telescopes past, as well as the possibilities involved in acquiring these instruments. What are classic telescopes? First, the book takes a look at the more traditional telescopes built by the great instrument makers of the eighteenth and nineteenth centuries and the dynastic houses founded by the likes of John Dollond, Alvan Clark, Thomas Cooke & Sons and Carl Zeiss, plus some lesser-known luminaries, including John Brashear, John Calver, and Henry Fitz. Instruments constructed from the 1950s until as recently as the early 1990s are now also considered 'classic.' There is thus a very active market for buying and selling these 'modern' classics. The author examines some of the most talked about instruments on the amateur Internet forums, including the Unitron refractors, the Questar 90, a classic 6-inch reflector, the RV-6; a 3-inch F/15 achromat by Fullerscopes; the time-honored AstroScan Richfield reflector; and many, many more. Classic telescopes are of...
The Planck Telescope reflectors
Stute, Thomas
2004-09-01
The mechanical division of EADS-Astrium GmbH, Friedrichshafen is currently engaged with the development, manufacturing and testing of the advanced dimensionally stable composite reflectors for the ESA satellite borne telescope Planck. The objective of the ESA mission Planck is to analyse the first light that filled the universe, the cosmic microwave background radiation. Under contract of the Danish Space Research Institute and ESA EADS-Astrium GmbH is developing the all CFRP primary and secondary reflectors for the 1.5-metre telescope which is the main instrument of the Planck satellite. The operational frequency ranges from to 25 GHz to 1000 GHz. The demanding high contour accuracy and surface roughness requirements are met. The design provides the extreme dimensional stability required by the cryogenic operational environment at around 40 K. The elliptical off-axis reflectors display a classical lightweight sandwich design with CFRP core and facesheets. Isostatic mounts provide the interfaces to the telescope structure. Protected VDA provides the reflecting surface. The manufacturing is performed at the Friedrichshafen premises of EADS-Space Transportation GmbH, the former Dornier composite workshops. Advanced manufacturing technologies like true angle lay-up by CNC fibre placement and filament winding are utilized. The protected coating is applied at the CAHA facilities at the Calar Alto Observatory, Spain. The exhaustive environmental testing is performed at the facilities of IABG, Munich (mechanical testing) and for the cryo-optical tests at CSL Liege. The project is in advanced state with both Qualification Models being under environmental testing. The flight models will be delivered in 2004. The paper gives an overview over the requirements and the main structural features how these requirements are met. Special production aspects and available test results are reported.
Alignment and phasing of deployable telescopes
Woolf, N. J.; Ulich, B. L.
1983-01-01
The experiences in coaligning and phasing the Multi-Mirror Telescope (MMT), together with studies in setting up radio telescopes, are presented. These experiences are discussed, and on the basis they furnish, schemes are suggested for coaligning and phasing four large future telescopes with complex primary mirror systems. These telescopes are MT2, a 15-m-equivalent MMT, the University of California Ten Meter Telescope, the 10 m sub-mm wave telescope of the University of Arizona and the Max Planck Institute for Radioastronomy, and the Large Deployable Reflector, a future space telescope for far-IR and sub-mm waves.
OVERVIEW OF THE ATACAMA COSMOLOGY TELESCOPE: RECEIVER, INSTRUMENTATION, AND TELESCOPE SYSTEMS
International Nuclear Information System (INIS)
Swetz, D. S.; Devlin, M. J.; Dicker, S. R.; Ade, P. A. R.; Amiri, M.; Battistelli, E. S.; Burger, B.; Halpern, M.; Hasselfield, M.; Appel, J. W.; Essinger-Hileman, T.; Fisher, R. P.; Fowler, J. W.; Hincks, A. D.; Jarosik, N.; Chervenak, J.; Doriese, W. B.; Hilton, G. C.; Irwin, K. D.; Duenner, R.
2011-01-01
The Atacama Cosmology Telescope was designed to measure small-scale anisotropies in the cosmic microwave background and detect galaxy clusters through the Sunyaev-Zel'dovich effect. The instrument is located on Cerro Toco in the Atacama Desert, at an altitude of 5190 m. A 6 m off-axis Gregorian telescope feeds a new type of cryogenic receiver, the Millimeter Bolometer Array Camera. The receiver features three 1000-element arrays of transition-edge sensor bolometers for observations at 148 GHz, 218 GHz, and 277 GHz. Each detector array is fed by free space millimeter-wave optics. Each frequency band has a field of view of approximately 22' x 26'. The telescope was commissioned in 2007 and has completed its third year of operations. We discuss the major components of the telescope, camera, and related systems, and summarize the instrument performance.
Overview of the Atacama Cosmology Telescope: Receiver, Instrumentation, and Telescope Systems
Swetz, D. S.; Ade, P. A. R.; Amiri, M.; Appel, J. W.; Battistelli, E. S.; Burger, B.; Chervenak, J.; Devlin, M. J.; Dicker, S. R.; Doriese, W. B.; Dünner, R.; Essinger-Hileman, T.; Fisher, R. P.; Fowler, J. W.; Halpern, M.; Hasselfield, M.; Hilton, G. C.; Hincks, A. D.; Irwin, K. D.; Jarosik, N.; Kaul, M.; Klein, J.; Lau, J. M.; Limon, M.; Marriage, T. A.; Marsden, D.; Martocci, K.; Mauskopf, P.; Moseley, H.; Netterfield, C. B.; Niemack, M. D.; Nolta, M. R.; Page, L. A.; Parker, L.; Staggs, S. T.; Stryzak, O.; Switzer, E. R.; Thornton, R.; Tucker, C.; Wollack, E.; Zhao, Y.
2011-06-01
The Atacama Cosmology Telescope was designed to measure small-scale anisotropies in the cosmic microwave background and detect galaxy clusters through the Sunyaev-Zel'dovich effect. The instrument is located on Cerro Toco in the Atacama Desert, at an altitude of 5190 m. A 6 m off-axis Gregorian telescope feeds a new type of cryogenic receiver, the Millimeter Bolometer Array Camera. The receiver features three 1000-element arrays of transition-edge sensor bolometers for observations at 148 GHz, 218 GHz, and 277 GHz. Each detector array is fed by free space millimeter-wave optics. Each frequency band has a field of view of approximately 22' × 26'. The telescope was commissioned in 2007 and has completed its third year of operations. We discuss the major components of the telescope, camera, and related systems, and summarize the instrument performance.
Computerization of a telescope at secondary education
García Santiago, A.; Martos Jumillas, J.
2017-03-01
The work we are presenting in this paper is the computerization of a refractor telescope on an EQ3 type equatorial mount through Arduino. The control of the mount is done via three different interfaces: Stellarium, an Android interface for mobile phones and a second interface for PC made with Processing. The aforementioned work was done by the authors with a double purpose: presenting the interest in astronomy in the Mathematics department, and the development of applications within the subject of Technology in 4th ESO. So, it is a collaborative project between both departments. Except for the telescope and the mount, all the resources we have used can be found in any high school: free software (Guadalinex v9), App Inventor and Processing.The project was carried out under the principle of reducing all possible costs given the economic possibilities of the institution.
The High-Resolution Lightweight Telescope for the EUV (HiLiTE)
Energy Technology Data Exchange (ETDEWEB)
Martinez-Galarce, D S; Boerner, P; Soufli, R; De Pontieu, B; Katz, N; Title, A; Gullikson, E M; Robinson, J C; Baker, S L
2008-06-02
The High-resolution Lightweight Telescope for the EUV (HiLiTE) is a Cassegrain telescope that will be made entirely of Silicon Carbide (SiC), optical substrates and metering structure alike. Using multilayer coatings, this instrument will be tuned to operate at the 465 {angstrom} Ne VII emission line, formed in solar transition region plasma at {approx}500,000 K. HiLiTE will have an aperture of 30 cm, angular resolution of {approx}0.2 arc seconds and operate at a cadence of {approx}5 seconds or less, having a mass that is about 1/4 that of one of the 20 cm aperture telescopes on the Atmospheric Imaging Assembly (AIA) instrument aboard NASA's Solar Dynamics Observatory (SDO). This new instrument technology thus serves as a path finder to a post-AIA, Explorer-class missions.
Recent results from a Si/CdTe semiconductor Compton telescope
International Nuclear Information System (INIS)
Tanaka, Takaaki; Watanabe, Shin; Takeda, Shin'ichiro; Oonuki, Kousuke; Mitani, Takefumi; Nakazawa, Kazuhiro; Takashima, Takeshi; Takahashi, Tadayuki; Tajima, Hiroyasu; Sawamoto, Naoyuki; Fukazawa, Yasushi; Nomachi, Masaharu
2006-01-01
We are developing a Compton telescope based on high-resolution Si and CdTe detectors for astrophysical observations in sub-MeV/MeV gamma-ray region. Recently, we constructed a prototype Compton telescope which consists of six layers of double-sided Si strip detectors (DSSDs) and CdTe pixel detectors to demonstrate the basic performance of this new technology. By irradiating the detector with gamma rays from radio isotope sources, we have succeeded in Compton reconstruction of images and spectra. The obtained angular resolution is 3.9 o (FWHM) at 511keV, and the energy resolution is 14keV (FWHM) at the same energy. In addition to the conventional Compton reconstruction, i.e., drawing cones in the sky, we also demonstrated a full reconstruction by tracking Compton recoil electrons using the signals detected in successive Si layers. By irradiating 137 Cs source, we successfully obtained an image and a spectrum of 662keV line emission with this method. As a next step, development of larger DSSDs with a size of 4cmx4cm is under way to improve the effective area of the Compton telescope. We are also developing a new low-noise analog ASIC to handle the increasing number of channels. Initial results from these two new technologies are presented in this paper as well
Dobson space telescope: development of an optical payload of the next generation
Segert, Tom; Danziger, Björn; Gork, Daniel; Lieder, Matthias
2017-11-01
The Dobson Space Telescope (DST) is a research project of the Department of Astronautics at the TUBerlin. For Development and commercialisation there is a close cooperation with the network of the Berlin Space Industry (RIBB). Major Partner is the Astro- und Feinwerktechnik Adlershof GmbH a specialist for space structures and head of the industry consortia which built the DLR BIRD micro satellite. The aim of the project is to develop a new type of deployable telescope that can overcome the mass and volume limitations of small satellites. With the DST payload micro satellites of the 100kg class will be able to carry 50cm main mirror diameter optics (→ 1m GSD). Basis of this technology is the fact that a telescope is mainly empty space between the optical elements. To fold down the telescope during launch and to undfold it after the satellite reached its orbit can save 70% of payload volume and 50% of payload mass. Since these advantages continue along the value added chain DST is of highest priority for the next generation of commercial EO micro satellites. Since 2002 the key technologies for DST have been developed in test benches in Labs of TU-Berlin and were tested on board a ESA parabolic flight campaign in 2005. The development team at TU-Berlin currently prepares the foundation of a start-up company for further development and commercialisation of DST.
Gehrels, Tom
1997-01-01
This grant funded about one third of the cost of the construction of a telescope with an aperture 1.8 meters in diameter to discover asteroids and comets and investigate the statistics of their populations and orbital distributions. This telescope has been built to the PI's specifications and installed in a dome on Kitt Peak mountain in Arizona. Funds for the dome and building were provided entirely by private sources. The dome building and telescope were dedicated in a ceremony at the site on June 7, 1997. The attached abstract describes the parameters of the telescope. The telescope is a new item of capital property. It is permanently located in University of Arizona building number 910 in the Steward Observatory compound on Kitt Peak mountain in the Tohono O'odham Nation, Arizona. fts property tag number is A252107. This grant did not include funds for the coma corrector lens, instrument derotator, CCD detector, detector electronics, or computers to acquire or process the data. It also did not include funds to operate the telescope or conduct research with it. Funds for these items and efforts are pending from NASA and other sources.
Simultaneous control of multiple instruments at the Advanced Technology Solar Telescope
Johansson, Erik M.; Goodrich, Bret
2012-09-01
The Advanced Technology Solar Telescope (ATST) is a 4-meter solar observatory under construction at Haleakala, Hawaii. The simultaneous use of multiple instruments is one of the unique capabilities that makes the ATST a premier ground based solar observatory. Control of the instrument suite is accomplished by the Instrument Control System (ICS), a layer of software between the Observatory Control System (OCS) and the instruments. The ICS presents a single narrow interface to the OCS and provides a standard interface for the instruments to be controlled. It is built upon the ATST Common Services Framework (CSF), an infrastructure for the implementation of a distributed control system. The ICS responds to OCS commands and events, coordinating and distributing them to the various instruments while monitoring their progress and reporting the status back to the OCS. The ICS requires no specific knowledge about the instruments. All information about the instruments used in an experiment is passed by the OCS to the ICS, which extracts and forwards the parameters to the appropriate instrument controllers. The instruments participating in an experiment define the active instrument set. A subset of those instruments must complete their observing activities in order for the experiment to be considered complete and are referred to as the must-complete instrument set. In addition, instruments may participate in eavesdrop mode, outside of the control of the ICS. All instrument controllers use the same standard narrow interface, which allows new instruments to be added without having to modify the interface or any existing instrument controllers.
The Advanced Gamma-ray Imaging System (AGIS): Telescope Mechanical Designs
Guarino, V.; Buckley, J.; Byrum, K.; Falcone, A.; Fegan, S.; Finley, J.; Hanna, D.; Horan, D.; Kaaret, P.; Konopelko, A.; Krawczynski, H.; Krennrich, F.; Wagner, R.; Woods, M.; Vassiliev, V.
2008-04-01
The concept of a future ground-based gamma-ray observatory, AGIS, in the energy range 40 GeV-100 TeV is based on an array of sim 100 imaging atmospheric Cherenkov telescopes (IACTs). The anticipated improvements of AGIS sensitivity, angular resolution and reliability of operation impose demanding technological and cost requirements on the design of IACTs. The relatively inexpensive Davies-Cotton telescope design has been used in ground-based gamma-ray astronomy for almost fifty years and is an excellent option. We are also exploring alternative designs and in this submission we focus on the recent mechanical design of a two-mirror telescope with a Schwarzschild-Couder (SC) optical system. The mechanical structure provides support points for mirrors and camera. The design was driven by the requirement of minimizing the deflections of the mirror support structures. The structure is also designed to be able to slew in elevation and azimuth at 10 degrees/sec.
Stahl, H. Philip; Postman, Marc; Mosier, Gary; Smith, W. Scott; Blaurock, Carl; Ha, Kong; Stark, Christopher C.
2014-08-01
The Advance Mirror Technology Development (AMTD) project is in Phase 2 of a multiyear effort, initiated in FY12, to mature by at least a half TRL step six critical technologies required to enable 4 meter or larger UVOIR space telescope primary mirror assemblies for both general astrophysics and ultra-high contrast observations of exoplanets. AMTD uses a science-driven systems engineering approach. We mature technologies required to enable the highest priority science AND provide a high-performance low-cost low-risk system. To give the science community options, we are pursuing multiple technology paths. A key task is deriving engineering specifications for advanced normal-incidence monolithic and segmented mirror systems needed to enable both general astrophysics and ultra-high contrast observations of exoplanets missions as a function of potential launch vehicles and their mass and volume constraints. A key finding of this effort is that the science requires an 8 meter or larger aperture telescope.
Feinberg, Lee; Bolcar, Matt; Liu, Alice; Guyon, Olivier; Stark,Chris; Arenberg, Jon
2016-01-01
Key challenges of a future large aperture, segmented Ultraviolet Optical Infrared (UVOIR) Telescope capable of performing a spectroscopic survey of hundreds of Exoplanets will be sufficient stability to achieve 10-10 contrast measurements and sufficient throughput and sensitivity for high yield Exo-Earth spectroscopic detection. Our team has collectively assessed an optimized end to end architecture including a high throughput coronagraph capable of working with a segmented telescope, a cost-effective and heritage based stable segmented telescope, a control architecture that minimizes the amount of new technologies, and an Exo-Earth yield assessment to evaluate potential performance.
Global TIE Observatories: Real Time Observational Astronomy Through a Robotic Telescope Network
Clark, G.; Mayo, L. A.
2001-12-01
Astronomy in grades K-12 is traditionally taught (if at all) using textbooks and a few simple hands-on activities. Teachers are generally not trained in observational astronomy techniques and are unfamiliar with the most basic astronomical concepts. In addition, most students, by High School graduation, will never have even looked through the eyepiece of a telescope. The problem becomes even more challenging in inner cities, remote rural areas and low socioeconomic communities where educational emphasis on topics in astronomy as well as access to observing facilities is limited or non existent. Access to most optical telescope facilities is limited to monthly observing nights that cater to a small percentage of the general public living near the observatory. Even here, the observing experience is a one-time event detached from the process of scientific enquiry and sustained educational application. Additionally, a number of large, "research grade" observatory facilities are largely unused, partially due to the slow creep of light pollution around the facilities as well as the development of newer, more capable telescopes. Though cutting edge science is often no longer possible at these sights, real research opportunities in astronomy remain numerous for these facilities as educational tools. The possibility now exists to establish a network of research grade telescopes, no longer useful to the professional astronomical community, that can be made accessible through classrooms, after school, and community based programs all across the country through existing IT technologies and applications. These telescopes could provide unparalleled research and educational opportunities for a broad spectrum of students and turns underutilized observatory facilities into valuable, state-of-the-art teaching centers. The NASA sponsored Telescopes In Education project has been wildly successful in engaging the K-12 education community in real-time, hands-on, interactive astronomy
Origins Space Telescope: Study Plan
Nayyeri, Hooshang; Cooray, Asantha; Origins Space Telescope Study Team
2018-01-01
The Origins Space Telescope (OST) is the mission concept for the Far-Infrared Surveyor, a study in development by NASA in preparation for the 2020 Astronomy and Astrophysics Decadal Survey. Origins is planned to be a large aperture, actively-cooled telescope covering a wide span of the mid- to far-infrared spectrum. Its spectrographs will enable 3D surveys of the sky that will discover and characterize the most distant galaxies, Milky-Way, exoplanets, and the outer reaches of our Solar system. Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s. The Science and Technology Definition Team (STDT) would like to hear your science needs and ideas for this mission. The team can be contacted at firsurveyor_info@lists.ipac.caltech.edu. This presentation will provide a summary of the OST STDT, the OST Study Team based at NASA Goddard Space Flight Center, study partners, and the advisory panel to the study. This presentation will also summarize recent activities, including the process used to reach a decision on the mission architecture, the identification of key science drivers, and the key study milestones between 2017 and 2020.
Lifescience Database Archive (English)
Full Text Available to BlastX Result : TrEMBL tr_hit_id B1NTT1 Definition tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachel....done Score E Sequences producing significant alignments: (bits) Value tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trache...li... 36 0.84 >tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachelium c
Scientific Performance Analysis of the SYZ Telescope Design versus the RC Telescope Design
Ma, Donglin; Cai, Zheng
2018-02-01
Recently, Su et al. propose an innovative design, referred as the “SYZ” design, for China’s new project of a 12 m optical-infrared telescope. The SYZ telescope design consists of three aspheric mirrors with non-zero power, including a relay mirror below the primary mirror. SYZ design yields a good imaging quality and has a relatively flat field curvature at Nasmyth focus. To evaluate the science-compatibility of this three-mirror telescope, in this paper, we thoroughly compare the performance of SYZ design with that of Ritchey–Chrétien (RC) design, a conventional two-mirror telescope design. Further, we propose the Observing Information Throughput (OIT) as a metric for quantitatively evaluating the telescopes’ science performance. We find that although a SYZ telescope yields a superb imaging quality over a large field of view, a two-mirror (RC) telescope design holds a higher overall throughput, a better diffraction-limited imaging quality in the central field of view (FOV < 5‧) which is better for the performance of extreme Adaptive Optics (AO), and a generally better scientific performance with a higher OIT value. D. Ma & Z. Cai contributed equally to this paper.
Science with the solar optical telescope
Jordan, S. D.; Hogan, G. D.
1984-01-01
The Solar Optical Telescope (SOT) is designed to provide the solar physics community with the data necessary for solving several fundamental problems in the energetics and dynamics of the solar atmosphere. Among these problems are questions on the origin and evolution of the sun's magnetic field, heating of the outer solar atmosphere, and sources of the solar wind in the lower lying regions of the outer atmosphere. The SOT will be built under the management of NASA's Goddard Space Flight Center, with science instruments provided by teams led by Principal Investigators. The telescope will be built by the Perkin-Elmer Corporation, and the science instruments selected for the first flight will be provided by the Lockheed Palo Alto Research Laboratory (LPARL) and the California Institute of Technology, with actual construction of a combined science instrument taking place at the LPARL. The SOT has a 1.3-meter-diameter primary mirror that will be capable of achieving diffraction-limited viewing in the visible of 0.1 arc-second. This dimension is less than a hydrodynamic scale-height or a mean-free-path of a continuum photon in the solar atmosphere. Image stability will be achieved by a control system in the telescope, which moves both the primary and tertiary mirrors in tandem, and will be further enhanced by a correlation tracker in the combined science instrument. The SOT Facility is currently scheduled for its first flight on Spacelab at the beginning of the 1990's.
Position measurement of the direct drive motor of Large Aperture Telescope
Li, Ying; Wang, Daxing
2010-07-01
Along with the development of space and astronomy science, production of large aperture telescope and super large aperture telescope will definitely become the trend. It's one of methods to solve precise drive of large aperture telescope using direct drive technology unified designed of electricity and magnetism structure. A direct drive precise rotary table with diameter of 2.5 meters researched and produced by us is a typical mechanical & electrical integration design. This paper mainly introduces position measurement control system of direct drive motor. In design of this motor, position measurement control system requires having high resolution, and precisely aligning the position of rotor shaft and making measurement, meanwhile transferring position information to position reversing information corresponding to needed motor pole number. This system has chosen high precision metal band coder and absolute type coder, processing information of coders, and has sent 32-bit RISC CPU making software processing, and gained high resolution composite coder. The paper gives relevant laboratory test results at the end, indicating the position measurement can apply to large aperture telescope control system. This project is subsidized by Chinese National Natural Science Funds (10833004).
Virtual Telescope Alignment System
National Aeronautics and Space Administration — Next-generation space telescopes require two spacecraft to fly in a coordinated fashion in space forming a virtual telescope. Achieving and maintaining this precise...
International Nuclear Information System (INIS)
Atwood, W.B.
1993-06-01
The recent discoveries and excitement generated by space satellite experiment EGRET (presently operating on Compton Gamma Ray Observatory -- CGRO) have prompted an investigation into modern detector technologies for the next generation space based gamma ray telescopes. The GLAST proposal is based on silicon strip detectors as the open-quotes technology of choiceclose quotes for space application: no consumables, no gas volume, robust (versus fragile), long lived, and self triggerable. The GLAST detector basically has two components: a tracking module preceding a calorimeter. The tracking module has planes of crossed strip (x,y) 300 μm pitch silicon detectors coupled to a thin radiator to measure the coordinates of converted electron-positron pairs. The gap between the layers (∼5 cm) provides a lever arm for track fitting resulting in an angular resolution of <0.1 degree at high energy. The status of this R ampersand D effort is discussed including details on triggering the instrument, the organization of the detector electronics and readout, and work on computer simulations to model this instrument
Precision Optical Coatings for Large Space Telescope Mirrors
Sheikh, David
This proposal “Precision Optical Coatings for Large Space Telescope Mirrors” addresses the need to develop and advance the state-of-the-art in optical coating technology. NASA is considering large monolithic mirrors 1 to 8-meters in diameter for future telescopes such as HabEx and LUVOIR. Improved large area coating processes are needed to meet the future requirements of large astronomical mirrors. In this project, we will demonstrate a broadband reflective coating process for achieving high reflectivity from 90-nm to 2500-nm over a 2.3-meter diameter coating area. The coating process is scalable to larger mirrors, 6+ meters in diameter. We will use a battery-driven coating process to make an aluminum reflector, and a motion-controlled coating technology for depositing protective layers. We will advance the state-of-the-art for coating technology and manufacturing infrastructure, to meet the reflectance and wavefront requirements of both HabEx and LUVOIR. Specifically, we will combine the broadband reflective coating designs and processes developed at GSFC and JPL with large area manufacturing technologies developed at ZeCoat Corporation. Our primary objectives are to: Demonstrate an aluminum coating process to create uniform coatings over large areas with near-theoretical aluminum reflectance Demonstrate a motion-controlled coating process to apply very precise 2-nm to 5- nm thick protective/interference layers to large areas, Demonstrate a broadband coating system (90-nm to 2500-nm) over a 2.3-meter coating area and test it against the current coating specifications for LUVOIR/HabEx. We will perform simulated space-environment testing, and we expect to advance the TRL from 3 to >5 in 3-years.
Energy Technology Data Exchange (ETDEWEB)
Lutz, Gerhard E-mail: gerhard.lutz@cern.ch; Braeuninger, H.; Englhauser, J.; Hartmann, R.; Kang, D.; Kotthaus, R.; Kuster, M.; Serber, W.; Strueder, L
2004-02-01
An X-ray mirror telescope consisting of a Wolter I type mirror assembly as used in X-ray astronomy and a new type X-ray CCD has been added to the CERN Axion Solar Telescope experiment. It will strongly improve the sensitivity in the search for axions, a so far elusive particle. The axion is predicted in order to explain the observed CP conservation in strong interaction which is not expected within the generally accepted 'standard model'. Construction and performance of the X-ray telescope are described. An improvement by two orders of magnitude in the signal over background S/B event ratio is estimated.
Lutz, Gerhard; Englhauser, J; Hartmann, R; Kang, D; Kotthaus, R; Kuster, M; Serber, W; Strüder, L
2004-01-01
An X-ray mirror telescope consisting of a Wolter I type mirror assembly as used in X-ray astronomy and a new type X-ray CCD has been added to the CERN Axion Solar Telescope experiment. It will strongly improve the sensitivity in the search for axions, a so far elusive particle. The axion is predicted in order to explain the observed CP conservation in strong interaction which is not expected within the generally accepted "standard model". Construction and performance of the X-ray telescope are described. An improvement by two orders of magnitude in the signal over background S/B event ratio is estimated.
Opto-mechanical design and development of a 460mm diffractive transmissive telescope
Qi, Bo; Wang, Lihua; Cui, Zhangang; Bian, Jiang; Xiang, Sihua; Ma, Haotong; Fan, Bin
2018-01-01
Using lightweight, replicated diffractive optics, we can construct extremely large aperture telescopes in space.The transmissive primary significantly reduces the sensitivities to out of plane motion as compared to reflective systems while reducing the manufacturing time and costs. This paper focuses on the design, fabrication and ground demonstration of a 460mm diffractive transmissive telescope the primary F/# is 6, optical field of view is 0.2° imagine bandwidth is 486nm 656nm.The design method of diffractive optical system was verified, the ability to capture a high-quality image using diffractive telescope collection optics was tested.The results show that the limit resolution is 94lp/mm, the diffractive system has a good imagine performance with broad bandwidths. This technology is particularly promising as a means to achieve extremely large optical primaries from compact, lightweight packages.
SIRI - A proposal for a multi-detector ΔE-E particle telescope
International Nuclear Information System (INIS)
Guttormsen, M.
1992-06-01
The CACTUS detector system which is mounted on the 90 o beam line of the Oslo Cyclotron consists of 28 NaI and 2 Ge detectors in combination with 8 Si particle telescopes. The Si particle telescopes are however based on an old technology with a geometrical lay-out that prohibits further increase in efficiency. In this report a replacement of the old system in the form of 64 telescopes based on silicon strip detectors is proposed. For the planned system called SIRI (Silicon Ring), the detectors are located on a ring around the target, covering the angles between 30 o and 60 o relative to the beam direction. The planned detector system will increase detector efficiency of charged particles by a factor 8. The design and construction of the new detector system is described and discussed. 8 refs., 9 figs., 4 tabs
AsteroidFinder - the space-borne telescope to search for NEO Asteroids
Hartl, M.; Mosebach, H.; Schubert, J.; Michaelis, H.; Mottola, S.; Kührt, E.; Schindler, K.
2017-11-01
This paper presents the mission profile as well as the optical configuration of the space-borne AsteroidFinder telescope. Its main objective is to retrieve asteroids with orbits interior to the earth's orbit. The instrument requires high sensitivity to detect asteroids with a limiting magnitude of equal or larger than 18.5mag (V-Band) and astrometric accuracy of 1arcsec (1σ). This requires a telescope aperture greater than 400cm2, high image stability, detector with high quantum efficiency (peak > 90%) and very low noise, which is only limited by zodiacal background. The telescope will observe the sky between 30° and 60° in solar elongation. The telescope optics is based on a Cook type TMA. An effective 2°×2° field of view (FOV) is achieved by a fast F/3.4 telescope with near diffraction-limited performance. The absence of centre obscuration or spiders in combination with an accessible intermediate field plane and exit pupil allow for efficient stray light mitigation. Design drivers for the telescope are the required point spread function (PSF) values, an extremely efficient stray light suppression (due to the magnitude requirement mentioned above), the detector performance, and the overall optical and mechanical stability for all orientations of the satellite. To accommodate the passive thermal stabilization scheme and the necessary structural stability, the materials selection for the telescope main structure and the mirrors are of vital importance. A focal plane with four EMCCD detectors is envisaged. The EMCCD technology features shorter integration times, which is in favor regarding the pointing performance of the satellite. The launch of the mission is foreseen for the year 2013 with a subsequent mission lifetime of at least 1 year.
New Control Software of the 188cm Telescope of Okayama Astrophysical Observatory
Yoshida, Michitoshi; Shimizu, Yasuhiro; Watanabe, Etsuji; Yanagisawa, Kenshi; Uraguchi, Fumihiro
2002-12-01
We developed the telescope control software for the 188cm telescope of Okayama Astrophysical Observatory (OAO) based on Java technology. Basically, the software consists of two processes running on separate Java virtual machines; one of which is the "Command Dispatcher (CD)" and the other is the "User Interface (UI)". Among the two, CD is the main engine/server of the telescope control, whereas UI is just a client. The "standard" UI we provide is a graphical user interface written in Java/Swing. CD communicates with the local control units (LCUs) of the telescope through RS232C. CD is a Java multi-thread program, in which a number of threads run simultaneously. The threads running in CD are the follows: UNIX socket servers for external communications, socket opener for on-demand open/close of a socket port, socket client manager, auto-guider and dome watcher, internal command dispatcher, status manager, status collector, RS232C writer and reader, logger, and control units. The above "control units" are software models ("objects") of the telescope system. We introduced four control units- "Telescope", "Dome", "Weather-Monitor", and "Pointing"- for telescope control. The first three units are simple software models of the real-worlds devices. The last one, "Pointing", is a unit which abstracts pointing procedure of the telescope. CD and UI communicate with each other using UNIX socket. The command protocol of this communication is fairly simple, and observation instruments, auto guider, or additional UI for remote observation are also able to communicate with CD through socket using this protocol. CD opens and closes socket ports for communication on demand according to the request of client process (UI, instruments etc.), so that any clients can be connected to CD dynamically.
Technology Needs for Gamma Ray Astronomy
Gehrels, Neil
2011-01-01
Gamma ray astronomy is currently in an exciting period of multiple missions and a wealth of data. Results from INTEGRAL, Fermi, AGILE, Suzaku and Swift are making large contributions to our knowledge of high energy processes in the universe. The advances are due to new detector and imaging technologies. The steps to date have been from scintillators to solid state detectors for sensors and from light buckets to coded aperture masks and pair telescopes for imagers. A key direction for the future is toward focusing telescopes pushing into the hard X-ray regime and Compton telescopes and pair telescopes with fine spatial resolution for medium and high energy gamma rays. These technologies will provide finer imaging of gamma-ray sources. Importantly, they will also enable large steps forward in sensitivity by reducing background.
Survey of Enabling Technologies for CAPS
Antol, Jeffrey; Mazanek, Daniel D.; Koons, Robert H.
2005-01-01
The enabling technologies required for the development of a viable Comet/Asteroid Protection System (CAPS) can be divided into two principal areas: detection and deflection/orbit modification. With the proper funding levels, many of the technologies needed to support a CAPS architecture could be achievable within the next 15 to 20 years. In fact, many advanced detection technologies are currently in development for future in-space telescope systems such as the James Webb Space Telescope (JWST), formerly known as the Next Generation Space Telescope. It is anticipated that many of the JWST technologies would be available for application for CAPS detection concepts. Deflection/orbit modification technologies are also currently being studied as part of advanced power and propulsion research. However, many of these technologies, such as extremely high-output power systems, advanced propulsion, heat rejection, and directed energy systems, would likely be farther term in availability than many of the detection technologies. Discussed subsequently is a preliminary examination of the main technologies that have been identified as being essential to providing the element functionality defined during the CAPS conceptual study. The detailed requirements for many of the technology areas are still unknown, and many additional technologies will be identified as future in-depth studies are conducted in this area.
Mechanical design of SST-GATE, a dual-mirror telescope for the Cherenkov Telescope Array
Dournaux, Jean-Laurent; Huet, Jean-Michel; Amans, Jean-Philippe; Dumas, Delphine; Laporte, Philippe; Sol, Hélène; Blake, Simon
2014-07-01
The Cherenkov Telescope Array (CTA) project aims to create the next generation Very High Energy (VHE) gamma-ray telescope array. It will be devoted to the observation of gamma rays over a wide band of energy, from a few tens of GeV to more than 100 TeV. Two sites are foreseen to view the whole sky where about 100 telescopes, composed of three different classes, related to the specific energy region to be investigated, will be installed. Among these, the Small Size class of Telescopes, SSTs, are devoted to the highest energy region, to beyond 100 TeV. Due to the large number of SSTs, their unit cost is an important parameter. At the Observatoire de Paris, we have designed a prototype of a Small Size Telescope named SST-GATE, based on the dual-mirror Schwarzschild-Couder optical formula, which has never before been implemented in the design of a telescope. Over the last two years, we developed a mechanical design for SST-GATE from the optical and preliminary mechanical designs made by the University of Durham. The integration of this telescope is currently in progress. Since the early stages of mechanical design of SST-GATE, finite element method has been used employing shape and topology optimization techniques to help design several elements of the telescope. This allowed optimization of the mechanical stiffness/mass ratio, leading to a lightweight and less expensive mechanical structure. These techniques and the resulting mechanical design are detailed in this paper. We will also describe the finite element analyses carried out to calculate the mechanical deformations and the stresses in the structure under observing and survival conditions.
Konacki, M.; Lejba, P.; Sybilski, P.; Pawłaszek, R.; Kozłowski, S.; Suchodolski, T.; Litwicki, M.; Kolb, U.; Burwitz, V.; Baader, J.; Groot, P.; Bloemen, S.; Ratajczak, M.; Helminiak, K.; Borek, R.; Chodosiewicz, P.
2016-09-01
We present the assets of the Nicolaus Copernicus Astronomical Center, Space Research Center (both of the Polish Academy of Sciences), two Polish companies Sybilla Technologies, Cillium Engineering and a non-profit research foundation Baltic Institute of Technology. These assets are enhanced by telescopes belonging to The Open University (UK), the Max Planck Institute for Extraterrestrial Physics and in the future the Radboud University. They consist of the Solaris-Panoptes global network of optical robotic telescopes and the satellite laser ranging station in Borowiec, Poland. These assets will contribute to the Polish and European Space Surveillance and Tracking (SST) program. The Solaris component is composed of four autonomous observatories in the Southern Hemisphere. Solaris nodes are located at the South African Astronomical Observatory (Solaris-1 and Solaris-2), Siding Spring Observatory, Australia (Solaris-3) and Complejo Astronomico El Leoncito, Argentina (Solaris-4). They are equipped with 0.5-m telescopes on ASA DDM-160 direct drive mounts, Andor iKon-L cameras and housed in 3.5-m Baader Planetarium (BP) clamshell domes. The Panoptes component is a network of telescopes operated by software from Sybilla Technologies. It currently consists of 4 telescopes at three locations, all on GM4000 mounts. One 0.36-m (Panoptes-COAST, STL- 1001E camera, 3.5 BP clamshell dome) and one 0.43-m (Panoptes-PIRATE, FLI 16803 camera, 4.5-m BP clamshell dome, with planned exchange to 0.63-m) telescope are located at the Teide Observatory (Tenerfie, Canary Islands), one 0.6-m (Panoptes-COG, SBIG STX 16803 camera, 4.5-m BP clamshell dome) telescope in Garching, Germany and one 0.5-m (Panoptes-MAM, FLI 16803 camera, 4.5-m BP slit dome) in Mammendorf, Germany. Panoptes-COAST and Panoptes-PIRATE are owned by The Open University (UK). Panoptes-COG is owned by the Max Planck Institute
Design and end-to-end modelling of a deployable telescope
Dolkens, Dennis; Kuiper, Hans
2017-09-01
Deployable optics have the potential of revolutionizing the field of high resolution Earth Observation. By offering the same resolutions as a conventional telescope, while using a much smaller launch volume and mass, the costs of high resolution image data can be brought down drastically. In addition, the technology will ultimately enable resolutions that are currently unattainable due to limitations imposed by the size of launcher fairings. To explore the possibilities and system complexities of a deployable telescope, a concept study was done to design a competitive deployable imager. A deployable telescope was designed for a ground sampling distance of 25 cm from an orbital altitude of 550 km. It offers an angular field of view of 0.6° and has a panchromatic channel as well as four multispectral bands in the visible and near infrared spectrum. The optical design of the telescope is based on an off-axis Korsch Three Mirror Anastigmat. A freeform tertiary mirror is used to ensure a diffraction limited image quality for all channels, while maintaining a compact design. The segmented primary mirror consists of four tapered aperture segments, which can be folded down during launch, while the secondary mirror is mounted on a deployable boom. In its stowed configuration, the telescope fits within a quarter of the volume of a conventional telescope reaching the same resolution. To reach a diffraction limited performance while operating in orbit, the relative position of each individual mirror segment must be controlled to a fraction of a wavelength. Reaching such tolerances with deployable telescope challenging, due to inherent uncertainties in the deployment mechanisms. Adding to the complexity is the fact that the telescope will be operating in a Low Earth Orbit (LEO) where it will be exposed to very dynamic thermal conditions. Therefore, the telescope will be equipped with a robust calibration system. Actuators underneath the primary mirror will be controlled using
Camp, J.; Barthelmy, S.; Blackburn, L.; Carpenter, K. G.; Gehrels, N.; Kanner, J.; Marshall, F. E.; Racusin, J. L.; Sakamoto, T.
2013-01-01
The International Space Station offers a unique platform for rapid and inexpensive deployment of space telescopes. A scientific opportunity of great potential later this decade is the use of telescopes for the electromagnetic follow-up of ground-based gravitational wave detections of neutron star and black hole mergers. We describe this possibility for OpTIIX, an ISS technology demonstration of a 1.5 m diffraction limited optical telescope assembled in space, and ISS-Lobster, a wide-field imaging X-ray telescope now under study as a potential NASA mission. Both telescopes will be mounted on pointing platforms, allowing rapid positioning to the source of a gravitational wave event. Electromagnetic follow-up rates of several per year appear likely, offering a wealth of complementary science on the mergers of black holes and neutron stars.
Advanced X-Ray Telescope Mirrors Provide Sharpest Focus Ever
1997-03-01
's science mission. "We will observe X-rays generated when stars are torn apart by the incredibly strong gravity around massive black holes in the centers of galaxies," added Tananbaum. On a larger scale, the telescope will play a vital role in answering fundamental questions about the universe. "The superior quality of the mirrors will allow us to see and measure the details of hot gas clouds in clusters of galaxies, giving us a much better idea of the age and size of the universe," said Dr. Leon Van Speybroeck, Telescope Scientist at the Smithsonian Observatory. "These same observations also will measure the amount of dark matter present, providing unique insight into one of nature's great puzzles," said Van Speybroeck. A second phase of testing is now underway at Marshall. Calibration of the observatory's science instruments began in mid-February. "This phase of testing," said Weisskopf, "includes two focal plane instruments and two sets of gratings used to analyze images and energy distributions from cosmic sources seen by the telescope." Working around the clock, test teams are taking measurements and studying results. "It is very exciting," said Weisskopf. "With more than 1,200 measurements taken, there is already a tremendous amount of information for study." The calibration process will end around late April. The mirror assembly then will be shipped to TRW Space and Electronics Group, Redondo Beach, CA -- NASA's prime contractor for the program -- for integration into the spacecraft. The science instruments will remain at Marshall for several more weeks of testing before being shipped to Ball Aerospace and Technologies Corporation in Boulder, CO, where they will be integrated into the science instrument module before being shipped to TRW. The Advanced X-ray Astrophysics Facility is scheduled for launch in August 1998 and will join NASA's Hubble Space Telescope and Compton Gamma-ray Observatory in exploring the universe. Marshall manages development of the observatory
The Atacama Large Aperture Submm/mm Telescope (AtLAST) Project
Bertoldi, Frank
2018-01-01
In the past decade a strong case has been made for the construction of a next generation, 25 to 40-meter large submillimeter telescope, most notably through the CCAT and the Japanese LST projects. Although much effort had been spent on detailed science cases and technological studies, none of these projects have yet secured funding to advance to construction. We invite the interested community to join a study of the scientific merit, technical implementation, and financial path toward what we coin the "Atacama Large Submillimeter Telescope" (AtLAST). Through this community workshop, working groups, and a final report to be released in early 2019, we hope to motivate the global astronomy community to value and support the realization of such a facility.
Abraham, Nithin S.; Hasegawa, Mark M.; Wooldridge, Eve M.; Henderson-Nelson, Kelly A.
2016-01-01
As a coating made of highly porous zeolite materials, the Molecular Adsorber Coating (MAC) was developed to capture outgassed molecular contaminants, such as hydrocarbons and silicones. For spaceflight applications, the adsorptive capabilities of the coating can alleviate on-orbit outgassing concerns on or near sensitive surfaces and instruments within the spacecraft. Similarly, this sprayable paint technology has proven to be significantly beneficial for ground based space applications, in particular, for vacuum chamber environments. This paper describes the recent use of the MAC technology during Pathfinder testing of the Optical Ground Support Equipment (OGSE) for the James Webb Space Telescope (JWST) at NASA Johnson Space Center (JSC). The coating was used as a mitigation tool to entrap persistent outgassed contaminants, specifically silicone based diffusion pump oil, from within JSC's cryogenic optical vacuum chamber test facility called Chamber A. This paper summarizes the sample fabrication, installation, laboratory testing, post-test chemical analysis results, and future plans for the MAC technology, which was effectively used to protect the JWST test equipment from vacuum chamber contamination.
The First Telescope in the Korean History I. Translation of Jeong`s Report
Directory of Open Access Journals (Sweden)
Sang-Hyeon Ahn
2009-06-01
Full Text Available In 1631 A.D. Jeong Duwon, an ambassador of the Joseon dynasty was sent to the Ming dynasty. There he met João Rodrigues, a Jesuit missionary, in Dengzhou of Shandong peninsula. The missionary gave the ambassador a number of results of latest European innovations. A detailed description on this event was written in `Jeong's official report regarding a message from an European country' ( which is an important literature work to understand the event. Since the document was written in classical Chinese, we make a comprehensive translation to Korean with detailed notes. According to the report, the items that Rodrigues presented include four books written in Chinese that describe European discoveries about the world, a report on the tribute of new cannons manufactured by Portuguese in Macao, a telescope, a flintlock, a Foliot-type mechanical clock, a world atlas drawn by Matteo Ricci, an astronomical planisphere, and a sun-dial. We discuss the meaning of each item in the Korean history of science and technology. In particular, Jeong's introduction is an important event in the history of Korean astronomy, because the telescope he brought was the first one to be introduced in Korean history. Even though king Injo and his associates of the Joseon dynasty were well aware of the value as military armaments of new technologies such as telescopes, cannons, and flintlocks, they were not able to quickly adopt such technologies to defend against the military threat of Jurchen. We revisit the reason in view of the general history of science and technology of east-Asian countries in the 17th century.
The first telescope of the HEGRA air Cherenkov imaging telescope array
International Nuclear Information System (INIS)
Mirzoyan, R.; Kankanian, R.; Krennrich, F.; Mueller, N.; Sander, H.; Sawallisch, P.; Aharonian, F.; Akhperjanian, A.; Beglarian, A.; Fernandez, J.; Fonseca, V.; Grewe, W.; Heusler, A.; Konopelko, A.K.; Lorenz, E.; Merck, M.; Plyasheshnikov, A.V.; Renker, D.; Samorski, M.; Sauerland, K.; Smarsch, E.; Stamm, W.; Ulrich, M.; Wiedner, C.A.; Wirth, H.
1994-01-01
In search of VHE γ ray emission from cosmic point sources a system of imaging Cherenkov telescopes is constructed at present on the Canarian island of La Palma; the first telescope has been operational since 1992. The Cherenkov light from air shower particles is collected by a 5 m 2 reflector. The camera at the focus contains 37 photomultipliers which sample the images of the Cherenkov flashes. The subsequent image analysis allows the discrimination of γ ray induced events from the much more abundant charged cosmic ray induced showers. The telescope has an effective energy threshold for γ showers of about 1.5 TeV. During the first year of operation a signal from the Crab nebula was detected. ((orig.))
Astrobiology with Robotic Telescopes at CAB
Directory of Open Access Journals (Sweden)
Luis Cuesta
2010-01-01
Full Text Available The key objectives of RTRCAB are the identification of new exoplanets and especially the characterization of the known exoplanets by observing photometric and systematic monitoring of their transits. These telescopes, equipped with advanced technology, optimized control programs, and optical and technical characteristics adequate for this purpose, are ideal to make the observations that are required to carry out these programs. The achievement of these goals is ensured by the existence of three separated geographical stations. In this sense, there are several planned missions that have the same objectives among their scientific goals, like Kepler, CoRoT, GAIA, and PLATO.
Infrared up-conversion telescope
DEFF Research Database (Denmark)
2014-01-01
There is presented to an up-conversion infrared telescope (110) arranged for imaging an associated scene (130), wherein the up-conversion infrared telescope (110) comprises a non-linear crystal (120) arranged for up-conversion of infrared electromagnetic radiation, and wherein a first optical...
VizieR Online Data Catalog: NuSTAR serendipitous survey: the 40-month catalog (Lansbury+, 2017)
Lansbury, G. B.; Stern, D.; Aird, J.; Alexander, D. M.; Fuentes, C.; Harrison, F. A.; Treister, E.; Bauer, F. E.; Tomsick, J. A.; Balokovic, M.; Del Moro, A.; Gandhi, P.; Ajello, M.; Annuar, A.; Ballantyne, D. R.; Boggs, S. E.; Brandt, W. N.; Brightman, M.; Chen, C.-T. J.; Christensen, F. E.; Civano, F.; Comastri, A.; Craig, W. W.; Forster, K.; Grefenstette, B. W.; Hailey, C. J.; Hickox, R. C.; Jiang, B.; Jun, H. D.; Koss, M.; Marchesi, S.; Melo, A. D.; Mullaney, J. R.; Noirot, G.; Schulze, S.; Walton, D. J.; Zappacosta, L.; Zhang, W. W.
2017-09-01
Over the period from 2012 July to 2015 November, which is the focus of the current study, there are 510 individual NuSTAR exposures that have been incorporated into the serendipitous survey. These exposures were performed over 331 unique fields (i.e., 331 individual sky regions, each with contiguous coverage composed of one or more NuSTAR exposures), yielding a total sky area coverage of 13deg2. Table 1 lists the fields chronologically. The fields have a cumulative exposure time of 20.4Ms. We have undertaken a campaign of dedicated spectroscopic follow-up in the optical-IR bands, obtaining spectroscopic identifications for a large fraction (56%) of the total sample. Since NuSTAR performs science pointings across the whole sky, a successful ground-based follow-up campaign requires the use of observatories at a range of geographic latitudes, and preferably across a range of dates throughout the sidereal year. This has been achieved through observing programs with, primarily, the following telescopes over a multiyear period (2012 Oct 10 to 2016 Jul 10): the Hale Telescope at Palomar Observatory (5.1m; PIs F. A. Harrison and D. Stern); Keck I and II at the W. M. Keck Observatory (10m; PIs F. A. Harrison and D. Stern); the New Technology Telescope (NTT) at La Silla Observatory (3.6m; PI G. B. Lansbury); the Magellan I (Baade) and Magellan II (Clay) Telescopes at Las Campanas Observatory (6.5m; PIs E. Treister and F. E. Bauer); and the Gemini-South observatory (8.1m; PI E. Treister). (5 data files).
The nature of 50 Palermo Swift-BAT hard X-ray objects through optical spectroscopy
Rojas, A. F.; Masetti, N.; Minniti, D.; Jiménez-Bailón, E.; Chavushyan, V.; Hau, G.; McBride, V. A.; Bassani, L.; Bazzano, A.; Bird, A. J.; Galaz, G.; Gavignaud, I.; Landi, R.; Malizia, A.; Morelli, L.; Palazzi, E.; Patiño-Álvarez, V.; Stephen, J. B.; Ubertini, P.
2017-06-01
We present the nature of 50 hard X-ray emitting objects unveiled through an optical spectroscopy campaign performed at seven telescopes in the northern and southern hemispheres. These objects were detected with the Burst Alert Telescope (BAT) instrument onboard the Swift satellite and listed as of unidentified nature in the 54-month Palermo BAT catalogue. In detail, 45 sources in our sample are identified as active galactic nuclei of which, 27 are classified as type 1 (with broad and narrow emission lines) and 18 are classified as type 2 (with only narrow emission lines). Among the broad-line emission objects, one is a type 1 high-redshift quasi-stellar object, and among the narrow-line emission objects, one is a starburst galaxy, one is a X-ray bright optically normal galaxy, and one is a low ionization nuclear emission line region. We report 30 new redshift measurements, 13 confirmations and 2 more accurate redshift values. The remaining five objects are galactic sources: three are Cataclismic Variables, one is a X-ray Binary probably with a low mass secondary star, and one is an active star. Based on observations obtained from the following observatories: Cerro Tololo Interamerican Observatory (Chile); Astronomical Observatory of Bologna in Loiano (Italy); Observatorio Astronómico Nacional (San Pedro Mártir, Mexico); Radcliffe telescope of the South African Astronomical Observatory (Sutherland, South Africa); Sloan Digital Sky Survey; Observatorio del Roque de los Muchachos of the Instituto de Astrofísica de Canarias (Canary Islands, Spain) and New Technology Telescope (NTT) of La Silla Observatory, Chile.
Telescope sipping the optimum fuel leak detection system
International Nuclear Information System (INIS)
Deleryd, R.
1998-01-01
The TELESCOPE Sipping technology is an evolutionary development from previous ABB fuel leak systems used in LWR reactors. The system utilizes the existing dynamics that cause numerous fission products to leak from a failed fuel rod when the fuel assembly is raised from a reactor core during core fuel alterations. The system can also be used by repair work in pool side inspection in order to detect leaking rods or to verify reconstituted assemblies as non leakers. (author)
The Advanced Telescope for High Energy Astrophysics
Guainazzi, Matteo
2017-08-01
Athena (the Advanced Telescope for High Energy Astrophysics) is a next generation X-ray observatory currently under study by ESA for launch in 2028. Athena is designed to address the Hot and Energetic Universe science theme, which addresses two key questions: 1) How did ordinary matter evolve into the large scale structures we see today? 2) How do black holes grow and shape the Universe. To address these topics Athena employs an innovative X-ray telescope based on Silicon Pore Optics technology to deliver extremely light weight and high throughput, while retaining excellent angular resolution. The mirror can be adjusted to focus onto one of two focal place instruments: the X-ray Integral Field Unit (X-IFU) which provides spatially-resolved, high resolution spectroscopy, and the Wide Field Imager (WFI) which provides spectral imaging over a large field of view, as well as high time resolution and count rate tolerance. Athena is currently in Phase A and the study status will be reviewed, along with the scientific motivations behind the mission.
Direct imaging of extra-solar planetary systems with the Circumstellar Imaging Telescope (CIT)
International Nuclear Information System (INIS)
Terrile, R.J.
1988-01-01
In a joint study conducted by the Jet Propulsion Laboratory and the Perkin-Elmer Corporation it was found that an earth orbital, 1.5 meter diameter low scattered light coronagraphic telescope can achieve a broad range of scientific objectives including the direct detection of Jupiter-sized planets around the nearby stars. Recent major advances in the understanding of coronagraphic performance and in the field of super smooth mirror fabrication allow such an instrument to be designed and built within current technology. Such a project, called the Circumstellar Imaging Telescope (CIT), is currently being proposed. 10 references
Design considerations for large detector arrays on submillimeter-wave telescopes
Stark, Antony A.
2000-07-01
The emerging technology of large (approximately 10,000 pixel) submillimeter-wave bolometer arrays presents a novel optical design problem -- how can such arrays be fed by diffraction- limited telescope optics where the primary mirror is less than 100,000 wavelengths in diameter? Standard Cassegrain designs for radiotelescope optics exhibit focal surface curvature so large that detectors cannot be placed more than 25 beam diameters from the central ray. The problem is worse for Ritchey-Chretien designs, because these minimize coma while increasing field curvature. Classical aberrations, including coma, are usually dominated by diffraction in submillimeter- wave single dish telescopes. The telescope designer must consider (1) diffraction, (2) aberration, (3) curvature of field, (4) cross-polarization, (5) internal reflections, (6) the effect of blockages, (7) means of beam chopping on- and off-source, (8) gravitational and thermal deformations of the primary mirror, (9) the physical mounting of large detector packages, and (10) the effect of gravity and (11) vibration on those detectors. Simultaneous optimization of these considerations in the case of large detector arrays leads to telescopes that differ considerably from standard radiotelescope designs. Offset optics provide flexibility for mounting detectors, while eliminating blockage and internal reflections. Aberrations and cross-polarization can be the same as on-axis designs having the same diameter and focal length. Trade-offs include the complication of primary mirror homology and an increase in overall cost. A dramatic increase in usable field of view can be achieved using shaped optics. Solutions having one to six mirrors will be discussed, including possible six-mirror design for the proposed South Pole 10 m telescope.
The camera of the fifth H.E.S.S. telescope. Part I: System description
Energy Technology Data Exchange (ETDEWEB)
Bolmont, J., E-mail: bolmont@in2p3.fr [LPNHE, Université Pierre et Marie Curie Paris 6, Université Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252 Paris Cedex 5 (France); Corona, P.; Gauron, P.; Ghislain, P.; Goffin, C.; Guevara Riveros, L.; Huppert, J.-F.; Martineau-Huynh, O.; Nayman, P.; Parraud, J.-M.; Tavernet, J.-P.; Toussenel, F.; Vincent, D.; Vincent, P. [LPNHE, Université Pierre et Marie Curie Paris 6, Université Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252 Paris Cedex 5 (France); Bertoli, W.; Espigat, P.; Punch, M. [APC, AstroParticule et Cosmologie, Université Paris Diderot, CNRS/IN2P3, CEA/Irfu, Observatoire de Paris, Sorbonne Paris Cité, 10, rue Alice Domon et Léonie Duquet, F-75205 Paris Cedex 13 (France); Besin, D.; Delagnes, E.; Glicenstein, J.-F. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); and others
2014-10-11
In July 2012, as the four ground-based gamma-ray telescopes of the H.E.S.S. (High Energy Stereoscopic System) array reached their tenth year of operation in Khomas Highlands, Namibia, a fifth telescope took its first data as part of the system. This new Cherenkov detector, comprising a 614.5 m{sup 2} reflector with a highly pixelized camera in its focal plane, improves the sensitivity of the current array by a factor two and extends its energy domain down to a few tens of GeV. The present part I of the paper gives a detailed description of the fifth H.E.S.S. telescope's camera, presenting the details of both the hardware and the software, emphasizing the main improvements as compared to previous H.E.S.S. camera technology.
Development of a mid-sized Schwarzschild-Couder Telescope for the Cherenkov Telescope Array
Energy Technology Data Exchange (ETDEWEB)
Cameron, Robert A.
2012-06-28
The Cherenkov Telescope Array (CTA) is a ground-based observatory for very high-energy (10 GeV to 100 TeV) gamma rays, planned for operation starting in 2018. It will be an array of dozens of optical telescopes, known as Atmospheric Cherenkov Telescopes (ACTs), of 8 m to 24 m diameter, deployed over an area of more than 1 square km, to detect flashes of Cherenkov light from showers initiated in the Earth's atmosphere by gamma rays. CTA will have improved angular resolution, a wider energy range, larger fields of view and an order of magnitude improvement in sensitivity over current ACT arrays such as H.E.S.S., MAGIC and VERITAS. Several institutions have proposed a research and development program to eventually contribute 36 medium-sized telescopes (9 m to 12 m diameter) to CTA to enhance and optimize its science performance. The program aims to construct a prototype of an innovative, Schwarzschild-Couder telescope (SCT) design that will allow much smaller and less expensive cameras and much larger fields of view than conventional Davies-Cotton designs, and will also include design and testing of camera electronics for the necessary advances in performance, reliability and cost. We report on the progress of the mid-sized SCT development program.
A telescope with augmented reality functions
Hou, Qichao; Cheng, Dewen; Wang, Qiwei; Wang, Yongtian
2016-10-01
This study introduces a telescope with virtual reality (VR) and augmented reality (AR) functions. In this telescope, information on the micro-display screen is integrated to the reticule of telescope through a beam splitter and is then received by the observer. The design and analysis of telescope optical system with AR and VR ability is accomplished and the opto-mechanical structure is designed. Finally, a proof-of-concept prototype is fabricated and demonstrated. The telescope has an exit pupil diameter of 6 mm at an eye relief of 19 mm, 6° field of view, 5 to 8 times visual magnification , and a 30° field of view of the virtual image.
The Gemini 8-Meter Telescopes Project
Boroson, Todd A.
1995-05-01
The Gemini 8-Meter Telescopes Project is an international partnership to build and operate two 8-meter telescopes, one on Mauna Kea, Hawaii, and one on Cerro Pachon, Chile. The telescopes will be international facilities, open to the scientific communities of the six member countries, the United States (50%), the United Kingdom (25%), Canada (15%), Chile (5%), Argentina (2.5%), and Brazil (2.5%). The telescopes are designed to exploit the best atmospheric conditions at these excellent sites. Near diffraction limited performance will be delivered at 2.2 microns and longward, with minimal degradation of the best seeing conditions at shorter wavelengths. The telescopes and facilities are designed to achieve emissivity opportunity. First light for the Mauna Kea telescope is expected in late 1998, and for the Cerro Pachon telescope in mid-2000. This talk will report on construction progress, the instrumental capabilities, and operations strategies being considered. The Gemini 8-meter Telescopes Project is managed by the Association of Universities for Research in Astronomy (AURA), Inc. under a cooperative agreement with the National Science Foundation which serves as executive agency for the Gemini partner countries. U.S. participation in the project is through the U.S. Gemini Program, a division of the National Optical Astronomy Observatories. NOAO is operated by AURA, Inc. under cooperative agreement with the National Science Foundation.
Maccarone, Maria C.; Mineo, Teresa; Capalbi, Milvia; Conforti, Vito; Coffaro, Martina
2016-08-01
The Cherenkov Telescope Array (CTA) represents the next generation of ground based observatories for very high energy gamma ray astronomy. The CTA will consist of two arrays at two different sites, one in the northern and one in the southern hemisphere. The current CTA design foresees, in the southern site, the installation of many tens of imaging atmospheric Cherenkov telescopes of three different classes, namely large, medium, and small, so defined in relation to their mirror area; the northern hemisphere array would consist of few tens of the two larger telescope types. The telescopes will be equipped with cameras composed either of photomultipliers or silicon photomultipliers, and with different trigger and read-out electronics. In such a scenario, several different methods will be used for the telescopes' calibration. Nevertheless, the optical throughput of any CTA telescope, independently of its type, can be calibrated analyzing the characteristic image produced by local atmospheric highly energetic muons that induce the emission of Cherenkov light which is imaged as a ring onto the focal plane if their impact point is relatively close to the telescope optical axis. Large sized telescopes would be able to detect useful muon events under stereo coincidence and such stereo muon events will be directly addressed to the central CTA array data acquisition pipeline to be analyzed. For the medium and small sized telescopes, due to their smaller mirror area and large inter-telescope distance, the stereo coincidence rate will tend to zero; nevertheless, muon events will be detected by single telescopes that must therefore be able to identify them as possible useful calibration candidates, even if no stereo coincidence is available. This is the case for the ASTRI telescopes, proposed as pre-production units of the small size array of the CTA, which are able to detect muon events during regular data taking without requiring any dedicated trigger. We present two fast
Development of the Advanced Energetic Pair Telescope (AdEPT) for Medium-Energy Gamma-Ray Astronomy
Hunter, Stanley D.; Bloser, Peter F.; Dion, Michael P.; McConnell, Mark L.; deNolfo, Georgia A.; Son, Seunghee; Ryan, James M.; Stecker, Floyd W.
2011-01-01
Progress in high-energy gamma-ray science has been dramatic since the launch of INTEGRAL, AGILE and FERMI. These instruments, however, are not optimized for observations in the medium-energy (approx.0.3< E(sub gamma)< approx.200 MeV) regime where many astrophysical objects exhibit unique, transitory behavior, such as spectral breaks, bursts, and flares. We outline some of the major science goals of a medium-energy mission. These science goals are best achieved with a combination of two telescopes, a Compton telescope and a pair telescope, optimized to provide significant improvements in angular resolution and sensitivity. In this paper we describe the design of the Advanced Energetic Pair Telescope (AdEPT) based on the Three-Dimensional Track Imager (3-DTI) detector. This technology achieves excellent, medium-energy sensitivity, angular resolution near the kinematic limit, and gamma-ray polarization sensitivity, by high resolution 3-D electron tracking. We describe the performance of a 30x30x30 cm3 prototype of the AdEPT instrument.
Wide Field Infrared Survey Telescope [WFIRST]: telescope design and simulated performance
Goullioud, R.; Content, D. A.; Kuan, G. M.; Moore, J. D.; Chang, Z.; Sunada, E. T.; Villalvazo, J.; Hawk, J. P.; Armani, N. V.; Johnson, E. L.; Powell, C. A.
2012-09-01
The Wide Field Infrared Survey Telescope (WFIRST) mission concept was ranked first in new space astrophysics missions by the Astro2010 Decadal Survey, incorporating the Joint Dark Energy Mission payload concept and multiple science white papers. This mission is based on a space telescope at L2 studying exoplanets [via gravitational microlensing], probing dark energy, and surveying the near infrared sky. Since the release of the Astro2010 Decadal Survey, the team has been working with the WFIRST Science Definition Team to refine mission and payload concepts. We present the current interim reference mission point design of the payload, based on the use of a 1.3m unobscured aperture three mirror anastigmat form, with focal imaging and slit-less spectroscopy science channels. We also present the first results of Structural/Thermal/Optical performance modeling of the telescope point design.
Hartman Testing of X-Ray Telescopes
Saha, Timo T.; Biskasch, Michael; Zhang, William W.
2013-01-01
Hartmann testing of x-ray telescopes is a simple test method to retrieve and analyze alignment errors and low-order circumferential errors of x-ray telescopes and their components. A narrow slit is scanned along the circumference of the telescope in front of the mirror and the centroids of the images are calculated. From the centroid data, alignment errors, radius variation errors, and cone-angle variation errors can be calculated. Mean cone angle, mean radial height (average radius), and the focal length of the telescope can also be estimated if the centroid data is measured at multiple focal plane locations. In this paper we present the basic equations that are used in the analysis process. These equations can be applied to full circumference or segmented x-ray telescopes. We use the Optical Surface Analysis Code (OSAC) to model a segmented x-ray telescope and show that the derived equations and accompanying analysis retrieves the alignment errors and low order circumferential errors accurately.
SCIENTIFIC EFFICIENCY OF GROUND-BASED TELESCOPES
International Nuclear Information System (INIS)
Abt, Helmut A.
2012-01-01
I scanned the six major astronomical journals of 2008 for all 1589 papers that are based on new data obtained from ground-based optical/IR telescopes worldwide. Then I collected data on numbers of papers, citations to them in 3+ years, the most-cited papers, and annual operating costs. These data are assigned to four groups by telescope aperture. For instance, while the papers from telescopes with an aperture >7 m average 1.29 more citations than those with an aperture of 2 to 7 m) telescopes. I wonder why the large telescopes do so relatively poorly and suggest possible reasons. I also found that papers based on archival data, such as the Sloan Digital Sky Survey, produce 10.6% as many papers and 20.6% as many citations as those based on new data. Also, the 577.2 papers based on radio data produced 36.3% as many papers and 33.6% as many citations as the 1589 papers based on optical/IR telescopes.
Directory of Open Access Journals (Sweden)
Santri E. P. Djahimo
2016-01-01
Full Text Available This writing is about management of innovation in language teaching and it is reflected by a case study of managing innovation in rural schools in East Nusa Tenggara (NTT Province, Indonesia. The content of this writing mostly discusses about how to manage innovation in language teaching. However, there are several minor parts describe about the case study conducted in rural schools in Nil Province. Innovation in education is not a totally new thing to be discussed. Many researchers as well as writers have given great attention to this topic for many years. Innovation in this study means a new way of doing something to make an improvement to someone or something. In this case, an innovation in the form of teaching methodology has been implemented to create a better atmosphere in the classroom and an improvement in the students1 performance in vocabulary acquisition in EFL classroom. It has been expected that through this innovation, the students' performance would be better in vocabulary acquisition and so a better output could be achieved. Through this writing, the writer would like to show that educational innovation needs to be applied, especially by those who want better changes in order to improve themselves and achieve better results in education. The success and failure of this kind of innovation will be determined by several essential factors included in the three big category, namely Knowledge and Skill factors; Resource and Support factors; and Human and Social factors, as well as characteristics and attributes. These factors determine whether or not an innovation in education can be adopted.
Gianotti, Fulvio; Fioretti, Valentina; Tanci, Claudio; Conforti, Vito; Tacchini, Alessandro; Leto, Giuseppe; Gallozzi, Stefano; Bulgarelli, Andrea; Trifoglio, Massimo; Malaguti, Giuseppe; Zoli, Andrea
2014-07-01
ASTRI is an Italian flagship project whose first goal is the realization of an end-to-end telescope prototype, named ASTRI SST-2M, for the Cherenkov Telescope Array (CTA). The prototype will be installed in Italy during Fall 2014. A second goal will be the realization of the ASTRI/CTA mini-array which will be composed of seven SST-2M telescopes placed at the CTA Southern Site. The Information and Communication Technology (ICT) equipment necessary to drive the infrastructure for the ASTRI SST-2M prototype is being designed as a complete and stand-alone computer center. The design goal is to obtain basic ICT equipment that might be scaled, with a low level of redundancy, for the ASTRI/CTA mini-array, taking into account the necessary control, monitor and alarm system requirements. The ICT equipment envisaged at the Serra La Nave observing station in Italy, where the ASTRI SST-2M telescope prototype will operate, includes computers, servers and workstations, network devices, an uninterruptable power supply system, and air conditioning systems. Suitable hardware and software tools will allow the parameters related to the behavior and health of each item of equipment to be controlled and monitored. This paper presents the proposed architecture and technical solutions that integrate the ICT equipment in the framework of the Observatory Control System package of the ASTRI/CTA Mini- Array Software System, MASS, to allow their local and remote control and monitoring. An end-toend test case using an Internet Protocol thermometer is reported in detail.
Silicon carbide optics for space and ground based astronomical telescopes
Robichaud, Joseph; Sampath, Deepak; Wainer, Chris; Schwartz, Jay; Peton, Craig; Mix, Steve; Heller, Court
2012-09-01
Silicon Carbide (SiC) optical materials are being applied widely for both space based and ground based optical telescopes. The material provides a superior weight to stiffness ratio, which is an important metric for the design and fabrication of lightweight space telescopes. The material also has superior thermal properties with a low coefficient of thermal expansion, and a high thermal conductivity. The thermal properties advantages are important for both space based and ground based systems, which typically need to operate under stressing thermal conditions. The paper will review L-3 Integrated Optical Systems - SSG’s (L-3 SSG) work in developing SiC optics and SiC optical systems for astronomical observing systems. L-3 SSG has been fielding SiC optical components and systems for over 25 years. Space systems described will emphasize the recently launched Long Range Reconnaissance Imager (LORRI) developed for JHU-APL and NASA-GSFC. Review of ground based applications of SiC will include supporting L-3 IOS-Brashear’s current contract to provide the 0.65 meter diameter, aspheric SiC secondary mirror for the Advanced Technology Solar Telescope (ATST).
Tonkin, Stephen
Many amateur astronomers make their own instruments, either because of financial considerations or because they are just interested. Amateur Telescope Making offers a variety of designs for telescopes, mounts and drives which are suitable for the home-constructor. The designs range from simple to advanced, but all are within the range of a moderately well-equipped home workshop. The book not only tells the reader what he can construct, but also what it is sensible to construct given what time is available commercially. Thus each chapter begins with reasons for undertaking the project, then looks at theoretical consideration before finishing with practical instructions and advice. An indication is given as to the skills required for the various projects. Appendices list reputable sources of (mail order) materials and components. The telescopes and mounts range from "shoestring" (very cheap) instruments to specialist devices that are unavailable commercially.
Evaluating SLOOH Robotic Telescopes for Formal Educational Use
Gershun, D.; Berryhill, K. J.; Slater, T. F.
2012-12-01
The past several years has seen a gradual shift from telescopes being used only by top researchers to a case where educators across the STEM spectrum now have access to quality telescopes. This has been made possible by equipping telescopes to be controlled over the internet, either robotically which requires no human interaction during observation, or remotely which retain full user controllability. Education researchers around the world have recently focused on applications in elementary and secondary education (McKinnon & Geissinger 2002, Sadler et al. 2007). Responding to this paradigm shift, graduate students and faculty at the University of Wyoming and Center for Physic & Astronomy Education Research (www.caperteam.com) are dedicating time to explore this further at the undergraduate level, in order to better advise STEM educators of the most effective technological resources and curriculum development. Current research focuses on evaluating the academic merit of using SLOOH Space Camera in a summer online course offered by the University of Wyoming Outreach Program. SLOOH has robotic telescopes in the Canary Islands and La Dehesa, Chile. This evaluation will provide valuable data on an emerging technology as well as serve to advise future introductory astronomy sections at the University of Wyoming on the use of similar internet-controlled telescopes. The eight-week course exposed nine graduate science education students to basic night sky observing knowledge as well as provided hands-on experience using several robotic and remote observatories1,2,3,4. This mixed-methods case study collected data in the forms of six focus-group recordings, pre- and post-tests from all participants, a post-class survey, and general observations by the lead researcher. Transcripts and comments are coded to determine the most important features of SLOOH, and testing measures are analyzed to gauge the incoming and outgoing knowledge of participants. Analysis of testing measures
Review of lunar telescope studies at MSFC
Hilchey, John D.; Nein, Max E.
1993-09-01
In the near future astronomers can take advantage of the lunar surface as the new 'high ground' from which to study the universe. Optical telescopes placed and operated on the lunar surface would be successors to NASA's Great Observatories. Four telescopes, ranging in aperture from a 16-m, IR/Vis/UV observatory down to a 1-m, UV 'transit' instrument, have been studied by the Lunar Telescope Working Group and the LUTE (lunar telescope ultraviolet experiment) Task Team of the Marshall Space Flight Center (MSFC). This paper presents conceptual designs of the telescopes, provides descriptions of the telescope subsystem options selected for each concept, and outlines the potential evolution of their science capabilities.
History of Robotic and Remotely Operated Telescopes
Genet, Russell M.
2011-03-01
While automated instrument sequencers were employed on solar eclipse expeditions in the late 1800s, it wasn't until the 1960s that Art Code and associates at Wisconsin used a PDP minicomputer to automate an 8-inch photometric telescope. Although this pioneering project experienced frequent equipment failures and was shut down after a couple of years, it paved the way for the first space telescopes. Reliable microcomputers initiated the modern era of robotic telescopes. Louis Boyd and I applied single board microcomputers with 64K of RAM and floppy disk drives to telescope automation at the Fairborn Observatory, achieving reliable, fully robotic operation in 1983 that has continued uninterrupted for 28 years. In 1985 the Smithsonian Institution provided us with a suburb operating location on Mt. Hopkins in southern Arizona, while the National Science Foundation funded additional telescopes. Remote access to our multiple robotic telescopes at the Fairborn Observatory began in the late 1980s. The Fairborn Observatory, with its 14 fully robotic telescopes and staff of two (one full and one part time) illustrates the potential for low operating and maintenance costs. As the information capacity of the Internet has expanded, observational modes beyond simple differential photometry opened up, bringing us to the current era of real-time remote access to remote observatories and global observatory networks. Although initially confined to smaller telescopes, robotic operation and remote access are spreading to larger telescopes as telescopes from afar becomes the normal mode of operation.
Zuccaro Marchi, Alessandro; D'Amato, Francesco; Gallieni, Daniele; Biasi, Roberto; Molina, Marco; Duò, Fabrizio; Ruder, Nikolaus; Salinari, Piero; Lisi, Franco; Riccardi, Armando; Gambicorti, Lisa; Simonetti, Francesca; Pereira do Carmo, Joao Pedro N.
2017-11-01
The increasing interest on space telescopes for scientific applications leads to implement the manufacturing technology of the most critical element, i.e. the primary mirror: being more suitable a large aperture, it must be lightweight and deployable. The presented topic was originally addressed to a spaceborne DIAL (Differential Absorption LIDAR) mission operating at 935.5 nm for the measurement of water vapour profile in atmosphere, whose results were presented at ICSO 2006 and 2008. Aim of this paper is to present the latest developments on the main issues related to the fabrication of a breadboard, covering two project critical areas identified during the preliminary studies: the design and performances of the long-stroke actuators used to implement the mirror active control and the mirror survivability to launch via Electrostatic Locking (EL) between mirror and backplane. The described work is developed under the ESA/ESTEC contract No. 22321/09/NL/RA. The lightweight mirror is structured as a central sector surrounded by petals, all of them actively controlled to reach the specified shape after initial deployment and then maintained within specs for the entire mission duration. The presented study concerns: a) testing the Carbon Fiber Reinforced Plastic (CFRP) backplane manufacturing and EL techniques, with production of suitable specimens; b) actuator design optimisation; c) design of the deployment mechanism including a high precision latch; d) the fabrication of thin mirrors mock-ups to validate the fabrication procedure for the large shells. The current activity aims to the construction of an optical breadboard capable of demonstrating the achievement of all these coupled critical aspects: optical quality of the thin shell mirror surface, actuators performances and back-plane - EL subsystem functionality.
Prospects for γ-ray imaging telescopes
International Nuclear Information System (INIS)
Carter, J.N.; Dean, A.J.; Ramsden, D.
1981-01-01
Apart from the requirement for a new, high angular-resolution gamma-ray telescope for the more precise location of known COS-B gamma-ray sources, there is also a need for another instrument that can be used in a search for the gamma-ray emission from specific X-ray-emitting objects. If there is to be any hope of relating gamma ray emission to specific candidate X-ray objects, then an angular resolution of typically a few minutes of arc is required to resolve adjacent sources in crowded regions of the sky such as the galactic centre. Efforts to improve the angular resolution of track-chamber telescopes are compared. For energies close to 1 MeV telescopes have either used collimators to restrict the field of view or have made use of the kinematics of the Compton scattering process to determine the direction of the incident photon. The use of coded aperture techniques in high angular resolution X-ray astronomy telescopes is reviewed. A practical telescope for astronomy at high energies described by Carter is mentioned. At low energies an imaging telescope could be constructed by making use of position-sensitive detectors initially developed for use in medical physics. Such a telescope is outlined in general terms and its benefits and uses given. (U.K.)
Innovative compact focal plane array for wide field vis and ir orbiting telescopes
Hugot, Emmanuel; Vives, Sébastien; Ferrari, Marc; Gaeremynck, Yann; Jahn, Wilfried
2017-11-01
The future generation of high angular resolution space telescopes will require breakthrough technologies to combine large diameters and large focal plane arrays with compactness and lightweight mirrors and structures. Considering the allocated volume medium-size launchers, short focal lengths are mandatory, implying complex optical relays to obtain diffraction limited images on large focal planes. In this paper we present preliminary studies to obtain compact focal plane arrays (FPA) for earth observations on low earth orbits at high angular resolution. Based on the principle of image slicers, we present an optical concept to arrange a 1D FPA into a 2D FPA, allowing the use of 2D detector matrices. This solution is particularly attractive for IR imaging requiring a cryostat, which volume could be considerably reduced as well as the relay optics complexity. Enabling the use of 2D matrices for such an application offers new possibilities. Recent developments on curved FPA allows optimization without concerns on the field curvature. This innovative approach also reduces the complexity of the telescope optical combination, specifically for fast telescopes. This paper will describe the concept and optical design of an F/5 - 1.5m telescope equipped with such a FPA, the performances and the impact on the system with a comparison with an equivalent 1.5m wide field Korsch telescope.
Status of the MAGIC telescopes
Energy Technology Data Exchange (ETDEWEB)
Colin, Pierre; Carmona, Emiliano; Schweizer, Thomas; Sitarek, Julian [Max-Planck-Institut fuer Physik, Werner-Heisenberg Institut, Muenchen (Germany)
2010-07-01
MAGIC is a system of two 17-m Cherenkov telescopes located on La Palma (Canary islands),sensitive to gamma-rays above 30 GeV. It has been recently upgraded by a second telescope which strongly improves the sensitivity, particularly at low energy. Here we present the status of the MAGIC telescopes and an overview of the recent results obtained in single or stereoscopic mode. We also discuss the real performance of the new stereoscopic system based on Crab Nebula observations.
Schallig, Ellen; Lewis, Ian J.; Gilbert, James; Dalton, Gavin; Brock, Matthew; Abrams, Don Carlos; Middleton, Kevin; Aguerri, J. Alfonso L.; Bonifacio, Piercarlo; Carrasco, Esperanza; Trager, Scott C.; Vallenari, Antonella
2016-01-01
WEAVE is the next-generation wide-field optical spectroscopy facility for the William Herschel Telescope (WHT) on La Palma in the Canary Islands, Spain. It is a multi-object "pick-and-place" fibre-fed spectrograph with a 1000 fibre multiplex behind a new dedicated 2° prime focus corrector. The WEAVE
Hoover, Richard B.; Baker, Phillip C.; Hadaway, James B.; Johnson, R. B.; Peterson, Cynthia; Gabardi, David R.; Walker, Arthur B., Jr.; Lindblom, J. F.; Deforest, Craig; O'Neal, R. H.
1991-12-01
The Multi-Spectral Solar Telescope Array (MSSTA), which is a sounding-rocket-borne observatory for investigating the sun in the soft X-ray/EUV and FUV regimes of the electromagnetic spectrum, utilizes single reflection multilayer coated Herschelian telescopes for wavelengths below 100 A, and five doubly reflecting multilayer coated Ritchey-Chretien and two Cassegrain telescopes for selected wavelengths in the EUV region between 100 and 1000 A. The paper discusses the interferometric alignment, testing, focusing, visible light testing, and optical performance characteristics of the Ritchey-Chretien and Cassegrain telescopes of MSSTA. A schematic diagram of the MSSTA Ritchey-Chretien telescope is presented together with diagrams of the system autocollimation testing.
Lifescience Database Archive (English)
Full Text Available rotein ycf1 OS=... 62 2e-08 tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachel... + + Sbjct: 124 FSIQRIFFQNLLFQFFNPLFLPSSIFMRFVNIYLFRCNNKVLFLTKS 170 >tr|B1NTT1|B1NTT1_TRACE Hypothetical chloroplast RF19 OS=Trachel
Kitchin, C R
2013-01-01
Telescopes and Techniques has proved itself in its first two editions, having become probably one of the most widely used astronomy texts, both for amateur astronomers and astronomy and astrophysics undergraduates. Both earlier editions of the book were widely used for introductory practical astronomy courses in many universities. In this Third Edition the author guides the reader through the mathematics, physics and practical techniques needed to use today's telescopes (from the smaller models to the larger instruments installed in many colleges) and how to find objects in the sky. Most of the physics and engineering involved is described fully and requires little prior knowledge or experience. Both visual and electronic imaging techniques are covered, together with an introduction to how data (measurements) should be processed and analyzed. A simple introduction to radio telescopes is also included. Brief coverage of the more advanced topics of photometry and spectroscopy are included, but mainly to enable ...
Canzian, Blaise; Barentine, J.; Hull, T.
2012-01-01
L-3 Integrated Optical Systems (IOS) Division has been selected by the National Solar Observatory (NSO) to make the Top End Optical Assembly (TEOA) for the 4-meter Advanced Technology Solar Telescope (ATST) to operate at Haleakala, Maui. ATST will perform to a very high optical performance level in a difficult thermal environment. The TEOA, containing the 0.65-meter silicon carbide secondary mirror and support, mirror thermal management system, mirror positioning and fast tip-tilt system, field stop with thermally managed heat dump, thermally managed Lyot stop, safety interlock and control system, and support frame, operates in the "hot spot” at the prime focus of the ATST and so presents special challenges. In this paper, we will describe the L-3 IOS technical approach to meet these challenges, including subsystems for opto-mechanical positioning, rejected and stray light control, wavefront tip-tilt compensation, and thermal management. Key words: ATST, TEOA, L-3 IOS, thermal management, silicon carbide (SiC) mirrors, hexapods, solar astronomy
Wilkie, William Keats; Williams, R. Brett; Agnes, Gregory S.; Wilcox, Brian H.
2007-01-01
This paper presents a feasibility study of robotically constructing a very large aperture optical space telescope on-orbit. Since the largest engineering challenges are likely to reside in the design and assembly of the 150-m diameter primary reflector, this preliminary study focuses on this component. The same technology developed for construction of the primary would then be readily used for the smaller optical structures (secondary, tertiary, etc.). A reasonable set of ground and on-orbit loading scenarios are compiled from the literature and used to define the structural performance requirements and size the primary reflector. A surface precision analysis shows that active adjustment of the primary structure is required in order to meet stringent optical surface requirements. Two potential actuation strategies are discussed along with potential actuation devices at the current state of the art. The finding of this research effort indicate that successful technology development combined with further analysis will likely enable such a telescope to be built in the future.
A telescope for observation from space of extreme lightnings in the upper atmosphere
International Nuclear Information System (INIS)
Nam, S.; Artikova, S.; Chung, T.; Garipov, G.; Jeon, J.A.; Jeong, S.; Jin, J.Y.; Khrenov, B.A.; Kim, J.E.; Kim, M.; Kim, Y.K.; Klimov, P.; Lee, J.; Lee, H.Y.; Na, G.W.; Oh, S.J.; Panasyuk, M.; Park, I.H.; Park, J.H.; Park, Y.-S.
2008-01-01
A new type of telescope with a wide field-of-view and functions of fast zoom-in has been introduced. Two kinds of MEMS (Micro-Electro-Mechanical Systems) micromirrors, digital and analog, are used for reflectors of the telescope, placed at different focal lengths. We apply this technology to the observation from space of TLE (Transient Luminous Events), extremely large transient sparks occurring at the upper atmosphere. TLE are one type of important backgrounds to be understood for future space observation of UHECR (Ultra-High Energy Cosmic Rays). The launch of the payload carried by a Russian microsatellite is foreseen in the middle of 2008
Digitalized Mirror Array and Its Application in Large Telescope: Principle and Case Studies
International Nuclear Information System (INIS)
Chen Yingtian; Zhang Yang; Lim, Boon Ham; Lim, Chen Sin; Hu Sen; Ho, Tso-Hsiu; Chong, Kok Keong; Tan, Boon Kok
2009-01-01
In this article, we report the principle and conceptual design of a fundamentally different technology in fabricating high precision aberration free optical devices. The tip-tilt of facet in a mirror array is produced by digitally controlled line-tilts of rows and columns. It has not only provided a cost-effective designing methodology in optical physics but also led to a much finer precision of 1 mili arc sec or less. As examples of the application of the proposed digitalised optics, two case studies have been given: a 10 m Schmidt telescope (off-axis) and an 8 m Cassegrain telescope (on-axis). (geophysics, astronomy, and astrophysics)
Energy Technology Data Exchange (ETDEWEB)
Ruhl, J.E.; Ade, P.A.R.; Carlstrom, J.E.; Cho, H.M.; Crawford,T.; Dobbs, M.; Greer, C.H.; Halverson, N.W.; Holzapfel, W.L.; Lanting,T.M.; Lee, A.T.; Leitch, E.M.; Leong, J.; Lu, W.; Lueker, M.; Mehl, J.; Meyer, S.S.; Mohr, J.J.; Padin, S.; Plagge, T.; Pryke, C.; Runyan, M.C.; Schwan, D.; Sharp, M.K.; Spieler, H.; Staniszewski, Z.; Stark, A.A.
2004-11-04
A new 10 meter diameter telescope is being constructed for deployment at the NSF South Pole research station. The telescope is designed for conducting large-area millimeter and sub-millimeter wave surveys of faint, low contrast emission, as required to map primary and secondary anisotropies in the cosmic microwave background. To achieve the required sensitivity and resolution, the telescope design employs an off-axis primary with a 10 m diameter clear aperture. The full aperture and the associated optics will have a combined surface accuracy of better than 20 microns rms to allow precision operation in the submillimeter atmospheric windows. The telescope will be surrounded with a large reflecting ground screen to reduce sensitivity to thermal emission from the ground and local interference. The optics of the telescope will support a square degree field of view at 2mm wavelength and will feed a new 1000-element micro-lithographed planar bolometric array with superconducting transition-edge sensors and frequency-multiplexed readouts. The first key project will be to conduct a survey over 4000 degrees for galaxy clusters using the Sunyaev-Zeldovich Effect. This survey should find many thousands of clusters with a mass selection criteria that is remarkably uniform with redshift. Armed with redshifts obtained from optical and infrared follow-up observations, it is expected that the survey will enable significant constraints to be placed on the equation of state of the dark energy.
Commissioning and first tests of the MAGIC telescope
Baixeras, C.; Bastieri, D.; Bigongiari, C.; Blanch, O.; Blanchot, G.; Bock, R.; Bretz, T.; Chilingarian, A.; Coarasa, J. A.; Colombo, E.; Contreras, J. C.; Corti, D.; Cortina, J.; Domingo, C.; Domingo, E.; Ferenc, D.; Fernández, E.; Flix, J.; Fonseca, V.; Font, L.; Galante, N.; Gaug, M.; Garczarczyk, M.; Gebauer, J.; Giller, M.; Goebel, F.; Hengstebeck, T.; Jacone, P.; de Jager, O. C.; Kalekin, O.; Kestel, M.; Kneiske, T.; Laille, A.; López, M.; López, J.; Lorenz, E.; Mannheim, K.; Mariotti, M.; Martínez, M.; Mase, K.; Merck, M.; Meucci, M.; Miralles, L.; Mirzoyan, R.; Moralejo, A.; Wilhelmi, E. Oña; Orduña, R.; Paneque, D.; Paoletti, R.; Pascoli, D.; Pavel, N.; Pegna, R.; Peruzzo, L.; Piccioli, A.; Roberts, A.; Reyes, R.; Saggion, A.; Sánchez, A.; Sartori, P.; Scalzotto, V.; Schweizer, T.; Sillanpaa, A.; Sobczynska, D.; Stamerra, A.; Stepanian, A.; Stiehler, R.; Takalo, L.; Teshima, M.; Tonello, N.; Torres, A.; Turini, N.; Vitale, V.; Volkov, S.; Wagner, R. M.; Wibig, T.; Wittek, W.
2004-02-01
Major Atmospheric Gamma Imaging Cherenkov telescope is starting its operations with a set of engineering runs to tune the telescope subsystem elements to be ready for the first physics campaign. Many technical improvements have been developed and implemented in several elements of the telescope to reach the lowest energy threshold ever obtained by an Imaging Atmospheric Cherenkov Telescope. A general description of the telescope is presented. The commissioning of the telescope's elements is described and the expected performances are reviewed with the final detector set-up.
Balasubramanian, Kunjithapatham; Shaklan, Stuart; Give'on, Amir; Cady, Eric; Marchen, Luis
2011-01-01
The NASA Exoplanet program and the Cosmic Origins program are exploring technical options to combine the visible to NIR performance requirements of a space coronagraph with the general astrophysics requirements of a space telescope covering the deep UV spectrum. Are there compatible options in terms of mirror coatings and telescope architecture to satisfy both goals? In this paper, we address some of the main concerns, particularly relating to polarization in the visible and throughput in the UV. Telescope architectures employing different coating options compatible with current technology are considered in this trade study.
European Extremely Large Telescope: progress report
Tamai, R.; Spyromilio, J.
2014-07-01
The European Extremely Large Telescope is a project of the European Southern Observatory to build and operate a 40-m class optical near-infrared telescope. The telescope design effort is largely concluded and construction contracts are being placed with industry and academic/research institutes for the various components. The siting of the telescope in Northern Chile close to the Paranal site allows for an integrated operation of the facility providing significant economies. The progress of the project in various areas is presented in this paper and references to other papers at this SPIE meeting are made.
Merz telescopes a global heritage worth preserving
2017-01-01
This book comprises a fascinating collection of contributions on the Merz telescopes in Italy that collectively offer the first survey on historical large refracting telescopes in the country, drawing on original documents and photographs. It opens with a general introduction on the importance of Merz telescopes in the history of astronomy and analyses of the local and international contexts in which the telescopes were made. After examination of an example of the interaction between the maker and the astronomer in the construction and maintenance of these refractors, the history of the Merz telescopes at the main Italian observatories in the nineteenth century is described in detail. Expert testimony is also provided on how these telescopes were successfully used until the second half of the twentieth century for research purposes, thus proving their excellent optical qualities.
Evaluation of indigenous tomato hybrids under plastic tunnel
International Nuclear Information System (INIS)
Farooq, M.; Ullah, H.; Nawab, N.N.; Qureshi, K.M.
2013-01-01
Evaluation of indigenous tomato hybrids under plastic tunnel Seventeen locally developed indeterminate tomato hybrids were evaluated along with 'Sahel' as check under plastic tunnel for yield and yield components at National Agricultural Research Centre, Islamabad. Maximum yield of 71.58 tha/sup -1/ was recorded in NTT-12-08 while minimum yield (34.75 tha/sup -1/) was observed in NTT-16-08. Sahel used as check bore maximum number of fruits plant/sup -1/(30.26) and followed by NTT-04-08 and NTT-03-08 bearing 28.68 and 24.16 fruits plant/sup -1/, respectively. The highest mean fruit weight of 170.63 g was recorded in NTT-05-08 while minimum fruit weight (80.90 g) was observed in Sahel (check). Maximum fruit length of 7.89 cm was recorded in Sahel which is oblong in shape while minimum (5.70 cm) in NTT-14-08. Similarly a significant difference was observed among hybrids for fruit diameter. Fruits having more diameter are round to roundish in shape. Fruit diameter ranged from 8.85 to 5.49 cm. Fruit firmness also varied significantly ranging from 3.54 to 1.67 kg m/sup -3/ in Sahel and NTT-07-08, respectively. Maximum pericarp thickness (0.90 cm) was recorded in NTT-10-08 while minimum pericarp thickness of 0.58 cm was observed in NTT-16-08. NTT-01-08 exhibits the highest number of locules (5.22). It was followed by NTT-02-08 having 4.55 locules while minimum (2.0) locules were observed in NTT-09-08. (author)
Canzian, Blaise; Barentine, J.; Arendt, J.; Bader, S.; Danyo, G.; Heller, C.
2012-09-01
L-3 Integrated Optical Systems (IOS) Division has been selected by the National Solar Observatory (NSO) to design and produce the Top End Optical Assembly (TEOA) for the 4-meter Advanced Technology Solar Telescope (ATST) to operate at Haleakal', Maui. ATST will perform to a very high optical performance level in a difficult thermal environment. The TEOA, containing the 0.65-meter silicon carbide secondary mirror and support, mirror thermal management system, mirror positioning and fast tip-tilt system, field stop with thermally managed heat dump, thermally managed Lyot stop, safety interlock and control system, and support frame, operates in the "hot spot" at the prime focus of the ATST and so presents special challenges. In this paper, we describe progress in the L-3 technical approach to meeting these challenges, including silicon carbide off-axis mirror design, fabrication, and high accuracy figuring and polishing all within L-3; mirror support design; the design for stray light control; subsystems for opto-mechanical positioning and high accuracy absolute mirror orientation sensing; Lyot stop design; and thermal management of all design elements to remain close to ambient temperature despite the imposed solar irradiance load.
Savant, Vaibhav; Smith, Niall
2016-07-01
We report on the current status in the development of a pilot automated data acquisition and reduction pipeline based around the operation of two nodes of remotely operated robotic telescopes based in California, USA and Cork, Ireland. The observatories are primarily used as a testbed for automation and instrumentation and as a tool to facilitate STEM (Science Technology Engineering Mathematics) promotion. The Ireland node is situated at Blackrock Castle Observatory (operated by Cork Institute of Technology) and consists of two optical telescopes - 6" and 16" OTAs housed in two separate domes while the node in California is its 6" replica. Together they form a pilot Telescope ARrAy known as TARA. QuickPhot is an automated data reduction pipeline designed primarily to throw more light on the microvariability of blazars employing precision optical photometry and using data from the TARA telescopes as they constantly monitor predefined targets whenever observing conditions are favourable. After carrying out aperture photometry, if any variability above a given threshold is observed, the reporting telescope will communicate the source concerned and the other nodes will follow up with multi-band observations, taking advantage that they are located in strategically separated time-zones. Ultimately we wish to investigate the applicability of Shock-in-Jet and Geometric models. These try to explain the processes at work in AGNs which result in the formation of jets, by looking for temporal and spectral variability in TARA multi-band observations. We are also experimenting with using a Twochannel Optical PHotometric Imaging CAMera (TOΦCAM) that we have developed and which has been optimised for simultaneous two-band photometry on our 16" OTA.
CsI Calorimeter for a Compton-Pair Telescope
Grove, Eric J.
We propose to build and test a hodoscopic CsI(Tl) scintillating-crystal calorimeter for a medium-energy γ-ray Compton and pair telescope. The design and technical approach for this calorimeter relies deeply on heritage from the Fermi LAT CsI Calorimeter, but it dramatically improves the low-energy performance of that design by reading out the scintillation light with silicon photomultipliers (SiPMs), making the technology developed for Fermi applicable in the Compton regime. While such a hodoscopic calorimeter is useful for an entire class of medium-energy γ-ray telescope designs, we propose to build it explicitly to support beam tests and balloon flight of the Proto-ComPair telescope, the development and construction of which was funded in a four-year APRA program beginning in 2015 ("ComPair: Steps to a Medium Energy γ-ray Mission" with PI J. McEnery of GSFC). That award did not include funding for its CsI calorimeter subsystem, and this proposal is intended to cover that gap. ComPair is a MIDEX-class instrument concept to perform a high-sensitivity survey of the γ-ray sky from 0.5 MeV to 500 MeV. ComPair is designed to provide a dramatic increase in sensitivity relative to previous instruments in this energy range (predominantly INTEGRAL/SPI and Compton COMPTEL), with the same transformative sensitivity increase - and corresponding scientific return- that the Fermi Large Area Telescope provided relative to Compton EGRET. To enable transformative science over a broad range of MeV energies and with a wide field of view, ComPair is a combined Compton telescope and pair telescope employing a silicon-strip tracker (for Compton scattering and pair conversion and tracking) and a solid-state CdZnTe calorimeter (for Compton absorption) and CsI calorimeter (for pair calorimetry), surrounded by a plastic scintillator anti-coincidence detector. Under the current proposal, we will complete the detailed design, assembly, and test of the CsI calorimeter for the risk
Gamma ray astronomy with atmospheric Cherenkov telescopes: the future
International Nuclear Information System (INIS)
Krennrich, Frank
2009-01-01
Atmospheric Cherenkov telescopes have been key to the recent discoveries in teraelectronvolt (TeV) γ-ray astronomy. The detection of TeV γ rays from more than 90 galactic and extragalactic sources provides a wealth of data for probing physical phenomena that pertain to some of the big questions in astrophysics. These include the understanding of the origin of cosmic rays, unveiling the connection between relativistic jets and black holes, shedding light on dark matter and its relation to supersymmetric particles and estimating the brightness of cosmological diffuse radiation fields in the optical/infrared waveband. While these recent advances were made with instruments designed in the 1990s, the present paper is concerned with a next generation of imaging atmospheric Cherenkov telescopes (IACTs) that are currently in the conceptual planning stage. We discuss the basic ideas, the required technology and expected performance of a ≥1 square-kilometer array, which is poised to yield the most dramatic step yet to come in TeV astronomy.
SAAO's new robotic telescope and WiNCam (Wide-field Nasmyth Camera)
Worters, Hannah L.; O'Connor, James E.; Carter, David B.; Loubser, Egan; Fourie, Pieter A.; Sickafoose, Amanda; Swanevelder, Pieter
2016-08-01
The South African Astronomical Observatory (SAAO) is designing and manufacturing a wide-field camera for use on two of its telescopes. The initial concept was of a Prime focus camera for the 74" telescope, an equatorial design made by Grubb Parsons, where it would employ a 61mmx61mm detector to cover a 23 arcmin diameter field of view. However, while in the design phase, SAAO embarked on the process of acquiring a bespoke 1-metre robotic alt-az telescope with a 43 arcmin field of view, which needs a homegrown instrument suite. The Prime focus camera design was thus adapted for use on either telescope, increasing the detector size to 92mmx92mm. Since the camera will be mounted on the Nasmyth port of the new telescope, it was dubbed WiNCam (Wide-field Nasmyth Camera). This paper describes both WiNCam and the new telescope. Producing an instrument that can be swapped between two very different telescopes poses some unique challenges. At the Nasmyth port of the alt-az telescope there is ample circumferential space, while on the 74 inch the available envelope is constrained by the optical footprint of the secondary, if further obscuration is to be avoided. This forces the design into a cylindrical volume of 600mm diameter x 250mm height. The back focal distance is tightly constrained on the new telescope, shoehorning the shutter, filter unit, guider mechanism, a 10mm thick window and a tip/tilt mechanism for the detector into 100mm depth. The iris shutter and filter wheel planned for prime focus could no longer be accommodated. Instead, a compact shutter with a thickness of less than 20mm has been designed in-house, using a sliding curtain mechanism to cover an aperture of 125mmx125mm, while the filter wheel has been replaced with 2 peripheral filter cartridges (6 filters each) and a gripper to move a filter into the beam. We intend using through-vacuum wall PCB technology across the cryostat vacuum interface, instead of traditional hermetic connector-based wiring. This
Bangia, Tarun; Yadava, Shobhit; Kumar, Brijesh; Ghanti, A. S.; Hardikar, P. M.
2016-07-01
India's largest 3.6 m aperture optical telescope facility has been recently established at Devasthal site by Aryabhatta Research Institute of Observation Sciences (ARIES), an autonomous Institute under Department of Science and Technology, Government of India. The telescope is equipped with active optics and it is designed to be used for seeinglimited observations at visible and near-infrared wavelengths. A steel building with rotating cylindrical steel Dome was erected to house 3.6m telescope and its accessories at hilltop of Devasthal site. Customized cranes were essentially required inside the building as there were space constraints around the telescope building for operating big external heavy duty cranes from outside, transportation constraints in route for bringing heavy weight cranes, altitude of observatory, and sharp bends etc. to site. To meet the challenge of telescope installation from inside the telescope building by lifting components through its hatch, two Single Girder cranes and two Under Slung cranes of 10 MT capacity each were specifically designed and developed. All the four overhead cranes were custom built to achieve the goal of handling telescope mirror and its various components during installation and assembly. Overhead cranes were installed in limited available space inside the building and tested as per IS 3177. Cranes were equipped with many features like VVVFD compatibility, provision for tandem operation, digital load display, anti-collision mechanism, electrical interlocks, radio remote, low hook height and compact carriage etc. for telescope integration at site.
Open principle for large high-resolution solar telescopes
Hammerschlag, R.H.; Bettonvil, F.C.M.; Jägers, A.P.L.; Sliepen, G.
2009-01-01
Vacuum solar telescopes solve the problem of image deterioration inside the telescope due to refractive index fluctuations of the air heated by the solar light. However, such telescopes have a practical diameter limit somewhat over 1 m. The Dutch Open Telescope (DOT) was the pioneering demonstrator
Alignment and qualification of the Gaia telescope using a Shack-Hartmann sensor
Dovillaire, G.; Pierot, D.
2017-09-01
Since almost 20 years, Imagine Optic develops, manufactures and offers to its worldwide customers reliable and accurate wavefront sensors and adaptive optics solutions. Long term collaboration between Imagine Optic and Airbus Defence and Space has been initiated on the Herschel program. More recently, a similar technology has been used to align and qualify the GAIA telescope.
GLASS AND SILICON FOILS FOR X-RAY SPACE TELESCOPE MIRRORS
Directory of Open Access Journals (Sweden)
M. MIKA
2011-12-01
Full Text Available Unique observations delivered by space X-ray imaging telescopes have been significantly contributing to important discoveries of current astrophysics. The telescopes’ most crucial part is a high throughput, heavily nested mirror array reflecting X-rays and focusing them to a detector. Future astronomical projects on large X-ray telescopes require novel materials and technologies for the construction of the reflecting mirrors. The future mirrors must be lightweight and precisely shaped to achieve large collecting area with high angular resolution of a few arc sec. The new materials and technologies must be cost-effective as well. Currently, the most promising materials are glass or silicon foils which are commercially produced on a large scale. A thermal forming process was used for the precise shaping of these foils. The forced and free slumping of the foils was studied in the temperature range of hot plastic deformation and the shapes obtained by the different slumping processes were compared. The shapes and the surface quality of the foils were measured by a Taylor Hobson contact profilemeter, a ZYGO interferometer and Atomic Forced Microscopy. In the experiments, both heat-treatment temperature and time were varied following our experiment design. The obtained data and relations can be used for modelling and optimizing the thermal forming procedure.
Analysis of polarization introduced due to the telescope optics of the Thirty Meter Telescope
Anche, Ramya Manjunath; Sen, Asoke Kumar; Anupama, Gadiyara Chakrapani; Sankarasubramanian, Kasiviswanathan; Skidmore, Warren
2018-01-01
An analytical model has been developed to estimate the polarization effects, such as instrumental polarization (IP), crosstalk (CT), and depolarization, due to the optics of the Thirty Meter Telescope. These are estimated for the unvignetted field-of-view and the wavelengths of interest. The model estimates an IP of 1.26% and a CT of 44% at the Nasmyth focus of the telescope at the wavelength of 0.6 μm at field angle zero with the telescope pointing to zenith. Mueller matrices have been estimated for the primary, secondary, and Nasmyth mirrors. It is found that some of the Mueller matrix elements of the primary and secondary mirrors show a fourfold azimuthal antisymmetry, which indicates that the polarization at the Cassegrain focus is negligible. At the inclined Nasmyth mirror, there is no azimuthal antisymmetry in the matrix elements, and this results in nonzero values for IP and CT, which would negatively impact the polarization measurements at the telescope focus. The averaged Mueller matrix is estimated at the Nasmyth focus at different instrument ports and various zenith angles of the telescope. The variation in the Mueller matrix elements for different coatings is also estimated. The impact of this polarization effect on the science case requirements has been discussed. This analysis will help in achieving precise requirements for future instruments with polarimetric capability.
Optical Design of the STAR-X Telescope
Saha, Timo T.; Zhang, William W.; McClelland, Ryan S.
2017-01-01
Top-level science goals of the Survey and Time-domain Astrophysical Research eXplorer (STAR-X) include: investigations of most violent explosions in the universe, study of growth of black holes across cosmic time and mass scale, and measure how structure formation heats majority of baryons in the universe. To meet these goals, the field-of-view of the telescope should be about 1 square-degree, the angular resolution should be 5 arc-seconds or below across large part of the field-of-view. The on-axis effective area at 1 KeV should be about 2,000 sq cm. Payload cost and launch considerations limit the outer diameter, focal length, and mass to 1.3 meters, 5 meters, and 250 kilograms, respectively. Telescope design is based on a segmented meta-shell approach we have developed at Goddard Space Flight Center for the STAR-X telescope. The telescope shells are divided into 30-degree segments. Individual telescopes and meta-shells are nested inside each other to meet the effective area requirements in 0.5 - 6.0 KeV range. We consider Wolter-Schwarzschild, and Modified-Wolter-Schwarzschild telescope designs as basic building blocks of the nested STAR-X telescope. These designs offer an excellent resolution over a large field of views. Nested telescopes are vulnerable to stray light problems. We have designed a multi-component baffle system to eliminate direct and single-reflection light paths inside the telescopes. Large number of internal and external baffle vane structures are required to prevent stray rays from reaching the focal plane. We have developed a simple ray-trace based tool to determine the dimensions and locations of the baffles. In this paper, we present the results of our trade studies, baffle design studies, and optical performance analyses of the STAR-X telescope.
FPGA applications for single dish activity at Medicina radio telescopes
Bartolini, M.; Naldi, G.; Mattana, A.; Maccaferri, A.; De Biaggi, M.
FPGA technologies are gaining major attention in the recent years in the field of radio astronomy. At Medicina radio telescopes, FPGAs have been used in the last ten years for a number of purposes and in this article we will take into exam the applications developed and installed for the Medicina Single Dish 32m Antenna: these range from high performance digital signal processing to instrument control developed on top of smaller FPGAs.
Neutrino telescopes in the World
International Nuclear Information System (INIS)
Ernenwein, J.-P.
2007-01-01
Neutrino astronomy has rapidly developed these last years, being the only way to get specific and reliable information about astrophysical objects still poorly understood.Currently two neutrino telescopes are operational in the World: BAIKAL, in the lake of the same name in Siberia, and AMANDA, in the ices of the South Pole. Two telescopes of the same type are under construction in the Mediterranean Sea: ANTARES and NESTOR. All these telescopes belong to a first generation, with an instrumented volume smaller or equal to 0.02 km3. Also in the Mediterranean Sea, the NEMO project is just in its starting phase, within the framework of a cubic kilometer size neutrino telescope study. Lastly, the ICECUBE detector, with a volume reaching about 1 km3, is under construction on the site of AMANDA experiment, while an extension of the BAIKAL detector toward km3 is under study. We will present here the characteristics of these experiments, as well as the results of their observations
International Nuclear Information System (INIS)
Gomboc, Andreja; Bode, Michael F.; Carter, David; Mundell, Carol G.; Newsam, Andrew; Smith, Robert J.; Steele, Iain A.
2004-01-01
The Liverpool Telescope, situated at Roque de los Muchachos Observatory, La Palma, Canaries, is the first 2-m, fully instrumented robotic telescope. It recently began observations. Among Liverpool Telescope's primary scientific goals is to monitor variable objects on all timescales from seconds to years. An additional benefit of its robotic operation is rapid reaction to unpredictable phenomena and their systematic follow up, simultaneous or coordinated with other facilities. The Target of Opportunity Programme of the Liverpool Telescope includes the prompt search for and observation of GRB and XRF counterparts. A special over-ride mode implemented for GRB/XRF follow-up enables observations commencing less than a minute after the alert, including optical and near infrared imaging and spectroscopy. In particular, the moderate aperture and rapid automated response make the Liverpool Telescope excellently suited to help solving the mystery of optically dark GRBs and for the investigation of currently unstudied short bursts and XRFs
ANTARES: The first undersea neutrino telescope
Ageron, M.; Aguilar, J. A.; Al Samarai, I.; Albert, A.; Ameli, F.; André, M.; Anghinolfi, M.; Anton, G.; Anvar, S.; Ardid, M.; Arnaud, K.; Aslanides, E.; Assis Jesus, A. C.; Astraatmadja, T.; Aubert, J.-J.; Auer, R.; Barbarito, E.; Baret, B.; Basa, S.; Bazzotti, M.; Becherini, Y.; Beltramelli, J.; Bersani, A.; Bertin, V.; Beurthey, S.; Biagi, S.; Bigongiari, C.; Billault, M.; Blaes, R.; Bogazzi, C.; de Botton, N.; Bou-Cabo, M.; Boudahef, B.; Bouwhuis, M. C.; Brown, A. M.; Brunner, J.; Busto, J.; Caillat, L.; Calzas, A.; Camarena, F.; Capone, A.; Caponetto, L.; Cârloganu, C.; Carminati, G.; Carmona, E.; Carr, J.; Carton, P. H.; Cassano, B.; Castorina, E.; Cecchini, S.; Ceres, A.; Chaleil, Th.; Charvis, Ph.; Chauchot, P.; Chiarusi, T.; Circella, M.; Compère, C.; Coniglione, R.; Coppolani, X.; Cosquer, A.; Costantini, H.; Cottini, N.; Coyle, P.; Cuneo, S.; Curtil, C.; D'Amato, C.; Damy, G.; van Dantzig, R.; de Bonis, G.; Decock, G.; Decowski, M. P.; Dekeyser, I.; Delagnes, E.; Desages-Ardellier, F.; Deschamps, A.; Destelle, J.-J.; di Maria, F.; Dinkespiler, B.; Distefano, C.; Dominique, J.-L.; Donzaud, C.; Dornic, D.; Dorosti, Q.; Drogou, J.-F.; Drouhin, D.; Druillole, F.; Durand, D.; Durand, R.; Eberl, T.; Emanuele, U.; Engelen, J. J.; Ernenwein, J.-P.; Escoffier, S.; Falchini, E.; Favard, S.; Fehr, F.; Feinstein, F.; Ferri, M.; Ferry, S.; Fiorello, C.; Flaminio, V.; Folger, F.; Fritsch, U.; Fuda, J.-L.; Galatá, S.; Galeotti, S.; Gay, P.; Gensolen, F.; Giacomelli, G.; Gojak, C.; Gómez-González, J. P.; Goret, Ph.; Graf, K.; Guillard, G.; Halladjian, G.; Hallewell, G.; van Haren, H.; Hartmann, B.; Heijboer, A. J.; Heine, E.; Hello, Y.; Henry, S.; Hernández-Rey, J. J.; Herold, B.; Hößl, J.; Hogenbirk, J.; Hsu, C. C.; Hubbard, J. R.; Jaquet, M.; Jaspers, M.; de Jong, M.; Jourde, D.; Kadler, M.; Kalantar-Nayestanaki, N.; Kalekin, O.; Kappes, A.; Karg, T.; Karkar, S.; Karolak, M.; Katz, U.; Keller, P.; Kestener, P.; Kok, E.; Kok, H.; Kooijman, P.; Kopper, C.; Kouchner, A.; Kretschmer, W.; Kruijer, A.; Kuch, S.; Kulikovskiy, V.; Lachartre, D.; Lafoux, H.; Lagier, P.; Lahmann, R.; Lahonde-Hamdoun, C.; Lamare, P.; Lambard, G.; Languillat, J.-C.; Larosa, G.; Lavalle, J.; Le Guen, Y.; Le Provost, H.; Levansuu, A.; Lefèvre, D.; Legou, T.; Lelaizant, G.; Lévéque, C.; Lim, G.; Lo Presti, D.; Loehner, H.; Loucatos, S.; Louis, F.; Lucarelli, F.; Lyashuk, V.; Magnier, P.; Mangano, S.; Marcel, A.; Marcelin, M.; Margiotta, A.; Martinez-Mora, J. A.; Masullo, R.; Mazéas, F.; Mazure, A.; Meli, A.; Melissas, M.; Migneco, E.; Mongelli, M.; Montaruli, T.; Morganti, M.; Moscoso, L.; Motz, H.; Musumeci, M.; Naumann, C.; Naumann-Godo, M.; Neff, M.; Niess, V.; Nooren, G. J. L.; Oberski, J. E. J.; Olivetto, C.; Palanque-Delabrouille, N.; Palioselitis, D.; Papaleo, R.; Păvălaş, G. E.; Payet, K.; Payre, P.; Peek, H.; Petrovic, J.; Piattelli, P.; Picot-Clemente, N.; Picq, C.; Piret, Y.; Poinsignon, J.; Popa, V.; Pradier, T.; Presani, E.; Prono, G.; Racca, C.; Raia, G.; van Randwijk, J.; Real, D.; Reed, C.; Réthoré, F.; Rewiersma, P.; Riccobene, G.; Richardt, C.; Richter, R.; Ricol, J. S.; Rigaud, V.; Roca, V.; Roensch, K.; Rolin, J.-F.; Rostovtsev, A.; Rottura, A.; Roux, J.; Rujoiu, M.; Ruppi, M.; Russo, G. V.; Salesa, F.; Salomon, K.; Sapienza, P.; Schmitt, F.; Schöck, F.; Schuller, J.-P.; Schüssler, F.; Sciliberto, D.; Shanidze, R.; Shirokov, E.; Simeone, F.; Sottoriva, A.; Spies, A.; Spona, T.; Spurio, M.; Steijger, J. J. M.; Stolarczyk, Th.; Streeb, K.; Sulak, L.; Taiuti, M.; Tamburini, C.; Tao, C.; Tasca, L.; Terreni, G.; Tezier, D.; Toscano, S.; Urbano, F.; Valdy, P.; Vallage, B.; van Elewyck, V.; Vannoni, G.; Vecchi, M.; Venekamp, G.; Verlaat, B.; Vernin, P.; Virique, E.; de Vries, G.; van Wijk, R.; Wijnker, G.; Wobbe, G.; de Wolf, E.; Yakovenko, Y.; Yepes, H.; Zaborov, D.; Zaccone, H.; Zornoza, J. D.; Zúñiga, J.
2011-11-01
The ANTARES Neutrino Telescope was completed in May 2008 and is the first operational Neutrino Telescope in the Mediterranean Sea. The main purpose of the detector is to perform neutrino astronomy and the apparatus also offers facilities for marine and Earth sciences. This paper describes the design, the construction and the installation of the telescope in the deep sea, offshore from Toulon in France. An illustration of the detector performance is given.
ANTARES: The first undersea neutrino telescope
International Nuclear Information System (INIS)
Ageron, M.; Aguilar, J.A.; Al Samarai, I.; Albert, A.; Ameli, F.; Andre, M.; Anghinolfi, M.; Anton, G.; Anvar, S.; Ardid, M.; Arnaud, K.; Aslanides, E.; Assis Jesus, A.C.; Astraatmadja, T.; Aubert, J.-J.; Auer, R.; Barbarito, E.; Baret, B.
2011-01-01
The ANTARES Neutrino Telescope was completed in May 2008 and is the first operational Neutrino Telescope in the Mediterranean Sea. The main purpose of the detector is to perform neutrino astronomy and the apparatus also offers facilities for marine and Earth sciences. This paper describes the design, the construction and the installation of the telescope in the deep sea, offshore from Toulon in France. An illustration of the detector performance is given.
NASA Telescopes Help Identify Most Distant Galaxy Cluster
2011-01-01
WASHINGTON -- Astronomers have uncovered a burgeoning galactic metropolis, the most distant known in the early universe. This ancient collection of galaxies presumably grew into a modern galaxy cluster similar to the massive ones seen today. The developing cluster, named COSMOS-AzTEC3, was discovered and characterized by multi-wavelength telescopes, including NASA's Spitzer, Chandra and Hubble space telescopes, and the ground-based W.M. Keck Observatory and Japan's Subaru Telescope. "This exciting discovery showcases the exceptional science made possible through collaboration among NASA projects and our international partners," said Jon Morse, NASA's Astrophysics Division director at NASA Headquarters in Washington. Scientists refer to this growing lump of galaxies as a proto-cluster. COSMOS-AzTEC3 is the most distant massive proto-cluster known, and also one of the youngest, because it is being seen when the universe itself was young. The cluster is roughly 12.6 billion light-years away from Earth. Our universe is estimated to be 13.7 billion years old. Previously, more mature versions of these clusters had been spotted at 10 billion light-years away. The astronomers also found that this cluster is buzzing with extreme bursts of star formation and one enormous feeding black hole. "We think the starbursts and black holes are the seeds of the cluster," said Peter Capak of NASA's Spitzer Science Center at the California Institute of Technology in Pasadena. "These seeds will eventually grow into a giant, central galaxy that will dominate the cluster -- a trait found in modern-day galaxy clusters." Capak is first author of a paper appearing in the Jan. 13 issue of the journal Nature. Most galaxies in our universe are bound together into clusters that dot the cosmic landscape like urban sprawls, usually centered around one old, monstrous galaxy containing a massive black hole. Astronomers thought that primitive versions of these clusters, still forming and clumping
The Dutch Open Telescope: History, Status, Prospects
Rutten, R.J.
1999-01-01
After many years of persistent telescope design and telescope construction, R.H. Hammerschlag has installed his Dutch Open Telescope (DOT) on La Palma. I brie y review its history and design. The future of optical solar physics at Utrecht hinges on a recently-funded three- year DOT science
LSST telescope and site status
Gressler, William J.
2016-07-01
The Large Synoptic Survey Telescope (LSST) Project1 received its construction authorization from the National Science Foundation in August 2014. The Telescope and Site (T and S) group has made considerable progress towards completion in subsystems required to support the scope of the LSST science mission. The LSST goal is to conduct a wide, fast, deep survey via a 3-mirror wide field of view optical design, a 3.2-Gpixel camera, and an automated data processing system. The summit facility is currently under construction on Cerro Pachón in Chile, with major vendor subsystem deliveries and integration planned over the next several years. This paper summarizes the status of the activities of the T and S group, tasked with design, analysis, and construction of the summit and base facilities and infrastructure necessary to control the survey, capture the light, and calibrate the data. All major telescope work package procurements have been awarded to vendors and are in varying stages of design and fabrication maturity and completion. The unique M1M3 primary/tertiary mirror polishing effort is completed and the mirror now resides in storage waiting future testing. Significant progress has been achieved on all the major telescope subsystems including the summit facility, telescope mount assembly, dome, hexapod and rotator systems, coating plant, base facility, and the calibration telescope. In parallel, in-house efforts including the software needed to control the observatory such as the scheduler and the active optics control, have also seen substantial advancement. The progress and status of these subsystems and future LSST plans during this construction phase are presented.
Automatic Photoelectric Telescope Service
International Nuclear Information System (INIS)
Genet, R.M.; Boyd, L.J.; Kissell, K.E.; Crawford, D.L.; Hall, D.S.; BDM Corp., McLean, VA; Kitt Peak National Observatory, Tucson, AZ; Dyer Observatory, Nashville, TN)
1987-01-01
Automatic observatories have the potential of gathering sizable amounts of high-quality astronomical data at low cost. The Automatic Photoelectric Telescope Service (APT Service) has realized this potential and is routinely making photometric observations of a large number of variable stars. However, without observers to provide on-site monitoring, it was necessary to incorporate special quality checks into the operation of the APT Service at its multiple automatic telescope installation on Mount Hopkins. 18 references
DEFF Research Database (Denmark)
Gorenstein, P.; Worrall, D.; Joensen, K.D.
1996-01-01
The Hard X-Ray Telescope was selected for study as a possible new intermediate size mission for the early 21st century. Its principal attributes are: (1) multiwavelength observing with a system of focussing telescopes that collectively observe from the UV to over 1 MeV, (2) much higher sensitivity...
21 CFR 886.5870 - Low-vision telescope.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Low-vision telescope. 886.5870 Section 886.5870...) MEDICAL DEVICES OPHTHALMIC DEVICES Therapeutic Devices § 886.5870 Low-vision telescope. (a) Identification. A low-vision telescope is a device that consists of an arrangement of lenses or mirrors intended for...
Initial Technology Assessment for the Large UV-Optical-Infrared (LUVOIR) Mission Concept Study
Bolcar, Matthew R.; Feinberg, Lee D.; France, Kevin; Rauscher, Bernard J.; Redding, David; Schiminovich, David
2016-01-01
The NASA Astrophysics Divisions 30-Year Roadmap prioritized a future large-aperture space telescope operating in the ultra-violet-optical-infrared wavelength regime. The Association of Universities for Research in Astronomy envisioned a similar observatory, the High Definition Space Telescope. And a multi-institution group also studied the Advanced Technology Large Aperture Space Telescope. In all three cases, a broad science case is outlined, combining general astrophysics with the search for bio-signatures via direct-imaging and spectroscopic characterization of habitable exo-planets. We present an initial technology assessment that enables such an observatory that is currently being studied for the 2020 Decadal Survey by the Large UV-Optical Infrared (LUVOIR) surveyor Science and Technology Definition Team. We present here the technology prioritization for the 2016 technology cycle and define the required technology capabilities and current state-of-the-art performance. Current, planned, and recommended technology development efforts are also reported.
Origins Space Telescope: Tracing Dark Molecular Gas in the Milky Way
Narayanan, Desika; Li, Qi; Krumholz, Mark; Dave, Romeel; Origins Space Telescope Science and Technology Definition Team
2018-01-01
We present theoretical models for quantifying the fraction of CO-dark molecular gas in galaxies. To do this, we combine novel thermal, chemical, and radiative equilibrium calculations with high-resolution cosmological zoom galaxy formation models. We discuss how this dark molecular gas will be uncovered by the Origins Space Telescope, one of the four science and technology definition studies of NASA Headquarters for the 2020 Astronomy and Astrophysics Decadal survey.
High energy neutrino astronomy and its telescopes
International Nuclear Information System (INIS)
Halzen, F.
1995-01-01
Doing astronomy with photons of energies in excess of a GeV has turned out to be extremely challenging. Efforts are underway to develop instruments that may push astronomy to wavelengths smaller than 10 -14 cm by mapping the sky using high energy neutrinos instead. Neutrino astronomy, born with the identification of thermonuclear fusion in the sun and the particle processes controlling the fate of a nearby supernova, will reach outside the galaxy and make measurements relevant to cosmology. The field is immersed in technology in the domains of particle physics to which many of its research goals are intellectually connected. To mind come the search for neutrino mass, cold dark matter (supersymmetric particles?) and the monopoles of the Standard Model. While a variety of collaborations are pioneering complementary methods by building telescopes with effective area in excess of 0.01 km 2 , we show here that the natural scale of a high energy neutrino telescope is 1 km 2 . With several thousand optical modules and a price tag unlikely to exceed 100 million dollars, the scope of a kilometer-scale instrument is similar to that of experiments presently being commissioned such as the SNO neutrino observatory in Canada and the Superkamiokande experiment in Japan
Using Internet-Based Robotic Telescopes to Engage Non-Science Majors in Astronomical Observation
Berryhill, K. J.; Coble, K.; Slater, T. F.; McLin, K. M.; Cominsky, L. R.
2013-12-01
Responding to national science education reform documents calling for students to have more opportunities for authentic research experiences, several national projects have developed online telescope networks to provide students with Internet-access to research grade telescopes. The nature of astronomical observation (e.g., remote sites, expensive equipment, and odd hours) has been a barrier in the past. Internet-based robotic telescopes allow scientists to conduct observing sessions on research-grade telescopes half a world away. The same technology can now be harnessed by STEM educators to engage students and reinforce what is being taught in the classroom, as seen in some early research in elementary schools (McKinnon and Mainwaring 2000 and McKinnon and Geissinger 2002), middle/high schools (Sadler et al. 2001, 2007 and Gehret et al. 2005) and undergraduate programs (e.g., McLin et al. 2009). This project looks at the educational value of using Internet-based robotic telescopes in a general education introductory astronomy course at the undergraduate level. Students at a minority-serving institution in the midwestern United States conducted observational programs using the Global Telescope Network (GTN). The project consisted of the use of planetarium software to determine object visibility, observing proposals (with abstract, background, goals, and dissemination sections), peer review (including written reviews and panel discussion according to NSF intellectual merit and broader impacts criteria), and classroom presentations showing the results of the observation. The GTN is a network of small telescopes funded by the Fermi mission to support the science of high energy astrophysics. It is managed by the NASA E/PO Group at Sonoma State University and is controlled using SkyNet. Data includes course artifacts (proposals, reviews, panel summaries, presentations, and student reflections) for six semesters plus student interviews. Using a grounded theory approach
Scientific management of Space Telescope
Odell, C. R.
1981-01-01
A historical summay is given on the science management of the Space Telescope, the inception of which began in 1962, when scientists and engineers first recommended the development of a nearly diffraction limited substantial-size optical telescope. Phase A, the feasibility requirements generation phase, began in 1971 and consisted largely of NASA scientists and a NASA design. Phase B, the preliminary design phase, established a tiered structure of scientists, led by the Large Space Telescope operations and Management Work Group. A Mission Operations Working Group headed six instrument definition teams to develop the essential instrument definitions. Many changes took place during Phase B, before design and development, which began in 1978 and still continues today.
Advanced optical instruments technology
Shao, Mike; Chrisp, Michael; Cheng, Li-Jen; Eng, Sverre; Glavich, Thomas; Goad, Larry; Jones, Bill; Kaarat, Philip; Nein, Max; Robinson, William
1992-08-01
The science objectives for proposed NASA missions for the next decades push the state of the art in sensitivity and spatial resolution over a wide range of wavelengths, including the x-ray to the submillimeter. While some of the proposed missions are larger and more sensitive versions of familiar concepts, such as the next generation space telescope, others use concepts, common on the Earth, but new to space, such as optical interferometry, in order to provide spatial resolutions impossible with other concepts. However, despite their architecture, the performance of all of the proposed missions depends critically on the back-end instruments that process the collected energy to produce scientifically interesting outputs. The Advanced Optical Instruments Technology panel was chartered with defining technology development plans that would best improve optical instrument performance for future astrophysics missions. At this workshop the optical instrument was defined as the set of optical components that reimage the light from the telescope onto the detectors to provide information about the spatial, spectral, and polarization properties of the light. This definition was used to distinguish the optical instrument technology issues from those associated with the telescope, which were covered by a separate panel. The panel identified several areas for optical component technology development: diffraction gratings; tunable filters; interferometric beam combiners; optical materials; and fiber optics. The panel also determined that stray light suppression instruments, such as coronagraphs and nulling interferometers, were in need of general development to support future astrophysics needs.
Remote secure observing for the Faulkes Telescopes
Smith, Robert J.; Steele, Iain A.; Marchant, Jonathan M.; Fraser, Stephen N.; Mucke-Herzberg, Dorothea
2004-09-01
Since the Faulkes Telescopes are to be used by a wide variety of audiences, both powerful engineering level and simple graphical interfaces exist giving complete remote and robotic control of the telescope over the internet. Security is extremely important to protect the health of both humans and equipment. Data integrity must also be carefully guarded for images being delivered directly into the classroom. The adopted network architecture is described along with the variety of security and intrusion detection software. We use a combination of SSL, proxies, IPSec, and both Linux iptables and Cisco IOS firewalls to ensure only authenticated and safe commands are sent to the telescopes. With an eye to a possible future global network of robotic telescopes, the system implemented is capable of scaling linearly to any moderate (of order ten) number of telescopes.
A 4-m evolvable space telescope configured for NASA's HabEx Mission: the initial stage of LUVOIR
Lillie, Charles F.; MacEwen, Howard A.; Polidan, Ronald S.; Breckinridge, James B.
2017-09-01
Previous papers have described our concept for a large telescope that would be assembled in space in several stages (in different configurations) over a period of fifteen to 20 years. Spreading the telescope development, launch and operations cost over 20 years would minimize the impact on NASA's annual budget and drastically shorten the time between program start and "first light" for this space observatory. The first Stage of this Evolvable Space Telescope (EST) would consist of an instrument module located at the prime focus of three 4-meter hexagonal mirrors arranged in a semi-circle to form one-half of a 12-m segmented mirror. After several years three additional 4-m mirrors would be added to create a 12-m filled aperture. Later, twelve more 4-m mirrors will be added to this Stage 2 telescope to create a 20-m filled aperture space telescope. At each stage the telescope would have an unparalleled capability for UVOIR observations, and the results of these observations will guide the evolution of the telescope and its instruments. In this paper we describe our design concept for an initial configuration of our Evolvable Space Telescope that can meet the requirements of the 4-m version of the HabEx spacecraft currently under consideration by NASA's Habitable Exoplanet Science and Technology Definition Team. This "Stage Zero" configuration will have only one 4-m mirror segment with the same 30-m focal length and a prime focus coronagraph with normal incidence optics to minimize polarization effects. After assembly and checkout in cis-lunar space, the telescope would transfer to a Sun-Earth L2 halo orbit and obtain high sensitivity, high resolution, high contrast UVOIR observations that address the scientific objectives of the Habitable-Exoplanet Imaging Missions.
Single particle detecting telescope system
International Nuclear Information System (INIS)
Yamamoto, I.; Tomiyama, T.; Iga, Y.; Komatsubara, T.; Kanada, M.; Yamashita, Y.; Wada, T.; Furukawa, S.
1981-01-01
We constructed the single particle detecting telescope system for detecting a fractionally charged particle. The telescope consists of position detecting counters, wall-less multi-cell chambers, single detecting circuits and microcomputer system as data I/0 processor. Especially, a frequency of double particle is compared the case of the single particle detecting with the case of an ordinary measurement
Building the Hubble Space Telescope
International Nuclear Information System (INIS)
O'dell, C.R.
1989-01-01
The development of the design for the Hubble Space Telescope (HST) is discussed. The HST optical system is described and illustrated. The financial and policy issues related to the development of the HST are considered. The actual construction of the HST optical telescope is examined. Also, consideration is given to the plans for the HST launch
Im, Myungshin; Choi, Changsu; Kim, Kihyun
2015-08-01
We introduce the Lee Sang Gak Telescope (LSGT), a remotely operated, robotic 0.43-meter telescope. The telescope was installed at the Siding Spring Observatory, Australia, in 2014 October, to secure regular and exclusive access to the dark sky and excellent atmospheric conditions in the southern hemisphere from the Seoul National University (SNU) campus. Here, we describe the LSGT system and its performance, present example images from early observations, and discuss a future plan to upgrade the system. The use of the telescope includes (i) long-term monitoring observations of nearby galaxies, active galactic nuclei, and supernovae; (ii) rapid follow-up observations of transients such as gamma-ray bursts and gravitational wave sources; and (iii) observations for educational activities at SNU. Based on observations performed so far, we find that the telescope is capable of providing images to a depth of R=21.5 mag (point source detection) at 5-σ with 15 min total integration time under good obs-erving conditions.
Advanced Source Deconvolution Methods for Compton Telescopes
Zoglauer, Andreas
list-mode approach to get the best angular resolution, to get achieve both at the same time! The second open question concerns the best deconvolution algorithm. For example, several algorithms have been investigated for the famous COMPTEL 26Al map which resulted in significantly different images. There is no clear answer as to which approach provides the most accurate result, largely due to the fact that detailed simulations to test and verify the approaches and their limitations were not possible at that time. This has changed, and therefore we propose to evaluate several deconvolution algorithms (e.g. Richardson-Lucy, Maximum-Entropy, MREM, and stochastic origin ensembles) with simulations of typical observations to find the best algorithm for each application and for each stage of the hybrid reconstruction approach. We will adapt, implement, and fully evaluate the hybrid source reconstruction approach as well as the various deconvolution algorithms with simulations of synthetic benchmarks and simulations of key science objectives such as diffuse nuclear line science and continuum science of point sources, as well as with calibrations/observations of the COSI balloon telescope. This proposal for "development of new data analysis methods for future satellite missions" will significantly improve the source deconvolution techniques for modern Compton telescopes and will allow unlocking the full potential of envisioned satellite missions using Compton-scatter technology in astrophysics, heliophysics and planetary sciences, and ultimately help them to "discover how the universe works" and to better "understand the sun". Ultimately it will also benefit ground based applications such as nuclear medicine and environmental monitoring as all developed algorithms will be made publicly available within the open-source Compton telescope analysis framework MEGAlib.
Directory of Open Access Journals (Sweden)
Yusuf
2015-06-01
Full Text Available Nusa Tenggara Timur (NTT province identically with the dry land that had the potential of local food diversity both of tubers, cereal and fruits groups. Food processing based on local food, especially the tubers are still very limited in NTT. The objectives of this studi are (1 to determine the physico chemical characteristics of modified cassava flour (mocaf, sweet potato flour and corn flour, (2 to determine the financial feasibility of mocaf, sweet potato flour and corn flour in Timor Tengah Selatan regency, NTT. Introduction approach of processing through the understanding and skills of processing of mocaf, sweet potato flour and corn flour in two women farmers groups (KWT, namely KWT Suka Maju Ajaobaki Village Mollo Utara District and KWT Hetven Kesetnana village Mollo Selatan District, Timor Tengah Selatan regency. Introductions of processing technology has been done after optimization of the processing in the Laboratory of BPTP NTT. The results showed that the local food such as cassava, sweet potato and corn can be processed into flour so can increase the added value and increase the competitiveness of local food. Local food flour can be used as a wheat flour substitute in food processing. Flouring effort of mocaf, sweet potatoes and corn had been managed efficiently indicated by revenue cost ratio (RCR value is more than 1.00.
Harnessing solar pressure to slew and point large infrared space telescopes
Errico, Simona; Angel, Roger P.; Calvert, Paul D.; Woof, Neville
2003-03-01
Large astronomical Gossamer telescopes in space will need to employ large solar shields to safeguard the optics from solar radiation. These types of telescopes demand accurate controls to maintain telescope pointing over long integration periods. We propose an active solar shield system that harnesses radiation pressure to accurately slew and acquire new targets without the need for reaction wheels or thrusters. To provide the required torques, the solar shield is configured as an inverted, 4-sided pyramidal roof. The sloped roof interior surfaces are covered with hinged “tiles” made from piezoelectric film bimorphs with specular metallized surfaces. Nominally, the tiles lie flat against the roof and the sunlight is reflected outward equally from all sloped surfaces. However, when the tiles on one roof pitch are raised, the pressure balance is upset and the sunshade is pushed to one side. By judicious selection of the tiles and control of their lift angle, the solar pressure can be harvested to stabilize the spacecraft orientation or to change its angular momentum. A first order conceptual design performance analysis and the results from the experimental design, fabrication and testing of piezoelectric bimorph hinge elements will be presented. Next phase challenges in engineering design, materials technology, and systems testing will be discussed.
Carbon Fiber Mirror for a CubeSat Telescope
Kim, Young-Soo; Jang, Jeong Gyun; Kim, Jihun; Nam, Uk Won
2017-08-01
Telescope mirrors made by carbon fibers have been increasingly used especially for space applications, and they may replace the traditional glass mirrors. Glass mirrors are easy to fabricate, but needed to be carefully handled as they are brittle. Other materials have also been considered for telescope mirrors, such as metals, plastics, and liquids even. However glass and glass ceramics are still commonly and dominantly used.Carbon fiber has mainly been used for mechanical supports like truss structure and telescope tubes, as it is stiff and light-weight. It can also be a good material for telescope mirrors, as it has additional merits of non-brittle and very low thermal expansion. Therefore, carbon fiber mirror would be suitable for space telescopes which should endure the harsh vibration conditions during launch.A light-weight telescope made by carbon fiber has been designed for a small satellite which would have much less weight than conventional ones. In this poster, mirror materials are reviewed, and a design of carbon fiber telescope is presented and discussed.
A free market in telescope time?
Etherton, Jason; Steele, Iain A.; Mottram, Christopher J.
2004-09-01
As distributed systems are becoming more and more diverse in application there is a growing need for more intelligent resource scheduling. eSTAR Is a geographically distributed network of Grid-enabled telescopes, using grid middleware to provide telescope users with an authentication and authorisation method, allowing secure, remote access to such resources. The eSTAR paradigm is based upon this secure, single sign-on, giving astronomers or their agent proxies direct access to these telescopes. This concept, however, involves the complex issue of how to schedule observations stored within physically distributed media, on geographically distributed resources. This matter is complicated further by the varying degrees of constraints placed upon observations such as timeliness, atmospheric and meteorological conditions, and sky brightness to name a few. This paper discusses a free market approach to this scheduling problem, where astronomers are given credit, instead of time, from their respective TAGs to spend on telescopes as they see fit. This approach will ultimately provide a community-driven schedule, genuine indicators of the worth of specific telescope time and promote a more efficient use of that time, as well as demonstrating a 'survival of the fittest' type selection.
VLTI First Fringes with Two Auxiliary Telescopes at Paranal
2005-03-01
ESO Video Newsreel 15, released on March 14, 2005. It provides an introduction to the VLT Interferometer (VLTI) and the two Auxiliary Telescopes (ATs) now installed at Paranal. ESO PR Photo 07a/05 shows the impressive ensemble at the summit of Paranal. From left to right, the enclosure of VLT Antu, Kueyen and Melipal, AT1, the VLT Survey Telescope (VST) in the background, AT2 and VLT Yepun. Located at the summit of the 2,600-m high Cerro Paranal in the Atacama Desert (Chile), ESO's Very Large Telescope (VLT) is at the forefront of astronomical technology and is one of the premier facilities in the world for optical and near-infrared observations. The VLT is composed of four 8.2-m Unit Telescope (Antu, Kueyen, Melipal and Yepun). They have been progressively put into service together with a vast suite of the most advanced astronomical instruments and are operated every night in the year. Contrary to other large astronomical telescopes, the VLT was designed from the beginning with the use of interferometry as a major goal. The href="/instruments/vlti">VLT Interferometer (VLTI) combines starlight captured by two 8.2- VLT Unit Telescopes, dramatically increasing the spatial resolution and showing fine details of a large variety of celestial objects. The VLTI is arguably the world's most advanced optical device of this type. It has already demonstrated its powerful capabilities by addressing several key scientific issues, such as determining the size and the shape of a variety of stars (ESO PR 22/02, PR 14/03 and PR 31/03), measuring distances to stars (ESO PR 25/04), probing the innermost regions of the proto-planetary discs around young stars (ESO PR 27/04) or making the first detection by infrared interferometry of an extragalactic object (ESO PR 17/03). "Little Brothers" ESO PR Photo 07b/05 ESO PR Photo 07b/05 [Preview - JPEG: 597 x 400 pix - 47k] [Normal - JPEG: 1193 x 800 pix - 330k] [HiRes - JPEG: 5000 x 3354 pix - 10.0M] ESO PR Photo 07c/05 ESO PR Photo 07c/05
Bolcar, Matthew R.; Feinberg, Lee; France, Kevin; Rauscher, Bernard J.; Redding, David; Schiminovich, David
2016-01-01
The NASA Astrophysics Division's 30-Year Roadmap prioritized a future large-aperture space telescope operating in the ultra-violet/optical/infrared wavelength regime. The Association of Universities for Research in Astronomy envisioned a similar observatory, the High Definition Space Telescope. And a multi-institution group also studied the Advanced Technology Large Aperture Space Telescope. In all three cases, a broad science case is outlined, combining general astrophysics with the search for biosignatures via direct-imaging and spectroscopic characterization of habitable exoplanets. We present an initial technology assessment that enables such an observatory that is currently being studied for the 2020 Decadal Survey by the Large UV/Optical/Infrared (LUVOIR) surveyor Science and Technology Definition Team. We present here the technology prioritization for the 2016 technology cycle and define the required technology capabilities and current state-of-the-art performance. Current, planned, and recommended technology development efforts are also reported.
Brown, Anthony M.
2018-01-01
Recent advances in unmanned aerial vehicle (UAV) technology have made UAVs an attractive possibility as an airborne calibration platform for astronomical facilities. This is especially true for arrays of telescopes spread over a large area such as the Cherenkov Telescope Array (CTA). In this paper, the feasibility of using UAVs to calibrate CTA is investigated. Assuming a UAV at 1km altitude above CTA, operating on astronomically clear nights with stratified, low atmospheric dust content, appropriate thermal protection for the calibration light source and an onboard photodiode to monitor its absolute light intensity, inter-calibration of CTA's telescopes of the same size class is found to be achievable with a 6 - 8 % uncertainty. For cross-calibration of different telescope size classes, a systematic uncertainty of 8 - 10 % is found to be achievable. Importantly, equipping the UAV with a multi-wavelength calibration light source affords us the ability to monitor the wavelength-dependent degradation of CTA telescopes' optical system, allowing us to not only maintain this 6 - 10 % uncertainty after the first few years of telescope deployment, but also to accurately account for the effect of multi-wavelength degradation on the cross-calibration of CTA by other techniques, namely with images of air showers and local muons. A UAV-based system thus provides CTA with several independent and complementary methods of cross-calibrating the optical throughput of individual telescopes. Furthermore, housing environmental sensors on the UAV system allows us to not only minimise the systematic uncertainty associated with the atmospheric transmission of the calibration signal, it also allows us to map the dust content above CTA as well as monitor the temperature, humidity and pressure profiles of the first kilometre of atmosphere above CTA with each UAV flight.
Pepin, M Barlow
2005-01-01
Commercially-made astronomical telescopes are better and less expensive than ever before, and their optical and mechanical performance can be superb. When a good-quality telescope fails to perform as well as it might, the reason is quite probably that it needs a little care and attention! Here is a complete guide for anyone who wants to understand more than just the basics of astronomical telescopes and accessories, and how to maintain them in the peak of condition. The latest on safely adjusting, cleaning, and maintaining your equipment is combined with thoroughly updated methods from the old masters. Here, too, are details of choosing new and used optics and accessories, along with enhancements you can make to extend their versatility and useful lifetime. This book is for you. Really. Looking after an astronomical telescope isn't only for the experts - although there are some things that only an expert should attempt - and every serious amateur astronomer will find invaluable information here, gleaned from ...
Origins Space Telescope: Breaking the Confusion Limit
Wright, Edward L.; Origins Space Telescope Science and Technology Definition Team
2018-01-01
The Origins Space Telescope (OST) is the mission concept for the Far-Infrared Surveyor, one of the four science and technology definition studies of NASA Headquarters for the 2020 Astronomy and Astrophysics Decadal survey. Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s.OST will have a background-limited sensitivity for a background 27,000 times lower than the Herschel background caused by thermal emission from Herschel's warm telescope. For continuum observations the confusion limit in a diffraction-limited survey can be reached in very short integration times at longer far-infrared wavelengths. But the confusion limit can be pierced for both the nearest and the farthest objects to be observed by OST. For outer the Solar System the targets' motion across the sky will provide a clear signature in surveys repeated after an interval of days to months. This will provide a size-frequency distribution of TNOs that is not biased toward high albedo objects.For the distant Universe the first galaxies and the first metals will provide a third dimension of spectral information that can be measured with a long-slit, medium resolution spectrograph. This will allow 3Dmapping to measure source densities as a function of redshift. The continuum shape associated with sourcesat different redshifts can be derived from correlation analyses of these 3D maps.Fairly large sky areas can be scanned by moving the spacecraft at a constant angular rate perpendicular to the orientation of the long slit of the spectrograph, avoiding the high overhead of step-and-stare surveying with a large space observatory.We welcome you to contact the Science and Technology Definition Team (STDT) with your science needs and ideas by emailing us at ost_info@lists.ipac.caltech.edu
GRANITE- A steroscopic imaging Chernkov telescope system
International Nuclear Information System (INIS)
Shubnell, M.; Akerlof, C.W.; Cawley, M.F.; Chantell, M.; Fegan, D.J.; Fennell, S.; O'Flaherty, K.S.; Freeman, S.; Frishman, D.; Gaidos, J.A.; Hagan, J.; Harris, K.; Hillas, A.M.; Kerrick, A.D.; Lamb, R.C.; Lappin, T.; Lawrence, M.A.; Levy, H.; Lewis, D.A.; Meyer, D.I.; Mohanty, G.; Punch, M.; Reynolds, P.T.; Rovero, A.C.; Sembroski, G.; Weaverdyck, C.; Weekes, T.C.; Whitaker, T.; Wilson, C.
1993-01-01
A second 10 meter class imaging telescope was constructed on Mt. Hopkins, Arizona, the site of the original 10 meter Whipple Cherenkov telescope. The twin telescope system with a 140 meter base line will allow both a reduction in the energy threshold and an improvement in the rejection of the hardonic background. The new telescope started operation in December 1991. With the final completion of the first installation stage (GRANITE I) during spring 92, it is now operating simultaneously with the orginal reflector. We describe in this paper design and construction of the new instrument and demonstrate the capability of the experiment to record coincident events
Overdenture dengan Pegangan Telescopic Crown
Directory of Open Access Journals (Sweden)
Pambudi Santoso
2014-06-01
Full Text Available Kaitan presisi merupakan alat retensi mekanis yang menghubungkan antara satu atau lebih pegangan gigi tiruan, yang bertujuan untuk menambah retensi dan/atau stabilisasi. Kaitan presisi dapat digunakan secara luas pada gigi tiruan cekat, gigi tiruan sebagian lepasan, overdenture, implant untuk retensi overdenture, dan protesa maksilo fasial. Overdenture dengan kaitan presisi dapat membantu dalam pembagian beban kunyah, meminimalkan trauma pada gigi pegangan dan jaringan lunak, meminimalkan resorbsi tulang, dan meningkatkan estetik dan pengucapan suara. Salah satu jenis dari kaitan presisi adalah telescopic crown, terdiri dari 2 macam mahkota, yaitu mahkota primer yang melekat secara permanen pada gigi penyangga, dan mahkota sekunder yang melekat pada gigi tiruan. Tujuan pemaparan kasus ini adalah untuk memberikan informasi tentang rehabilitasi pasien edentulous sebagian rahang atas dengan telescopic crown.. Pasien wanita berusia 45 tahun datang ke klinik prostodonsia RSGM Prof.Soedomo dengan keluhan ingin dibuatkan gigi tiruan. Pasien kehilangan gigi 11 12 15 16 17 21 22 24 25 26 dan 27 yang diindikasikan untuk pembuatan overdenture gigi tiruan sebagian lepasan (GTS kerangka logam dengan pegangan telescopic crown pada gigi 13 dan 14 dengan sistem parallel-sided crown. Tahap-tahap pembuatan telescopic crown yaitu mencetak model study dengan catatan gigit pendahuluan. Perawatan saluran dilakukan pada akar gigi 13, dilanjutkan pemasangan pasak fiber serta rewalling dinding bukal. Gigi 13 dan 14 dilakukan preparasi mahkota penuh, dilanjutkan dengan pencetakan model kerja untuk coping primer dan kerangka logam dengan metode double impression. Coping primer disementasi pada gigi penyangga, dilanjutkan pasang coba coping sekunder beserta kerangka logam. Selanjutnya dilakukan pencatatan gigit, pencetakan model kerja, penyusunan gigi dan pasang coba penyusunan gigi pada pasien. Prosedur dilanjutkan dengan proses di laboratorium, serta insersi pada
Buratti, Bonnie J.; Meinke, Bonnie K.; Schmude, Richard W.
2017-10-01
Based on an activity that DPS member Richard Schmude Jr. has been doing for years, with over 5000 children reached, DPS initiated in 2016 a pilot program entitled “Trick-or-Treat and Telescopes.” DPS encouraged its members to put out their telescopes during trick-or-treat time on Halloween, in their own lawns or in a neighbor’s lawn with better viewing (or more traffic). The program will be continued in 2017. This year should offer good viewing with a waxing gibbous moon and Saturn visible. The program was also advertised though the Night Sky Network, a consortium of astronomy clubs. The following website gives advice and connections to resources.https://dps.aas.org/education/trick-or-treat-and-telescopes acknowledged.
Assembly of NASA's Most Powerful X-Ray Telescope Completed
1998-03-01
holes, many of which are invisible to us now. We may even see the processes that create the elements found here on Earth." Assembly of the observatory began in 1997 with the arrival of the high resolution mirror assembly at TRW Space and Electronics Group. In August 1997, the telescope's optical bench was mated with the mirrors, followed by integration of the telescope with the spacecraft in October. In February 1998, the observatory's science instrument module was mated to the top of the telescope. The complete observatory is 45 feet long, has a solar array wing span 64 feet wide, and weighs more than 5 tons. Using glass purchased from Schott Glaswerke, Mainz, Germany, the telescope's mirrors were built by Raytheon Optical Systems Inc., Danbury, Conn. The mirrors were coated by Optical Coating Laboratory Inc., Santa Rosa, Calif.; and assembled by Eastman-Kodak Co., Rochester, N.Y. The observatory's charged coupled device imaging spectrometer was developed by Pennsylvania State University at University Park, and the Massachusetts Institute of Technology (MIT), at Cambridge. One diffraction grating was developed by MIT, the other by the Space Research Organization Netherlands, Utrecht, in collaboration with the Max Planck Institute, Garching, Germany. The high resolution camera instrument was built by the Smithsonian Astrophysical Observatory. Ball Aerospace & Technologies Corporation of Boulder, Colo., developed the science instrument module. The Advanced X-ray Astrophysics Facility program is managed by the Marshall Center for the Office of Space Science, NASA Headquarters, Washington, D.C. The Smithsonian Astrophysical Observatory in Cambridge, Mass., will operate the observatory for NASA. NOTE TO EDITORS: A photo of the integrated telescope is available via the World Wide Web at URL: http://chandra.harvard.edu/press/images.html Prepared by John Bryk
Smith, Harlan J.
1989-10-01
Many design and technical innovations over the past ten or fifteen years have reduced the costs of very large telescopes by nearly an order of magnitude over those of classical designs. Still a further order of magnitude reduction is possible if the telescope is specialized for on-axis spectroscopy, giving up especially the luxuries of wide field, multiple focal positions, and access to all the sky at will. The SST (Spectroscopic Survey Telescope) will use eighty-five 1-m circular mirrors mounted in a steel frame composed of hundreds of interlocking tetrahedrons, keeping a fixed elevation angle of 60 deg with rotation only in azimuth. Using an optical fiber it will feed as much light to spectrographs as can be done by a conventional 8-m telescope, yet has a target basic completion cost of only $6 million.
The readout and control system of the mid-size telescope prototype of the Cherenkov telescope array
International Nuclear Information System (INIS)
Oya, I; Anguner, O; Birsin, E; Schwanke, U; Behera, B; Melkumyan, D; Schmidt, T; Sternberger, R; Wegner, P; Wiesand, S; Fuessling, M
2014-01-01
The Cherenkov Telescope Array (CTA) is one of the major ground-based astronomy projects being pursued and will be the largest facility for ground-based y-ray observations ever built. CTA will consist of two arrays: one in the Northern hemisphere composed of about 20 telescopes, and the other one in the Southern hemisphere composed of about 100 telescopes, both arrays containing telescopes of different type and size. A prototype for the Mid-Size Telescope (MST) with a diameter of 12 m has been installed in Berlin and is currently being commissioned. This prototype is composed of a mechanical structure, a drive system and mirror facets mounted with powered actuators to enable active control. Five Charge-Coupled Device (CCD) cameras, and a wide set of sensors allow the evaluation of the performance of the instrument. The design of the control software is following concepts and tools under evaluation within the CTA consortium in order to provide a realistic test-bed for the middleware: 1) The readout and control system for the MST prototype is implemented with the Atacama Large Millimeter/submillimeter Array (ALMA) Common Software (ACS) distributed control middleware; 2) the OPen Connectivity-Unified Architecture (OPC UA) is used for hardware access; 3) the document oriented MongoDB database is used for an efficient storage of CCD images, logging and alarm information: and 4) MySQL and MongoDB databases are used for archiving the slow control monitoring data and for storing the operation configuration parameters. In this contribution, the details of the implementation of the control system for the MST prototype telescope are described.
The readout and control system of the mid-size telescope prototype of the Cherenkov Telescope Array
Oya, I.; Anguner, O.; Behera, B.; Birsin, E.; Fuessling, M.; Melkumyan, D.; Schmidt, T.; Schwanke, U.; Sternberger, R.; Wegner, P.; Wiesand, S.; Cta Consortium,the
2014-06-01
The Cherenkov Telescope Array (CTA) is one of the major ground-based astronomy projects being pursued and will be the largest facility for ground-based y-ray observations ever built. CTA will consist of two arrays: one in the Northern hemisphere composed of about 20 telescopes, and the other one in the Southern hemisphere composed of about 100 telescopes, both arrays containing telescopes of different type and size. A prototype for the Mid-Size Telescope (MST) with a diameter of 12 m has been installed in Berlin and is currently being commissioned. This prototype is composed of a mechanical structure, a drive system and mirror facets mounted with powered actuators to enable active control. Five Charge-Coupled Device (CCD) cameras, and a wide set of sensors allow the evaluation of the performance of the instrument. The design of the control software is following concepts and tools under evaluation within the CTA consortium in order to provide a realistic test-bed for the middleware: 1) The readout and control system for the MST prototype is implemented with the Atacama Large Millimeter/submillimeter Array (ALMA) Common Software (ACS) distributed control middleware; 2) the OPen Connectivity-Unified Architecture (OPC UA) is used for hardware access; 3) the document oriented MongoDB database is used for an efficient storage of CCD images, logging and alarm information: and 4) MySQL and MongoDB databases are used for archiving the slow control monitoring data and for storing the operation configuration parameters. In this contribution, the details of the implementation of the control system for the MST prototype telescope are described.
McBride, William R.; McBride, Daniel R.
2016-08-01
The Daniel K. Inouye Solar Telescope (DKIST) will be the largest solar telescope in the world, with a 4-meter off-axis primary mirror and 16 meter rotating Coudé laboratory within the telescope pier. The off-axis design requires a mount similar to an 8-meter on-axis telescope. Both the telescope mount and the Coudé laboratory utilize a roller bearing technology in place of the more commonly used hydrostatic bearings. The telescope enclosure utilizes a crawler mechanism for the altitude axis. As these mechanisms have not previously been used in a telescope, understanding the vibration characteristics and the potential impact on the telescope image is important. This paper presents the methodology used to perform jitter measurements of the enclosure and the mount bearings and servo system in a high-noise environment utilizing seismic accelerometers and high dynamic-range data acquisition equipment, along with digital signal processing (DSP) techniques. Data acquisition and signal processing were implemented in MATLAB. In the factory acceptance testing of the telescope mount, multiple accelerometers were strategically located to capture the six axes-of-motion of the primary and secondary mirror dummies. The optical sensitivity analysis was used to map these mirror mount displacements and rotations into units of image motion on the focal plane. Similarly, tests were done with the Coudé rotator, treating the entire rotating instrument lab as a rigid body. Testing was performed by recording accelerometer data while the telescope control system performed tracking operations typical of various observing scenarios. The analysis of the accelerometer data utilized noise-averaging fast Fourier transform (FFT) routines, spectrograms, and periodograms. To achieve adequate dynamic range at frequencies as low as 3Hz, the use of special filters and advanced windowing functions were necessary. Numerous identical automated tests were compared to identify and select the data sets
Design and development of telescope control system and software for the 50/80 cm Schmidt telescope
Kumar, T. S.; Banavar, R. N.
2012-09-01
In this paper, we describe the details of telescope controller design for the 50/80 cm Schmidt telescope at the Aryabhatta Research Institute of observational sciencES. The GUI based software for commanding the telescope is developed in Visual C++. The hardware architecture features a distributed network of microcontrollers over CAN. The basic functionality can also be implemented using the dedicated RS232 port per board. The controller is able to perform with negligible rms velocity errors. At fine speeds limit cycles are exhibited due to nonlinear friction. At speeds over 3.90 × 10-02 radians/sec, the PI controller performs with peak errors less than 1%.
Simulation and track reconstruction for beam telescopes
Maqbool, Salman
2017-01-01
Beam telescopes are used for testing new detectors under development. Sensors are placed and a particle beam is passed through them. To test these novel detectors and determine their properties, the particle tracks need to be reconstructed from the known detectors in the telescope. Based on the reconstructed track, it’s predicted hits on the Device under Test (DUT) are compared with the actual hits on the DUT. Several methods exist for track reconstruction, but most of them don’t account for the effects of multiple scattering. General Broken Lines is one such algorithm which incorporates these effects during reconstruction. The aim of this project was to simulate the beam telescope and extend the track reconstruction framework for the FE-I4 telescope, which takes these effects into account. Section 1 introduces the problem, while section 2 focuses on beam telescopes. This is followed by the Allpix2 simulation framework in Section 3. And finally, Section 4 introduces the Proteus track reconstruction framew...
Habitable Exoplanet Imager Optical Telescope Concept Design
Stahl, H Philip
2017-01-01
The Habitable Exoplanet Imaging Mission (HabEx) is one of four missions under study for the 2020 Astrophysics Decadal Survey. Its goal is to directly image and spectroscopically characterize planetary systems in the habitable zone of Sun-like stars. Additionally, HabEx will perform a broad range of general astrophysics science enabled by 100 to 2500 nm spectral range and 3 x 3 arc-minute FOV. Critical to achieving the HabEx science goals is a large, ultra-stable UV/Optical/Near-IR (UVOIR) telescope. The baseline HabEx telescope is a 4-meter off-axis unobscured three-mirror-anastigmatic, diffraction limited at 400 nm with wavefront stability on the order of a few 10s of picometers. This paper summarizes the opto-mechanical design of the HabEx baseline optical telescope assembly, including a discussion of how science requirements drive the telescope's specifications, and presents analysis that the baseline telescope structure meets its specified tolerances.
Simulation and Track Reconstruction for Beam Telescopes
Maqbool, Salman
2017-01-01
Beam telescopes are an important tool to test new detectors under development in a particle beam. To test these novel detectors and determine their properties, the particle tracks need to be reconstructed from the known detectors in the telescope. Based on the reconstructed track, its predicted position on the Device under Test (DUT) are compared with the actual hits on the DUT. Several methods exist for track reconstruction, but most of them do not account for the effects of multiple scattering. General Broken Lines is one such algorithm which incorporates these effects during reconstruction. The aim of this project was to simulate the beam telescope and extend the track reconstruction framework for the FE-I4 telescope, which takes these effects into account. Section 1 introduces the problem, while section 2 focuses on beam telescopes. This is followed by the Allpix2 simulation framework in Section 3. And finally, Section 4 introduces the Proteus track reconstruction framework along with the General Broken ...
Habitable exoplanet imager optical telescope concept design
Stahl, H. Philip
2017-09-01
The Habitable Exoplanet Imaging Mission (HabEx) is one of four missions under study for the 2020 Astrophysics Decadal Survey. Its goal is to directly image and spectroscopically characterize planetary systems in the habitable zone of Sunlike stars. Additionally, HabEx will perform a broad range of general astrophysics science enabled by 100 to 2500 nm spectral range and 3 x 3 arc-minute FOV. Critical to achieving the HabEx science goals is a large, ultra-stable UV/Optical/Near-IR (UVOIR) telescope. The baseline HabEx telescope is a 4-meter off-axis unobscured three-mirroranastigmatic, diffraction limited at 400 nm with wavefront stability on the order of a few 10s of picometers. This paper summarizes the opto-mechanical design of the HabEx baseline optical telescope assembly, including a discussion of how science requirements drive the telescope's specifications, and presents analysis that the baseline telescope structure meets its specified tolerances.
Giat Industries selected for construction of the "Very Large Telescope"
1995-06-01
Versailles-Satory (France) May 31, 1995 - Giat Industries has just obtained a contract from the European Southern Observatory (ESO) for the construction of the primary and tertiary mirror supports and the positioning apparatus of the world's largest optical telescope. This contract, worth almost 140 million francs, represents over 100,000 hours of work. It was won by Gitech, a division of Giat Industries, in collaboration with the Sfim group, following an international competition between the largest European groups in the space field. Gitech is charged with the development of civil and military industrial equipment for the Giat Industries group, in particular in high technology fields. The VLT (Very Large Telescope) will be installed in Chile before the year 2000; the delivery schedule provides for reception of the first assembly in May 1997. It will consist of four telescopes of 8.2m diameter, providing, in its most powerful configuration, a close-up view of an object measuring one meter on the surface of the moon. The cell, built by Gitech, is one of the key parts of the telescope. It mainly consists of a very rigid metal structure and an electro-hydraulic system of more that 200 hydraulic jacks and 150 electrically-controlled jacks linking the metallic structure to the mirror. This structure, produced to an original design of laser-welded steel chambers, weighs less than 10 tonnes and will support over 37 tonnes of mirror and equipment, while guaranteeing precise positioning to within a micron. The electro-hydraulic jack system, manufactured in collaboration with the Sfim group, will support and position the mirror, and correct its geometry by applying a precise distribution of forces to its rear. The assembly is designed to meet the requirements of para-seismic safety. Gitech is also producing the computerised control system to ensure the operation and the reliability of the assembly.
Byrum, Karen L.; Vassiliev, V.; AGIS Collaboration
2010-03-01
AGIS is a concept for the next-generation ground-based gamma-ray observatory. It will be an array of 36 imaging atmospheric Cherenkov telescopes (IACTs) sensitive in the energy range from 50 GeV to 200 TeV. The required improvements in sensitivity, angular resolution, and reliability of operation relative to the present generation instruments imposes demanding technological and cost requirements on the design of AGIS telescopes. In this submission, we outline the status of the development of the optical and mechanical systems for a novel Schwarzschild-Couder two-mirror aplanatic telescope. This design can provide a field of view and angular resolution significantly better to those offered by the traditional Davies-Cotton optics utilized in present-day IACTs. Other benefits of the novel design include isochronous focusing and compatibility with cost-effective, high quantum efficiency image sensors such as multi-anode PMTs, silicon PMTs (SiPMs), or image intensifiers.
Camera memory study for large space telescope. [charge coupled devices
Hoffman, C. P.; Brewer, J. E.; Brager, E. A.; Farnsworth, D. L.
1975-01-01
Specifications were developed for a memory system to be used as the storage media for camera detectors on the large space telescope (LST) satellite. Detectors with limited internal storage time such as intensities charge coupled devices and silicon intensified targets are implied. The general characteristics are reported of different approaches to the memory system with comparisons made within the guidelines set forth for the LST application. Priority ordering of comparisons is on the basis of cost, reliability, power, and physical characteristics. Specific rationales are provided for the rejection of unsuitable memory technologies. A recommended technology was selected and used to establish specifications for a breadboard memory. Procurement scheduling is provided for delivery of system breadboards in 1976, prototypes in 1978, and space qualified units in 1980.
Space Telescope maintenance and refurbishment
Trucks, H. F.
1983-01-01
The Space Telescope (ST) represents a new concept regarding spaceborne astronomical observatories. Maintenance crews will be brought to the orbital worksite to make repairs and replace scientific instruments. For major overhauls the telescope can be temporarily returned to earth with the aid of the Shuttle. It will, thus, be possible to conduct astronomical studies with the ST for two decades or more. The five first-generation scientific instruments used with the ST include a wide field/planetary camera, a faint object camera, a faint object spectrograph, a high resolution spectrograph, and a high speed photometer. Attention is given to the optical telescope assembly, the support systems module, aspects of mission and science operations, unscheduled maintenance, contingency orbital maintenance, planned on-orbit maintenance, ground maintenance, ground refurbishment, and ground logistics.
Eyes on the sky a spectrum of telescopes
Graham-Smith, Francis
2016-01-01
Astronomy is experiencing a golden age, with a new generation of innovative telescopes yielding a flood of information on the Universe. This book traces the development of telescopes from Galileo to the present day, and explains the basic principles of telescopes that operate in different parts of electromagnetic spectrum.
Optical Design for a Survey X-Ray Telescope
Saha, Timo T.; Zhang, William W.; McClelland, Ryan S.
2014-01-01
Optical design trades are underway at the Goddard Space Flight Center to define a telescope for an x-ray survey mission. Top-level science objectives of the mission include the study of x-ray transients, surveying and long-term monitoring of compact objects in nearby galaxies, as well as both deep and wide-field x-ray surveys. In this paper we consider Wolter, Wolter-Schwarzschild, and modified Wolter-Schwarzschild telescope designs as basic building blocks for the tightly nested survey telescope. Design principles and dominating aberrations of individual telescopes and nested telescopes are discussed and we compare the off-axis optical performance at 1.0 KeV and 4.0 KeV across a 1.0-degree full field-of-view.
Jirdeh, Hussein; Straughn, Amber; Smith, Denise Anne; Eisenhamer, Bonnie
2015-08-01
April 24, 2015 marked the 25th anniversary of the launch of the Hubble Space Telescope. In its quarter-century in orbit, the Hubble Space Telescope has transformed the way we understand the Universe, helped us find our place among the stars, and paved the way to incredible advancements in science and technology.In this presentation, we explain how NASA and ESA, including the Space Telescope Science Institute (STScI) and partners, is using the 25th anniversary of Hubble’s launch as a unique opportunity to communicate to students, educators, and the public the significance of the past quarter-century of discovery with the Hubble Space Telescope. We describe the various programs, resources, and experiences we are utilizing to enhancethe public understanding of Hubble’s many contributions to the scientific world. These include educator professional development opportunities, exhibits, events, traditional and social media, and resources for educators (formal k-12, informal, and higher education). We also highlight how we are capitalizing on Hubble’s cultural popularity to make the scientific connection to NASA’s next Great Observatory, the James Webb Space Telescope.This presentation highlights many of the opportunities by which students, educators, and the public are joining in the anniversary activities, both in-person and online. Find out more at hubble25th.org and follow #Hubble25 on social media.
Sanchez-Lavega, A.; Ordoñez-Etxeberria, I.; del Rio Gaztelurrutia, T.; Illarramendi, M. A.; Perez-Hoyos, S.; Hueso, R.; Rojas, J. F.
2017-12-01
We present a set of practical experiments carried out with the students of the Master in Space Science and Technology of the University of the Basque Country (A. Sanchez-Lavega et al., Eur. J. of Eng. Education. 2014) using small telescopes that have been published in refereed journals. The telescopes (from 15 to 50 cm in aperture) and instruments pertain to the Aula EspaZio Gela Observatory (http://www.ehu.eus/aula-espazio/presentacion.html). The students have participated in some cases as co-authors of the publications or in presentations at meetings which encourages them to continue their scientific career towards PhD studies. Dedicated observations with these small telescopes with the participation of the planetary amateur community have also been employed in scientific research and publications. A series of examples are presented.
ANTARES : The first undersea neutrino telescope
Ageron, M.; Aguilar, J. A.; Al Samarai, I.; Albert, A.; Ameli, F.; Andre, M.; Anghinolfi, M.; Anton, G.; Anvar, S.; Ardid, M.; Arnaud, K.; Aslanides, E.; Jesus, A. C. Assis; Astraatmadja, T.; Aubert, J. -J.; Auer, R.; Barbarito, E.; Baret, B.; Basa, S.; Bazzotti, M.; Becherini, Y.; Beltramelli, J.; Bersani, A.; Bertin, V.; Beurthey, S.; Biagi, S.; Bigongiari, C.; Billault, M.; Blaes, R.; Bogazzi, C.; de Botton, N.; Bou-Cabo, M.; Boudahef, B.; Bouwhuis, M. C.; Brown, A. M.; Brunner, J.; Busto, J.; Caillat, L.; Calzas, A.; Camarena, F.; Capone, A.; Caponetto, L.; Carloganu, C.; Carminati, G.; Carmona, E.; Carr, J.; Carton, P. H.; Cassano, B.; Castorina, E.; Cecchini, S.; Ceres, A.; Chaleil, Th; Charvis, Ph; Chauchot, P.; Chiarusi, T.; Circella, M.; Compere, C.; Coniglione, R.; Coppolani, X.; Cosquer, A.; Costantini, H.; Cottini, N.; Coyle, P.; Cuneo, S.; Curtil, C.; D'Amato, C.; Damy, G.; van Dantzig, R.; De Bonis, G.; Decock, G.; Decowski, M. P.; Dekeyser, I.; Delagnes, E.; Desages-Ardellier, F.; Deschamps, A.; Destelle, J. -J.; Di Maria, F.; Dinkespiler, B.; Distefano, C.; Dominique, J. -L.; Donzaud, C.; Dornic, D.; Dorosti, Q.; Drogou, J. -F.; Drouhin, D.; Druillole, F.; Durand, D.; Durand, R.; Eberl, T.; Emanuele, U.; Engelen, J. J.; Ernenwein, J. -P.; Escoffier, S.; Falchini, E.; Favard, S.; Fehr, F.; Feinstein, F.; Ferri, M.; Ferry, S.; Fiorello, C.; Flaminio, V.; Folger, F.; Fritsch, U.; Fuda, J. -L.; Galata, S.; Galeotti, S.; Gay, P.; Gensolen, F.; Giacomelli, G.; Gojak, C.; Gomez-Gonzalez, J. P.; Goret, Ph.; Graf, K.; Guillard, G.; Halladjian, G.; Hallewell, G.; van Haren, H.; Hartmann, B.; Heijboer, A. J.; Heine, E.; Hello, Y.; Henry, S.; Hernandez-Rey, J. J.; Herold, B.; Hoessl, J.; Hogenbirk, J.; Hsu, C. C.; Hubbard, J. R.; Jaquet, M.; Jaspers, M.; de Jong, M.; Jourde, D.; Kadler, M.; Kalantar-Nayestanaki, N.; Kalekin, O.; Kappes, A.; Karg, T.; Karkar, S.; Karolak, M.; Katz, U.; Keller, P.; Kestener, P.; Kok, E.; Kok, H.; Kooijman, P.; Kopper, C.; Kouchner, A.; Kretschmer, W.; Kruijer, A.; Kuch, S.; Kulikovskiy, V.; Lachartre, D.; Lafoux, H.; Lagier, P.; Lahmann, R.; Lahonde-Hamdoun, C.; Lamare, P.; Lambard, G.; Languillat, J-C; Larosa, G.; Lavalle, J.; Le Guen, Y.; Le Provost, H.; LeVanSuu, A.; Lefevre, D.; Legou, T.; Lelaizant, G.; Leveque, C.; Lim, G.; Lo Presti, D.; Loehner, H.; Loucatos, S.; Louis, F.; Lucarelli, F.; Lyashuk, V.; Magnier, P.; Mangano, S.; Marcel, A.; Marcelin, M.; Margiotta, A.; Martinez-Mora, J. A.; Masullo, R.; Mazeas, F.; Mazure, A.; Meli, A.; Melissas, M.; Migneco, E.; Mongelli, M.; Montaruli, T.; Morganti, M.; Moscoso, L.; Motz, H.; Musumeci, M.; Naumann, C.; Naumann-Godo, M.; Neff, M.; Niess, V.; Nooren, G. J. L.; Oberski, J. E. J.; Olivetto, C.; Palanque-Delabrouille, N.; Patioselitis, D.; Papaleo, R.; Pavalas, G. E.; Payet, K.; Payre, P.; Peek, H.; Petrovic, J.; Piattelli, P.; Picot-Clemente, N.; Picq, C.; Piret, Y.; Poinsignon, J.; Popa, V.; Pradier, T.; Presani, E.; Prono, G.; Racca, C.; Raia, G.; van Randwijk, J.; Real, D.; Reed, C.; Rethore, F.; Rewiersma, P.; Riccobene, G.; Richardt, C.; Richter, R.; Ricol, J. S.; Rigaud, V.; Roca, V.; Roensch, K.; Rolin, J. -F.; Rostovtsev, A.; Rottura, A.; Roux, J.; Rujoiu, M.; Ruppi, M.; Russo, G. V.; Salesa, F.; Salomon, K.; Sapienza, P.; Schmitt, F.; Schoeck, F.; Schuller, J. -P.; Schuessler, F.; Sciliberto, D.; Shanidze, R.; Shirokov, E.; Simeone, F.; Sottoriva, A.; Spies, A.; Spona, T.; Spurio, M.; Steijger, J. J. M.; Stolarczyk, Th; Streeb, K.; Sulak, L.; Taiuti, M.; Tamburini, C.; Tao, C.; Tasca, L.; Terreni, G.; Tezier, D.; Toscano, S.; Urbano, F.; Valdy, P.; Vallage, B.; Van Elewyck, V.; Vannoni, G.; Vecchi, M.; Venekamp, G.; Verlaat, B.; Vernin, P.; Virique, E.; de Vries, G.; Wijnker, G.; Wobbe, G.; de Wolf, E.; Yakovenko, Y.; Yepes, H.; Zaborov, D.; Zaccone, H.; Zornoza, J. D.; Zuniga, J.; van Wijk, R.
2011-01-01
The ANTARES Neutrino Telescope was completed in May 2008 and is the first operational Neutrino Telescope in the Mediterranean Sea. The main purpose of the detector is to perform neutrino astronomy and the apparatus also offers facilities for marine and Earth sciences. This paper describes the
Optimal networks of future gravitational-wave telescopes
Raffai, Péter; Gondán, László; Heng, Ik Siong; Kelecsényi, Nándor; Logue, Josh; Márka, Zsuzsa; Márka, Szabolcs
2013-08-01
We aim to find the optimal site locations for a hypothetical network of 1-3 triangular gravitational-wave telescopes. We define the following N-telescope figures of merit (FoMs) and construct three corresponding metrics: (a) capability of reconstructing the signal polarization; (b) accuracy in source localization; and (c) accuracy in reconstructing the parameters of a standard binary source. We also define a combined metric that takes into account the three FoMs with practically equal weight. After constructing a geomap of possible telescope sites, we give the optimal 2-telescope networks for the four FoMs separately in example cases where the location of the first telescope has been predetermined. We found that based on the combined metric, placing the first telescope to Australia provides the most options for optimal site selection when extending the network with a second instrument. We suggest geographical regions where a potential second and third telescope could be placed to get optimal network performance in terms of our FoMs. Additionally, we use a similar approach to find the optimal location and orientation for the proposed LIGO-India detector within a five-detector network with Advanced LIGO (Hanford), Advanced LIGO (Livingston), Advanced Virgo, and KAGRA. We found that the FoMs do not change greatly in sites within India, though the network can suffer a significant loss in reconstructing signal polarizations if the orientation angle of an L-shaped LIGO-India is not set to the optimal value of ˜58.2°( + k × 90°) (measured counterclockwise from East to the bisector of the arms).
Active control of the Chinese Giant Solar Telescope
Dai, Yichun; Yang, Dehua; Jin, Zhenyu; Liu, Zhong; Qin, Wei
2014-07-01
The Chinese Giant Solar Telescope (CGST) is the next generation solar telescope of China with diameter of 8 meter. The unique feature of CGST is that its primary is a ring, which facilitates the polarization detection and thermal control. In its present design and development phase, two primary mirror patterns are considered. For one thing, the primary mirror is expected to construct with mosaic mirror with 24 trapezoidal (or petal) segments, for another thing, a monolithic mirror is also a candidate for its primary mirror. Both of them depend on active control technique to maintain the optical quality of the ring mirror. As a solar telescope, the working conditions of the CGST are quite different from those of the stellar telescopes. To avoid the image deterioration due to the mirror seeing and dome seeing, especially in the case of the concentration of flux in a solar telescope, large aperture solar projects prefer to adopt open telescopes and open domes. In this circumstance, higher wind loads act on the primary mirror directly, which will cause position errors and figure errors of the primary with matters worse than those of the current 10-meter stellar telescopes with dome protect. Therefore, it gives new challenges to the active control capability, telescope structure design, and wind shielding design. In this paper, the study progress of active control of CGST for its mosaic and monolithic mirror are presented, and the wind effects on such two primary mirrors are also investigated.
Energy Technology Data Exchange (ETDEWEB)
Bisconti, Francesca, E-mail: francesca.bisconti@kit.edu
2016-07-11
EUSO-TA is one of the prototypes developed for the JEM-EUSO project, a space-based large field-of-view telescope to observe the fluorescence light emitted by cosmic ray air showers in the atmosphere. EUSO-TA is a ground-based prototype located at the Telescope Array (TA) site in Utah, USA, where an Electron Light Source and a Central Laser Facility are installed. The purpose of the EUSO-TA project is to calibrate the prototype with the TA fluorescence detector in presence of well-known light sources and cosmic ray air showers. In 2015, the detector started the first measurements and tests using the mentioned light sources have been performed successfully. A first cosmic ray candidate has been observed, as well as stars of different magnitude and color index. Since Silicon Photo-Multipliers (SiPMs) are very promising for fluorescence telescopes of next generation, they are under consideration for the realization of a new prototype of EUSO Photo Detector Module (PDM). The response of this sensor type is under investigation through simulations and laboratory experimentation.
Bisconti, Francesca; JEM-EUSO Collaboration
2016-07-01
EUSO-TA is one of the prototypes developed for the JEM-EUSO project, a space-based large field-of-view telescope to observe the fluorescence light emitted by cosmic ray air showers in the atmosphere. EUSO-TA is a ground-based prototype located at the Telescope Array (TA) site in Utah, USA, where an Electron Light Source and a Central Laser Facility are installed. The purpose of the EUSO-TA project is to calibrate the prototype with the TA fluorescence detector in presence of well-known light sources and cosmic ray air showers. In 2015, the detector started the first measurements and tests using the mentioned light sources have been performed successfully. A first cosmic ray candidate has been observed, as well as stars of different magnitude and color index. Since Silicon Photo-Multipliers (SiPMs) are very promising for fluorescence telescopes of next generation, they are under consideration for the realization of a new prototype of EUSO Photo Detector Module (PDM). The response of this sensor type is under investigation through simulations and laboratory experimentation.
Konno, Y.; Kubo, H.; Masuda, S.; Paoletti, R.; Poulios, S.; Rugliancich, A.; Saito, T.
2016-07-01
The Cherenkov Telescope Array (CTA) is the next generation VHE γ-ray observatory which will improve the currently available sensitivity by a factor of 10 in the range 100 GeV to 10 TeV. The array consists of different types of telescopes, called large size telescope (LST), medium size telescope (MST) and small size telescope (SST). A LST prototype is currently being built and will be installed at the Observatorio Roque de los Muchachos, island of La Palma, Canary islands, Spain. The readout system for the LST prototype has been designed and around 300 readout boards will be produced in the coming months. In this note we describe an automated quality control system able to measure basic performance parameters and quickly identify faulty boards.
Telescopic multi-resolution augmented reality
Jenkins, Jeffrey; Frenchi, Christopher; Szu, Harold
2014-05-01
To ensure a self-consistent scaling approximation, the underlying microscopic fluctuation components can naturally influence macroscopic means, which may give rise to emergent observable phenomena. In this paper, we describe a consistent macroscopic (cm-scale), mesoscopic (micron-scale), and microscopic (nano-scale) approach to introduce Telescopic Multi-Resolution (TMR) into current Augmented Reality (AR) visualization technology. We propose to couple TMR-AR by introducing an energy-matter interaction engine framework that is based on known Physics, Biology, Chemistry principles. An immediate payoff of TMR-AR is a self-consistent approximation of the interaction between microscopic observables and their direct effect on the macroscopic system that is driven by real-world measurements. Such an interdisciplinary approach enables us to achieve more than multiple scale, telescopic visualization of real and virtual information but also conducting thought experiments through AR. As a result of the consistency, this framework allows us to explore a large dimensionality parameter space of measured and unmeasured regions. Towards this direction, we explore how to build learnable libraries of biological, physical, and chemical mechanisms. Fusing analytical sensors with TMR-AR libraries provides a robust framework to optimize testing and evaluation through data-driven or virtual synthetic simulations. Visualizing mechanisms of interactions requires identification of observable image features that can indicate the presence of information in multiple spatial and temporal scales of analog data. The AR methodology was originally developed to enhance pilot-training as well as `make believe' entertainment industries in a user-friendly digital environment We believe TMR-AR can someday help us conduct thought experiments scientifically, to be pedagogically visualized in a zoom-in-and-out, consistent, multi-scale approximations.
Chun, F.; Tippets, R.; Dearborn, M.; Gresham, K.; Freckleton, R.; Douglas, M.
2014-09-01
The Falcon Telescope Network (FTN) is a global network of small aperture telescopes developed by the Center for Space Situational Awareness Research in the Department of Physics at the United States Air Force Academy (USAFA). Consisting of commercially available equipment, the FTN is a collaborative effort between USAFA and other educational institutions ranging from two- and four-year colleges to major research universities. USAFA provides the equipment (e.g. telescope, mount, camera, filter wheel, dome, weather station, computers and storage devices) while the educational partners provide the building and infrastructure to support an observatory. The user base includes USAFA along with K-12 and higher education faculty and students. Since the FTN has a general use purpose, objects of interest include satellites, astronomical research, and STEM support images. The raw imagery, all in the public domain, will be accessible to FTN partners and will be archived at USAFA in the Cadet Space Operations Center. FTN users will be able to submit observational requests via a web interface. The requests will then be prioritized based on the type of user, the object of interest, and a user-defined priority. A network wide schedule will be developed every 24 hours and each FTN site will autonomously execute its portion of the schedule. After an observational request is completed, the FTN user will receive notification of collection and a link to the data. The Falcon Telescope Network is an ambitious endeavor, but demonstrates the cooperation that can be achieved by multiple educational institutions.
Processing of data from innovative parabolic strip telescope.
Kosejk, Vladislav; Novy, J.; Chadzitaskos, Goce
2015-12-01
This paper presents an innovative telescope design based on the usage of a parabolic strip fulfilling the function of an objective. Isaac Newton was the first to solve the problem of chromatic aberration, which is caused by a difference in the refractive index of lenses. This problem was solved by a new kind of telescope with a mirror used as an objective. There are many different kinds of telescopes. The most basic one is the lens telescope. This type of a telescope uses a set of lenses. Another type is the mirror telescope, which employs the concave mirror, spherical parabolic mirror or hyperbolically shaped mirror as its objective. The lens speed depends directly on the surface of a mirror. Both types can be combined to form a telescope composed of at least two mirrors and a set of lenses. The light is reflected from the primary mirror to the secondary one and then to the lens system. This type is smaller-sized, with a respectively reduced lens speed. The telescope design presented in this paper uses a parabolic strip fulfilling the function of an objective. Observed objects are projected as lines in a picture plane. Each of the lines of a size equal to the size of the strip corresponds to the sum of intensities of the light coming perpendicular to the objective from an observed object. A series of pictures taken with a different rotation and processed by a special reconstruction algorithm is needed to get 2D pictures. The telescope can also be used for fast detection of objects. In this mode, the rotation and multiple pictures are not needed, just one picture in the focus of a mirror is required to be taken.
Origins Space Telescope: Nearby Galaxies, the Milky Way, and the Interstellar Medium
Battersby, Cara; Sandstrom, Karin; Origins Space Telescope Science and Technology Definition Team
2018-01-01
The Origins Space Telescope (OST) is the mission concept for the Far-Infrared Surveyor, one of the four science and technology definition studies of NASA Headquarters for the 2020 Astronomy and Astrophysics Decadal survey. Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s. We welcome you to contact the Science and Technology Definition Team (STDT) with your science needs and ideas by emailing us at ost_info@lists.ipac.caltech.eduThis presentation will summarize the science case related to Nearby Galaxies, the Milky Way, and the Interstellar Medium (Interstellar Medium). The Origins Space Telescope will enable a wealth of unprecedented scientific advances in this area, both those we know to expect, and the discovery space that lies unexplored. Origins will enable a comprehensive view of magnetic fields, turbulence, and the multiphase ISM; connecting these physics across scales of galaxies to protostellar cores. With unprecedented sensitivity, Origins will measure and characterize the mechanisms of feedback from star formation and Active Galactic Nuclei, and their interplay, over cosmic time. Origins will unveil the abundance and availability of water for habitable planets by allowing us to trace the trail of water from interstellar clouds to protoplanetary disks, to Earth itself.
Optimal networks of future gravitational-wave telescopes
International Nuclear Information System (INIS)
Raffai, Péter; Márka, Zsuzsa; Márka, Szabolcs; Gondán, László; Kelecsényi, Nándor; Heng, Ik Siong; Logue, Josh
2013-01-01
We aim to find the optimal site locations for a hypothetical network of 1–3 triangular gravitational-wave telescopes. We define the following N-telescope figures of merit (FoMs) and construct three corresponding metrics: (a) capability of reconstructing the signal polarization; (b) accuracy in source localization; and (c) accuracy in reconstructing the parameters of a standard binary source. We also define a combined metric that takes into account the three FoMs with practically equal weight. After constructing a geomap of possible telescope sites, we give the optimal 2-telescope networks for the four FoMs separately in example cases where the location of the first telescope has been predetermined. We found that based on the combined metric, placing the first telescope to Australia provides the most options for optimal site selection when extending the network with a second instrument. We suggest geographical regions where a potential second and third telescope could be placed to get optimal network performance in terms of our FoMs. Additionally, we use a similar approach to find the optimal location and orientation for the proposed LIGO-India detector within a five-detector network with Advanced LIGO (Hanford), Advanced LIGO (Livingston), Advanced Virgo, and KAGRA. We found that the FoMs do not change greatly in sites within India, though the network can suffer a significant loss in reconstructing signal polarizations if the orientation angle of an L-shaped LIGO-India is not set to the optimal value of ∼58.2°( + k × 90°) (measured counterclockwise from East to the bisector of the arms). (paper)
Hubble Space Telescope: The Telescope, the Observations & the Servicing Mission
1999-11-01
Today the HST Archives contain more than 260 000 astronomical observations. More than 13 000 astronomical objects have been observed by hundreds of different groups of scientists. Direct proof of the scientific significance of this project is the record-breaking number of papers published : over 2400 to date. Some of HST's most memorable achievements are: * the discovery of myriads of very faint galaxies in the early Universe, * unprecedented, accurate measurements of distances to the farthest galaxies, * significant improvement in the determination of the Hubble constant and thus the age of the Universe, * confirmation of the existence of blacks holes, * a far better understanding of the birth, life and death of stars, * a very detailed look at the secrets of the process by which planets are created. Europe and HST ESA's contribution to HST represents a nominal investment of 15%. ESA provided one of the two imaging instruments - the Faint Object Camera (FOC) - and the solar panels. It also has 15 scientists and computer staff working at the Space Telescope Science Institute in Baltimore (Maryland). In Europe the astronomical community receives observational assistance from the Space Telescope European Coordinating Facility (ST-ECF) located in Garching, Munich. In return for ESA's investment, European astronomers have access to approximately 15% of the observing time. In reality the actual observing time competitively allocated to European astronomers is closer to 20%. Looking back at almost ten years of operation, the head of ST-ECF, European HST Project Scientist Piero Benvenuti states: "Hubble has been of paramount importance to European astronomy, much more than the mere 20% of observing time. It has given the opportunity for European scientists to use a top class instrument that Europe alone would not be able to build and operate. In specific areas of research they have now, mainly due to HST, achieved international leadership." One of the major reasons for
Structural design considerations for an 8-m space telescope
Arnold, William r., Sr.; Stahl, H. Philip
2009-08-01
NASA's upcoming ARES V launch vehicle, with its' immense payload capacities (both volume and mass) has opened the possibilities for a whole new paradigm of space observatories. It becomes practical to consider a monolith mirror of sufficient size to permit significant scientific advantages, both in collection area and smoothness or figure at a reasonable price. The technologies and engineering to manufacture and test 8 meter class monoliths is mature, with nearly a dozen of such mirrors already in operation around the world. This paper will discuss the design requirements to adapt an 8m meniscus mirror into a Space Telescope System, both launch and operational considerations are included. With objects this massive and structurally sensitive, the mirror design must include all stages of the process. Based upon the experiences of the Hubble Space Telescope, testing and verification at both component and integrated system levels are considered vital to mission success. To this end, two different component level test methods for gravity sag (the so call zero- gravity simulation or test mount) are proposed, with one of these methods suitable for the full up system level testing as well.
Radio Frequency Interference Site Survey for Thai Radio Telescopes
Jaroenjittichai, P.; Punyawarin, S.; Singwong, D.; Somboonpon, P.; Prasert, N.; Bandudej, K.; Kempet, P.; Leckngam, A.; Poshyachinda, S.; Soonthornthum, B.; Kramer, B.
2017-09-01
Radio astronomical observations have increasingly been threaten by the march of today telecommunication and wireless technology. Performance of radio telescopes lies within the fact that astronomical sources are extremely weak. National Astronomy Research Institute of Thailand (NARIT) has initiated a 5-year project, known as the Radio Astronomy Network and Geodesy for Development (RANGD), which includes the establishment of 40-meter and 13-meter radio telescopes. Possible locations have been narrowed down to three candidates, situated in the Northern part of Thailand, where the atmosphere is sufficiently dry and suitable for 22 and 43 GHz observations. The Radio Frequency Interference (RFI) measurements were carried out with a DC spectrum analyzer and directional antennas at 1.5 meter above ground, from 20 MHz to 6 GHz with full azimuth coverage. The data from a 3-minute pointing were recorded for both horizontal and vertical polarizations, in maxhold and average modes. The results, for which we used to make preliminary site selection, show signals from typical broadcast and telecommunication services and aeronautics applications. The signal intensity varies accordingly to the presence of nearby population and topography of the region.
Energy Technology Data Exchange (ETDEWEB)
Konno, Y.; Kubo, H.; Masuda, S. [Department of Physics, Graduate School of Science, Kyoto University, Kyoto (Japan); Paoletti, R.; Poulios, S. [SFTA Department, Physics Section, University of Siena and INFN, Siena (Italy); Rugliancich, A., E-mail: andrea.rugliancich@pi.infn.it [SFTA Department, Physics Section, University of Siena and INFN, Siena (Italy); Saito, T. [Department of Physics, Graduate School of Science, Kyoto University, Kyoto (Japan)
2016-07-11
The Cherenkov Telescope Array (CTA) is the next generation VHE γ-ray observatory which will improve the currently available sensitivity by a factor of 10 in the range 100 GeV to 10 TeV. The array consists of different types of telescopes, called large size telescope (LST), medium size telescope (MST) and small size telescope (SST). A LST prototype is currently being built and will be installed at the Observatorio Roque de los Muchachos, island of La Palma, Canary islands, Spain. The readout system for the LST prototype has been designed and around 300 readout boards will be produced in the coming months. In this note we describe an automated quality control system able to measure basic performance parameters and quickly identify faulty boards. - Highlights: • The Dragon Board is part of the DAQ of the LST Cherenkov telescope prototype. • We developed an automated quality control system for the Dragon Board. • We check pedestal, linearity, pulse shape and crosstalk values. • The quality control test can be performed on the production line.
The Breadboard model of the LISA telescope assembly
Lucarelli, S.; Scheulen, D.; Kemper, D.; Sippel, R.; Verlaan, A.; Hogenhuis, H.; Ende, D.
2017-11-01
The primary goal of the LISA mission is the detection of gravitational waves from astronomical sources in a frequency range of 10-4 to 1 Hz. This requires operational stabilities in the picometer range as well as highly predictable mechanical distortions upon cooling down, outgassing in space, and gravity release. In March 2011 ESA announced a new way forward for the Lclass candidate missions, including LISA. ESA and the scientific community are now studying options for European-only missions that offer a significant reduction of the costs, while maintaining their core science objectives. In this context LISA has become the New Gravitational wave Observatory (NGO). Despite this reformulation, the need for dimensional stability in the picometer range remains valid, and ESA have continued the corresponding LISA Technology Development Activities (TDA's) also in view of NGO. In such frame Astrium GmbH and xperion (Friedrichshafen, Germany) have designed and manufactured an ultra-stable CFRP breadboard of the LISA telescope in order to experimentally demonstrate that the structure and the M1 & M2 mirror mounts are fulfilling the LISA requirements in the mission operational thermal environment. Suitable techniques to mount the telescope mirrors and to support the M1 & M2 mirrors have been developed, with the aim of measuring a system CTE of less than 10-7 K-1 during cooling down to -80°C. Additionally to the stringent mass and stiffness specifications, the required offset design makes the control of relative tilts and lateral displacements between the M1 and M2 mirrors particularly demanding. The thermo-elastic performance of the telescope assembly is going to be experimentally verified by TNO (Delft, The Netherlands) starting from the second half of 2012. This paper addresses challenges faced in the design phase, shows the resulting hardware and present first outcomes of the test campaign performed at TNO.
The TOTEM T2 telescope based on triple-GEM chambers
Bagliesi, M G; Brucken, E; Cecchi, R; David, E; Garcia, F; Greco, V; Heino, J; Hilden, T; Kurvinen, K; Lauhakangas, R; Lami, S; Latino, G; Magazzu, G; Oliveri, E; Pedreschi, E; Ropelewski, L; Scribano, A; Spinella, F; Turini, N; van Stenis, M
2010-01-01
The TOTEM experiment at LHC has chosen the triple Gas Electron Multiplier (GEM) technology for its T2 telescope which will provide charged track reconstruction in the pseudorapidity range 5.3<|η|<6.5 and a fully inclusive trigger for inelastic events. GEMs are gas filled detectors which combine good spatial resolution with very high rate capability and a good resistance to radiation. Preliminary results of cosmic ray tests performed at CERN on final T2 modules before installation are here presented. Comparisons between real and simulated detector performance are also shown.
The TOTEM T2 telescope based on triple-GEM chambers
Energy Technology Data Exchange (ETDEWEB)
Bagliesi, M.G., E-mail: mg.bagliesi@pi.infn.i [University of Siena and INFN Pisa (Italy); Berretti, M. [University of Siena and INFN Pisa (Italy); Brucken, E. [Helsinki (Finland); Cecchi, R. [University of Siena and INFN Pisa (Italy); David, E. [CERN, Geneva (Switzerland); Garcia, F. [Helsinki (Finland); Greco, V. [University of Siena and INFN Pisa (Italy); Heino, J.; Hilden, T.; Kurvinen, K.; Lauhakangas, R. [Helsinki (Finland); Lami, S.; Latino, G.; Magazzu, G.; Oliveri, E.; Pedreschi, E. [University of Siena and INFN Pisa (Italy); Ropelewski, L. [CERN, Geneva (Switzerland); Scribano, A.; Spinella, F.; Turini, N. [University of Siena and INFN Pisa (Italy)
2010-05-21
The TOTEM experiment at LHC has chosen the triple Gas Electron Multiplier (GEM) technology for its T2 telescope which will provide charged track reconstruction in the pseudorapidity range 5.3<|{eta}|<6.5 and a fully inclusive trigger for inelastic events. GEMs are gas filled detectors which combine good spatial resolution with very high rate capability and a good resistance to radiation. Preliminary results of cosmic ray tests performed at CERN on final T2 modules before installation are here presented. Comparisons between real and simulated detector performance are also shown.
The TACTIC atmospheric Cherenkov imaging telescope
International Nuclear Information System (INIS)
Koul, R.; Tickoo, A.K.; Kaul, S.K.; Kaul, S.R.; Kumar, N.; Yadav, K.K.; Bhatt, N.; Venugopal, K.; Goyal, H.C.; Kothari, M.; Chandra, P.; Rannot, R.C.; Dhar, V.K.; Koul, M.K.; Kaul, R.K.; Kotwal, S.; Chanchalani, K.; Thoudam, S.; Chouhan, N.; Sharma, M.; Bhattacharyya, S.; Sahayanathan, S.
2007-01-01
The TACTIC (TeV Atomospheric Cherenkov Telescope with Imaging Camera) γ-ray telescope, equipped with a light collector of area ∼9.5m 2 and a medium resolution imaging camera of 349 pixels, has been in operation at Mt. Abu, India, since 2001. This paper describes the main features of its various subsystems and its overall performance with regard to (a) tracking accuracy of its two-axes drive system, (b) spot size of the light collector, (c) back-end signal processing electronics and topological trigger generation scheme, (d) data acquisition and control system and (e) relative and absolute gain calibration methodology. Using a trigger field-of-view of 11x11 pixels (∼3.4 a tx3.4 a t), the telescope records a cosmic ray event rate of ∼2.5Hz at a typical zenith angle of 15 a t. Monte Carlo simulation results are also presented in the paper for comparing the expected performance of the telescope with actual observational results. The consistent detection of a steady signal from the Crab Nebula above ∼1.2TeV energy, at a sensitivity level of ∼5.0σ in ∼25h, along with excellent matching of its energy spectrum with that obtained by other groups, reassures that the performance of the TACTIC telescope is quite stable and reliable. Furthermore, encouraged by the detection of strong γ-ray signals from Mrk 501 (during 1997 and 2006 observations) and Mrk 421 (during 2001 and 2005-2006 observations), we believe that there is considerable scope for the TACTIC telescope to monitor similar TeV γ-ray emission activity from other active galactic nuclei on a long-term basis
Simulation of the Simbol-X telescope: imaging performance of a deformable x-ray telescope
Chauvin, Maxime; Roques, Jean-Pierre
2009-08-01
We have developed a simulation tool for a Wolter I telescope subject to deformations. The aim is to understand and predict the behavior of Simbol-X and other future missions (NuSTAR, Astro-H, IXO, ...). Our code, based on Monte-Carlo ray-tracing, computes the full photon trajectories up to the detector plane, along with the deformations. The degradation of the imaging system is corrected using metrology. This tool allows to perform many analyzes in order to optimize the configuration of any of these telescopes.
FACT. Bokeh alignment for Cherenkov telescopes
Energy Technology Data Exchange (ETDEWEB)
Mueller, Sebastian Achim [ETH Zurich (Switzerland); Buss, Jens [TU Dortmund (Germany)
2016-07-01
Imaging Atmospheric Cherenkov Telescopes (IACTs) need fast and large imaging optics to map the faint Cherenkov light emitted in cosmic ray air showers onto their image sensors. Segmented reflectors are inexpensive, lightweight and offer good image quality. However, alignment of the mirror facets remains a challenge. A good alignment is crucial in IACT observations to separate gamma rays from hadronic cosmic rays. We present a simple, yet extendable method, to align segmented reflectors using their Bokeh. Bokeh alignment does not need a star or good weather nights but can be done anytime, even during the day. Bokeh alignment optimizes the facet orientations by comparing the segmented reflector's Bokeh to a predefined template. The Bokeh is observed using the out of focus image of a nearby point like light source in a distance of about ten times the focal lengths. We introduce Bokeh alignment on segmented reflectors and present its use on the First Geiger-mode Avalanche Cherenkov Telescope (FACT) on Canary Island La Palma, as well as on the Cherenkov Telescope Array (CTA) Medium Size Telescope (MST) prototype in Berlin Adlershof.
Choosing and Using a Refracting Telescope
English, Neil
2011-01-01
The refracting telescope has a long and illustrious past. Here’s what the author says about early telescopes and today’s refractors: “Four centuries ago, a hitherto obscure Italian scientist turned a home-made spyglass towards the heavens. The lenses he used were awful by modern standards, inaccurately figured and filled with the scars of their perilous journey from the furnace to the finishing workshop. Yet, despite these imperfections, they allowed him to see what no one had ever seen before – a universe far more complex and dynamic than anyone had dared imagine. But they also proved endlessly useful in the humdrum of human affairs. For the first time ever, you could spy on your neighbor from a distance, or monitor the approach of a war-mongering army, thus deciding the fate of nations. “The refractor is without doubt the prince of telescopes. Compared with all other telescopic designs, the unobstructed view of the refractor enables it to capture the sharpest, highest contrast images and the wides...
Go-To Telescopes Under Suburban Skies
Monks, Neale
2010-01-01
For the last four centuries stargazers have turned their telescopes to the night skies to look at its wonders, but only in this age of computers has it become possible to let the telescope find for you the object you are looking for! So-called “go-to” telescopes are programmed with the locations of thousands of objects, including dazzling distant Suns, stunning neighboring galaxies, globular and open star clusters, the remnants of past supernovae, and many other breathtaking sights. This book does not tell you how to use your Go-to telescope. Your manual will help you do that. It tells you what to look for in the deep sky and why, and what equipment to best see it with. Organized broadly by what is best for viewing in the northern hemisphere in different seasons, Monks further divides the sights of each season into groupings such as “Showpiece Objects,” “Interesting Deep Sky Objects,” and “Obscure and Challenging Deep Sky Objects.” He also tells what objects are visible even in light-polluted ...
Telescoping cylindrical piezoelectric fiber composite actuator assemblies
Allison, Sidney G. (Inventor); Shams, Qamar A. (Inventor); Fox, Robert L. (Inventor); Fox, legal representative, Christopher L. (Inventor); Fox Chattin, legal representative, Melanie L. (Inventor)
2010-01-01
A telescoping actuator assembly includes a plurality of cylindrical actuators in a concentric arrangement. Each cylindrical actuator is at least one piezoelectric fiber composite actuator having a plurality of piezoelectric fibers extending parallel to one another and to the concentric arrangement's longitudinal axis. Each cylindrical actuator is coupled to concentrically-adjacent ones of the cylindrical actuators such that the plurality of cylindrical actuators can experience telescopic movement. An electrical energy source coupled to the cylindrical actuators applies actuation energy thereto to generate the telescopic movement.
Neutrino telescopes sensitivity to dark matter
International Nuclear Information System (INIS)
Albuquerque, I.F.M.; Lamoureux, J.; Smoot, G.F.
2002-01-01
The nature of the dark matter of the Universe is yet unknown and most likely is connected with new physics. The search for its composition is underway through direct and indirect detection. Fundamental physical aspects such as energy threshold, geometry and location are taken into account to investigate proposed neutrino telescopes of km3 volume sensitivities to dark matter. These sensitivities are just sufficient to test a few weakly interacting massive particle scenarios. Telescopes of km3 volume, such as IceCube, can definitely discover or exclude superheavy (M>1010 GeV) strong interacting massive particles (simpzillas). Smaller neutrino telescopes such as ANTARES, AMANDA-II and NESTOR can probe a large region of simpzilla parameter space
Origins Space Telescope: Cosmology and Reionization
Vieira, Joaquin Daniel; Origins Space Telescope
2018-01-01
The Origins Space Telescope (OST) is the mission concept for the Far-Infrared Surveyor, a study in development by NASA in preparation for the 2020 Astronomy and Astrophysics Decadal Survey. Origins is planned to be a large aperture, actively-cooled telescope covering a wide span of the mid- to far-infrared spectrum. Its imagers and spectrographs will enable a variety of surveys of the sky that will discover and characterize the most distant galaxies, Milky-Way, exoplanets, and the outer reaches of our Solar system. Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s. The Science and Technology Definition Team (STDT) would like to hear your science needs and ideas for this mission. The team can be contacted at firsurveyor_info@lists.ipac.caltech.edu.A core science goal of the OST mission is to study the the cosmological history of star, galaxy, and structure formation into the epoch of reionization (EoR). OST will probe the birth of galaxies through warm molecular hydrogen emission during the cosmic dark ages. Utilizing the unique power of the infrared fine-structure emission lines, OST will trace the rise of metals from the first galaxies until today. It will quantify the dust enrichment history of the Universe, uncover its composition and physical conditions, reveal the first cosmic sources of dust, and probe the properties of the earliest star formation. OST will provide a detailed astrophysical probe into the condition of the intergalactic medium at z > 6 and the galaxies which dominate the epoch of reionization.
Fast Fourier transform telescope
International Nuclear Information System (INIS)
Tegmark, Max; Zaldarriaga, Matias
2009-01-01
We propose an all-digital telescope for 21 cm tomography, which combines key advantages of both single dishes and interferometers. The electric field is digitized by antennas on a rectangular grid, after which a series of fast Fourier transforms recovers simultaneous multifrequency images of up to half the sky. Thanks to Moore's law, the bandwidth up to which this is feasible has now reached about 1 GHz, and will likely continue doubling every couple of years. The main advantages over a single dish telescope are cost and orders of magnitude larger field-of-view, translating into dramatically better sensitivity for large-area surveys. The key advantages over traditional interferometers are cost (the correlator computational cost for an N-element array scales as Nlog 2 N rather than N 2 ) and a compact synthesized beam. We argue that 21 cm tomography could be an ideal first application of a very large fast Fourier transform telescope, which would provide both massive sensitivity improvements per dollar and mitigate the off-beam point source foreground problem with its clean beam. Another potentially interesting application is cosmic microwave background polarization.
A low cost, high performance, 1.2m off-axis telescope built with NG-Xinetics silicon carbide
Rey, Justin J.; Wellman, John A.; Egan, Richard G.; Wollensak, Richard J.
2011-09-01
The search for extrasolar habitable planets is one of three major astrophysics priorities identified for the next decade. These missions demand very high performance visible-wavelength optical imaging systems. Such high performance space telescopes are typically extremely expensive and can be difficult for government agencies to afford in today's economic climate, and most lower cost systems offer little benefit because they fall short on at least one of the following three key performance parameters: imaging wavelength, total system-level wavefront error and aperture diameter. Northrop Grumman Xinetics has developed a simple, lightweight, low-cost telescope design that will address the near-term science objectives of this astrophysics theme with the required optical performance, while reducing the telescope cost by an order of magnitude. Breakthroughs in SiC mirror manufacturing, integrated wavefront sensing, and high TRL deformable mirror technology have finally been combined within the same organization to offer a complete end-to-end telescope system in the lower end of the Class D cost range. This paper presents the latest results of real OAP polishing and metrology data, an optimized optical design, and finite element derived WFE
Liverpool Telescope 2: beginning the design phase
Copperwheat, Christopher M.; Steele, Iain A.; Barnsley, Robert M.; Bates, Stuart D.; Bode, Mike F.; Clay, Neil R.; Collins, Chris A.; Jermak, Helen E.; Knapen, Johan H.; Marchant, Jon M.; Mottram, Chris J.; Piascik, Andrzej S.; Smith, Robert J.
2016-07-01
The Liverpool Telescope is a fully robotic 2-metre telescope located at the Observatorio del Roque de los Muchachos on the Canary Island of La Palma. The telescope began routine science operations in 2004, and currently seven simultaneously mounted instruments support a broad science programme, with a focus on transient followup and other time domain topics well suited to the characteristics of robotic observing. Work has begun on a successor facility with the working title `Liverpool Telescope 2'. We are entering a new era of time domain astronomy with new discovery facilities across the electromagnetic spectrum, and the next generation of optical survey facilities such as LSST are set to revolutionise the field of transient science in particular. The fully robotic Liverpool Telescope 2 will have a 4-metre aperture and an improved response time, and will be designed to meet the challenges of this new era. Following a conceptual design phase, we are about to begin the detailed design which will lead towards the start of construction in 2018, for first light ˜2022. In this paper we provide an overview of the facility and an update on progress.
The Telescope: Outline of a Poetic History
Stocchi, M. P.
2011-06-01
Amongst the first editions of Galileo's books, only the Saggiatore has on its frontispiece the image of the telescope. Indeed, the telescope is not pictured on the very emphatic frontispieces of the other books in which Galileo was presenting and defending the results achieved by his celestial observations, such as the Sidereus Nuncius. Many contemporary scientists denied the reliability of the telescope, and some even refused to look into the eyepiece. In the 16th and 17th century, the lenses, mirrors, and optical devices of extraordinary complexity did not have the main task of leading to the objective truth but obtaining the deformation of the reality by means of amazing effects of illusion. The Baroque art and literature had the aim of surprising, and the artists gave an enthusiastic support to the telescope. The poems in praise of Galileo's telescopic findings were quite numerous, including Adone composed by Giovanni Battista Marino, one of the most renowned poets of the time. The Galilean discoveries were actually accepted by the poets as ideologically neutral contributions to the "wonder" in spite they were rejected or even condemned by the scientists, philosophers, and theologians.
Development and Performances of the Magic Telescope
Bastieri, D.; Bigongiari, C.; Dazzi, F.; Mariotti, M.; Moralejo, A.; Peruzzo, L.; Saggion, A.; Tonello, N.
2002-11-01
The MAGIC Collaboration is building an imaging Čerenkov telescope at La Palma site (2200 m a.s.l.), in the Canary Islands, to observe gamma rays in the hundred-GeV region. The MAGIC telescope, with its reflecting parabolic dish, 17 m in diameter, and a two-level pattern trigger designed to cope with severe trigger rates, is the Čerenkov telescope with the lowest envisaged energy threshold. Due to its lightweight alto-azimuthal mounting, MAGIC can be repositioned in less than 30 seconds, becoming the only detector, with an adequate effective area, capable to observe GRB phenomena above 30 GeV. MAGIC telescope is characterised by a 30 GeV energy threshold and a sensitivity of 6×l0-11 cm-2s-1 for a 5σ-detection in 50-hours of observation. In this report, some future scientific goals for MAGIC will be highlighted and the technical development for the main elements of the telescope will be detailed. Special emphasis will be given to the construction of the individual metallic mirrors which form the reflecting surface and the development of the fast pattern-recognition trigger.
A new concept of imaging system: telescope windows
Bourgenot, Cyril; Cowie, Euan; Young, Laura; Love, Gordon; Girkin, John; Courtial, Johannes
2018-02-01
A Telescope window is a novel concept of transformation-optics consisting of an array of micro-telescopes, in our configuration, of a Galilean type. When the array is considered as one multifaceted device, it acts as a traditional Galilean telescope with distinctive and attractive properties such as compactness and modularity. Each lenslet, can in principle, be independently designed for a specific optical function. In this paper, we report on the design, manufacture and prototyping, by diamond precision machining, of 2 concepts of telescope windows, and discuss both their performances and limitations with a view to use them as potential low vision aid devices to support patients with macular degeneration.
GISOT: a giant solar telescope
Hammerschlag, Robert H.; von der Lühe, Oskar F.; Bettonvil, Felix C.; Jägers, Aswin P.; Snik, Frans
2004-10-01
A concept is presented for an extremely large high-resolution solar telescope with an aperture of 11 m and diffraction limited for visual wavelengths. The structure of GISOT will be transparent to wind and placed on a transparent stiff tower. For efficient wind flushing, all optics, including the primary mirror, will be located above the elevation axis. The aperture will be of the order of 11 m, not rotatively symmetrical, but of an elongated shape with dimensions 11 x 4 m. It consists of a central on-axis 4 m mirror with on both sides 3 pieces of 2 m mirrors. The optical layout will be kept simple to guarantee quality and minimize stray light. A Coudé room for instruments is planned below the telescope. The telescope will not be housed in a dome-like construction, which interferes with the open principle. Instead the telescope will be protected by a foldable tent construction with a diameter of the order of 30 m, which doesn"t form any obstruction during observations, but can withstand the severe weather circumstances on mountain sites. Because of the nature of the solar scene, extremely high resolution in only one dimension is sufficient to solve many exciting problems in solar physics and in this respect the concept of GISOT is very promising.
Undergraduate Education with the WIYN 0.9-m Telescope
Pilachowski, Catherine A.
2017-01-01
Several models have been explored at Indiana University Bloomington for undergraduate student engagement in astronomy using the WIYN 0.9-m telescope at Kitt Peak. These models include individual student research projects using the telescope, student observations as part of an observational techniques course for majors, and enrichment activities for non-science majors in general education courses. Where possible, we arrange for students to travel to the telescope. More often, we are able to use simple online tools such as Skype and VNC viewers to give students an authentic observing experience. Experiences with the telescope motivate students to learn basic content in astronomy, including the celestial sphere, the electromagnetic spectrum, telescopes and detectors, the variety of astronomical objects, date reduction processes, image analysis, and color image creation and appreciation. The WIYN 0.9-m telescope is an essential tool for our program at all levels of undergraduate education
Ground-based telescope pointing and tracking optimization using a neural controller.
Mancini, D; Brescia, M; Schipani, P
2003-01-01
Neural network models (NN) have emerged as important components for applications of adaptive control theories. Their basic generalization capability, based on acquired knowledge, together with execution rapidity and correlation ability between input stimula, are basic attributes to consider NN as an extremely powerful tool for on-line control of complex systems. By a control system point of view, not only accuracy and speed, but also, in some cases, a high level of adaptation capability is required in order to match all working phases of the whole system during its lifetime. This is particularly remarkable for a new generation ground-based telescope control system. Infact, strong changes in terms of system speed and instantaneous position error tolerance are necessary, especially in case of trajectory disturb induced by wind shake. The classical control scheme adopted in such a system is based on the proportional integral (PI) filter, already applied and implemented on a large amount of new generation telescopes, considered as a standard in this technological environment. In this paper we introduce the concept of a new approach, the neural variable structure proportional integral, (NVSPI), related to the implementation of a standard multi layer perceptron network in new generation ground-based Alt-Az telescope control systems. Its main purpose is to improve adaptive capability of the Variable structure proportional integral model, an already innovative control scheme recently introduced by authors [Proc SPIE (1997)], based on a modified version of classical PI control model, in terms of flexibility and accuracy of the dynamic response range also in presence of wind noise effects. The realization of a powerful well tested and validated telescope model simulation system allowed the possibility to directly compare performances of the two control schemes on simulated tracking trajectories, revealing extremely encouraging results in terms of NVSPI control robustness and
Technology demonstration of starshade manufacturing for NASA's Exoplanet mission program
Kasdin, N. J.; Lisman, D.; Shaklan, S.; Thomson, M.; Cady, E.; Martin, S.; Marchen, L.; Vanderbei, R. J.; Macintosh, B.; Rudd, R. E.; Savransky, D.; Mikula, J.; Lynch, D.
2012-09-01
It is likely that the coming decade will see the development of a large visible light telescope with enabling technology for imaging exosolar Earthlike planets in the habitable zone of nearby stars. One such technology utilizes an external occulter, a satellite flying far from the telescope and employing a large screen, or starshade, to suppress the incoming starlight suffciently for detecting and characterizing exoplanets. This trades the added complexity of building the precisely shaped starshade and flying it in formation against simplifications in the telescope since extremely precise wavefront control is no longer necessary. In this paper we present the results of our project to design, manufacture, and measure a prototype occulter petal as part of NASA's first Technology Development for Exoplanet Missions program. We describe the mechanical design of the starshade and petal, the precision manufacturing tolerances, and the metrology approach. We demonstrate that the prototype petal meets the requirements and is consistent with a full-size occulter achieving better than 10-10 contrast.
Schraml, J
1972-01-01
An on-line computer control process developed for the 100-m radio telescope of the Max-Planck-Institut fur Radioastronomie in Bonn is described. The instrument is the largest fully steerable antenna in the world. Its operation started on May 31st 1972. It is controlled by a Ferranti Argus 500 on-line computer. The first part of the paper deals with the process itself, the radio telescope and its operation, and the demands resulting for the control program. The second part briefly describes the computer and its hardware. The final part introduces the architecture of the executive program in general, which has been tailored to meet the demands of the process and the hardware. The communication between the observer and the system, the format of data on magnetic tape and an on-line reduction of position measurements are considered. (0 refs).
The JCMT Telescope Management System
Tilanus, Remo P. J.; Jenness, Tim; Economou, Frossie; Cockayne, Steve
Established telescopes often face a challenge when trying to incorporate new software standards and utilities into their existing real-time control system. At the JCMT we have successfully added important new features such as a Relational Database (the Telescope Management System---TMS), an online data Archive, and WWW based utilities to an, in part, 10-year old system. The new functionality was added with remarkably few alterations to the existing system. We are still actively expanding and exploring these new capabilities.
Development of Slewing Mirror Telescope Optical System for the UFFO-pathfinder
DEFF Research Database (Denmark)
Jeong, S.; Nam, J.W.; Ahn, K.-B.
2013-01-01
The Slewing Mirror Telescope (SMT) is the UV/optical telescope of UFFO-pathfinder. The SMT optical system is a Ritchey-Chrétien (RC) telescope of 100 mm diameter pointed by means of a gimbal-mounted flat mirror in front of the telescope. The RC telescope has a 17 × 17arcmin2 in Field of View and ...
Academic Training: Deep Space Telescopes
Françoise Benz
2006-01-01
2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 20, 21, 22, 23, 24 February from 11:00 to 12:00 - Council Chamber on 20, 21, 23, 24 February, TH Auditorium, bldg 4 - 3-006, on 22 February Deep Space Telescopes G. BIGNAMI / CNRS, Toulouse, F & Univ. di Pavia, I The short series of seminars will address results and aims of current and future space astrophysics as the cultural framework for the development of deep space telescopes. It will then present such new tools, as they are currently available to, or imagined by, the scientific community, in the context of the science plans of ESA and of all major world space agencies. Ground-based astronomy, in the 400 years since Galileo's telescope, has given us a profound phenomenological comprehension of our Universe, but has traditionally been limited to the narrow band(s) to which our terrestrial atmosphere is transparent. Celestial objects, however, do not care about our limitations, and distribute most of the information about their physics thro...
ALMA Telescope Reaches New Heights
2009-09-01
ball at a distance of nine miles, and to keep their smooth reflecting surfaces accurate to less than the thickness of a human hair. Once the transporter reached the high plateau it carried the antenna to a concrete pad -- a docking station with connections for power and fiber optics -- and positioned it with an accuracy of a small fraction of an inch. The transporter is guided by a laser steering system and, just like some cars, also has ultrasonic collision detectors. These sensors ensure the safety of the state-of-the-art antennas as the transporter drives them across what will soon be a rather crowded plateau. Ultimately, ALMA will have at least 66 antennas distributed over about 200 pads, spread over distances of up to 11.5 miles and operating as a single, giant telescope. Even when ALMA is fully operational, the transporters will be used to move the antennas between pads to reconfigure the telescope for different kinds of observations. This first ALMA antenna at the high site will soon be joined by others, and the ALMA team looks forward to making their first observations from the Chajnantor plateau. They plan to link three antennas by early 2010, and to make the first scientific observations with ALMA in the second half of 2011. ALMA will help astronomers answer important questions about our cosmic origins. The telescope will observe the Universe using light with millimeter and submillimeter wavelengths, between infrared light and radio waves in the electromagnetic spectrum. Light at these wavelengths comes from some of the coldest, and from some of the most distant objects in the cosmos. These include cold clouds of gas and dust where new stars are being born, or remote galaxies towards the edge of the observable universe. The Universe is relatively unexplored at submillimeter wavelengths, as the telescopes need extremely dry atmospheric conditions, such as those at Chajnantor, and advanced detector technology. The Atacama Large Millimeter/submillimeter Array
Observations of Anomalous Refraction with Co-housed Telescopes
Taylor, Malinda S.; McGraw, J. T.; Zimmer, P. C.
2013-01-01
Anomalous refraction is described as a low frequency, large angular scale motion of the entire image plane with respect to the celestial coordinate system as observed and defined by previous astrometric catalogs. These motions of typically several tenths of an arcsecond with timescales on the order of ten minutes are ubiquitous to drift-scan ground-based astrometric measurements regardless of location or telescopes used and have been attributed to meter scale slowly evolving coherent dynamical structures in the boundary-layer below 60 meters. The localized nature of the effect and general inconsistency of the motions seen by even closely spaced telescopes in individual domes has led to the hypothesis that the dome or other type of telescope housing may be responsible. This hypothesis is tested by observing anomalous refraction using two telescopes housed in a single roll-off roof observatory building with the expected outcome that the two telescopes will see correlated anomalous refraction induced motions.
Simulation of the Simbol-X Telescope
International Nuclear Information System (INIS)
Chauvin, M.; Roques, J. P.
2009-01-01
We have developed a simulation tool for a Wolter I telescope operating in formation flight. The aim is to understand and predict the behavior of the Simbol-X instrument. As the geometry is variable, formation flight introduces new challenges and complex implications. Our code, based on Monte Carlo ray tracing, computes the full photon trajectories up to the detector plane, along with the relative drifts of the two spacecrafts. It takes into account angle and energy dependent interactions of the photons with the mirrors and applies to any grazing incidence telescope. The resulting images of simulated sources from 0.1 keV to 100 keV allow us to optimize the configuration of the instrument and to assess the performance of the Simbol-X telescope.
Simulation of the Simbol-X Telescope
Chauvin, M.; Roques, J. P.
2009-05-01
We have developed a simulation tool for a Wolter I telescope operating in formation flight. The aim is to understand and predict the behavior of the Simbol-X instrument. As the geometry is variable, formation flight introduces new challenges and complex implications. Our code, based on Monte Carlo ray tracing, computes the full photon trajectories up to the detector plane, along with the relative drifts of the two spacecrafts. It takes into account angle and energy dependent interactions of the photons with the mirrors and applies to any grazing incidence telescope. The resulting images of simulated sources from 0.1 keV to 100 keV allow us to optimize the configuration of the instrument and to assess the performance of the Simbol-X telescope.
The VTIE telescope resource management system
Busschots, B.; Keating, J. G.
2005-06-01
The VTIE Telescope Resource Management System (TRMS) provides a frame work for managing a distributed group of internet telescopes as a single "Virtual Observatory". The TRMS provides hooks which allow for it to be connected to any Java Based web portal and for a Java based scheduler to be added to it. The TRMS represents each telescope and observatory in the system with a software agent and then allows the scheduler and web portal to communicate with these distributed resources in a simple transparent way, hence allowing the scheduler and portal designers to concentrate only on what they wish to do with these resources rather than how to communicate with them. This paper outlines the structure and implementation of this frame work.
The pinwheel pupil discovery: exoplanet science & improved processing with segmented telescopes
Breckinridge, James Bernard
2018-01-01
In this paper, we show that by using a “pinwheel” architecture for the segmented primary mirror and curved supports for the secondary mirror, we can achieve a near uniform diffraction background in ground and space large telescope systems needed for high SNR exoplanet science. Also, the point spread function will be nearly rotationally symmetric, enabling improved digital image reconstruction. Large (>4-m) aperture space telescopes are needed to characterize terrestrial exoplanets by direct imaging coronagraphy. Launch vehicle volume constrains these apertures are segmented and deployed in space to form a large mirror aperture that is masked by the gaps between the hexagonal segments and the shadows of the secondary support system. These gaps and shadows over the pupil result in an image plane point spread function that has bright spikes, which may mask or obscure exoplanets.These telescope artifact mask faint exoplanets, making it necessary for the spacecraft to make a roll about the boresight and integrate again to make sure no planets are missed. This increases integration time, and requires expensive space-craft resources to do bore-sight roll.Currently the LUVOIR and HabEx studies have several significant efforts to develop special purpose A/O technology and to place complex absorbing apodizers over their Hex pupils to shape the unwanted diffracted light. These strong apodizers absorb light, decreasing system transmittance and reducing SNR. Implementing curved pupil obscurations will eliminate the need for the highly absorbing apodizers and thus result in higher SNR.Quantitative analysis of diffraction patterns that use the pinwheel architecture are compared to straight hex-segment edges with a straight-line secondary shadow mask to show a gain of over a factor of 100 by reducing the background. For the first-time astronomers are able to control and minimize image plane diffraction background “noise”. This technology will enable 10-m segmented
Direct illumination LED calibration for telescope photometry
International Nuclear Information System (INIS)
Barrelet, E.; Juramy, C.
2008-01-01
A calibration method for telescope photometry, based on the direct illumination of a telescope with a calibrated light source regrouping multiple LEDs, is proposed. Its purpose is to calibrate the instrument response. The main emphasis of the proposed method is the traceability of the calibration process and a continuous monitoring of the instrument in order to maintain a 0.2% accuracy over a period of years. Its specificity is to map finely the response of the telescope and its camera as a function of all light ray parameters. This feature is essential to implement a computer model of the instrument representing the variation of the overall light collection efficiency of each pixel for various filter configurations. We report on hardware developments done for SNDICE, the first application of this direct illumination calibration system which will be installed in Canada France Hawaii telescope (CFHT) for its leading supernova experiment (SNLS)
Valsecchi, G.; Banham, R.; Bianucci, G.; Eder, J.; Ghislanzoni, R.; Ritucci, A.; Terraneo, M.; Zocchi, F. E.; Smith, D.; Gale, D.; Hughes, D.
2016-07-01
The Large Millimeter Telescope (LMT) Alfonso Serrano is a 50 m diameter single-dish radio telescope optimized for astronomical observations at wavelengths of about a millimeter. Built and operated by the Instituto Nacional de Astrofísica, Óptica y Electrónica (INAOE) in collaboration with the University of Massachusetts (UMASS), the telescope is located at the 4600 m summit of volcano Sierra Negra, Mexico. Anticipating the completion of the main reflector, currently operating over a 32 m subaperture, INAOE has contracted Media Lario for the design and manufacturing of a new 2.63 m subreflector that will enable higher efficiency astronomical observations with the entire main reflector surface. The new subreflector manufactured by Media Lario is segmented in 9 smaller panels, one central dome and eight identical petals, assembled and precisely aligned on a steel truss structure that will be connected to the hexapod mounted on the tetrapod head. Each panel was fabricated with Media Lario's unique laminated technology consisting of front and rear Nickel skins, electroformed from precise molds and bonded to a lightweight Aluminum honeycomb core. The reflecting surface of each panel was given a thin galvanic Rhodium coating that ensures that the reflector survives the harsh environmental conditions at the summit of Sierra Negra during the 30 year lifetime of the telescope. Finally, the 2.63 m subreflector produced by Media Lario was qualified for typical cold night through hot day observation conditions with a maximum RMS error of 24.8 μm, which meets INAOE's requirements.
Far Sidelobes Measurement of the Atacama Cosmology Telescope
Duenner, Rolando; Gallardo, Patricio; Wollack, Ed; Henriquez, Fernando; Jerez-Hanckes, Carlos
2012-01-01
The Atacama Cosmology Telescope (ACT) is a 6m telescope designed to map the Cosmic Microwave Background (CMB) simultaneously at 145GHz, 220 GHz and 280 GHz. Its off-axis Gregorian design is intended to minimize and control the off-axis sidelobe response, which is critical for scientific purposes. The expected sidelobe level for this kind of design is less than -50 dB and can be challenging to measure. Here we present a measurement of the 145 GHz far sidelobes of ACT done on the near-field of the telescope. We used a 1 mW microwave source placed 13 meters away from the telescope and a chopper wheel to produce a varying signal that could be detected by the camera for different orientations of the telescope. The source feed was designed to produce a wide beam profile. Given that the coupling is expected to be dominated by diffraction over the telescope shielding structure, when combined with a measurements of the main beam far field response, these measurement can be used to validate elements of optical design and constrain the level of spurious coupling at large angles. Our results show that the diffractive coupling beyond the ground screen is consistently below -75 dB, satisfying the design expectations.
Strebel, Christoph
2006-01-01
Galileo's publication of observations made with his newly reinvented telescope provoked a fierce debate. In April 1610 Martinus Horky, a young Bohemian astronomer, had an opportunity to make his own observations with Galileo's telescope in the presence of Antonio Magini and other astronomers. Horky and the other witnesses denied the adequacy of Galileo's telescope and therefore the bona fides of his discoveries. Kepler conjectured Horky as well as all his witnesses to be myopic. But Kepler's objection could not stop the publication of Horky's Peregrinatio contra nuncium sidereum (Modena, 1610), the first printed refutation of Galileo's Sidereus nuncius. In his treatise, Horky adresses four questions: 1) Do the four newly observed heavenly bodies actually exist? Horky denies their existence on various grounds: a) God, as every astronomer teaches, has created only seven moveable heavenly bodies and astronomical knowledge originates in God, too. b) Heavenly bodies are either stars or planets. Galileo's moveable heavenly bodies fit into neither category. c) If they do exist, why have they not already been observed by other scholars? Horky concludes that there are no such heavenly bodies. 2) What are these phenomena? They are purely artefactual, and produced by Galileo's telescope. 3) How are they like? Galileo's "stars" are so small as to be almost invisible. Galileo claims that he has measured their distances from each other. This however is impossible due to their diminutive size and other observational problems. Hence, Galileo's claim is a further proof that he is a fraud. 4) Why are they? For Galileo they are a chance to earn money but for astronomers like Horky they are a reason to offer thanks and honour to God. Horky's treatise was favourably received by the enemies of Galileo. But Kepler's critique was devastating. After calling on Kepler in Prague, Horky had to revoke the contents of his book.
The Associate Principal Astronomer for AI Management of Automatic Telescopes
Henry, Gregory W.
1998-01-01
This research program in scheduling and management of automatic telescopes had the following objectives: 1. To field test the 1993 Automatic Telescope Instruction Set (ATIS93) programming language, which was specifically developed to allow real-time control of an automatic telescope via an artificial intelligence scheduler running on a remote computer. 2. To develop and test the procedures for two-way communication between a telescope controller and remote scheduler via the Internet. 3. To test various concepts in Al scheduling being developed at NASA Ames Research Center on an automatic telescope operated by Tennessee State University at the Fairborn Observatory site in southern Arizona. and 4. To develop a prototype software package, dubbed the Associate Principal Astronomer, for the efficient scheduling and management of automatic telescopes.
Clarke, Fraser; Lynn, James; Thatte, Niranjan; Tecza, Matthias
2014-08-01
We have developed a simple but effective guider for use with the Oxford-SWIFT integral field spectrograph on the Palomar 200-inch telescope. The guider uses mainly off-the-shelf components, including commercial amateur astronomy software to interface with the CCD camera, calculating guiding corrections, and send guide commands to the telescope. The only custom piece of software is an driver to provide an interface between the Palomar telescope control system and the industry standard 'ASCOM' system. Using existing commercial software provided a very cheap guider (guiding, and could easily be adapted to any other professional telescope
NASA funding opportunities for optical fabrication and testing technology development
Stahl, H. Philip
2013-09-01
NASA requires technologies to fabricate and test optical components to accomplish its highest priority science missions. The NRC ASTRO2010 Decadal Survey states that an advanced large-aperture UVOIR telescope is required to enable the next generation of compelling astrophysics and exo-planet science; and, that present technology is not mature enough to affordably build and launch any potential UVOIR mission concept. The NRC 2012 NASA Space Technology Roadmaps and Priorities Report states that the highest priority technology in which NASA should invest to `Expand our understanding of Earth and the universe' is next generation X-ray and UVOIR telescopes. Each of the Astrophysics division Program Office Annual Technology Reports (PATR) identifies specific technology needs. NASA has a variety of programs to fund enabling technology development: SBIR (Small Business Innovative Research); the ROSES APRA and SAT programs (Research Opportunities in Space and Earth Science; Astrophysics Research and Analysis program; Strategic Astrophysics Technology program); and several Office of the Chief Technologist (OCT) programs.
Telescope Construction: A Hands-On Approach to Astronomy Education
Sarrazine, Angela R.; Albin, E.
2009-01-01
We report on a popular semester-long telescope making course offered at Fernbank Science Center in Atlanta, GA. The program is tailored for junior / senior level high school students and incorporates the current educational performance standards for the state of Georgia. This course steps out of the traditional classroom environment and allows students to explore optics and astronomical concepts by constructing their own telescopes. Student telescopes follow the classic six-inch f/8 Newtonian reflector design, which has proven to be a good compromise between portability and aperture. Participants meet for a few hours, twice weekly, to build their telescopes. Over the course of the semester, raw one-inch thick Pyrex mirror blanks are ground, polished, and figured by hand into precision telescope objectives. Along the way, students are introduced to the Ronchi and Foucault methods for testing optics and once figured, completed mirrors are then chemically silvered. A plywood Dobsonian-style base is built and eventually mated with an optical tube made from a standard eight-inch concrete form tube or sonotube. An evening of star testing the optics and observation is planned at the end of the semester to insure the proper operation of each telescope. In summary, we believe that a hands-on approach to the understanding and use of optical telescopes is a great way not only to instill enthusiasm among students for the night sky, but may perhaps inspire the next generation of professional telescope makers.
Hubble Space Telescope, Faint Object Camera
1981-01-01
This drawing illustrates Hubble Space Telescope's (HST's), Faint Object Camera (FOC). The FOC reflects light down one of two optical pathways. The light enters a detector after passing through filters or through devices that can block out light from bright objects. Light from bright objects is blocked out to enable the FOC to see background images. The detector intensifies the image, then records it much like a television camera. For faint objects, images can be built up over long exposure times. The total image is translated into digital data, transmitted to Earth, and then reconstructed. The purpose of the HST, the most complex and sensitive optical telescope ever made, is to study the cosmos from a low-Earth orbit. By placing the telescope in space, astronomers are able to collect data that is free of the Earth's atmosphere. The HST detects objects 25 times fainter than the dimmest objects seen from Earth and provides astronomers with an observable universe 250 times larger than visible from ground-based telescopes, perhaps as far away as 14 billion light-years. The HST views galaxies, stars, planets, comets, possibly other solar systems, and even unusual phenomena such as quasars, with 10 times the clarity of ground-based telescopes. The HST was deployed from the Space Shuttle Discovery (STS-31 mission) into Earth orbit in April 1990. The Marshall Space Flight Center had responsibility for design, development, and construction of the HST. The Perkin-Elmer Corporation, in Danbury, Cornecticut, developed the optical system and guidance sensors.
SETIBURST: A Robotic, Commensal, Realtime Multi-science Backend for the Arecibo Telescope
Energy Technology Data Exchange (ETDEWEB)
Chennamangalam, Jayanth; Karastergiou, Aris; Williams, Christopher [Astrophysics, University of Oxford, Denys Wilkinson Building, Keble Road, Oxford OX1 3RH (United Kingdom); MacMahon, David; Cobb, Jeff; Siemion, Andrew P. V.; Gajjar, Vishal; Werthimer, Dan [Department of Astronomy, University of California Berkeley, Berkeley, CA 94720 (United States); Rajwade, Kaustubh; Lorimer, Duncan R.; McLaughlin, Maura A. [Department of Physics and Astronomy, West Virginia University, P.O. Box 6315, Morgantown, WV 26506 (United States); Armour, Wes, E-mail: jayanth@astro.ox.ac.uk [Oxford e-Research Centre, University of Oxford, Keble Road, Oxford OX1 3QG (United Kingdom)
2017-02-01
Radio astronomy has traditionally depended on observatories allocating time to observers for exclusive use of their telescopes. The disadvantage of this scheme is that the data thus collected is rarely used for other astronomy applications, and in many cases, is unsuitable. For example, properly calibrated pulsar search data can, with some reduction, be used for spectral line surveys. A backend that supports plugging in multiple applications to a telescope to perform commensal data analysis will vastly increase the science throughput of the facility. In this paper, we present “SETIBURST,” a robotic, commensal, realtime multi-science backend for the 305 m Arecibo Telescope. The system uses the 1.4 GHz, seven-beam Arecibo L -band Feed Array (ALFA) receiver whenever it is operated. SETIBURST currently supports two applications: SERENDIP VI, a SETI spectrometer that is conducting a search for signs of technological life, and ALFABURST, a fast transient search system that is conducting a survey of fast radio bursts (FRBs). Based on the FRB event rate and the expected usage of ALFA, we expect 0–5 FRB detections over the coming year. SETIBURST also provides the option of plugging in more applications. We outline the motivation for our instrumentation scheme and the scientific motivation of the two surveys, along with their descriptions and related discussions.
SETIBURST: A Robotic, Commensal, Realtime Multi-science Backend for the Arecibo Telescope
International Nuclear Information System (INIS)
Chennamangalam, Jayanth; Karastergiou, Aris; Williams, Christopher; MacMahon, David; Cobb, Jeff; Siemion, Andrew P. V.; Gajjar, Vishal; Werthimer, Dan; Rajwade, Kaustubh; Lorimer, Duncan R.; McLaughlin, Maura A.; Armour, Wes
2017-01-01
Radio astronomy has traditionally depended on observatories allocating time to observers for exclusive use of their telescopes. The disadvantage of this scheme is that the data thus collected is rarely used for other astronomy applications, and in many cases, is unsuitable. For example, properly calibrated pulsar search data can, with some reduction, be used for spectral line surveys. A backend that supports plugging in multiple applications to a telescope to perform commensal data analysis will vastly increase the science throughput of the facility. In this paper, we present “SETIBURST,” a robotic, commensal, realtime multi-science backend for the 305 m Arecibo Telescope. The system uses the 1.4 GHz, seven-beam Arecibo L -band Feed Array (ALFA) receiver whenever it is operated. SETIBURST currently supports two applications: SERENDIP VI, a SETI spectrometer that is conducting a search for signs of technological life, and ALFABURST, a fast transient search system that is conducting a survey of fast radio bursts (FRBs). Based on the FRB event rate and the expected usage of ALFA, we expect 0–5 FRB detections over the coming year. SETIBURST also provides the option of plugging in more applications. We outline the motivation for our instrumentation scheme and the scientific motivation of the two surveys, along with their descriptions and related discussions.
SETIBURST: A Robotic, Commensal, Realtime Multi-science Backend for the Arecibo Telescope
Chennamangalam, Jayanth; MacMahon, David; Cobb, Jeff; Karastergiou, Aris; Siemion, Andrew P. V.; Rajwade, Kaustubh; Armour, Wes; Gajjar, Vishal; Lorimer, Duncan R.; McLaughlin, Maura A.; Werthimer, Dan; Williams, Christopher
2017-02-01
Radio astronomy has traditionally depended on observatories allocating time to observers for exclusive use of their telescopes. The disadvantage of this scheme is that the data thus collected is rarely used for other astronomy applications, and in many cases, is unsuitable. For example, properly calibrated pulsar search data can, with some reduction, be used for spectral line surveys. A backend that supports plugging in multiple applications to a telescope to perform commensal data analysis will vastly increase the science throughput of the facility. In this paper, we present “SETIBURST,” a robotic, commensal, realtime multi-science backend for the 305 m Arecibo Telescope. The system uses the 1.4 GHz, seven-beam Arecibo L-band Feed Array (ALFA) receiver whenever it is operated. SETIBURST currently supports two applications: SERENDIP VI, a SETI spectrometer that is conducting a search for signs of technological life, and ALFABURST, a fast transient search system that is conducting a survey of fast radio bursts (FRBs). Based on the FRB event rate and the expected usage of ALFA, we expect 0-5 FRB detections over the coming year. SETIBURST also provides the option of plugging in more applications. We outline the motivation for our instrumentation scheme and the scientific motivation of the two surveys, along with their descriptions and related discussions.
Studies on a silicon-photomultiplier-based camera for Imaging Atmospheric Cherenkov Telescopes
Arcaro, C.; Corti, D.; De Angelis, A.; Doro, M.; Manea, C.; Mariotti, M.; Rando, R.; Reichardt, I.; Tescaro, D.
2017-12-01
Imaging Atmospheric Cherenkov Telescopes (IACTs) represent a class of instruments which are dedicated to the ground-based observation of cosmic VHE gamma ray emission based on the detection of the Cherenkov radiation produced in the interaction of gamma rays with the Earth atmosphere. One of the key elements of such instruments is a pixelized focal-plane camera consisting of photodetectors. To date, photomultiplier tubes (PMTs) have been the common choice given their high photon detection efficiency (PDE) and fast time response. Recently, silicon photomultipliers (SiPMs) are emerging as an alternative. This rapidly evolving technology has strong potential to become superior to that based on PMTs in terms of PDE, which would further improve the sensitivity of IACTs, and see a price reduction per square millimeter of detector area. We are working to develop a SiPM-based module for the focal-plane cameras of the MAGIC telescopes to probe this technology for IACTs with large focal plane cameras of an area of few square meters. We will describe the solutions we are exploring in order to balance a competitive performance with a minimal impact on the overall MAGIC camera design using ray tracing simulations. We further present a comparative study of the overall light throughput based on Monte Carlo simulations and considering the properties of the major hardware elements of an IACT.
Proxy magnetometry with the Dutch Open Telescope
Rutten, R.J.; Hammerschlag, R.H.; Sütterlin, P.; Bettonvil, F.C.M.
1999-01-01
Superb movies from the Dutch Open Telescope (DOT) on La Palma have proven the validity of the open concept of this innovative telescope for high-resolution imaging of the solar atmosphere. A five- camera speckle-burst registration system is being installed that should permit consistent and
Planetary Sciences practical experiences at the Master level with small telescopes
Sanchez-Lavega, A.; Perez-Hoyos, S.; del Rio-Gaztelurrutia, T.; Hueso, R.; Ordonez Etxeberria, I.; Rojas, J. F.
2016-12-01
The Master in Space Science and Technology of the Basque Country University UPV/EHU in Bilbao (Spain) has been taught during 7 years (A. Sanchez-Lavega et al., Eur. J. of Eng. Education. 2014). Along the different courses, a series of practical observations and studies of planetary sciences have been conducted with Master students, using telescopes with diameters in the range 28-50 cm pertaining to the Aula EspaZio Gela Observatory (http://www.ehu.eus/aula-espazio/presentacion.html). Simple instrumentation (cameras and a spectrograph) have been employed to study planetary atmospheres (dynamics and cloud structure) and orbital mechanics using the Galilean satellites. Here we present a sample of these studies, which have lead to publications in refereed journals and have been presented at different meetings with the coauthoring of the students. Plans for the future include involving the master students in high-resolution observations of Solar System planets using a remote controlled 36 cm telescope at the Calar Alto observatory in Southern Spain (separated 1000 km from the teaching facilities in Bilbao).
Developments of next generation monitor and control systems for radio telescopes
Kodilkar, J.; Uprade, R.; Nayak, S.; Wadadekar, Y.; Chengalur, J.; Gupta, Y.
2013-04-01
As part of the ongoing upgrade of the GMRT observatory, the monitor and control (M&C) system is being upgraded to a modern specification driven system. The basic building block of the proposed M&C framework is a SACE node which provides command, response and event data streaming interfaces to the child and parent nodes running locally or remotely in a heterogeneous operating system environment. A prototype M&C system formed by hierarchically composing SACE nodes at different levels has been successfully tested at the GMRT. For the recently built 15m antenna at NCRA, a generic, web based M&C system has been developed which allows remote, authenticated operation. We discuss issues relevant to the development of the next generation M&C systems for radio telescopes using the lessons learned from these two systems. We also summarize flexible, reusable and cost-effective approaches using off the shelf packages and technologies used in generic frameworks, which can contribute to form the basis for M&C systems of very large radio telescopes like the SKA.
Developments of next generation monitor and control systems for radio telescopes
International Nuclear Information System (INIS)
Kodilkar, J; Uprade, R; Nayak, S; Wadadekar, Y; Chengalur, J; Gupta, Y
2013-01-01
As part of the ongoing upgrade of the GMRT observatory, the monitor and control (M and C) system is being upgraded to a modern specification driven system. The basic building block of the proposed M and C framework is a SACE node which provides command, response and event data streaming interfaces to the child and parent nodes running locally or remotely in a heterogeneous operating system environment. A prototype M and C system formed by hierarchically composing SACE nodes at different levels has been successfully tested at the GMRT. For the recently built 15m antenna at NCRA, a generic, web based M and C system has been developed which allows remote, authenticated operation. We discuss issues relevant to the development of the next generation M and C systems for radio telescopes using the lessons learned from these two systems. We also summarize flexible, reusable and cost-effective approaches using off the shelf packages and technologies used in generic frameworks, which can contribute to form the basis for M and C systems of very large radio telescopes like the SKA.
Possible GRB Observation with the MAGIC Telescope
Bastieri, D.; Bigongiari, C.; Mariotti, M.; Peruzzo, L.; Saggion, A.
2001-08-01
The MAGIC Telescope, with its reflecting parabolic dish of 17 m of diameter and its careful design of a robust, lightweight, alto-azimuthal mount, is an ideal detector for GRB phenomena. The telescope is an air Cherenkov telescope that, even in the first phase, equipped with standard PMTs, can reach an energy threshold below 30 GeV. The threshold is going to drop well below 10 GeV in the envisaged second phase, when chamber PMTs will be substituted by high quantum efficiency APDs. The telescope can promptly respond to GRB alerts coming, for instance, from GCN, and can reposition itself in less than 30 seconds, 20 seconds being the time to turn half a round for the azimuth bearing. In this report, the effective area of the detector as a function of energy and zenith angle is taken into account, in order to evaluate the expected yearly occurrence and the response to different kinds of GRBs.
Space telescopes capturing the rays of the electromagnetic spectrum
English, Neil
2017-01-01
Space telescopes are among humankind’s greatest scientific achievements of the last fifty years. This book describes the instruments themselves and what they were designed to discover about the Solar System and distant stars. Exactly how these telescopes were built and launched and the data they provided is explored. Only certain kinds of radiation can penetrate our planet's atmosphere, which limits what we can observe. But with space telescopes all this changed. We now have the means to "see" beyond Earth using ultraviolet, microwave, and infrared rays, X-rays and gamma rays. In this book we meet the pioneers and the telescopes that were built around their ideas. This book looks at space telescopes not simply chronologically but also in order of the electromagnetic spectrum, making it possible to understand better why they were made.
The Space Infrared Interferometric Telescope (SPIRIT)
Leisawitz, David T.
2014-01-01
The far-infrared astrophysics community is eager to follow up Spitzer and Herschel observations with sensitive, high-resolution imaging and spectroscopy, for such measurements are needed to understand merger-driven star formation and chemical enrichment in galaxies, star and planetary system formation, and the development and prevalence of water-bearing planets. The Space Infrared Interferometric Telescope (SPIRIT) is a wide field-of-view space-based spatio-spectral interferometer designed to operate in the 25 to 400 micron wavelength range. This talk will summarize the SPIRIT mission concept, with a focus on the science that motivates it and the technology that enables it. Without mentioning SPIRIT by name, the astrophysics community through the NASA Astrophysics Roadmap Committee recently recommended this mission as the first in a series of space-based interferometers. Data from a laboratory testbed interferometer will be used to illustrate how the spatio-spectral interferometry technique works.
New technologies and new performances of the JCMT radio-telescope: a preliminary design study
Mian, S.; De Lorenzi, S.; Ghedin, L.; Rampini, F.; Marchiori, G.; Craig, S.
2012-09-01
With a diameter of 15m the James Clerk Maxwell Telescope (JCMT) is the largest astronomical telescope in the world designed specifically to operate in the submillimeter wavelength region of the spectrum. It is situated close to the summit of Mauna Kea, Hawaii, at an altitude of 4092m. Its primary reflector currently consists of a steel geodesic supporting structure and pressed aluminium panels on a passive mount. The major issues of the present reflector are its thermal stability and its panels deterioration. A preliminary design study for the replacement of the JCMT antenna dish is here presented. The requested shape error for the new reflector is <20μm RMS. The proposed solution is based on a semi-monocoque backing structure made of CFRP and on high precision electroformed panels. The choice of CFRP for the backing structure allows indeed to improve the antenna performance in terms of both stiffness and thermal stability, so that the required surface accuracy of the primary can be achieved even by adopting a passive panels system. Moreover thanks to CFRP, a considerable weight reduction of the elevation structure can be attained. The performance of the proposed solution for the JCMT antenna has been investigated through FE analyses and the assessed deformation of the structure under different loading cases has been taken into account for subsequent error budgeting. Results show that the proposed solution is in line with the requested performance. With this new backing structure, the JCMT would have the largest CFRP reflector ever built.
A semiconductor counter telescope for neutron reaction studies
Energy Technology Data Exchange (ETDEWEB)
Lalovic, B I; Ajdacic, V S [Institute of nuclear sciences Boris Kidric, Vinca, Beograd (Yugoslavia)
1963-12-15
A counter telescope consisting of two or three semiconductor counters for {delta}E/{delta}x vs. E analysis was made for studying nuclear reactions induced by 14.4 MeV neutrons. Various factors important for the telescope performance are discussed in details and some solutions for getting an optimum resolution and a low background are given. Protons, deuterons and alpha particles resulting from scattering and reactions of 14.4 MeV neutrons on deuterium, tritium, praseodymium and niobium were detected, and pulses from the counters recorded on a two-dimensional analyzer. These experiments have shown that the telescope compares favorably with other types of telescopes with regards to the upper limit of neutron flux which can be used, (DELTADELTA)x and E resolution, versatility and compactness (author)
Smith, Denise Anne; Jirdeh, Hussein; Eisenhamer, Bonnie; Villard, Ray; Green, Joel David
2015-08-01
As the science operations center for the Hubble Space Telescope and the James Webb Space Telescope, the Space Telescope Science Institute (STScI) is uniquely positioned to captivate the imagination and inspire learners of all ages in humanity’s quest to understand fundamental questions about our universe and our place in it. This presentation will provide an overview of the impact of the STScI’s Office of Public Outreach’s efforts to engage students, educators, and the public in exploring the universe through audience-based news, education, and outreach programs.At the heart of our programs lies a tight coupling of scientific, education, and communications expertise. By partnering scientists and educators, we assure current, accurate science content and education products and programs that are classroom-ready and held to the highest pedagogical standards. Likewise, news and outreach programs accurately convey cutting-edge science and technology in a way that is attuned to audience needs. The combination of Hubble’s scientific capabilities, majestic imagery, and our deep commitment to create effective programs to share Hubble science with the education community and the public, has enabled the STScI Office of Public Outreach programs to engage 6 million students and ½ million educators per year, and 24 million online viewers per year. Hubble press releases generate approximately 5,000 online news articles per year with an average circulation of 125 million potential readers per press release news story. We will also share how best practices and lessons learned from this long-lived program are already being applied to engage a new generation of explorers in the science and technology of the James Webb Space Telescope.
Imagine Astronomy at the Rochester Institute of Technology
Rapson, Valerie; Almeyda, T.; Freeman, M.; Lena, D.; Principe, D.; Punzi, K.; Sargent, B. A.; Vaddi, S.; Vazquez, B.; Vorobiev, D.
2014-01-01
The Imagine RIT Innovation and Creativity Festival is an annual free event held each year on the campus of the Rochester Institute of Technology (RIT). The purpose of the festival is to showcase the work and research conducted by students and faculty at RIT, and get the public excited about science and technology. For the past three years, graduate students, post-docs and faculty in the Astrophysical Sciences and Technology graduate program at RIT have participated in the festival by showcasing their astronomy research in a fun, interactive and hands on way. We have presented work conducted with various telescopes in the fields of star formation and galaxy evolution. Here, we present our three unique exhibits and the public’s reception to each exhibit. We found that interactive games such as astro-trivia, and hands on activities such as building a scale model of the Hubble Space Telescope were the most exciting for visitors. Interactive pieces of the exhibit in general acquired the most attention, whereas posters and videos, despite their pictorial nature, were not as well received. The most successful piece of our exhibit each year has been solar observing through eclipse glasses and telescopes. Most people who observed the sun at our exhibit were left awe-struck because this was their first experience viewing an astronomical object through a telescope. We plan to improve upon our exhibit by introducing more hands-on activities that will engage the public in current astronomy research at RIT.
LCOGT: A World-Wide Network of Robotic Telescopes
Brown, T.
2013-05-01
Las Cumbres Observatory Global Telescope (LCOGT) is an organization dedicated to time-domain astronomy. To carry out the necessary observations in fields such as supernovae, extrasolar planets, small solar-system bodies, and pulsating stars, we have developed and are now deploying a set of robotic optical telescopes at sites around the globe. In this talk I will concentrate on the core of this network, consisting of up to 15 identical 1m telescopes deployed across multiple sites in both the northern and southern hemispheres. I will summarize the technical and performance aspect of these telescopes, including both their imaging and their anticipated spectroscopic capabilities. But I will also delve into the network organization, including communication among telescopes (to assure that observations are properly carried out), interactions among the institutions and scientists who will use the network (to optimize the scientific returns), and our funding model (which until now has relied entirely on one private donor, but will soon require funding from outside sources, if the full potential of the network is to be achieved).
Coronagraphic Wavefront Control for the ATLAST-9.2m Telescope
Lyon, RIchard G.; Oegerle, William R.; Feinberg, Lee D.; Bolcar, Matthew R.; Dean, Bruce H.; Mosier, Gary E.; Postman, Marc
2010-01-01
The Advanced Technology for Large Aperture Space Telescope (ATLAST) concept was assessed as one of the NASA Astrophysics Strategic Mission Concepts (ASMC) studies. Herein we discuss the 9.2-meter diameter segmented aperture version and its wavefront sensing and control (WFSC) with regards to coronagraphic detection and spectroscopic characterization of exoplanets. The WFSC would consist of at least two levels of sensing and control: (i) an outer coarser level of sensing and control to phase and control the segments and secondary mirror in a manner similar to the James Webb Space Telescope but operating at higher temporal bandwidth, and (ii) an inner, coronagraphic instrument based, fine level of sensing and control for both amplitude and wavefront errors operating at higher temporal bandwidths. The outer loop would control rigid-body actuators on the primary and secondary mirrors while the inner loop would control one or more segmented deformable mirror to suppress the starlight within the coronagraphic field-of view. Herein we discuss the visible nulling coronagraph (VNC) and the requirements it levies on wavefront sensing and control and show the results of closed-loop simulations to assess performance and evaluate the trade space of system level stability versus control bandwidth.
Coronagraphic wavefront control for the ATLAST 9.2m telescope
Lyon, Richard G.; Oegerle, William R.; Feinberg, Lee D.; Bolcar, Matthew R.; Dean, Bruce H.; Mosier, Gary E.; Postman, Marc
2010-07-01
The Advanced Technology for Large Aperture Space Telescope (ATLAST) concept was assessed as one of the NASA Astrophysics Strategic Mission Concepts (ASMC) studies. Herein we discuss the 9.2-meter diameter segmented aperture version and its wavefront sensing and control (WFSC) with regards to coronagraphic detection and spectroscopic characterization of exoplanets. The WFSC would consist of at least two levels of sensing and control: (i) an outer coarser level of sensing and control to phase and control the segments and secondary mirror in a manner similar to the James Webb Space Telescope but operating at higher temporal bandwidth, and (ii) an inner, coronagraphic instrument based, fine level of sensing and control for both amplitude and wavefront errors operating at higher temporal bandwidths. The outer loop would control rigid-body actuators on the primary and secondary mirrors while the inner loop would control one or more segmented deformable mirror to suppress the starlight within the coronagraphic field-of-view. Herein we discuss the visible nulling coronagraph (VNC) and the requirements it levies on wavefront sensing and control and show the results of closed-loop simulations to assess performance and evaluate the trade space of system level stability versus control bandwidth.
CLIC Telescope optimization with ALLPIX simulation
Qi, Wu
2015-01-01
A simulation study of CLIC-EUDET telescope resolution with MIMOSA 26 as reference sensors under DESY (5.6 GeV electron beam) and CERN-SPS (120-180 GeV pion^{-} beam) conditions. During the study, a virtual DUT sensor with cylindrical sensing area was defined and used with ALLPIX software. By changing the configuration of telescope, some results for DESY's setup were found agreeing with the theoretical calculation.
New infrared telescopic observation of Vesta
Palomba, E.; D'Aversa, E.; Sato, T.; Longobardo, A.; Aoki, S.; Sindoni, G.; Oliva, F.
2017-09-01
In this work we present new telescopic observations of the Vesta asteroid made at the Subaru Telescope by using the COMICS IR spectrometer. We were able to obtain 5 different observations in 5 day, at two different epochs. The obtained spectra do not exhibit Reststrahlen bands and show only weak features attributable to the Christiansen peak and to the transparency feature compatible with a fine grain size regolith.
Leveraging Emerging Technologies in Outreach for JWST
Meinke, Bonnie K.; Green, Joel D.; Smith, Louis Chad; Smith, Denise A.; Lawton, Brandon L.; Gough, Michael
2017-10-01
The James Webb Space Telescope (JWST) is NASA’s next great observatory, launching in October 2018. How will we maintain the prestige and cultural impact of the Hubble Space Telescope as the torch passes to Webb? Emerging technologies such as augmented (AR) and virtual reality (VR) bring the viewer into the data and introduce the telescope in previously unimaginable immersive detail. Adoption of mobile devices, many of which easily support AR and VR, has expanded access to information for wide swaths of the public. From software like Worldwide Telescope to hardware like the HTC Vive, immersive environments are providing new avenues for learning. If we develop materials properly tailored to these media, we can reach more diverse audiences than ever before. STScI is piloting tools related to JWST to showcase at DPS, and in local events, which I highlight here.
The Timepix3 Telescope for LHCb Upgrade RD 1 measurements
Saunders, Daniel Martin
2016-01-01
The Timepix3 telescope is a high rate, data driven beam telescope created for LHCb upgrade studies, such as sensor performance for prototypes of the vertex locator (VELO) upgrade. When testing VELO prototypes the readout is identical to the telescope, and additionally, a simple way to integrate triggers from other detectors is also provided, allowing tracks to be synchronised offline with other devices under test. Examples of LHCb upgrade detectors which have been qualified with the Timepix3 telescope are the Upstream Tracker (UT), Scintillating Fibres (SciFi), Ring Imaging CHerenkov (RICH), and Time Of internally Reflected CHerenkov light (TORCH). The telescope was installed in the SPS North hall at CERN. It consists of 8 planes with 300 μ m p-on-n silicon sensors read out by Timepix3 ASICs. Tracks measured with the telescope have excellent temporal ( ∼ 1 ns) and spatial resolution ( 2 μ m). The telescope has been operated with a rate of tracks written to disk up to 5 MHz - limited only by conditions at ...
Rise to SUMMIT: the Sydney University Multiple-Mirror Telescope
Moore, Anna M.; Davis, John
2000-07-01
The Sydney University Multiple Mirror Telescope (SUMMIT) is a medium-sized telescope designed specifically for high resolution stellar spectroscopy. Throughout the design emphasis has been placed on high efficiency at low cost. The telescope consists of four 0.46 m diameter mirrors mounted on a single welded steel frame. Specially designed mirror cells support and point each mirror, allowing accurate positioning of the images on optical fibers located at the foci of the mirrors. Four fibers convey the light to the future location of a high resolution spectrograph away from the telescope in a stable environment. An overview of the commissioning of the telescope is presented, including the guidance and automatic mirror alignment and focussing systems. SUMMIT is located alongside the Sydney University Stellar Interferometer at the Paul Wild Observatory, near Narrabri, Northern New South Wales.
The NASA Spitzer Space Telescope.
Gehrz, R D; Roellig, T L; Werner, M W; Fazio, G G; Houck, J R; Low, F J; Rieke, G H; Soifer, B T; Levine, D A; Romana, E A
2007-01-01
The National Aeronautics and Space Administration's Spitzer Space Telescope (formerly the Space Infrared Telescope Facility) is the fourth and final facility in the Great Observatories Program, joining Hubble Space Telescope (1990), the Compton Gamma-Ray Observatory (1991-2000), and the Chandra X-Ray Observatory (1999). Spitzer, with a sensitivity that is almost three orders of magnitude greater than that of any previous ground-based and space-based infrared observatory, is expected to revolutionize our understanding of the creation of the universe, the formation and evolution of primitive galaxies, the origin of stars and planets, and the chemical evolution of the universe. This review presents a brief overview of the scientific objectives and history of infrared astronomy. We discuss Spitzer's expected role in infrared astronomy for the new millennium. We describe pertinent details of the design, construction, launch, in-orbit checkout, and operations of the observatory and summarize some science highlights from the first two and a half years of Spitzer operations. More information about Spitzer can be found at http://spitzer.caltech.edu/.
Mobile Tracking Systems Using Meter Class Reflective Telescopes
Sturzenbecher, K.; Ehrhorn, B.
This paper is a discussion on the use of large reflective telescopes on mobile tracking systems with modern instrument control systems. Large optics can be defined as reflective telescopes with an aperture of at least 20 inches in diameter. New carbon composite construction techniques allow for larger, stronger, and lighter telescopes ranging from 240 pounds for a 20 inch, to 800 pounds for a 32 inch, making them ideal for mobile tracking systems. These telescopes have better light gathering capability and produce larger images with greater detail at a longer range than conventional refractive lenses. In a mobile configuration these systems provide the ability to move the observation platform to the optimal location anywhere in the world. Mounting and systems integration - We will discuss how large telescopes can be physically fit to the mobile tracking system and the integration with the tracking systems' digital control system. We will highlight the remote control capabilities. We will discuss special calibration techniques available in a modern instrument control system such as star calibration, calibration of sensors. Tracking Performance - We will discuss the impact of using large telescopes on the performance of the mobile tracking system. We will highlight the capabilities for auto-tracking and sidereal rate tracking in a mobile mount. Large optics performance - We will discuss the advantages of two-mirror Ritchey-Chrétien reflective optics which offer in-focus imaging across the spectrum, from visible to Long Wave Infrared. These zero expansion optics won't lose figure or focus during temperature changes. And the carbon composite telescope tube is thermally inert. The primary mirror is a modern lightweight "dish" mirror for low thermal mass and is center supported/self balancing. Applications - We will discuss Visible - IR Imaging requirements, Optical Rangefinders, and capabilities for special filters to increase resolution in difficult conditions such as
CERN. Geneva
2006-01-01
The short series of seminars will address results and aims of current and future space astrophysics as the cultural framework for the development of deep space telescopes. It will then present such new tools, as they are currently available to, or imagined by, the scientific community, in the context of the science plans of ESA and of all major world space agencies. Ground-based astronomy, in the 400 years since Galileo’s telescope, has given us a profound phenomenological comprehension of our Universe, but has traditionally been limited to the narrow band(s) to which our terrestrial atmosphere is transparent. Celestial objects, however, do not care about our limitations, and distribute most of the information about their physics throughout the complete electromagnetic spectrum. Such information is there for the taking, from millimiter wavelengths to gamma rays. Forty years astronomy from space, covering now most of the e.m. spectrum, have thus given us a better understanding of our physical Universe then t...
A Possible Technology Development Path to Direct Imaging of Exo-Earths from Space
Siegler, Nicholas
2018-01-01
We describe a possible roadmap to achieving the technological capability to search for biosignatures on an Earth-like exoplanet from a future space telescope. The detection of Earth-like exoplanets in the habitable zone of their stars, and their spectroscopic characterization in a search for biosignatures, requires starlight suppression that exceeds the current best ground-based performance by orders of magnitude. The required planet/star brightness ratio of order 1e-10 at visible wavelengths can be obtained by blocking stellar photons with an occulter, either externally (a starshade) or internally (a coronagraph) to the telescope system, and managing diffracted starlight, so as to directly image the exoplanet in reflected starlight. Coronagraph instruments require advancement in telescope aperture (either monolithic or segmented), aperture obscurations (obscured by secondary mirror and its support struts), and wavefront error sensitivity (e.g. line-of-sight jitter, telescope vibration, polarization). The starshade, which has never been used in a science application, benefits a mission by being decoupled from the telescope, allowing a loosening of telescope stability requirements. In doing so, it transfers the difficult technology from the telescope system to a large deployable structure (tens of meters to greater than ~ 100 m in diameter) that must be positioned precisely at a distance of tens of thousands of kilometers from the telescope. Two ongoing mission concept studies, HabEx and LUVOIR, include the direct imaging of Earth-sized habitable exoplanets as a central science theme.
Hubble Space Telescope via the Web
O'Dea, Christopher P.
The Space Telescope Science Institute (STScI) makes available a wide variety of information concerning the Hubble Space Telescope (HST) via the Space Telescope Electronic Information Service (STEIS). STEIS is accessible via anonymous ftp, gopher, WAIS, and WWW. The information on STEIS includes how to propose for time on the HST, the current status of HST, reports on the scientific instruments, the observing schedule, data reduction software, calibration files, and a set of publicly available images in JPEG, GIF and TIFF format. STEIS serves both the astronomical community as well as the larger Internet community. WWW is currently the most widely used interface to STEIS. Future developments on STEIS are expected to include larger amounts of hypertext, especially HST images and educational material of interest to students, educators, and the general public, and the ability to query proposal status.
Thermal Design and Thermal Behaviour of Radio Telescopes and their Enclosures
Greve, Albert
2010-01-01
Radio telescopes as well as communication antennas operate under the influence of gravity, temperature and wind. Among those, temperature influences may degrade the performance of a radio telescope through transient changes of the focus, pointing, path length and sensitivity, often in an unpredictable way. Thermal Design and Thermal Behaviour of Radio Telescopes and their Enclosures reviews the design and construction principles of radio telescopes in view of thermal aspects and heat transfer with the variable thermal environment; it explains supporting thermal model calculations and the application and efficiency of thermal protection and temperature control; it presents many measurements illustrating the thermal behaviour of telescopes in the environment of their observatory sites. The book benefits scientists and radio/communication engineers, telescope designers and construction firms as well as telescope operators, observatory staff, but also the observing astronomer who is directly confronted with the t...
A monolithic silicon detector telescope
International Nuclear Information System (INIS)
Cardella, G.; Amorini, F.; Cabibbo, M.; Di Pietro, A.; Fallica, G.; Franzo, G.; Figuera, P.; Papa, M.; Pappalardo, G.; Percolla, G.; Priolo, F.; Privitera, V.; Rizzo, F.; Tudisco, S.
1996-01-01
An ultrathin silicon detector (1 μm) thick implanted on a standard 400 μm Si-detector has been built to realize a monolithic telescope detector for simultaneous charge and energy determination of charged particles. The performances of the telescope have been tested using standard alpha sources and fragments emitted in nuclear reactions with different projectile-target colliding systems. An excellent charge resolution has been obtained for low energy (less than 5 MeV) light nuclei. A multi-array lay-out of such detectors is under construction to charge identify the particles emitted in reactions induced by low energy radioactive beams. (orig.)
Artificial Intelligence in Autonomous Telescopes
Mahoney, William; Thanjavur, Karun
2011-03-01
Artificial Intelligence (AI) is key to the natural evolution of today's automated telescopes to fully autonomous systems. Based on its rapid development over the past five decades, AI offers numerous, well-tested techniques for knowledge based decision making essential for real-time telescope monitoring and control, with minimal - and eventually no - human intervention. We present three applications of AI developed at CFHT for monitoring instantaneous sky conditions, assessing quality of imaging data, and a prototype for scheduling observations in real-time. Closely complementing the current remote operations at CFHT, we foresee further development of these methods and full integration in the near future.
NASA 3D Models: James Webb Space Telescope
National Aeronautics and Space Administration — The James Webb Space Telescope (JWST) will be a large infrared telescope with a 6.5-meter primary mirror. The project is working to a 2018 launch date. The JWST will...
Energy Technology Data Exchange (ETDEWEB)
Gascon, D; Sanuy, A; Ribo, M [Dept. AM i Dept.ECM, Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona, Marti i Franques 1, E08028, Barcelona (Spain); Delagnes, E; Glicenstein, J-F [IRFU/DSM/CEA, CE-Saclay, Bat. 141 SEN Saclay, F-91191, Gif-sur-Yvette (France); Sieiro, X [Departament d' Electronica, Universitat de Barcelona, Marti i Franques 1, E08028, Barcelona (Spain); Feinstein, F; Vorobiov, S [LPTA, Universite Montpellier II and IN2P3/CNRS, Montpellier (France); Nayman, P; Toussenel, F; Tavernet, J-P; Vincent, P, E-mail: gascon@ecm.ub.es [LPNHE, Universite Paris VI and IN2P3/CNRS, Paris (France)
2010-12-15
A fully differential wideband amplifier for the camera of the Cherenkov Telescope Array (CTA) is presented. This amplifier would be part of a new ASIC, developed by the NECTAr collaboration, performing the digitization at 1 GS/s with a dynamic range of 16 bits. Input amplifiers must have a voltage gain up to 20 V/V and a bandwidth of 400 MHz. Being impossible to design a fully differential operational amplifier with an 8 GHz GBW product in a 0.35{mu}m CMOS technology, an alternative implementation based on HF linearised transconductors is explored. Test results show that the required GBW product is achieved, with a linearity error smaller than 1% for a differential output voltage range up to 1 Vpp, and smaller than 3% for 2 Vpp.
International Nuclear Information System (INIS)
Gascon, D; Sanuy, A; Ribo, M; Delagnes, E; Glicenstein, J-F; Sieiro, X; Feinstein, F; Vorobiov, S; Nayman, P; Toussenel, F; Tavernet, J-P; Vincent, P
2010-01-01
A fully differential wideband amplifier for the camera of the Cherenkov Telescope Array (CTA) is presented. This amplifier would be part of a new ASIC, developed by the NECTAr collaboration, performing the digitization at 1 GS/s with a dynamic range of 16 bits. Input amplifiers must have a voltage gain up to 20 V/V and a bandwidth of 400 MHz. Being impossible to design a fully differential operational amplifier with an 8 GHz GBW product in a 0.35μm CMOS technology, an alternative implementation based on HF linearised transconductors is explored. Test results show that the required GBW product is achieved, with a linearity error smaller than 1% for a differential output voltage range up to 1 Vpp, and smaller than 3% for 2 Vpp.
The next generation balloon-borne large aperture submillimeter telescope (BLAST-TNG)
Dober, Bradley Jerald
Large areas of astrophysics, such as precision cosmology, have benefited greatly from large maps and datasets, yielded by telescopes of ever-increasing number and ability. However, due to the unique challenges posed by submillimeter polarimetry, the study of molecular cloud dynamics and star formation remain stunted. Previously, polarimetry data was limited to a few vectors on only the brightest areas of molecular clouds. This made drawing statistically-driven conclusions a daunting task. However, the successful flight of the Balloon-born Large Aperture Submillimeter Telescope for Polarimetry (BLASTPol) generated maps with thousands of independent polarization measurements of molecular clouds, and ushered in a new era of empirical modeling of molecular cloud dynamics. Now that the potential benefits from large-scale maps of magnetic fields in molecular clouds had been identified, a successor that would truly unlock the secrets must be born. The Next Generation Balloon-borne Large Aperture Submillimeter Telescope (BLAST-TNG), the successor to BLASTPol, has the ability to make larger and more detailed maps of magnetic fields in molecular clouds. It will push the field of star formation into a statistics-driven, empirical realm. With these large, detailed datasets, astronomers will be able to find new relationships between the dust dynamics and the magnetic fields. The field will surge to a new level of understanding. One of the key enabling technologies of BLAST-TNG is its three arrays of polarization-sensitive Microwave Kinetic Inductance Detectors (MKIDs). MKIDs are superconducting RLC circuits with a resonant frequency that shifts proportionally to the amount of incident radiation. The key feature of MKIDs is that thousands of detectors, each with their own unique resonant frequency, can be coupled to the same readout line. This technology will be able to drive the production of large-scale monolithic arrays, containing tens or hundreds of thousands of detectors
The Origins Space Telescope (OST)
Staguhn, Johannes
2018-01-01
The Origins Space Telescope is the mission concept for the Far-Infrared Surveyor, one of the four science and technology definition studies to be submitted by NASA Headquarters to the 2020 Astronomy and Astrophysics Decadal survey. The observatory will provide orders of magnitude improvements in sensitivity over prior missions, in particular for spectroscopy, enabling breakthrough science across astrophysics. The observatory will cover a wavelength range between 5 μm and 600 μm in order to enable the study of the formation of proto-planetary disks, detection of bio-signatures from extra-solar planet's atmospheres, characterization of the first galaxies in the universe, and many more. The five instruments that are currently studied are two imaging far-infrared spectrometers using incoherent detectors, providing up to R 10^5 spectral resolution, one far-infrared infrared heterodyne instrument for even higher spectral resolving powers, one far-infrared continuum imager and polarimeter, plus a mid-infrared coronagraph with imaging and spectroscopy mode. I will describe the scientific and technical capabilities of the observatory with focus on the expected synergies with AtLAST.
Young Astronomers' Observe with ESO Telescopes
1995-11-01
Today, forty 16-18 year old students and their teachers are concluding a one-week, educational `working visit' to the ESO Headquarters in Garching (See ESO Press Release 14/95 of 8 November 1995). They are the winners of the Europe-wide contest `Europe Towards the Stars', organised by ESO with the support of the European Union, under the auspices of the Third European Week for Scientific and Technological Culture. From November 14-20, they have worked with professional ESO astronomers in order to get insight into the methods and principles of modern astronomy and astrophysics, as carried out at one of the world's foremost international centres. This included very successful remote observations with the ESO 3.5-m New Technology Telescope (NTT) and the 1.4-m Coude Auxiliary Telescope (CAT) via a satellite link between the ESO Headquarters and the La Silla observatory in Chile, 12,000 kilometres away. After a general introduction to modern astronomy on the first day of the visit, the participants divided into six teams, according to their interests. Some chose to observe distant galaxies, others prefered to have a closer look on binary stars, and one team decided to investigate a star which is thought to be surrounded by a proto-planetary system. Each team was supported by an experienced ESO astronomer. Then followed the observations at the remote consoles during three nights, the first at the NTT and the following at the CAT. Each team had access to the telescope during half a night. Although the work schedule - exactly as in `real' science - was quite hard, especially during the following data reduction and interpretative phase, all teams managed extremely well and in high spirits. The young astronomers' observations were favoured by excellent atmospheric conditions. At the NTT, the seeing was better than 0.5 arcsecond during several hours, an exceptional value that allows very good images to be obtained. All observations represent solid and interesting science, and
PROMPT: Panchromatic Robotic Optical Monitoring and Polarimetry Telescopes
Energy Technology Data Exchange (ETDEWEB)
Reichart, D.; Nysewander, M.; Moran, J. [North Carolina Univ., Chapel Hill (United States). Department of Physics and Astronomy] (and others)
2005-07-15
Funded by $1.2M in grants and donations, we are now building PROMPT at CTIO. When completed in late 2005, PROMPT will consist of six 0.41-meter diameter Ritchey-Chretien telescopes on rapidly slewing mounts that respond to GRB alerts within seconds, when the afterglow is potentially extremely bright. Each mirror and camera coating is being optimized for a different wavelength range and function, including a NIR imager, two red-optimized imager, a blue-optimized imager, an UV-optimized imager, and an optical polarimeter. PROMPT will be able to identify high-redshift events by dropout and distinguish these events from the similar signatures of extinction. In this way, PROMPT will act a distance-finder scope for spectroscopic follow up on the larger 4.1-meter diameter SOAR telescope, which is also located at CTIO. When not chasing GRBs, PROMPT serves broader educational objectives across the state of north Carolina. Enclosure construction and the first two telescopes are now complete and functioning: PROMPT observed Swift's first GRB in December 2004. We upgrade from two to four telescope in February 2005 and from four to six telescopes in mid-2005.
Placco, Vinicius M.; Frebel, Anna; Beers, Timothy C.; Yoon, Jinmi; Chiti, Anirudh; Heger, Alexander; Chan, Conrad; Casey, Andrew R.; Christlieb, Norbert
2016-12-01
We report on the first high-resolution spectroscopic analysis of HE 0020-1741, a bright (V = 12.9), ultra metal-poor ([{Fe}/{{H}}] = -4.1), carbon-enhanced ([{{C}}/{Fe}] = +1.7) star selected from the Hamburg/ESO Survey. This star exhibits low abundances of neutron-capture elements ([{Ba}/{Fe}] = -1.1) and an absolute carbon abundance A(C) = 6.1 based on either criterion, HE 0020-1741 is subclassified as a carbon-enhanced metal-poor star without enhancements in neutron-capture elements (CEMP-no). We show that the light-element abundance pattern of HE 0020-1741 is consistent with predicted yields from a massive (M = 21.5 {M}⊙ ), primordial-composition, supernova (SN) progenitor. We also compare the abundance patterns of other ultra metal-poor stars from the literature with available measures of C, N, Na, Mg, and Fe abundances with an extensive grid of SN models (covering the mass range 10{--}100 {M}⊙ ), in order to probe the nature of their likely stellar progenitors. Our results suggest that at least two classes of progenitors are required at [{Fe}/{{H}}] \\lt -4.0, as the abundance patterns for more than half of the sample studied in this work (7 out of 12 stars) cannot be easily reproduced by the predicted yields. Based on observations gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile, and the New Technology Telescope (NTT) of the European Southern Observatory (088.D-0344A), La Silla, Chile.
The Atacama Cosmology Telescope: The Receiver and Instrumentation
Swetz, D. S.; Ade, P. A. R.; Amiri, M.; Appel, J. W.; Burger, B.; Devlin, M. J.; Dicker, S. R.; Doriese, W. B.; Essinger-Hileman, T.; Fisher, R. P.;
2010-01-01
The Atacama Cosmology Telescope was designed to measure small-scale anisotropies in the Cosmic Microwave Background and detect galaxy clusters through the Sunyaev-Zel'dovich effect. The instrument is located on Cerro Taco in the Atacama Desert, at an altitude of 5190 meters. A six-met.er off-axis Gregorian telescope feeds a new type of cryogenic receiver, the Millimeter Bolometer Array Camera. The receiver features three WOO-element arrays of transition-edge sensor bolometers for observations at 148 GHz, 218 GHz, and 277 GHz. Each detector array is fed by free space mm-wave optics. Each frequency band has a field of view of approximately 22' x 26'. The telescope was commissioned in 2007 and has completed its third year of operations. We discuss the major components of the telescope, camera, and related systems, and summarize the instrument performance.
Emerging Technologies and Outreach with JWST
Green, Joel D.; Smith, Denise A.; Meinke, Bonnie K.; Lawton, Brandon L.; Kenney, Jessica; Jirdeh, Hussein
2017-06-01
The James Webb Space Telescope (JWST), NASA’s next great observatory launching in October 2018, required a dozen new technologies to develop. How will we maintain the prestige and cultural impact of Hubble as the torch passes to Webb? Emerging technologies such as augmented and virtual reality bring the viewer into the data and the concept in previously unimaginable immersive detail. Adoption of mobile devices has expanded access to information for wide swaths of the public. Software like Worldwide Telescope to hardware like the Occulus Rift are providing new avenues for learning. If we develop materials properly tailored to this medium, we can reach more diverse audiences than ever before. STScI is pioneering some tools related to JWST for showcasing at AAS, and in local events, which I highlight here.
LYCORIS - A Large Area Strip Telescope
Krämer, U; Stanitzki, M; Wu, M
2018-01-01
The LYCORIS Large Area Silicon Strip Telescope for the DESY II Test Beam Facility is presented. The DESY II Test Beam Facility provides elec- tron and positron beams for beam tests of up to 6 GeV. A new telescope with a large 10 × 20 cm2 coverage area based on a 25 μm pitch strip sensor is to be installed within the PCMAG 1 T solenoid. The current state of the system is presented.
The Southern African Large Telescope project
Buckley, David A. H.; Charles, Philip A.; Nordsieck, Kenneth H.; O'Donoghue, Darragh
The recently completed Southern African Large Telescope (SALT) is a low cost, innovative, 10 m class optical telescope, which began limited scientific operations in August 2005, just 5 years after ground-breaking. This paper describes the design and construction of SALT, including the first-light instruments, SALTICAM and the Robert Stobie Spectrograph (RSS). A rigorous systems engineering approach has ensured that SALT was built to specification, on budget, close to the original schedule and using a relatively small project team. The design trade-offs, which include an active spherical primary mirror array and a fixed altitude telescope with a prime focus tracker, although restrictive in comparison to conventional telescopes, have resulted in an affordable 10 m class telescope for South Africa and its ten partners. Coupled with an initial set of two seeing-limited instruments that concentrate on the UV-visible region (320 - 900 nm) and featuring some niche observational capabilities, SALT will have an ability to conduct some unique science. This includes high time resolution studies, for which some initial results have already been obtained. Many of the versatile modes available with the RSS - which is currently being commissioned - are unique and provide unparallelled opportunities for imaging polarimetry and spectropolarimetry. Likewise, Multi-Object Spectroscopy (with slit masks) and imaging spectroscopy with the RSS, the latter using Fabry-Perot étalons and interference filters, will extend the multiplex advantage over resolutions from 300 to 9000 and fields of view of 2 to 8 arcminutes. Future instrumentation plans include an extremely stable, fibre-fed, high resolution échelle spectrograph and a near-IR (to between 1.5 to 1.7 μm) extension to the RSS. Future development possibilities include phasing the primary mirror and AO. Finally, extrapolations of the SALT/HET designs to ELT proportions remain viable and are surely more affordable than conventional
Calibration strategies for the Cherenkov Telescope Array
Gaug, Markus; Berge, David; Daniel, Michael; Doro, Michele; Förster, Andreas; Hofmann, Werner; Maccarone, Maria C.; Parsons, Dan; de los Reyes Lopez, Raquel; van Eldik, Christopher
2014-08-01
The Central Calibration Facilities workpackage of the Cherenkov Telescope Array (CTA) observatory for very high energy gamma ray astronomy defines the overall calibration strategy of the array, develops dedicated hardware and software for the overall array calibration and coordinates the calibration efforts of the different telescopes. The latter include LED-based light pulsers, and various methods and instruments to achieve a calibration of the overall optical throughput. On the array level, methods for the inter-telescope calibration and the absolute calibration of the entire observatory are being developed. Additionally, the atmosphere above the telescopes, used as a calorimeter, will be monitored constantly with state-of-the-art instruments to obtain a full molecular and aerosol profile up to the stratosphere. The aim is to provide a maximal uncertainty of 10% on the reconstructed energy-scale, obtained through various independent methods. Different types of LIDAR in combination with all-sky-cameras will provide the observatory with an online, intelligent scheduling system, which, if the sky is partially covered by clouds, gives preference to sources observable under good atmospheric conditions. Wide-field optical telescopes and Raman Lidars will provide online information about the height-resolved atmospheric extinction, throughout the field-of-view of the cameras, allowing for the correction of the reconstructed energy of each gamma-ray event. The aim is to maximize the duty cycle of the observatory, in terms of usable data, while reducing the dead time introduced by calibration activities to an absolute minimum.
Application of Molecular Adsorber Coatings in Chamber A for the James Webb Space Telescope
Abraham, Nithin S.
2017-01-01
As a coating made of highly porous zeolite materials, the Molecular Adsorber Coating (MAC) was developed to capture outgassed molecular contaminants, such as hydrocarbons and silicones. For spaceflight applications, the adsorptive capabilities of the coating can alleviate on-orbit outgassing concerns on or near sensitive surfaces and instruments within the spacecraft. Similarly, this sprayable paint technology has proven to be significantly beneficial for ground-based space applications, in particular, for vacuum chamber environments. This presentation describes the application of the MAC technology for the James Webb Space Telescope (JWST) at NASA Johnson Space Center (JSC). The coating was used as a mitigation tool to entrap outgassed contaminants, specifically silicone-based diffusion pump oil, from within JSCs cryogenic optical vacuum chamber test facility called Chamber A. This presentation summarizes the background, fabrication, installation, chemical analysis test results, and future plans for the MAC technology, which was effectively used to protect the JWST test equipment from vacuum chamber contamination. As a coating made of highly porous zeolite materials, the Molecular Adsorber Coating (MAC) was developed to capture outgassed molecular contaminants, such as hydrocarbons and silicones. For spaceflight applications, the adsorptive capabilities of the coating can alleviate on-orbit outgassing concerns on or near sensitive surfaces and instruments within the spacecraft. Similarly, this sprayable paint technology has proven to be significantly beneficial for ground-based space applications, in particular, for vacuum chamber environments. This presentation describes the application of the MAC technology for the James Webb Space Telescope (JWST) at NASA Johnson Space Center (JSC). The coating was used as a mitigation tool to entrap outgassed contaminants, specifically silicone-based diffusion pump oil, from within JSCs cryogenic optical vacuum chamber test
Twelve Years of Education and Public Outreach with the Fermi Gamma-ray Space Telescope
Cominsky, Lynn R.; McLin, K. M.; Simonnet, A.; Fermi E/PO Team
2013-04-01
During the past twelve years, NASA's Fermi Gamma-ray Space Telescope has supported a wide range of Education and Public Outreach (E/PO) activities, targeting K-14 students and the general public. The purpose of the Fermi E/PO program is to increase student and public understanding of the science of the high-energy Universe, through inspiring, engaging and educational activities linked to the mission’s science objectives. The E/PO program has additional more general goals, including increasing the diversity of students in the Science, Technology, Engineering and Mathematics (STEM) pipeline, and increasing public awareness and understanding of Fermi science and technology. Fermi's multi-faceted E/PO program includes elements in each major outcome category: ● Higher Education: Fermi E/PO promotes STEM careers through the use of NASA data including research experiences for students and teachers (Global Telescope Network), education through STEM curriculum development projects (Cosmology curriculum) and through enrichment activities (Large Area Telescope simulator). ● Elementary and Secondary education: Fermi E/PO links the science objectives of the Fermi mission to well-tested, customer-focused and NASA-approved standards-aligned classroom materials (Black Hole Resources, Active Galaxy Education Unit and Pop-up book, TOPS guides, Supernova Education Unit). These materials have been distributed through (Educator Ambassador and on-line) teacher training workshops and through programs involving under-represented students (after-school clubs and Astro 4 Girls). ● Informal education and public outreach: Fermi E/PO engages the public in sharing the experience of exploration and discovery through high-leverage multi-media experiences (Black Holes planetarium and PBS NOVA shows), through popular websites (Gamma-ray Burst Skymap, Epo's Chronicles), social media (Facebook, MySpace), interactive web-based activities (Space Mysteries, Einstein@Home) and activities by
Simulation of Telescope Detectivity for Geo Survey and Tracking
Richard, P.
2014-09-01
As the number of space debris on Earths Orbit increases steadily, the need to survey, track and catalogue them becomes of key importance. In this context, CNES has been using the TAROT Telescopes (Rapid Telescopes for Transient Objects owned and operated by CNRS) for several years to conduct studies about space surveillance and tracking. Today, two testbeds of services using the TAROT telescopes are running every night: one for GEO situational awareness and the second for debris tracking. Additionally to the CNES research activity on space surveillance and tracking domain, an operational collision avoidance service for LEO and GEO satellites is in place at CNES for several years. This service named CAESAR (Conjunction Analysis and Evaluation: Alerts and Recommendations) is used by CNES as well as by external customers. As the optical debris tracking testbed based on TAROT telescopes is the first step toward an operational provider of GEO measures that could be used by CAESAR, simulations have been done to help choosing the sites and types of telescopes that could be added in the GEO survey and debris tracking telescope network. One of the distinctive characteristics of the optical observation of space debris compared to traditional astronomic observation is the need to observe objects at low elevations. The two mains reasons for this are the need to observe the GEO belt from non-equatorial sites and the need to observe debris at longitudes far from the telescope longitude. This paper presents the results of simulations of the detectivity for GEO debris of various telescopes and sites, based on models of the GEO belt, the atmosphere and the instruments. One of the conclusions is that clever detection of faint streaks and spread sources by image processing is one of the major keys to improve the detection of debris on the GEO belt.
Thermal emissivity analysis of a GEMINI 8-meter telescopes design
St. Clair Dinger, Ann
1993-01-01
The GEMINI 8-meter Telescopes Project is designing twin 8-meter telescopes to be located in Hawaii and Chile. The GEMINI telescopes will have interchangeable secondary mirrors for use in the visible and IR. The APART/PADE program is being used to evaluate the effective IR emissivity of the IR configuration plus enclosure as a function of mirror contamination at three IR wavelengths. The goal is to design a telescope whose effective IR emissivity is no more than 2 percent when the mirrors are clean.
Goddard Robotic Telescope (GRT)
National Aeronautics and Space Administration — Since it is not possible to predict when a Gamma-Ray Burst (GRB) occurs, the follow-up ground telescopes must be distributed as uniform as possible all over the...
Enabling Technologies for Characterizing Exoplanet Systems with Exo-C
Cahoy, Kerri Lynn; Belikov, Ruslan; Stapelfeldt, Karl R.; Chakrabarti, Supriya; Trauger, John T.; Serabyn, Eugene; McElwain, Michael W.; Pong, Christopher M.; Brugarolas, Paul
2015-01-01
The Exoplanet Science and Technology Definition Team's Internal Coronagraph mission design, called 'Exo-C', utilizes several technologies that have advanced over the past decade with support from the Exoplanet Exploration Program. Following the flow of photons through the telescope, the science measurement is enabled by (i) a precision pointing system to keep the target exoplanet system precisely positioned on the detector during the integration time, (ii) high-performance coronagraphs to block the parent star's light so that the planet's reflected light can be detected, (iii) a wavefront control system to compensate for any wavefront errors such as those due to thermal or mechanical deformations in the optical path, especially errors with high spatial frequencies that could cause contrast-reducing speckles, and (iv) an integral field spectrograph (IFS) that provides moderate resolution spectra of the target exoplanets, permitting their characterization and comparison with models and other data sets. Technologies such as the wavefront control system and coronagraphs will also benefit from other funded efforts in progress, such as the Wide Field Infrared Survey Telescope Astrophysics Focused Telescope Assets (WFIRST-AFTA) program. Similarly, the Exo-C IFS will benefit from the Prototype Imaging Spectrograph for Coronagraphic Exoplanet Studies (PISCES) demonstration. We present specific examples for each of these technologies showing that the state of the art has advanced to levels that will meet the overall scientific, cost, and schedule requirements of the Exo-C mission. These capabilities have matured with testbed and/or ground-telescope demonstrations and have reached a technological readiness level (TRL) that supports their inclusion in the baseline design for potential flight at the end of this decade. While additional work remains to build and test flight-like components (that concurrently meet science as well as size, weight, power, and environmental
Infrared Astronomy Professional Development for K-12 Educators: WISE Telescope
Borders, Kareen; Mendez, B. M.
2010-01-01
K-12 educators need effective and relevant astronomy professional development. WISE Telescope (Wide-Field Infrared Survey Explorer) and Spitzer Space Telescope Education programs provided an immersive teacher professional development workshop at Arecibo Observatory in Puerto Rico during the summer of 2009. As many common misconceptions involve scale and distance, teachers worked with Moon/Earth scale, solar system scale, and distance of objects in the universe. Teachers built and used basic telescopes, learned about the history of telescopes, explored ground and satellite based telescopes, and explored and worked on models of WISE Telescope. An in-depth explanation of WISE and Spitzer telescopes gave participants background knowledge for infrared astronomy observations. We taught the electromagnetic spectrum through interactive stations. The stations included an overview via lecture and power point, the use of ultraviolet beads to determine ultraviolet exposure, the study of WISE lenticulars and diagramming of infrared data, listening to light by using speakers hooked up to photoreceptor cells, looking at visible light through diffraction glasses and diagramming the data, protocols for using astronomy based research in the classroom, and infrared thermometers to compare environmental conditions around the observatory. An overview of LIDAR physics was followed up by a simulated LIDAR mapping of the topography of Mars. We will outline specific steps for K-12 infrared astronomy professional development, provide data demonstrating the impact of the above professional development on educator understanding and classroom use, and detail future plans for additional K-12 professional development. Funding was provided by WISE Telescope, Spitzer Space Telescope, Starbucks, Arecibo Observatory, the American Institute of Aeronautics and Astronautics, and the Washington Space Grant Consortium.
Low-cost programmable pulse generator for particle telescope calibration
Sanchez, S; Seisdedos, M; Meziat, D; Carbajo, M; Medina, J; Bronchalo, E; Peral, L D; Rodríguez-Pacheco, J
1999-01-01
In this paper we present a new calibration system for particle telescopes including multipulse generator and digital controller. The calibration system generates synchronized pulses of variable height for every detector channel on the telescope. The control system is based on a commercial microcontroller linked to a personal computer through an RS-232 bidirectional line. The aim of the device is to perform laboratory calibration of multi-detector telescopes prior to calibration at accelerator. This task includes evaluation of linearity and resolution of each detector channel, as well as coincidence logic. The heights of the pulses sent to the detectors are obtained by Monte Carlo simulation of telescope response to a particle flux of any desired geometry and composition.
The Green Bank Telescope: A radio telescope for the twenty-first century: Final proposal June 1989
International Nuclear Information System (INIS)
Anon.
1989-01-01
The scientific goals, design, and projected performance of a 100-m-aperture steerable radio telescope to be built at Green Bank, WV are discussed in a proposal to the NSF. The goals considered include observations of pulsars, stars and the solar system; studies of Galactic and extragalactic H I, spectroscopic studies, measurements of continuum radiation; and VLBI observations. Detailed attention is given to the antenna, electronics, control and monitor system, data processing, operational factors, the telescope site, and cost estimates. Drawings, diagrams, sample images, and tables of numerical data are provided
ATHENA: system design and implementation for a next generation x-ray telescope
Ayre, M.; Bavdaz, M.; Ferreira, I.; Wille, E.; Lumb, D.; Linder, M.
2015-08-01
ATHENA, Europe's next generation x-ray telescope, has recently been selected for the 'L2' slot in ESA's Cosmic Vision Programme, with a mandate to address the 'Hot and Energetic Universe' Cosmic Vision science theme. The mission is currently in the Assessment/Definition Phase (A/B1), with a view to formal adoption after a successful System Requirements Review in 2019. This paper will describe the reference mission architecture and spacecraft design produced during Phase 0 by the ESA Concurrent Design Facility (CDF), in response to the technical requirements and programmatic boundary conditions. The main technical requirements and their mapping to resulting design choices will be presented, at both mission and spacecraft level. An overview of the spacecraft design down to subsystem level will then be presented (including the telescope and instruments), remarking on the critically-enabling technologies where appropriate. Finally, a programmatic overview will be given of the on-going Assessment Phase, and a snapshot of the prospects for securing the `as-proposed' mission within the cost envelope will be given.
A new Recoil Proton Telescope for energy and fluence measurement of fast neutron fields
Energy Technology Data Exchange (ETDEWEB)
Lebreton, Lena; Bachaalany, Mario [IRSN / LMDN (Institut de Radioprotection et de Surete nucleaire / Laboratoire de Metrologie et de dosimetrie des neutrons), Cadarache Bat.159, 13115 Saint Paul-lez-Durance, (France); Husson, Daniel; Higueret, Stephane [IPHC / RaMsEs (Institut Pluridisciplinaire Hubert Curien / Radioprotection et Mesures Environnementales), 23 rue du loess - BP28, 67037 Strasbourg cedex 2, (France)
2015-07-01
The spectrometer ATHENA (Accurate Telescope for High Energy Neutron metrology Applications), is being developed at the IRSN / LMDN (Institut de Radioprotection et de Surete nucleaire / Laboratoire de Metrologie et de dosimetrie des neutrons) and aims at characterizing energy and fluence of fast neutron fields. The detector is a Recoil Proton Telescope and measures neutron fields in the range of 5 to 20 MeV. This telescope is intended to become a primary standard for both energy and fluence measurements. The neutron detection is achieved by a polyethylene radiator for n-p conversion, three 50{sub m} thick silicon sensors that use CMOS technology for the proton tracking and a 3 mm thick silicon diode to measure the residual proton energy. This first prototype used CMOS sensors called MIMOSTAR, initially developed for heavy ion physics. The use of CMOS sensors and silicon diode increases the intrinsic efficiency of the detector by a factor of ten compared with conventional designs. The first prototype has already been done and was a successful study giving the results it offered in terms of energy and fluence measurements. For mono energetic beams going from 5 to 19 MeV, the telescope offered an energy resolution between 5 and 11% and fluence difference going from 5 to 7% compared to other home standards. A second and final prototype of the detector is being designed. It will hold upgraded CMOS sensors called FastPixN. These CMOS sensors are supposed to run 400 times faster than the older version and therefore give the telescope the ability to support neutron flux in the order of 107 to 108cm{sup 2}:s{sup 1}. The first prototypes results showed that a 50 m pixel size is enough for a precise scattering angle reconstruction. Simulations using MCNPX and GEANT4 are already in place for further improvements. A DeltaE diode will replace the third CMOS sensor and will be installed right before the silicon diode for a better recoil proton selection. The final prototype with
The SPIRIT Telescope Initiative: six years on
Luckas, Paul
2017-06-01
Now in its sixth year of operation, the SPIRIT initiative remains unique in Australia, as a robust web-enabled robotic telescope initiative funded for education and outreach. With multiple modes of operation catering for a variety of usage scenarios and a fully supported education program, SPIRIT provides free access to contemporary astronomical tools for students and educators in Western Australia and beyond. The technical solution itself provides an excellent model for low cost robotic telescope installations, and the education program has evolved over time to include a broad range of student experiences-from engagement activities to authentic science. This paper details the robotic telescope solution, student interface and educational philosophy, summarises achievements and lessons learned and examines the possibilities for future enhancement including spectroscopy.
Development of a Multivariable Parametric Cost Analysis for Space-Based Telescopes
Dollinger, Courtnay
2011-01-01
Over the past 400 years, the telescope has proven to be a valuable tool in helping humankind understand the Universe around us. The images and data produced by telescopes have revolutionized planetary, solar, stellar, and galactic astronomy and have inspired a wide range of people, from the child who dreams about the images seen on NASA websites to the most highly trained scientist. Like all scientific endeavors, astronomical research must operate within the constraints imposed by budget limitations. Hence the importance of understanding cost: to find the balance between the dreams of scientists and the restrictions of the available budget. By logically analyzing the data we have collected for over thirty different telescopes from more than 200 different sources, statistical methods, such as plotting regressions and residuals, can be used to determine what drives the cost of telescopes to build and use a cost model for space-based telescopes. Previous cost models have focused their attention on ground-based telescopes due to limited data for space telescopes and the larger number and longer history of ground-based astronomy. Due to the increased availability of cost data from recent space-telescope construction, we have been able to produce and begin testing a comprehensive cost model for space telescopes, with guidance from the cost models for ground-based telescopes. By separating the variables that effect cost such as diameter, mass, wavelength, density, data rate, and number of instruments, we advance the goal to better understand the cost drivers of space telescopes.. The use of sophisticated mathematical techniques to improve the accuracy of cost models has the potential to help society make informed decisions about proposed scientific projects. An improved knowledge of cost will allow scientists to get the maximum value returned for the money given and create a harmony between the visions of scientists and the reality of a budget.
A cyber infrastructure for the SKA Telescope Manager
Barbosa, Domingos; Barraca, João. P.; Carvalho, Bruno; Maia, Dalmiro; Gupta, Yashwant; Natarajan, Swaminathan; Le Roux, Gerhard; Swart, Paul
2016-07-01
The Square Kilometre Array Telescope Manager (SKA TM) will be responsible for assisting the SKA Operations and Observation Management, carrying out System diagnosis and collecting Monitoring and Control data from the SKA subsystems and components. To provide adequate compute resources, scalability, operation continuity and high availability, as well as strict Quality of Service, the TM cyber-infrastructure (embodied in the Local Infrastructure - LINFRA) consists of COTS hardware and infrastructural software (for example: server monitoring software, host operating system, virtualization software, device firmware), providing a specially tailored Infrastructure as a Service (IaaS) and Platform as a Service (PaaS) solution. The TM infrastructure provides services in the form of computational power, software defined networking, power, storage abstractions, and high level, state of the art IaaS and PaaS management interfaces. This cyber platform will be tailored to each of the two SKA Phase 1 telescopes (SKA_MID in South Africa and SKA_LOW in Australia) instances, each presenting different computational and storage infrastructures and conditioned by location. This cyber platform will provide a compute model enabling TM to manage the deployment and execution of its multiple components (observation scheduler, proposal submission tools, MandC components, Forensic tools and several Databases, etc). In this sense, the TM LINFRA is primarily focused towards the provision of isolated instances, mostly resorting to virtualization technologies, while defaulting to bare hardware if specifically required due to performance, security, availability, or other requirement.
Software framework for automatic learning of telescope operation
Rodríguez, Jose A.; Molgó, Jordi; Guerra, Dailos
2016-07-01
The "Gran Telescopio de Canarias" (GTC) is an optical-infrared 10-meter segmented mirror telescope at the ORM observatory in Canary Islands (Spain). The GTC Control System (GCS) is a distributed object and component oriented system based on RT-CORBA and it is responsible for the operation of the telescope, including its instrumentation. The current development state of GCS is mature and fully operational. On the one hand telescope users as PI's implement the sequences of observing modes of future scientific instruments that will be installed in the telescope and operators, in turn, design their own sequences for maintenance. On the other hand engineers develop new components that provide new functionality required by the system. This great work effort is possible to minimize so that costs are reduced, especially if one considers that software maintenance is the most expensive phase of the software life cycle. Could we design a system that allows the progressive assimilation of sequences of operation and maintenance of the telescope, through an automatic self-programming system, so that it can evolve from one Component oriented organization to a Service oriented organization? One possible way to achieve this is to use mechanisms of learning and knowledge consolidation to reduce to the minimum expression the effort to transform the specifications of the different telescope users to the operational deployments. This article proposes a framework for solving this problem based on the combination of the following tools: data mining, self-Adaptive software, code generation, refactoring based on metrics, Hierarchical Agglomerative Clustering and Service Oriented Architectures.
Optical design of a Michelson wide-field multiple-aperture telescope
Cassaing, Frederic; Sorrente, Beatrice; Fleury, Bruno; Laubier, David
2004-02-01
Multiple-Aperture Optical Telescopes (MAOTs) are a promising solution for very high resolution imaging. In the Michelson configuration, the instrument is made of sub-telescopes distributed in the pupil and combined by a common telescope via folding periscopes. The phasing conditions of the sub-pupils lead to specific optical constraints in these subsystems. The amplitude of main contributors to the wavefront error (WFE) is given as a function of high level requirements (such as field or resolution) and free parameters, mainly the sub-telescope type, magnification and diameter. It is shown that for the periscopes, the field-to-resolution ratio is the main design driver and can lead to severe specifications. The effect of sub-telescopes aberrations on the global WFE can be minimized by reducing their diameter. An analytical tool for the MAOT design has been derived from this analysis, illustrated and validated in three different cases: LEO or GEO Earth observation and astronomy with extremely large telescopes. The last two cases show that a field larger than 10 000 resolution elements can be covered with a very simple MAOT based on Mersenne paraboloid-paraboloid sub-telescopes. Michelson MAOTs are thus a solution to be considered for high resolution wide-field imaging, from space or ground.
Southern Fireworks above ESO Telescopes
1999-05-01
telescope at La Silla on May 11, 1999, at 08:42 UT, under inferior observing conditions (seeing = 1.9 arcsec). The exposure time was 450 sec in a B(lue) filter. The optical image of the afterglow of GRB 990510 is indicated with an arrow in the upper part of the field that measures about 8 x 16 arcmin 2. The original scale is 0.24 pix/arcsec and there are 2k x 4k pixels in the original frame. North is up and East is left. Caption to PR Photo 22b/99 : This is a (false-)colour composite of the area around the optical image of the afterglow of GRB 990510, based on three near-infrared exposures with the SOFI multi-mode instrument at the 3.6-m ESO New Technology Telescope (NTT) at La Silla, obtained on May 10, 1999, between 23:15 and 23:45 UT. The exposure times were 10 min each in the J- (1.2 µm; here rendered in blue), H- (1.6 µm; green) and K-bands (2.2 µm; red); the image quality is excellent (0.6 arcsec). The field measures about 5 x 5 arcmin 2 ; the original pixel size is 0.29 arcsec. North is up and East is left. ESO PR Photo 22c/99 ESO PR Photo 22c/99 [Preview - JPEG: 400 x 235 pix - 81k] [Normal - JPEG: 800 x 469 pix - 244k] [High-Res - JPEG: 2732 x 1603 pix - 2.6M] ESO PR Photo 22d/99 ESO PR Photo 22d/99 [Preview - JPEG: 400 x 441 pix - 154k] [Normal - JPEG: 800 x 887 pix - 561k] [High-Res - JPEG: 2300 x 2537 pix - 2.3M] Caption to PR Photo 22c/99 : To the left is a reproduction of a short (30 sec) centering exposure in the V-band (green-yellow light), obtained with VLT ANTU and the multi-mode FORS1 instrument on May 11, 1999, at 03:48 UT under mediocre observing conditions (image quality 1.0 arcsec).The optical image of the afterglow of GRB 990510 is easily seen in the box, by comparison with an exposure of the same sky field before the explosion, made with the ESO Schmidt Telescope in 1986 (right).The exposure time was 120 min on IIIa-F emulsion behind a R(ed) filter. The field shown measures about 6.2 x 6.2 arcmin 2. North is up and East is left. Caption to PR
NST: Thermal Modeling for a Large Aperture Solar Telescope
Coulter, Roy
2011-05-01
Late in the 1990s the Dutch Open Telescope demonstrated that internal seeing in open, large aperture solar telescopes can be controlled by flushing air across the primary mirror and other telescope structures exposed to sunlight. In that system natural wind provides a uniform air temperature throughout the imaging volume, while efficiently sweeping heated air away from the optics and mechanical structure. Big Bear Solar Observatory's New Solar Telescope (NST) was designed to realize that same performance in an enclosed system by using both natural wind through the dome and forced air circulation around the primary mirror to provide the uniform air temperatures required within the telescope volume. The NST is housed in a conventional, ventilated dome with a circular opening, in place of the standard dome slit, that allows sunlight to fall only on an aperture stop and the primary mirror. The primary mirror is housed deep inside a cylindrical cell with only minimal openings in the side at the level of the mirror. To date, the forced air and cooling systems designed for the NST primary mirror have not been implemented, yet the telescope regularly produces solar images indicative of the absence of mirror seeing. Computational Fluid Dynamics (CFD) analysis of the NST primary mirror system along with measurements of air flows within the dome, around the telescope structure, and internal to the mirror cell are used to explain the origin of this seemingly incongruent result. The CFD analysis is also extended to hypothetical systems of various scales. We will discuss the results of these investigations.
Chinese large solar telescopes site survey
Liu, Yu
2017-04-01
In order to observe the solar surface with unprecedentedly higher resolution, Chinse solar physics society decided to launch their solar site survey project in 2010 as the first step to look for the best candidate sites for the Chinese next-generation large-aperture solar telescopes, i.e., the 5-8 meter Chinese Giant Solar Telescope, and the 1 meter level coronagraph. We have built two long-term monitoring sites in Daocheng, with altitudes of around 4800 meters above the sea level located in the large Shangri-La mountain area, and we have collected systematic site data since 2014. Clear evidence, including the key parameters of seeing factor, sky brightness and water vapor content, has indicated that the large Shangri-La area owns the potential conditions of excellent seeing level and sufficient amount of clear-sky hours suitable for developing large solar telescopes. We will review the site survey progress and present the preliminary statistical results in this talk.
Observatories and Telescopes of Modern Times
Leverington, David
2016-11-01
Preface; Part I. Optical Observatories: 1. Palomar Mountain Observatory; 2. The United States Optical Observatory; 3. From the Next Generation Telescope to Gemini and SOAR; 4. Competing primary mirror designs; 5. Active optics, adaptive optics and other technical innovations; 6. European Northern Observatory and Calar Alto; 7. European Southern Observatory; 8. Mauna Kea Observatory; 9. Australian optical observatories; 10. Mount Hopkins' Whipple Observatory and the MMT; 11. Apache Point Observatory; 12. Carnegie Southern Observatory (Las Campanas); 13. Mount Graham International Optical Observatory; 14. Modern optical interferometers; 15. Solar observatories; Part II. Radio Observatories: 16. Australian radio observatories; 17. Cambridge Mullard Radio Observatory; 18. Jodrell Bank; 19. Early radio observatories away from the Australian-British axis; 20. The American National Radio Astronomy Observatory; 21. Owens Valley and Mauna Kea; 22. Further North and Central American observatories; 23. Further European and Asian radio observatories; 24. ALMA and the South Pole; Name index; Optical observatory and telescope index; Radio observatory and telescope index; General index.
The Swift Ultra-Violet/Optical Telescope
International Nuclear Information System (INIS)
Roming, Peter; Hunsberger, S.D.; Nousek, John; Mason, Keith
2001-01-01
The Ultra-Violet/Optical Telescope (UVOT) provides the Swift Gamma-Ray Burst Explorer with the capability of quickly detecting and characterizing the optical and ultraviolet properties of gamma ray burst counterparts. The UVOT design is based on the design of the Optical Monitor on XMM-Newton. It is a Ritchey-Chretien telescope with microchannel plate intensified charged-coupled devices (MICs) that deliver sub-arcsecond imaging. These MICs are photon-counting devices, capable of detecting low intensity signal levels. When flown above the atmosphere, the UVOT will have the sensitivity of a 4m ground based telescope, attaining a limiting magnitude of 24 for a 1000 second observation in the white light filter. A rotating filter wheel allows sensitive photometry in six bands spanning the UV and visible, which will provide photometric redshifts of objects in the 1-3.5z range. For bright counterparts, such as the 9th magnitude GRB990123, or for fainter objects down to 17th magnitude, two grisms provide low-resolution spectroscopy
Deployable reflector configurations. [for space telescope
Meinel, A. B.; Meinel, M. P.; Woolf, N. J.
1983-01-01
Both the theoretical reasons for considering a non-circular format for the Large Deployable Reflector, and a potentially realizable concept for such a device, are discussed. The optimum systems for diffraction limited telescopes with incoherent detection have either a single filled aperture, or two such apertures as an interferometer to synthesize a larger aperture. For a single aperture of limited area, a reflector in the form of a slot can be used to give increased angular resolution. It is shown how a 20 x 8 meter telescope can be configured to fit the Space Shuttle bay, and deployed with relatively simple operations. The relationship between the sunshield design and the inclination of the orbit is discussed. The possible use of the LDR as a basic module to permit the construction of supergiant space telescopes and interferometers both for IR/submm studies and for the entire ultraviolet through mm wave spectral region is discussed.
Template analysis for the MAGIC telescopes
Energy Technology Data Exchange (ETDEWEB)
Menzel, Uta [Max-Planck-Institut fuer Physik, Muenchen (Germany); Collaboration: MAGIC-Collaboration
2016-07-01
The MAGIC telescopes are two 17-m-diameter Imaging Air Cherenkov Telescopes located on the Canary island of La Palma. They record the Cherenkov light from air showers induced by very high energy photons. The current data analysis uses a parametrization of the two shower images (including Hillas parameters) to determine the characteristics of the primary particle. I am implementing an advanced analysis method that compares shower images on a pixel basis with template images based on Monte Carlo simulations. To reduce the simulation effort the templates contain only pure shower images that are convolved with the telescope response later in the analysis. The primary particle parameters are reconstructed by maximizing the likelihood of the template. By using all the information available in the shower images, the performance of MAGIC is expected to improve. In this presentation I will explain the general idea of a template-based analysis and show the first results of the implementation.
Straulino, Samuele; Terzuoli, Alessandra
2010-01-01
In the first months of 2009, the International Year of Astronomy, the authors developed an educational project for middle-level students connected with the first astronomical discoveries that Galileo Galilei (1564-1642) made 400 years ago. The project included the construction of a basic telescope and the observation of the Moon. The project, if…
Novel optical scanning cryptography using Fresnel telescope imaging.
Yan, Aimin; Sun, Jianfeng; Hu, Zhijuan; Zhang, Jingtao; Liu, Liren
2015-07-13
We propose a new method called modified optical scanning cryptography using Fresnel telescope imaging technique for encryption and decryption of remote objects. An image or object can be optically encrypted on the fly by Fresnel telescope scanning system together with an encryption key. For image decryption, the encrypted signals are received and processed with an optical coherent heterodyne detection system. The proposed method has strong performance through use of secure Fresnel telescope scanning with orthogonal polarized beams and efficient all-optical information processing. The validity of the proposed method is demonstrated by numerical simulations and experimental results.
Payload maintenance cost model for the space telescope
White, W. L.
1980-01-01
An optimum maintenance cost model for the space telescope for a fifteen year mission cycle was developed. Various documents and subsequent updates of failure rates and configurations were made. The reliability of the space telescope for one year, two and one half years, and five years were determined using the failure rates and configurations. The failure rates and configurations were also used in the maintenance simulation computer model which simulate the failure patterns for the fifteen year mission life of the space telescope. Cost algorithms associated with the maintenance options as indicated by the failure patterns were developed and integrated into the model.
Chromospheric telescope of Baikal Astrophysical Observatory. New light
Directory of Open Access Journals (Sweden)
Skomorovsky V.I.
2016-06-01
Full Text Available A chromospheric telescope is an important instrument for synoptic observations and solar research. After several decades of observations with the chromospheric telescope at the Baikal Astrophysical Observatory, a need arose to improve the characteristics of this telescope and filter. A new reimaging lens to produce full-disk solar images 18 mm in diameter at the CCD camera Hamamatsu C-124 with a 36×24 mm detector (4000×2672 pixels was designed and manufactured to replace the out-of-operation 50×50 mm Princeton Instruments camera. A contrast interference blocking filter and new calcite and quartz crystal plates were made and installed instead of damaged ones in the Hα birefringent filter (BF, manufactured by Bernhard Hallе Nachfl. The optical immersion in the filter was changed. All telescope optics was cleaned and adjusted. We describe for the first time the design features and their related BF passband tuning. The wavefront interferograms of optical elements and telescope as a whole show that the wavefront distortion of the optical path is within 0.25 λ. The BF and prefilter spectral parameters provide high-contrast monochromatic images. Besides, we give examples of solar chromospheric images in the Hα line core and wing.
The telescopic tourist's guide to the Moon
May, Andrew
2017-01-01
Whether you’re interested in visiting Apollo landing sites or the locations of classic sci-fi movies, this is the tourist guide for you! This tourist guide has a twist – it is a guide to a whole different world, which you can visit from the comfort of your backyard with the aid of nothing more sophisticated than an inexpensive telescope. It tells you the best times to view the Moon, the most exciting sights to look out for, and the best equipment to use, allowing you to snap stunning photographs as well as view the sights with your own eyes. Have you ever been inspired by stunning images from the Hubble telescope, or the magic of sci-fi special effects, only to look through a small backyard telescope at the disappointing white dot of a planet or faint blur of a galaxy? Yet the Moon is different. Seen through even a relatively cheap telescope, it springs into life like a real place, with mountains and valleys and rugged craters. With a bit of imagination, you can even picture yourself as a sightseeing visi...
A deployable telescope for sub-meter resolutions from microsatellite platforms
Dolkens, D.; Kuiper, J. M.
2017-11-01
Sub-meter resolution imagery has become increasingly important for disaster response, defence and security applications. Earth Observation (EO) at these resolutions has long been the realm of large and heavy telescopes, which results in high image costs, limited availability and long revisit times. Using synthetic aperture technology, instruments can now be developed that can reach these resolutions using a substantially smaller launch volume and mass. To obtain a competitive MicroSatellite telescope design, a concept study was performed to develop a deployable instrument that can reach a ground resolution of 25 cm from an orbital altitude of 500 km. Two classes of instruments were analysed: the Fizeau synthetic aperture, a telescope that uses a segmented primary mirror, and a Michelson synthetic aperture, an instrument concept that combines the light of a distributed array of afocal telescopes into a final image. In a trade-off the Fizeau synthetic aperture was selected as the most promising concept for obtaining high resolution imagery from a Low Earth Orbit. The optical design of the Fizeau synthetic aperture is based on a full-field Korsch telescope that has been optimized for compactness and an excellent wavefront quality. It uses three aperture segments in a tri-arm configuration that can be folded alongside the instrument during launch. The secondary mirror is mounted on a deployable boom, further decreasing the launch volume. To maintain a high image quality while operating in the harsh and dynamic space environment, one of the most challenging obstacles that must be addressed is the very tight tolerance on the positioning of the three primary mirror segments and the secondary mirror. Following a sensitivity analysis, systems engineering budgets have been defined. The instrument concept features a robust thermo-mechanical design, aimed at reducing the mechanical uncertainties to a minimum. Silicon Carbide mirror segments, the use of Invar for the deployable
Ostrowski, Michael; Błocki, J.; Bogacz, L.; Bulik, T.; Cadoux, F.; Christov, A.; Curyło, M.; della Volpe, D.; Dyrda, M.; Favre, Y.; Frankowski, A.; Grudnik, Ł.; Grudzińska, M.; Heller, M.; Idźkowski, B.; Jamrozy, M.; Janiak, M.; Kasperek, J.; Lalik, K.; Lyard, E.; Mach, E.; Mandat, D.; Marszałek, A.; Michałowski, J.; Moderski, R.; Montaruli, T.; Neronov, A.; Niemiec, J.; Paśko, P.; Pech, M.; Porcelli, A.; Prandini, E.; Pueschel, E.; Rajda, P.; Rameez, M.; Schioppa, E. jr; Schovanek, P.; Skowron, K.; Sliusar, V.; Sowiński, M.; Stawarz, Ł.; Stodulska, M.; Stodulski, M.; Toscano, S.; Troyano Pujadas, I.; Walter, R.; Wiȩcek, M.; Zagdański, A.; Ziȩtara, K.; Żychowski, P.; Barciński, T.; Karczewski, M.; Kukliński, J. Nicolau; Płatos, Ł.; Rataj, M.; Wawer, P.; Wawrzaszek, R.
2016-01-01
The prototype of a Davies-Cotton small size telescope (SST-1M) has been designed and developed by a consortium of Polish and Swiss institutions and proposed for the Cherenkov Telescope Array (CTA) observatory. The main purpose of the optical system is to focus the Cherenkov light emitted by extensive air showers in the atmosphere onto the focal plane detectors. The main component of the system is a dish consisting of 18 hexagonal mirrors with a total effective collection area of 6.47 m2 (including the shadowing and estimated mirror reflectivity). Such a solution was chosen taking into account the analysis of the Cherenkov light propagation and based on optical simulations. The proper curvature and stability of the dish is ensured by the mirror alignment system and the isostatic interface to the telescope structure. Here we present the design of the optical subsystem together with the performance measurements of its components.
The Hubble Space Telescope from concept to success
Shayler, David J
2016-01-01
The highly successful Hubble Space Telescope was meant to change our view and understanding of the universe. Within weeks of its launch in 1990, however, the space community was shocked to find out that the primary mirror of the telescope was flawed. It was only the skills of scientists and engineers on the ground and the daring talents of astronauts sent to service the telescope in December 1993 that saved the mission. For over two decades NASA had developed the capabilities to service a payload in orbit. This involved numerous studies and the creation of a ground-based infrastructure to support the challenging missions. Unique tools and EVA hardware supported the skills developed in crew training that then enabled astronauts to complete a demanding series of spacewalks. Drawing upon first hand interviews with those closely involved in the project over thirty years ago this story explains the development of the servicing mission concept and the hurdles that had to be overcome to not only launch the telescope...
Antarctic observations at long wavelengths with the IRAIT-ITM Telescope at Dome C
Durand, Gilles A.; Tremblin, Pascal; Minier, Vincent; Reinert, Yann; Leroy dos Santos, Christophe; Rodriguez, Louis; Joffrin, Xavier; Busso, Maurizio; Tosti, Gino; Nucciarelli, Giuliano; Dolci, Mauro; Straniero, Oscar; Valentini, Angelo; Abia, Carlos; Christille, Jean Marc; Doumayrou, Eric; Lortholary, Michel; Charron, Patrice; Lotrus, Paul; Walter, Christian; Ronayette, Samuel; Challita, Zalpha; Fromont, Laurent; Condamin, Mathieu; Kwon, Min Kyong; Tavagnacco, Daniele
2014-07-01
We illustrate the status of the international infra-red telescope IRAIT-ITM, a project developed thanks to an Italian- Spanish-French collaboration and now sited at the Dome C Antarctic base. The telescope and its subsystems were installed at DomeC by a team of Italian and French scientists. The 80 cm telescope is placed on a small snow hill next to a laboratory of astronomy. The operations started in January 2013, with the Nasmyth focal planes equipped with the midinfrared camera AMICA for 1.25 to 25 μm and the sub-millimetre camera CAMISTIC for observation of the sky noise at 200 and 350 μm using a bolometer camera. During 2013 the two winter-overs worked mainly on technological duties, learning how to operate the telescope, while temperatures decreased down to -80°C. The cryogenic systems could be operated respectively at 0.25K and 4K at all times, with satisfactory use of the heat from the compressors of the cryocoolers to the warm-up the laboratory through a closed loop glycol system. The lack of tests and reliability in extreme conditions of some components and difficult access to maintenance hampered regular observations below -50°C. Using the lessons of this first winter, the summer team improves the robustness of the failing systems and ease the access to maintenance. The winter 2014 is the first one with programmed observations. Because of power restrictions, the two instruments are used each one at a time by periods of 2 weeks. The Camistic camera continues to observe the stability of the sky at a fixed altitude in chopping mode and performs skydips. The TCS is being upgraded in order to prepare the next summer season with extensive observations of the sun with Camistic.
3.6-m Devasthal Optical Telescope Project: Completion and first results
Kumar, Brijesh; Omar, Amitesh; Maheswar, Gopinathan; Pandey, Anil Kumar; Sagar, Ram; Uddin, Wahab; Sanwal, Basant Ballabh; Bangia, Tarun; Kumar, Tripurari Satyanarayana; Yadav, Shobhit; Sahu, Sanjit; Pant, Jayshreekar; Reddy, Bheemireddy Krishna; Gupta, Alok Chandra; Chand, Hum; Pandey, Jeewan Chandra; Joshi, Mohit Kumar; Jaiswar, Mukeshkuma; Nanjappa, Nandish; Purushottam; Yadav, Rama Kant Singh; Sharma, Saurabh; Pandey, Shashi Bhushan; Joshi, Santosh; Joshi, Yogesh Chandra; Lata, Sneh; Mehdi, Biman Jyoti; Misra, Kuntal; Singh, Mahendra
2018-04-01
We present an update on the 3.6-m aperture optical telescope, which has been installed at Devasthal in the year 2016. In this paper, a brief overview of installation activities at site and first results are presented. The 3.6-m Devasthal Optical Telescope project was initiated in 2007 by the Aryabhatta Research Institute of Observational Sciences (ARIES; Nainital, India) in partnership with Belgium. The telescope has Ritchey-Chretien optics, an alt-azimuth mount, an active control of the primary and a corrected science field of view of 30' at the Cassegrain focus. The construction of the telescope enclosure building was completed in June 2014 and after successful installation of the telescope. The first engineering light was obtained on 22 March 2015. The on-sky performance of the telescope was carried out till February 2016.
Stray light field dependence for large astronomical space telescopes
Lightsey, Paul A.; Bowers, Charles W.
2017-09-01
Future large astronomical telescopes in space will have architectures that expose the optics to large angular extents of the sky. Options for reducing stray light coming from the sky range from enclosing the telescope in a tubular baffle to having an open telescope structure with a large sunshield to eliminate solar illumination. These two options are considered for an on-axis telescope design to explore stray light considerations. A tubular baffle design will limit the sky exposure to the solid angle of the cone in front of the telescope set by the aspect ratio of the baffle length to Primary Mirror (PM) diameter. Illumination from this portion of the sky will be limited to the PM and structures internal to the tubular baffle. Alternatively, an open structure design will allow a large portion of the sky to directly illuminate the PM and Secondary Mirror (SM) as well as illuminating sunshield and other structure surfaces which will reflect or scatter light onto the PM and SM. Portions of this illumination of the PM and SM will be scattered into the optical train as stray light. A Radiance Transfer Function (RTF) is calculated for the open architecture that determines the ratio of the stray light background radiance in the image contributed by a patch of sky having unit radiance. The full 4π steradian of sky is divided into a grid of patches, with the location of each patch defined in the telescope coordinate system. By rotating the celestial sky radiance maps into the telescope coordinate frame for a given pointing direction of the telescope, the RTF may be applied to the sky brightness and the results integrated to get the total stray light from the sky for that pointing direction. The RTF data generated for the open architecture may analyzed as a function of the expanding cone angle about the pointing direction. In this manner, the open architecture data may be used to directly compare to a tubular baffle design parameterized by allowed cone angle based on the
VLBI observations with the Kunming 40-meter radio telescope
International Nuclear Information System (INIS)
Hao Longfei; Wang Min; Yang Jun
2010-01-01
The Kunming 40-meter radio telescope is situated in the yard of the Yunnan Astronomical Observatory (Longitude: 102.8 0 East, Latitude: 25.0 0 North) and saw its first light in 2006 May. The Kunming station successfully joined the VLBI tracking of China's first lunar probe 'Chang'E-1 together with the other Chinese telescopes: the Beijing Miyun 50-meter radio telescope, Urumqi Nanshan 25-meter radio telescope, and Shanghai Sheshan 25-meter radio telescope, and received the downlinked scientific data together with the Miyun station from October of 2007 to March of 2009. We give an introduction to the new Chinese VLBI facility and investigate its potential applications. Due to its location, the Kunming station can significantly improve the u - v coverage of the European VLBI Network (EVN), in particular, in long baseline observations. We also report the results of the first EVN fringe-test experiment of N09SX1 with the Kunming station. The first fringes in the European telescopes were successfully detected at 2.3 GHz with the ftp-transferred data on 2009 June 17. From scheduling the observations to performing the post correlations, the Kunming station shows its good compatibility to work with the EVN. The imaging result of the extended source 1156+295 further demonstrates that the Kunming station greatly enhances the EVN performance. (research papers)
DEFF Research Database (Denmark)
WESTERGAARD, NJ; BYRNAK, BP; Christensen, Finn Erland
1989-01-01
modification of this design is optimized with respect to high energy throughput of the telescope. The mechanical design and the status of the surface preparation technologies are described. Various X-ray and optical test facilities for the measurement of surface roughness, "orange peel", and figure errors...
Peabody, Hume L.; Peters, Carlton V.; Rodriguez-Ruiz, Juan E.; McDonald, Carson S.; Content, David A.; Jackson, Clifton E.
2015-01-01
The design of the Wide Field Infrared Survey Telescope using Astrophysics Focused Telescope Assets (WFIRST-AFTA) continues to evolve as each design cycle is analyzed. In 2012, two Hubble sized (2.4 m diameter) telescopes were donated to NASA from elsewhere in the Federal Government. NASA began investigating potential uses for these telescopes and identified WFIRST as a mission to benefit from these assets. With an updated, deeper, and sharper field of view than previous design iterations with a smaller telescope, the optical designs of the WFIRST instruments were updated and the mechanical and thermal designs evolved around the new optical layout. Beginning with Design Cycle 3, significant analysis efforts yielded a design and model that could be evaluated for Structural-Thermal-Optical-Performance (STOP) purposes for the Wide Field Imager (WFI) and provided the basis for evaluating the high level observatory requirements. Development of the Cycle 3 thermal model provided some valuable analysis lessons learned and established best practices for future design cycles. However, the Cycle 3 design did include some major liens and evolving requirements which were addressed in the Cycle 4 Design. Some of the design changes are driven by requirements changes, while others are optimizations or solutions to liens from previous cycles. Again in Cycle 4, STOP analysis was performed and further insights into the overall design were gained leading to the Cycle 5 design effort currently underway. This paper seeks to capture the thermal design evolution, with focus on major design drivers, key decisions and their rationale, and lessons learned as the design evolved.
ESO Council Visits First VLT Unit Telescope Structure in Milan
1995-12-01
), Luigi Guiffrida (SOIMI), Gianpietro Marchiori (EIE) and Prof. Massimo Tarenghi (ESO), describing the very successful implementation of this major VLT contract that was awarded by ESO in September 1991 [2]. All speakers praised the good collaboration between ESO and its industrial partners and Prof. Riccardo Giacconi , Director General of ESO, expressed his satisfaction `with the splendid performance of the ESO-Industry team which was bringing us close to the realisation of the premier telescope array in optical ground-based astronomy in the world'. The participants were also pleased to listen to several of the Italian engineers present who commented on the very positive experience of being personally involved in the world's largest telescope project. The VLT telescope structures incorporate many new technological concepts. Thanks to these and careful planning of the many components and their integration, it has been possible to achieve, among others, light weight construction, high mechanical stiffness, good thermal equilibrium with the ambient air (of importance for the seeing during the observations), low electromagnetic emissitivity (i.e. low interference with the sensitive astronomical instruments) and easy maintainability. Of particular interest is also the giant, direct drive system with a diameter of 9 metres and the sophisticated, innovative laser encoder system. In this way, there is no direct contact between the moving parts and the friction during the rotation is kept at an absolute minimum. The Next Steps The ESO VLT project is now entering into a decisive phase and the next years will see an increasing number of telescope parts and instruments from the scientific and industrial laboratories of Europe converging towards the VLT observatory at Cerro Paranal in Chile. It is gratifying that, despite its high degree of complexity and incorporation of a substantial number of new technologies, the project is within schedule and budget. There will be several
DESTINY, The Dark Energy Space Telescope
Pasquale, Bert A.; Woodruff, Robert A.; Benford, Dominic J.; Lauer, Tod
2007-01-01
We have proposed the development of a low-cost space telescope, Destiny, as a concept for the NASA/DOE Joint Dark Energy Mission. Destiny is a 1.65m space telescope, featuring a near-infrared (0.85-1.7m) survey camera/spectrometer with a moderate flat-field field of view (FOV). Destiny will probe the properties of dark energy by obtaining a Hubble diagram based on Type Ia supernovae and a large-scale mass power spectrum derived from weak lensing distortions of field galaxies as a function of redshift.
Secondary mirror system for the European Solar Telescope (EST)
Cavaller, L.; Siegel, B.; Prieto, G.; Hernandez, E.; Casalta, J. M.; Mercader, J.; Barriga, J.
2010-07-01
The European Solar Telescope (EST) is a European collaborative project to build a 4m class solar telescope in the Canary Islands, which is now in its design study phase. The telescope will provide diffraction limited performance for several instruments observing simultaneously at the Coudé focus at different wavelengths. A multi-conjugated adaptive optics system composed of a tip-tilt mirror and several deformable mirrors will be integrated in the telescope optical path. The secondary mirror system is composed of the mirror itself (Ø800mm), the alignment drives and the cooling system needed to remove the solar heat load from the mirror. During the design study the feasibility to provide fast tip-tilt capabilities at the secondary mirror to work as the adaptive optics tip-tilt mirror is also being evaluated.
A Galaxy Zoo - WorldWide Telescope Mashup: Expanding User Defined Exploration
Luebbert, Jarod; Sands, M.; Fay, J.; Smith, A.; Gay, P. L.; Galaxy Zoo Team
2010-01-01
We present a new way of exploring your favorite Galaxy Zoo galaxies within the context of the sky using Microsoft Research's WorldWide Telescope. Galaxy Zoo has a fantastic community that is eager to learn and contribute to science through morphological classifications of galaxies. WorldWide Telescope is an interactive observatory that allows users to explore the sky. WorldWide Telescope uses images from the world's best telescopes, including the galaxies of the Sloan Digital Sky Survey. WorldWide Telescope provides a fantastic sense of size and distance that is hard to experience in Galaxy Zoo. Creating tours from favorite galaxies directly from Galaxy Zoo aims to solve this dilemma.The incorporation of Galaxy Zoo and WorldWide telescope provides a great resource for users to learn more about the galaxies they are classifying. Users can now explore the areas around certain galaxies and view information about that location from within WorldWide Telescope. Not only does this encourage self-motivated research but after tours are created they can be shared with anyone. We hope this will help spread citizen science to different audiences via email, Facebook, and Twitter.Without the WorldWide Telescope team at Microsoft Research this project would not have been possible. Please go start exploring at http://wwt.galaxyzoo.org. This project was funded through the Microsoft Research Academic Program.
Memory and time: Backward and forward telescoping in Alzheimer's disease.
El Haj, Mohamad; Janssen, Steve M J; Antoine, Pascal
2017-10-01
Backward and forward telescoping are opposite timing biases. The former refers to misattributing events to earlier dates, whereas the latter refers to misattributing events to later dates. The present study investigated both biases in participants with Alzheimer's Disease (AD) and healthy older adults, matched on age, sex, and education level. Participants were asked to recall the years when five remote and five recent public events had occurred. They were also assessed with a cognitive and clinical battery that included a context memory task on which they had to associate letters and locations. Results showed backward telescoping for recent events and forward telescoping for remote events in AD participants and older adults. Furthermore, poorer context recall was observed in AD participants and older adults displaying backward telescoping than in those displaying forward telescoping. These findings suggest an association between the amount of contextual information recalled and the direction of the timing bias. Backward telescoping can be associated with deficiencies in retrieving context characteristics of events, which have been associated with retrograde amnesia and pathological changes to the hippocampus in AD. Copyright © 2017 Elsevier Inc. All rights reserved.
GPU-based online track reconstruction for the MuPix-telescope
Energy Technology Data Exchange (ETDEWEB)
Grzesik, Carsten [JGU, Mainz (Germany); Collaboration: Mu3e-Collaboration
2016-07-01
The MuPix telescope is a beam telescope consisting of High Voltage Monolithic Active Pixel Sensors (HV-MAPS). This type of sensor is going to be used for the Mu3e experiment, which is aiming to measure the lepton flavor violating decay μ→ eee with an ultimate sensitivity of 10{sup -16}. This sensitivity requires a high muon decay rate in the order of 1 GHz leading to a data rate of about 1 TBit/s for the whole detector. This needs to be reduced by a factor 1000 using online event selection algorithms on Graphical Processing Units (GPUs) before passing the data to the storage. A test setup for the MuPix sensors and parts of the Mu3e tracking detector readout is realized in a four plane telescope. The telescope can also be used to show the usability of an online track reconstruction using GPUs. As a result the telescope can provide online information about efficiencies of a device under test or the alignment of the telescope itself. This talk discusses the implementation of the GPU based track reconstruction and shows some results from recent testbeam campaigns.
Advanced Athermal Telescopes, Phase I
National Aeronautics and Space Administration — This proposed innovative athermal telescope design uses advanced lightweight and high-stiffness material of Beryllium-Aluminum (Be-38Al). Peregrine's expertise with...
Origins Space Telescope: The Far Infrared Imager and Polarimeter FIP
Staguhn, Johannes G.; Chuss, David; Howard, Joseph; Meixner, Margaret; Vieira, Joaquin; Amatucci, Edward; Bradley, Damon; Carter, Ruth; Cooray, Asantha; Flores, Anel; Leisawitz, David; Moseley, Samuel Harvey; Wollack, Edward; Origins Space Telescope Study Team
2018-01-01
The Origins Space Telescope (OST)* is the mission concept for the Far-Infrared Surveyor, one of the four science and technology definition studies of NASA Headquarters for the 2020 Astronomy and Astrophysics Decadal survey. The current "concept 1", which envisions a cold (4K) 9m space telescope, includes 5 instruments, providing a wavelength coverage ranging from 6um and 667um. The achievable sensitivity of the observatory will provide three to four orders of magnitude of improvement in sensitivity over current observational capabilities, allowing to address a wide range of new and so far inaccessible scientific questions, ranging from bio-signatures on exo-planets to mapping primordial H_2 from the "dark ages" before the universe went through the phase of re-ionization.Here we present the Far Infrared Imager and Polarimeter (FIP) for OST. The cameral will cover four bands, 40um, 80um, 120um, and 240um. It will allow for differential polarimetry in those bands with the ability to observe two colors in polarimtery mode simultaneously, while all four bands can be observed simultaneously in total power mode. While the confusion limit will be reached in only 32ms at 240um, at 40um the source density on the sky is so low, that at the angular resolution of 1" of OST at this wavelength there will be no source confusion, even for the longest integration times. Science topics that can be addressed by FIP include but are not limited to galactic and extragalactic magnetic field studies, Deep Galaxy Surveys, and Outer Solar System objects..*Origins will enable flagship-quality general observing programs led by the astronomical community in the 2030s. We welcome you to contact the Science and Technology Definition Team (STDT) with your science needs and ideas by emailing us at ost_info@lists.ipac.caltech.edu
Status of the Visible Nulling Coronagraph Technology Demonstration Program
Clampin, M.; Lyon, R.
2012-01-01
We report on the development, sensing and control of the Vacuum Nuller Testbed to realize a Visible Nulling Coronagraphy (VNC) for exoplanet detection and characterization. The VNC is one of the few approaches that works with filled, segmented and sparse or diluted-aperture telescope systems. It thus spans a range of potential future NASA telescopes and could be flown as a separate instrument on such a future mission. NASA/Goddard Space Flight Center has an established effort to develop VNC technologies, and an incremental sequence of testbeds to advance this approach and its critical technologies. We will highlight results demonstrating the achievement of our TDEM contrast milestones, and highlight the performance of our wavefront sensing and control concept.
Annual risks of tuberculous infection in East Nusa Tenggara and Central Java Provinces, Indonesia.
Bachtiar, A; Miko, T Y; Machmud, R; Besral, B; Yudarini, P; Mehta, F; Chadha, V K; Basri, C; Loprang, F; Jitendra, R
2009-01-01
East Nusa Tenggara (NTT) and Central Java Provinces, Indonesia. To estimate the average annual risk of tuberculous infection (ARTI) among school children aged 6-9 years in each province. Children attending Classes 1-4 in 65 schools in NTT and 79 in Central Java, selected by two-stage sampling, were intradermally administered 2 tuberculin units of purified protein derivative RT23 with Tween 80 on the mid-volar aspect of the left forearm. The maximum transverse diameter of induration was measured 72 h later. The analysis was carried out among 5479 satisfactorily test-read children in NTT and 6943 in Central Java. One hundred and fifty-five new sputum smear-positive pulmonary tuberculosis (PTB) cases (78 in NTT and 77 in Central Java) were also tuberculin tested. Based on the frequency distribution of reaction sizes among the children and PTB cases, the prevalence of infection was estimated by the mirror-image method using the modes of tuberculous reactions at 15 and 17 mm. Using the 15 mm mode, ARTI was estimated at 1% in NTT and 0.9% in Central Java. Using the 17 mm mode, ARTI was estimated at 0.5% in NTT and 0.4% in Central Java. Transmission of tuberculous infection may be further reduced by intensification of tuberculosis control efforts.
Saleh, A.; Niraula, R.; Gallego, O.; Osei, E.; Kannan, N.
2017-12-01
The Nutrient Tracking Tool (NTT) is a user-friendly web-based computer program that estimate nutrient (nitrogen and phosphorus) and sediment losses from fields managed under a variety of cropping patterns and management practices. The NTT includes a user-friendly web-based interface and is linked to the Agricultural Policy Environmental eXtender (APEX) model. It also accesses USDA-NRCS's Web Soil Survey to obtain field, weather, and soil information. NTT provides producers, government officials, and other users with a fast and efficient method of estimating the nutrient, sediment, and atmosphoric gases (N2o, Co2, and NH4) losses, and crop production under different conservation practices regims at the farm-level. The information obtained from NTT can help producers to determine the most cost-effective conservation practice(s) to reduce the nutrient and sediment losses while optimizing the crop production. Also, the recent version of NTT (NTTg3) has been developed for those coutries without access to national databasis, such as soils and wether. The NTTg3 also has been designed as easy to use APEX interface. NTT is currently being evaluated for trading and other programs at Cheaseapea Bay regions and numerous states in US. During this presentation the new capabilities of NTTg3 will be described and demonstrated.
European astronaut selected for the third Hubble Space Telescope
1998-08-01
only observed relatively near celestial objects, like the planets in our solar system, but also looked thousands of millions of light years into space, taking images of the most distant galaxies ever seen. "The observations and spectral measurements taken with Hubble have improved our understanding of the origin and age of the universe. In some cases, the Hubble Space Telescope has already changed our thinking about the evolution of planetary systems, stars and galaxies," points out Roger Bonnet, ESA's Director of Science. Astronomers throughout the world are using the telescope. European astronomers have a significant share in the scientific utilisation of Hubble. The Space Telescope Science Institute in Baltimore, USA, coordinates and schedules the various observations. Europe's centre for coordinating observations from Hubble, the Space Telescope European Coordination Facility, is located at the Headquarters of the European Southern Observatory (ESO) at Garching, near Munich, Germany. The Hubble Space Telescope is the first spacecraft ever built that has been designed for extensive in-orbit maintenance and refurbishment by astronauts. Unlike other satellites launched on unmanned rockets, Hubble is accessible by astronauts in orbit. It has numerous grapple fixtures and handholds for ease of access and the safety of astronauts. Hence the telescope's planned 15-year continuous operating time, despite the harsh environmental conditions, and the ability to upgrade it with more powerful instruments as technology progresses. At regular intervals of 3 to 4 years, the US Space Shuttle visits the telescope in orbit to replace components which have failed or reached the nominal end of their operational lifetime and to replace and upgrade instruments with newer, better ones. STS-104 will be the third Hubble servicing mission, after STS-61 in December 1993 and STS-82 in February 1997. To increase Hubble's scientific capability, Nicollier and his fellow crew members from NASA
The ultraviolet telescope on the Astron satellite
International Nuclear Information System (INIS)
Boyarchuk, A.A.
1987-01-01
On 23 March 1983 in the USSR, the Astron astrophysical satellite, with the largest ultraviolet telescope (the UVT) in the world (main mirror diameter 80 cm) and a set of X-ray instruments on board was placed in a high-apogee orbit. The design of the ultraviolet telescope and the results of some of the observations carried out with it are described here. The X-ray instruments are discussed in a separate article. The ultraviolet telescope on the Astron astrophysical satellite is a result of the joint efforts of scientists and engineers at the Crimean Astrophysical Observatory (Academy of Sciences of the USSR), the Byurakan Astrophysical Observatory (Academy of Sciences of the Armenian USSR), and several industrial enterprises in our country. The Laboratoire d'Astronomie Spatiale (CNRS, Marseille, France) played a large role in building the spectrometer for the UVT
The Large Area Telescope on the Fermi Gamma-ray Space Telescope Mission
Energy Technology Data Exchange (ETDEWEB)
Atwood, W.B.; /UC, Santa Cruz; Abdo, Aous A.; /Naval Research Lab, Wash., D.C.; Ackermann, M.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Anderson, B. /UC, Santa Cruz; Axelsson, M.; /Stockholm U.; Baldini, L.; /INFN, Pisa; Ballet, J.; /DAPNIA, Saclay; Band, D.L.; /NASA, Goddard /NASA, Goddard; Barbiellini, Guido; /INFN, Trieste /Trieste U.; Bartelt, J.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bastieri, Denis; /INFN, Padua /Padua U.; Baughman, B.M.; /Ohio State U.; Bechtol, K.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bederede, D.; /DAPNIA, Saclay; Bellardi, F.; /INFN, Pisa; Bellazzini, R.; /INFN, Pisa; Berenji, B.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; Bignami, G.F.; /Pavia U.; Bisello, D.; /INFN, Padua /Padua U.; Bissaldi, E.; /Garching, Max Planck Inst., MPE; Blandford, R.D.; /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Perugia /Perugia U. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /INFN, Pisa /INFN, Pisa /Bari U. /INFN, Bari /Ecole Polytechnique /Washington U., Seattle /INFN, Padua /Padua U. /Bari U. /INFN, Bari /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /IASF, Milan /IASF, Milan /Kalmar U. /Royal Inst. Tech., Stockholm /DAPNIA, Saclay /ASI, Rome /INFN, Pisa /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /George Mason U. /Naval Research Lab, Wash., D.C. /NASA, Goddard /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /DAPNIA, Saclay /NASA, Goddard /INFN, Perugia /Perugia U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept. /Montpellier U. /Stanford U., HEPL /KIPAC, Menlo Park /Stanford U., Phys. Dept.; /more authors..
2009-05-15
The Large Area Telescope (Fermi/LAT, hereafter LAT), the primary instrument on the Fermi Gamma-ray Space Telescope (Fermi) mission, is an imaging, wide field-of-view (FoV), high-energy {gamma}-ray telescope, covering the energy range from below 20 MeV to more than 300 GeV. The LAT was built by an international collaboration with contributions from space agencies, high-energy particle physics institutes, and universities in France, Italy, Japan, Sweden, and the United States. This paper describes the LAT, its preflight expected performance, and summarizes the key science objectives that will be addressed. On-orbit performance will be presented in detail in a subsequent paper. The LAT is a pair-conversion telescope with a precision tracker and calorimeter, each consisting of a 4 x 4 array of 16 modules, a segmented anticoincidence detector that covers the tracker array, and a programmable trigger and data acquisition system. Each tracker module has a vertical stack of 18 (x, y) tracking planes, including two layers (x and y) of single-sided silicon strip detectors and high-Z converter material (tungsten) per tray. Every calorimeter module has 96 CsI(Tl) crystals, arranged in an eight-layer hodoscopic configuration with a total depth of 8.6 radiation lengths, giving both longitudinal and transverse information about the energy deposition pattern. The calorimeter's depth and segmentation enable the high-energy reach of the LAT and contribute significantly to background rejection. The aspect ratio of the tracker (height/width) is 0.4, allowing a large FoV (2.4 sr) and ensuring that most pair-conversion showers initiated in the tracker will pass into the calorimeter for energy measurement. Data obtained with the LAT are intended to (1) permit rapid notification of high-energy {gamma}-ray bursts and transients and facilitate monitoring of variable sources, (2) yield an extensive catalog of several thousand high-energy sources obtained from an all-sky survey, (3
UV/Visible Telescope with Hubble Disposal
Benford, Dominic J.
2013-01-01
Submission Overview: Our primary objective is to convey a sense of the significant advances possible in astrophysics investigations for major Cosmic Origins COR program goals with a 2.4m telescope asset outfitted with one or more advanced UV visible instruments. Several compelling science objectives were identified based on community meetings these science objectives drove the conceptual design of instruments studied by the COR Program Office during July September 2012. This RFI submission encapsulates the results of that study, and suggests that a more detailed look into the instrument suite should be conducted to prove viability and affordability to support the demonstrated scientific value. This study was conducted in the context of a larger effort to consider the options available for a mission to dispose safely of Hubble hence, the overall architecture considered for the mission we studied for the 2.4m telescope asset included resource sharing. This mitigates combined cost and risk and provides naturally for a continued US leadership role in astrophysics with an advanced, general-purpose UV visible space telescope.
Scientific Performance of a Nano-satellite MeV Telescope
Energy Technology Data Exchange (ETDEWEB)
Lucchetta, Giulio; Berlato, Francesco; Rando, Riccardo; Bastieri, Denis; Urso, Giorgio, E-mail: giulio.lucchetta@desy.de, E-mail: fberlato@mpe.mpg.de [Dipartimento di Fisica and Astronomia “G. Galilei,” Università di Padova, I-35131 Padova (Italy)
2017-05-01
Over the past two decades, both X-ray and gamma-ray astronomy have experienced great progress. However, the region of the electromagnetic spectrum around ∼1 MeV is not so thoroughly explored. Future medium-sized gamma-ray telescopes will fill this gap in observations. As the timescale for the development and launch of a medium-class mission is ∼10 years, with substantial costs, we propose a different approach for the immediate future. In this paper, we evaluate the viability of a much smaller and cheaper detector: a nano-satellite Compton telescope, based on the CubeSat architecture. The scientific performance of this telescope would be well below that of the instrument expected for the future larger missions; however, via simulations, we estimate that such a compact telescope will achieve a performance similar to that of COMPTEL.
NECTAR: New electronics for the Cherenkov Telescope Array
Naumann, Christopher Lindsay; Bolmont, J.; Corona, P.; Delagnes, E.; Dzahini, D.; Feinstein, F.; Gascon, D.; Glicenstein, J.-F.; Nayman, P.; Rarbi, F.; Ribo, M.; Sanuy, A.; Siero, X.; Tavernet, J.-P.; Toussenel, F.; Vincent, P.; Vorobiov, S.
2012-12-01
The international CTA consortium is currently in the preparatory phase for the development of the next-generation Cherenkov Telescope Array (CTA [1]), based on the return of experience from the three major current-generation arrays H.E.S.S., MAGIC and VERITAS. To achieve an unprecedented sensitivity and energy range for TeV gamma rays, a new kind of flexible and powerful yet inexpensive front-end hardware will be required for the order of 105 channels of photodetectors in up to 100 telescopes. One possible solution is the NECTAr (New Electronics for the Cherenkov Telescope Array) system, based on the integration of as much as possible of the front-end electronics (amplifiers, fast analogue samplers, memory and ADCs) into a single ASIC for very fast readout performance and a significant reduction of the cost and the lower consumption per channel, while offering a high degree of flexibility both for the triggering and the readout of the telescope. The current status of its development is presented, along with newest results from measurements and simulation studies.
Amateur Telescope Making in the Internet Age Finding Parts, Getting Help, and More
Clark, Robert L
2011-01-01
The Internet Age is changing everything about human invention and the use of technology. The change has been compared to that of the introduction of printing. Making your own telescope isn’t what it used to be, either, thanks partly to the Internet. The old days of grinding and polishing are gone – unless you want to do it! You can now assemble a great instrument from a wide range of affordable Internet-available components, new or used. The Internet is the new parts “junkyard,” with stuff from all over the world for you to pick through, day or night. In this book you will find out what’s generally available and how to access it. You will learn how to evaluate optical components and combine them from diverse Internet sources. You will get many ideas on how to make the parts that you don’t buy or scrounge and how to restore old lenses and mirrors. And you will learn some elementary physics of designing ergonomic – comfortable – telescopes. Navigating your way around the possibilities is easy us...
An optics education program designed around experiments with small telescopes
Pompea, Stephen M.; Sparks, Robert T.; Walker, Constance E.; Dokter, Erin F. C.
2010-08-01
The National Optical Astronomy Observatory has led the development of a new telescope kit for kids as part of a strategic plan to interest young children in science. This telescope has been assembled by tens of thousands of children nationwide, who are now using this high-quality telescope to conduct optics experiments and to make astronomical observations. The Galileoscope telescope kit and its associated educational program are an outgrowth of the NSF sponsored "Hands-On Optics" (HOO) project, a collaboration of the SPIE, the Optical Society of America, and NOAO. This project developed optics kits and activities for upper elementary students and has reached over 20,000 middle school kids in afterschool programs. HOO is a highly flexible educational program and was featured as an exemplary informal science program by the National Science Teachers Association. Our new "Teaching with Telescopes" program builds on HOO, the Galileoscope and other successful optical education projects.
The Atacama Cosmology Telescope: Instrument
Thornton, Robert J.; Atacama Cosmology Telescope Team
2010-01-01
The 6-meter Atacama Cosmology Telescope (ACT) is making detailed maps of the Cosmic Microwave Background at Cerro Toco in northern Chile. In this talk, I focus on the design and operation of the telescope and its commissioning instrument, the Millimeter Bolometer Array Camera. The camera contains three independent sets of optics that operate at 148 GHz, 217 GHz, and 277 GHz with arcminute resolution, each of which couples to a 1024-element array of Transition Edge Sensor (TES) bolometers. I will report on the camera performance, including the beam patterns, optical efficiencies, and detector sensitivities. Under development for ACT is a new polarimeter based on feedhorn-coupled TES devices that have improved sensitivity and are planned to operate at 0.1 K.
Status of the GroundBIRD Telescope
Choi, J.; Génova-Santos, R.; Hattori, M.; Hazumi, M.; Ishitsuka, H.; Kanno, F.; Karatsu, K.; Kiuchi, K.; Koyano, R.; Kutsuma, H.; Lee, K.; Mima, S.; Minowa, M.; Nagai, M.; Nagasaki, T.; Naruse, M.; Oguri, S.; Okada, T.; Otani, C.; Rebolo, R.; Rubiño-Martín, J.; Sekimoto, Y.; Suzuki, J.; Taino, T.; Tajima, O.; Tomita, N.; Uchida, T.; Won, E.; Yoshida, M.
2018-01-01
Our understanding of physics at very early Universe, as early as 10-35 s after the Big Bang, relies on the scenario known as the inflationary cosmology. Inflation predicts a particular polarization pattern in the cosmic microwave background, known as the B-mode yet the strength of such polarization pattern is extremely weak. To search for the B-mode of the polarization in the cosmic microwave background, we are constructing an off-axis rotating telescope to mitigate systematic effects as well as to maximize the sky coverage of the observation. We will discuss the present status of the GroundBIRD telescope.
UBAT of UFFO/ Lomonosov: The X-Ray Space Telescope to Observe Early Photons from Gamma-Ray Bursts
Jeong, S.; Panasyuk, M. I.; Reglero, V.; Connell, P.; Kim, M. B.; Lee, J.; Rodrigo, J. M.; Ripa, J.; Eyles, C.; Lim, H.; Gaikov, G.; Jeong, H.; Leonov, V.; Chen, P.; Castro-Tirado, A. J.; Nam, J. W.; Svertilov, S.; Yashin, I.; Garipov, G.; Huang, M.-H. A.; Huang, J.-J.; Kim, J. E.; Liu, T.-C.; Petrov, V.; Bogomolov, V.; Budtz-Jørgensen, C.; Brandt, S.; Park, I. H.
2018-02-01
The Ultra-Fast Flash Observatory (UFFO) Burst Alert and Trigger Telescope (UBAT) has been designed and built for the localization of transient X-ray sources such as Gamma Ray Bursts (GRBs). As one of main instruments in the UFFO payload onboard the Lomonosov satellite (hereafter UFFO/ Lomonosov), the UBAT's roles are to monitor the X-ray sky, to rapidly locate and track transient sources, and to trigger the slewing of a UV/optical telescope, namely Slewing Mirror Telescope (SMT). The SMT, a pioneering application of rapid slewing mirror technology has a line of sight parallel to the UBAT, allowing us to measure the early UV/optical GRB counterpart and study the extremely early moments of GRB evolution. To detect X-rays, the UBAT utilizes a 191.1 cm2 scintillation detector composed of Yttrium Oxyorthosilicate (YSO) crystals, Multi-Anode Photomultiplier Tubes (MAPMTs), and associated electronics. To estimate a direction vector of a GRB source in its field of view, it employs the well-known coded aperture mask technique. All functions are written for implementation on a field programmable gate array to enable fast triggering and to run the device's imaging algorithms. The UFFO/ Lomonosov satellite was launched on April 28, 2016, and is now collecting GRB observation data. In this study, we describe the UBAT's design, fabrication, integration, and performance as a GRB X-ray trigger and localization telescope, both on the ground and in space.
High performance Lyot and PIAA coronagraphy for arbitrarily shaped telescope apertures
Energy Technology Data Exchange (ETDEWEB)
Guyon, Olivier; Hinz, Philip M. [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Cady, Eric [Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Belikov, Ruslan [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Martinache, Frantz, E-mail: guyon@naoj.org [National Astronomical Observatory of Japan, Subaru Telescope, Hilo, HI 96720 (United States)
2014-01-10
Two high-performance coronagraphic approaches compatible with segmented and obstructed telescope pupils are described. Both concepts use entrance pupil amplitude apodization and a combined phase and amplitude focal plane mask to achieve full coronagraphic extinction of an on-axis point source. While the first concept, called Apodized Pupil Complex Mask Lyot Coronagraph (APCMLC), relies on a transmission mask to perform the pupil apodization, the second concept, called Phase-Induced Amplitude Apodization complex mask coronagraph (PIAACMC), uses beam remapping for lossless apodization. Both concepts theoretically offer complete coronagraphic extinction (infinite contrast) of a point source in monochromatic light, with high throughput and sub-λ/D inner working angle, regardless of aperture shape. The PIAACMC offers nearly 100% throughput and approaches the fundamental coronagraph performance limit imposed by first principles. The steps toward designing the coronagraphs for arbitrary apertures are described for monochromatic light. Designs for the APCMLC and the higher performance PIAACMC are shown for several monolith and segmented apertures, such as the apertures of the Subaru Telescope, Giant Magellan Telescope, Thirty Meter Telescope, the European Extremely Large Telescope, and the Large Binocular Telescope. Performance in broadband light is also quantified, suggesting that the monochromatic designs are suitable for use in up to 20% wide spectral bands for ground-based telescopes.
The Nuclear Spectroscopic Telescope Array (NuSTAR)
DEFF Research Database (Denmark)
Harrison, Fiona A.; Boggs, Steve; Christensen, Finn Erland
2010-01-01
The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing hard X-ray (6 - 80 keV) telescope to orbit. NuSTAR will offer a factor 50 - 100 sensitivity improvement compared to previous collimated or coded mask imagers that have operated...... in this energy band. In addition, NuSTAR provides sub-arcminute imaging with good spectral resolution over a 12-arcminute eld of view. After launch, NuSTAR will carry out a two-year primary science mission that focuses on four key programs: studying the evolution of massive black holes through surveys carried...... on-orbit deployment of an extendable mast. An aspect and alignment metrology system enable reconstruction of the absolute aspect and variations in the telescope alignment resulting from mast exure during ground data processing. Data will be publicly available at GSFC's High Energy Archive Research...
Gamma Large Area Silicon Telescope (GLAST)
International Nuclear Information System (INIS)
Godfrey, G.L.
1993-11-01
The recent discoveries and excitement generated by EGRET have prompted an investigation into modern technologies ultimately leading to the next generation space-based gamma ray telescope. The goal is to design a detector that will increase the data acquisition rate by almost two orders of magnitude beyond EGRET, while at the same time improving on the angular resolution, the energy measurement of reconstructed gamma rays, and the triggering capability of the instrument. The GLAST proposal is based on the assertion that silicon particle detectors are the technology of choice for space application: no consumables, no gas volume, robust (versus fragile), long lived, and self triggering. The GLAST detector is roughly modeled after EGRET in that a tracking module precedes a calorimeter. The GLAST Tracker has planes of thin radiatior interspersed with planes of crossed-strip (x,y) 300-μm-pitch silicon detectors to measure the coordinates of converted electron-positron pairs. The gap between the layers (∼5 cm) provides a lever arm in track fitting resulting in an angular resolution of 0.1 degree at high energy (the low energy angular resolution at 100 MeV would be about 2 degree, limited by multiple scattering). A possible GLAST calorimeter is made of a mosaic of Csl crystals of order 10 r.l. in depth, with silicon photodiodes readout. The increased depth of the GLAST calorimeter over EGRET's extends the energy range to about 300 GeV
Physics and astrophysics with gamma-ray telescopes
Energy Technology Data Exchange (ETDEWEB)
Vandenbroucke, J. [Kavli Institute for Particle Astrophysics and Cosmology, Department of Physics and SLAC National Accelerator Laboratory, Stanford University, Stanford, CA 94305 (United States)
2012-08-15
In the past few years gamma-ray astronomy has entered a golden age. A modern suite of telescopes is now scanning the sky over both hemispheres and over six orders of magnitude in energy. At {approx}TeV energies, only a handful of sources were known a decade ago, but the current generation of ground-based imaging atmospheric Cherenkov telescopes (H.E.S.S., MAGIC, and VERITAS) has increased this number to nearly one hundred. With a large field of view and duty cycle, the Tibet and Milagro air shower detectors have demonstrated the promise of the direct particle detection technique for TeV gamma rays. At {approx}GeV energies, the Fermi Gamma-ray Space Telescope has increased the number of known sources by nearly an order of magnitude in its first year of operation. New classes of sources that were previously theorized to be gamma-ray emitters have now been confirmed observationally. Moreover, there have been surprise discoveries of GeV gamma-ray emission from source classes for which no theory predicted it was possible. In addition to elucidating the processes of high-energy astrophysics, gamma-ray telescopes are making essential contributions to fundamental physics topics including quantum gravity, gravitational waves, and dark matter. I summarize the current census of astrophysical gamma-ray sources, highlight some recent discoveries relevant to fundamental physics, and describe the synergetic connections between gamma-ray and neutrino astronomy. This is a brief overview intended in particular for particle physicists and neutrino astronomers, based on a presentation at the Neutrino 2010 conference in Athens, Greece. I focus in particular on results from Fermi (which was launched soon after Neutrino 2008), and conclude with a description of the next generation of instruments, namely HAWC and the Cherenkov Telescope Array.
DEFF Research Database (Denmark)
Aznar, F.; Castel, J.; Christensen, F. E.
2015-01-01
We report on the design, construction and operation of a low background x-ray detection line composed of a shielded Micromegas detector of the microbulk technology. The detector is made from radiopure materials and is placed at the focal point of a ~ 5 cm diameter, 1.5 m focal-length, cone......-approximation Wolter I x-ray telescope (XRT) assembled from thermally-formed (or "slumped") glass substrates deposited with multilayer coatings. The system has been conceived as a technological pathfinder for the future International Axion Observatory (IAXO), as it combines two of the techniques (optic and detector...
The first GCT camera for the Cherenkov Telescope Array
De Franco, A.; Allan, D.; Armstrong, T.; Ashton, T.; Balzer, A.; Berge, D.; Bose, R.; Brown, A.M.; Buckley, J.; Chadwick, P.M.; Cooke, P.; Cotter, G.; Daniel, M.K.; Funk, S.; Greenshaw, T.; Hinton, J.; Kraus, M.; Lapington, J.; Molyneux, P.; Moore, P.; Nolan, S.; Okumura, A.; Ross, D.; Rulten, C.; Schmoll, J.; Schoorlemmer, H.; Stephan, M.; Sutcliffe, P.; Tajima, H.; Thornhill, J.; Tibaldo, L.; Varner, G.; Watson, J.; Zink, A.
2015-01-01
The Gamma Cherenkov Telescope (GCT) is proposed to be part of the Small Size Telescope (SST) array of the Cherenkov Telescope Array (CTA). The GCT dual-mirror optical design allows the use of a compact camera of diameter roughly 0.4 m. The curved focal plane is equipped with 2048 pixels of ~0.2{\\deg} angular size, resulting in a field of view of ~9{\\deg}. The GCT camera is designed to record the flashes of Cherenkov light from electromagnetic cascades, which last only a few tens of nanoseconds. Modules based on custom ASICs provide the required fast electronics, facilitating sampling and digitisation as well as first level of triggering. The first GCT camera prototype is currently being commissioned in the UK. On-telescope tests are planned later this year. Here we give a detailed description of the camera prototype and present recent progress with testing and commissioning.
Thermal/vacuum measurements of the Herschel space telescope by close-range photogrammetry
Parian, J. Amiri; Cozzani, A.; Appolloni, M.; Casarosa, G.
2017-11-01
In the frame of the development of a videogrammetric system to be used in thermal vacuum chambers at the European Space Research and Technology Centre (ESTEC) and other sites across Europe, the design of a network using micro-cameras was specified by the European Space agency (ESA)-ESTEC. The selected test set-up is the photogrammetric test of the Herschel Satellite Flight Model in the ESTEC Large Space Simulator. The photogrammetric system will be used to verify the Herschel Telescope alignment and Telescope positioning with respect to the Cryostat Vacuum Vessel (CVV) inside the Large Space Simulator during Thermal-Vacuum/Thermal-Balance test phases. We designed a close-range photogrammetric network by heuristic simulation and a videogrammetric system with an overall accuracy of 1:100,000. A semi-automated image acquisition system, which is able to work at low temperatures (-170°C) in order to acquire images according to the designed network has been constructed by ESA-ESTEC. In this paper we will present the videogrammetric system and sub-systems and the results of real measurements with a representative setup similar to the set-up of Herschel spacecraft which was realized in ESTEC Test Centre.
International Nuclear Information System (INIS)
Coelin Baldo, Milla
2009-01-01
The present volume contains the proceedings of the 13. International Workshop on 'Neutrino Telescope', 17. of the series 'Un altro modo di guardare il cielo', held in Venice at the 'Istituto Veneto di Scienze, Lettere ed Arti' from March 10 to March 13, 2009. This series started in Venice 21 years ago, in 1988, motivated by the growing interest in the exciting field of the neutrino physics and astrophysics, with the aim to bring together experimentalists and theorists and encourage discussion on the most recent results and to chart the direction of future researchers.
Telescopic Overdenture: A Case Report
Shruthi, C. S.; Poojya, R.; Ram, Swati; Anupama
2017-01-01
Patient: This report describes the case of a 68 year old female patient who presented with the chief complaint of difficulty in chewing and poor aesthetics due to missing teeth. The patient was interested in saving the remaining natural teeth and desired minimal tissue coverage from the prosthesis. After consideration of all the factors involved, it was deemed advisable to resort to a palate free maxillary telescopic complete denture and a mandibular removable partial denture. Discussion: Considering the age of the patient and the cost involved, implant supported prosthesis was ruled out as a treatment option for the patient. A telescopic denture was chosen as a favourable treatment option since it overcomes many of the problems posed by conventional complete dentures like progressive bone loss, lower stability and retention, loss of periodontal proprioception and low masticatory efficiency. It also provides minimal tissue coverage and better distribution of forces. Evaluation of occlusion, esthetics, phonetics and comfort after 24 hours, 1 week and 1 month of treatment showed that the patient was happy with the prosthesis and was able to speak and chew well. Conclusion: Telescopic overdentures have better retention and stability as compared to conventional complete dentures. They improve the chewing efficiency, patient comfort and also decrease the alveolar bone resorption. As such they are an excellent alternative to conventional complete denture treatment. PMID:28533736
Telescopic Overdenture: A Case Report.
Shruthi, C S; Poojya, R; Ram, Swati; Anupama
2017-03-01
This report describes the case of a 68 year old female patient who presented with the chief complaint of difficulty in chewing and poor aesthetics due to missing teeth. The patient was interested in saving the remaining natural teeth and desired minimal tissue coverage from the prosthesis. After consideration of all the factors involved, it was deemed advisable to resort to a palate free maxillary telescopic complete denture and a mandibular removable partial denture. Considering the age of the patient and the cost involved, implant supported prosthesis was ruled out as a treatment option for the patient. A telescopic denture was chosen as a favourable treatment option since it overcomes many of the problems posed by conventional complete dentures like progressive bone loss, lower stability and retention, loss of periodontal proprioception and low masticatory efficiency. It also provides minimal tissue coverage and better distribution of forces. Evaluation of occlusion, esthetics, phonetics and comfort after 24 hours, 1 week and 1 month of treatment showed that the patient was happy with the prosthesis and was able to speak and chew well. Telescopic overdentures have better retention and stability as compared to conventional complete dentures. They improve the chewing efficiency, patient comfort and also decrease the alveolar bone resorption. As such they are an excellent alternative to conventional complete denture treatment.
A cost-performance model for ground-based optical communications receiving telescopes
Lesh, J. R.; Robinson, D. L.
1986-01-01
An analytical cost-performance model for a ground-based optical communications receiving telescope is presented. The model considers costs of existing telescopes as a function of diameter and field of view. This, coupled with communication performance as a function of receiver diameter and field of view, yields the appropriate telescope cost versus communication performance curve.
The SPIRIT Telescope Initiative: Six Years On (Abstract)
Luckas, P.
2017-12-01
(Abstract only) Now in its sixth year of operation, the SPIRIT initiative remains unique in Australia, as a robust web-enabled robotic telescope initiative funded for education and outreach. With multiple modes of operation catering for a variety of usage scenarios and a fully supported education program, SPIRIT provides free access to contemporary astronomical tools for students and educators in Western Australia and beyond. The technical solution itself provides an excellent model for low cost robotic telescope installations, and the education program has evolved over time to include a broad range of student experiences - from engagement activities to authentic science. This paper details the robotic telescope solution, student interface, and educational philosophy, summarizes achievements and lessons learned, and examines the possibilities for future enhancement including spectroscopy.
Asteroid Observations with NCSFCT’s AZT-8 Telescope
Directory of Open Access Journals (Sweden)
Kozhukhov, O.M.
2017-01-01
Full Text Available The asteroid observations of the small Solar System bodies were carried out with the AZT-8 telescope (D=0.7 m, f/4 of the National Center of Space Facilities Control and Testing (NCSFCT during 2010-2013. The telescope is located near Yevpatoria, the observatory code according IAU is B17. The observational program included perturbed main belt asteroids and NEO’s for the GAIA FUN-SSO Company. The MPC database contains more than 4500 asteroids positions and magnitudes obtained during this period at AZT-8 telescope. The article presents analysis of the positional accuracy of B17 observations obtained from the comparison with the JPL HORIZONS ephemeris, and data from AstDyS-2 and NEODyS-2 web services.
Eyes on the Skies 400 Years of Telescopic Discovery
Schilling, Govert
2011-01-01
Adopted as the official book of the International Year of Astronomy (IYA) 2009, this stunningly illustrated history of telescopic discovery spans the range from the first telescopes via the Hubble Space Telescope to next generation platforms, and how they have changed and continue to change our view of the universe, our place in it and where it all came from. Eyes on the Skies features numerous full-page photographs and is printed in high-quality color throughout. Also includes the official IYA DVD with 59 minutes of narrated text, expert comments and interviews, animations, computer simulatio
Modal vibration testing of the DVA-1 radio telescope
Byrnes, Peter W. G.; Lacy, Gordon
2016-07-01
The Dish Verification Antenna 1 (DVA-1) is a 15m aperture offset Gregorian radio telescope featuring a rim-supported single piece molded composite primary reflector on an altitude-azimuth pedestal mount. Vibration measurements of the DVA-1 telescope were conducted over three days in October 2014 by NSI Herzberg engineers. The purpose of these tests was to measure the first several natural frequencies of the DVA-1 telescope. This paper describes the experimental approach, in particular the step-release method, and summarizes some interesting results, including unexpectedly high damping of the first mode over a narrow range of zenith angles.
Search for magnetic monopoles with the neutrino telescope ANTARES
International Nuclear Information System (INIS)
Picot-Clemente, N.
2010-01-01
The ANTARES neutrino telescope is located at a 2500 meters depth, and is composed of an array of 900 photomultipliers installed for the detection of Cherenkov light emitted by neutrino-induced muons, after having interacted with matter, and in order to reconstruct their directions. However, besides of being capable of detecting high energy neutrinos, neutrino telescopes could measure the incoming flux of magnetic monopoles in the detector. In this work, were first presented the different methods used in order to calibrate the photomultipliers, which are the heart of a neutrino telescope. The possibility of detecting magnetic monopoles with ANTARES was then discussed, and a first analysis optimised for the search for high velocity magnetic monopoles showed the great sensitivity offered by the telescope. Finally, a track reconstruction algorithm was modified, and a new analysis this time sensitive over a wider range of velocities was performed. After the application of the last analysis on the data taken in 2008 with the ANTARES telescope, new upper limits on the upward going magnetic monopole flux, of masses lower than 10 14 GeV were obtained, and are the best experimental constraints on their flux for the velocity region β ∼ [0.65, 0.995]. (author)
Reception and dissemination of American amateur telescope making in Sweden
Karnfelt, Johan
2017-04-01
This paper discusses the appropriation of the American Amateur Telescope Making (ATM) movement in Sweden in the 1940s and 1950s. A key player was the Swedish Astronomical Society, which in 1943, and inspired by the American example, launched a campaign to raise interest in ATM and disseminate the necessary knowledge amongst potential amateur astronomers. The campaign was successful and in just a few years it quadrupled the number of amateurs with access to telescopes. Swedish amateurs kept on building telescopes through the 1950s, but the activities then stalled with the introduction of cheap mass-market telescopes. The appropriation of ATM in Sweden is an important example of how technical innovations have shaped the course of amateur astronomy.
Schallig, Ellen; Lewis, Ian J.; Gilbert, James; Dalton, Gavin; Brock, Matthew; Abrams, Don Carlos; Middleton, Kevin; Aguerri, J. Alfonso L.; Bonifacio, Piercarlo; Carrasco, Esperanza; Trager, Scott C.; Vallenari, Antonella
2016-08-01
WEAVE is the next-generation wide-field optical spectroscopy facility for the William Herschel Telescope (WHT) on La Palma in the Canary Islands, Spain. It is a multi-object "pick-and-place" fibre-fed spectrograph with a 1000 fibre multiplex behind a new dedicated 2° prime focus corrector. The WEAVE positioner concept uses two robots working in tandem in order to reconfigure a fully populated field within the expected 1 hour dwell-time for the instrument (a good match between the required exposure times and the limit of validity for a given configuration due to the effects of differential refraction). In this paper we describe some of the final design decisions arising from the prototyping phase of the instrument design and provide an update on the current manufacturing status of the fibre positioner system.
Wood, M. A.
2003-12-01
The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.
The E-ELT project: the telescope main structure detailed design study
Marchiori, Gianpietro; Busatta, Andrea; Ghedin, Leonardo; De Lorenzi, Simone
2012-09-01
The European Extremely Large Telescope (E-ELT) is the biggest telescope in the world. Within the Detailed Design activities, ESO has awarded EIE GROUP (European Industrial Engineering) a contract for the Design of the Main Structure to the point where the concept of the telescope has been consolidated, from a construction point of view. All the Design activities have been developed in order to create an integrated system in terms of functionality and performance, while the engineering activities have been performed with the aim of obtaining a telescope that can be built, transported, integrated, with a reduced maintainability.
Hull, Anthony B.; Barentine, J.; Legters, S.
2012-01-01
The same technology and analytic approaches that led to cost-effective unmitigated successes for the spaceborne Kepler and WISE telescopes are now being applied to meter-class to 4-meter-class ground telescopes, providing affordable solutions to ground astronomy, with advanced features as needed for the application. The range of optical and mechanical performance standards and features that can be supplied for ground astronomy shall be described. Both classical RC designs, as well as unobscured designs are well represented in the IOS design library, allowing heritage designs for both night time and day time operations, the latter even in the proximity of the sun. In addition to discussing this library of mature features, we will also describe a process for working with astronomers early in the definition process to provide the best-value solution. Solutions can include remote operation and astronomical data acquisition and transmission.
A Cosmic Ray Telescope For Educational Purposes
International Nuclear Information System (INIS)
Voulgaris, G.; Kazanas, S.; Chamilothoris, I.
2010-01-01
Cosmic ray detectors are widely used, for educational purposes, in order to motivate students to the physics of elementary particles and astrophysics. Using a 'telescope' of scintillation counters, the directional characteristics, diurnal variation, correlation with solar activity, can be determined, and conclusions about the composition, origin and interaction of elementary particles with the magnetic field of earth can be inferred. A telescope was built from two rectangular scintillator panels with dimensions: 91.6x1.9x3.7 cm 3 . The scintillators are placed on top of each other, separated by a fixed distance of 34.6 cm. They are supported by a wooden frame which can be rotated around a horizontal axis. Direction is determined by the coincidence of the signals of the two PMTs. Standard NIM modules are used for readout. This device is to be used in the undergraduate nuclear and particle physics laboratory. The design and construction of the telescope as well as some preliminary results are presented.
The Lovell Telescope and its role in pulsar astronomy
Lyne, Andrew; Morison, Ian
2017-12-01
This year marks the 60th anniversary of the commissioning of the 250-ft telescope at Jodrell Bank Observatory, and the 50th anniversary of the discovery of pulsars at Cambridge. Both events resulted in enduring astronomical researches that have become intimately entwined, and here we celebrate them with a brief historical account of their relationship. We describe how the completion of the telescope in October 1957 coincided with the launch of Sputnik 1 at the start of the space race, a timely circumstance that was the financial saviour of Bernard Lovell's ambitious project. The telescope established a vital role in space tracking and, by the time that pulsars were discovered a decade later, was supported by an infrastructure that allowed their prompt, successful observation. Technical innovations to both the telescope and its receivers since then have continued to make it a superb tool for world-leading pulsar investigations and the study of the radio Universe.
Radio telescope reflectors historical development of design and construction
Baars, Jacob W M
2018-01-01
This book demonstrates how progress in radio astronomy is intimately linked to the development of reflector antennas of increasing size and precision. The authors describe the design and construction of major radio telescopes as those in Dwingeloo, Jodrell Bank, Parkes, Effelsberg and Green Bank since 1950 up to the present as well as millimeter wavelength telescopes as the 30m MRT of IRAM in Spain, the 50m LMT in Mexico and the ALMA submillimeter instrument. The advances in methods of structural design and coping with environmental influences (wind, temperature, gravity) as well as application of new materials are explained in a non-mathematical, descriptive and graphical way along with the story of the telescopes. Emphasis is placed on the interplay between astronomical and electromagnetic requirements and structural, mechanical and control solutions. A chapter on management aspects of large telescope projects closes the book. The authors address a readership with interest in the progress of engineering sol...
FACT. Normalized and asynchronous mirror alignment for Cherenkov telescopes
Energy Technology Data Exchange (ETDEWEB)
Mueller, Sebastian Achim [ETH Zurich (Switzerland); Buss, Jens [TU Dortmund (Germany)
2016-07-01
Imaging Atmospheric Cherenkov Telescopes (IACTs) need fast and large imaging optics to map the faint Cherenkov light emitted in cosmic ray air showers onto their image sensors. Segmented reflectors are inexpensive, lightweight and offer good image quality. However, alignment of the mirror facets remains a challenge. A good alignment is crucial in IACT observations to separate gamma rays from hadronic cosmic rays. We present a star tracking alignment method which is not restricted to clear nights. It normalizes the mirror facet reflections to be independent of the reference star or the cloud coverage. It records asynchronously of the telescope drive which makes the method easy to integrate in existing telescopes. It can be combined with remote facet actuation, but it does not need one to work. Furthermore, it can reconstruct all individual mirror facet point spread functions. We present the method and alignment results on the First Geiger-mode Photo Diode Avalanche Cherenkov Telescope (FACT) on the Canary Island of La Palma, Spain.
Wide-Field Imaging Telescope-0 (WIT0) with automatic observing system
Ji, Tae-Geun; Byeon, Seoyeon; Lee, Hye-In; Park, Woojin; Lee, Sang-Yun; Hwang, Sungyong; Choi, Changsu; Gibson, Coyne Andrew; Kuehne, John W.; Prochaska, Travis; Marshall, Jennifer L.; Im, Myungshin; Pak, Soojong
2018-01-01
We introduce Wide-Field Imaging Telescope-0 (WIT0), with an automatic observing system. It is developed for monitoring the variabilities of many sources at a time, e.g. young stellar objects and active galactic nuclei. It can also find the locations of transient sources such as a supernova or gamma-ray bursts. In 2017 February, we installed the wide-field 10-inch telescope (Takahashi CCA-250) as a piggyback system on the 30-inch telescope at the McDonald Observatory in Texas, US. The 10-inch telescope has a 2.35 × 2.35 deg field-of-view with a 4k × 4k CCD Camera (FLI ML16803). To improve the observational efficiency of the system, we developed a new automatic observing software, KAOS30 (KHU Automatic Observing Software for McDonald 30-inch telescope), which was developed by Visual C++ on the basis of a windows operating system. The software consists of four control packages: the Telescope Control Package (TCP), the Data Acquisition Package (DAP), the Auto Focus Package (AFP), and the Script Mode Package (SMP). Since it also supports the instruments that are using the ASCOM driver, the additional hardware installations become quite simplified. We commissioned KAOS30 in 2017 August and are in the process of testing. Based on the WIT0 experiences, we will extend KAOS30 to control multiple telescopes in future projects.
Autonomous Dome for a Robotic Telescope
Kumar, A.; Sengupta, A.; Ganesh, S.
2016-12-01
The Physical Research Laboratory operates a 50 cm robotic observatory at Mount Abu (Rajsthan, India). This Automated Telescope for Variability Studies (ATVS) makes use of the Remote Telescope System 2 (RTS2) for autonomous operations. The observatory uses a 3.5 m dome from Sirius Observatories. We have developed electronics using Arduino electronic circuit boards with home grown logic and software to control the dome operations. We are in the process of completing the drivers to link our Arduino based dome controller with RTS2. This document is a short description of the various phases of the development and their integration to achieve the required objective.
Status of the GroundBIRD Telescope
Directory of Open Access Journals (Sweden)
Choi J.
2018-01-01
Full Text Available Our understanding of physics at very early Universe, as early as 10−35 s after the Big Bang, relies on the scenario known as the inflationary cosmology. Inflation predicts a particular polarization pattern in the cosmic microwave background, known as the B-mode yet the strength of such polarization pattern is extremely weak. To search for the B-mode of the polarization in the cosmic microwave background, we are constructing an off-axis rotating telescope to mitigate systematic effects as well as to maximize the sky coverage of the observation. We will discuss the present status of the GroundBIRD telescope.
Automation of the Lowell Observatory 0.8-m Telescope
Buie, M. W.
2001-11-01
In the past year I have converted the Lowell Observatory 0.8-m telescope from a classically scheduled and operated telescope to an automated facility. The new setup uses an existing CCD camera and the existing telescope control system. The key steps in the conversion were writing a new CCD control and data acquisition module plus writing communication and queue control software. The previous CCD control program was written for DOS and much of the code was reused for this project. The entire control system runs under Linux and consists of four daemons: MOVE, PCCD, CMDR, and PCTL. The MOVE daemon is a process that communciates with the telescope control system via an RS232 port, keeping track of its state and forwarding commands from other processes to the telescope. The PCCD daemon controls the CCD camera and collects data. The CMDR daemon maintains a FIFO queue of commands to be executed during the night. The PCTL daemon receives notification from any other deamon of execution failures and sends an error code to the on-duty observer via a numeric pager. This system runs through the night much as you would traditionally operate a telescope. However, this system permits queuing up all the commands for a night and they execute one after another in sequence. Additional commands are needed to replace the normal human interaction during observing (ie., target acquisition, field registration, focusing). Also, numerous temporal synchronization commands are required so that observations happen at the right time. The system was used for this year's photometric monitoring of Pluto and Triton and is in general use for 2/3 of time on the telescope. Pluto observations were collected on 30 nights out of a potential pool of 90 nights. Detailed system design and capabilites plus sample observations will be presented. Also, a live demonstration will be provided if the weather is good. This work was supported by NASA Grant NAG5-4210 and the NSF REU Program grant to NAU.
Kalman Filter for Calibrating a Telescope Focal Plane
Kang, Bryan; Bayard, David
2006-01-01
The instrument-pointing frame (IPF) Kalman filter, and an algorithm that implements this filter, have been devised for calibrating the focal plane of a telescope. As used here, calibration signifies, more specifically, a combination of measurements and calculations directed toward ensuring accuracy in aiming the telescope and determining the locations of objects imaged in various arrays of photodetectors in instruments located on the focal plane. The IPF Kalman filter was originally intended for application to a spaceborne infrared astronomical telescope, but can also be applied to other spaceborne and ground-based telescopes. In the traditional approach to calibration of a telescope, (1) one team of experts concentrates on estimating parameters (e.g., pointing alignments and gyroscope drifts) that are classified as being of primarily an engineering nature, (2) another team of experts concentrates on estimating calibration parameters (e.g., plate scales and optical distortions) that are classified as being primarily of a scientific nature, and (3) the two teams repeatedly exchange data in an iterative process in which each team refines its estimates with the help of the data provided by the other team. This iterative process is inefficient and uneconomical because it is time-consuming and entails the maintenance of two survey teams and the development of computer programs specific to the requirements of each team. Moreover, theoretical analysis reveals that the engineering/ science iterative approach is not optimal in that it does not yield the best estimates of focal-plane parameters and, depending on the application, may not even enable convergence toward a set of estimates.
Education and outreach using the falcon telescope network
Gresham, Kimberlee C.; Palma, Christopher; Polsgrove, Daniel E.; Chun, Francis K.; Della-Rose, Devin J.; Tippets, Roger D.
2016-12-01
The Falcon Telescope Network (FTN) is a global network of small aperture telescopes developed by the Center for Space Situational Awareness Research in the Department of Physics at the United States Air Force Academy (USAFA). Consisting of commercially available equipment, the FTN is a collaborative effort between USAFA and other educational institutions ranging from two- and four-year colleges to major research universities. USAFA provides the equipment (e.g. telescope, mount, camera, filter wheel, dome, weather station, computers and storage devices) while the educational partners provide the building and infrastructure to support an observatory. The user base includes USAFA along with K-12 and higher education faculty and students. The diversity of the users implies a wide variety of observing interests, and thus the FTN collects images on diverse objects, including satellites, galactic and extragalactic objects, and objects popular for education and public outreach. The raw imagery, all in the public domain, will be accessible to FTN partners and will be archived at USAFA. Currently, there are five Falcon telescopes installed, two in Colorado and one each in Pennsylvania, Chile, and Australia. These five telescopes are in various stages of operational capability but all are remotely operable via a remote desktop application. The FTN team has conducted STEM First Light Projects for three of the U.S. observatories, soliciting proposals from middle and high school students and teachers that suggest and then become what is observed as official STEM first-light objects. Students and teachers learn how to write and submit a proposal as well as how telescopes operate and take data, while university-level students at the U.S. Air Force Academy and The Pennsylvania State University learn how to evaluate proposals and provide feedback to the middle and high school students and teachers. In this paper, we present the current status of the FTN, details of and lessons
The Telescope Array experiment: status and prospects
Energy Technology Data Exchange (ETDEWEB)
Tokuno, H; Cohen, F [Institute for Cosmic Ray Research, University of Tokyo, Kashiwa (Japan); Abbasi, R U; Abu-Zayyad, T; Belz, J W; Blake, S A; Brusova, O; Cady, R; Cao, Z [University of Utah, Salt Lake City (United States); Azuma, R [Tokyo Institute of Technology, Tokyo (Japan); Benno, T; Chikawa, M; Doura, K [Kinki University, Osaka (Japan); Bergman, D R [Rutgers University, Piscataway (United States); Cheon, B G [Hanyang University, Seoul (Korea, Republic of); Chiba, J [Tokyo University of Science, Noda (Japan); Cho, I S [Yonsei University, Seoul (Korea, Republic of); Chung, T [Ewha Womans University, Seoul (Korea, Republic of); Doyle, T [Utah State University, Logan (United States); Endo, A [Saitama University, Saitama (Japan)], E-mail: htokuno@icrr.u-tokyo.ac.jp (and others)
2008-07-15
Telescope Array (TA) is a hybrid detector of a surface detector array and fluorescence telescopes. This hybrid detector will measure the energy spectrum, anisotropy and composition of ultra-high energy cosmic rays (UHECRs) to identify their origin. The almost construction of the detector has been completed in May 2007, and the detector is running under test and adjustments. The first hybrid observation with the full configuration is planned in beginning of 2008. In this paper the status and prospects of TA detector is described.
Watson, Fraser T.; Beck, Christian; Penn, Matthew J.; Tritschler, Alexandra; Pillet, Valentín Martinez; Livingston, William C.
2015-11-01
In this article we describe a recent effort to cross-calibrate data from an infrared detector at the McMath-Pierce Solar Telescope and the Facility InfraRed Spectropolarimeter (FIRS) at the Dunn Solar Telescope. A synoptic observation program at the McMath-Pierce has measured umbral magnetic field strengths since 1998, and this data set has recently been compared with umbral magnetic field observations from SOHO/MDI and SDO/HMI. To further improve on the data from McMath-Pierce, we compared the data with measurements taken at the Dunn Solar Telescope with far greater spectral resolution than has been possible with space instrumentation. To minimise potential disruption to the study, concurrent umbral measurements were made so that the relationship between the two datasets can be most accurately characterised. We find that there is a strong agreement between the umbral magnetic field strengths recorded by each instrument, and we reduced the FIRS data in two different ways to successfully test this correlation further.
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... The Thirty-Meter Telescope international observatory will enable transformational observations over the full cosmic timeline all the way from the first luminous objects in the Universe to the planets and moons of our own solar system. To realize its full scientific potential, TMT will be equipped with a powerful ...
FRAM telescope - monitoring of atmospheric extinction and variable star photometry
Jurysek, J.; Honkova, K.; Masek, M.
2015-02-01
The FRAM (F/(Ph)otometric Robotic Atmospheric Monitor) telescope is a part of the Pierre Auger Observatory (PAO) located near town Malargüe in Argentina. The main task of the FRAM telescope is the continuous night - time monitoring of the atmospheric extinction and its wavelength dependence. The current methodology of the measurement of a atmospheric extinction and for instrumentation properties also allows simultaneous observation of other interesting astronomical targets. The current observations of the FRAM telescope are focused on the photometry of eclipsing binaries, positional refinement of minor bodies of the Solar system and observations of optical counterparts of gamma ray bursts. In this contribution, we briefly describe the main purpose of the FRAM telescope for the PAO and we also present its current astrono mical observing program.
Observations of VHE γ-Ray Sources with the MAGIC Telescope
Bartko, H.
2008-10-01
The MAGIC telescope with its 17m diameter mirror is today the largest operating single-dish Imaging Air Cherenkov Telescope (IACT). It is located on the Canary Island La Palma, at an altitude of 2200m above sea level, as part of the Roque de los Muchachos European Northern Observatory. The MAGIC telescope detects celestial very high energy γ-radiation in the energy band between about 50 GeV and 10 TeV. Since Autumn of 2004 MAGIC has been taking data routinely, observing various objects like supernova remnants (SNRs), γ-ray binaries, Pulsars, Active Galactic Nuclei (AGN) and Gamma-ray Bursts (GRB). We briefly describe the observational strategy, the procedure implemented for the data analysis, and discuss the results for individual sources. An outlook to the construction of the second MAGIC telescope is given.
Reducing the Requirements and Cost of Astronomical Telescopes
Smith, W. Scott; Whitakter, Ann F. (Technical Monitor)
2002-01-01
Limits on astronomical telescope apertures are being rapidly approached. These limits result from logistics, increasing complexity, and finally budgetary constraints. In an historical perspective, great strides have been made in the area of aperture, adaptive optics, wavefront sensors, detectors, stellar interferometers and image reconstruction. What will be the next advances? Emerging data analysis techniques based on communication theory holds the promise of yielding more information from observational data based on significant computer post-processing. This paper explores some of the current telescope limitations and ponders the possibilities increasing the yield of scientific data based on the migration computer post-processing techniques to higher dimensions. Some of these processes hold the promise of reducing the requirements on the basic telescope hardware making the next generation of instruments more affordable.
Sub-millimeter science with the Heinrich-Hertz-Telescope
Dumke, Michael
The Heinrich-Hertz-Telescope on Mt. Graham, Arizona, is a state-of-the-art single-dish radio telescope for observations in the sub-millimeter wavelength range. It is operated by the Sub-Millimeter Telescope Observatory (SMTO), which is a collaboration between the University of Arizona, Tucson, and the Max-Planck-Institut für Radioastronomie, Bonn. In this talk I give an overview over the telescope and its instrumentation, and show some examples of forefront research performed by astronomers from both the U.S. and Europe using this instrument. The telescope is located on Mt. Graham, Arizona, at an altitude of 3178 m, which ensures sub-mm weather conditions during a significant amount of available observing time. It has a primary reflector of 10 m diameter, mounted on a carbon fiber backup structure, and is equipped with a corotating enclosure. The surface accuracy of the primary reflector is 12 microns rms, what makes the HHT the most accurate radio telescope ever built. For spectral line observations, SIS receivers covering the frequency range from 200 to 500 GHz are available. Furthermore, a Hot-Electron-Bolometer, developed at the CfA, can be used for spectral line observations above 800 GHz. The continuum receivers are a 4-color bolometer, observing at 1300, 870, 450, and 350 microns, and a 19-channel bolometer array, developed at the MPIfR, which is sensitive around 850 microns. In the last few years, the HHT has been used by several groups to perform astronomical research. The most notable result was the measurement of the CO(9--8) line in Orion at 1.037 THz with the Hot-Electron Bolometer -- the first radioastronomical observation above 1 THz from a ground-based telescope. Several galactic molecular line sources have been mapped in the CO(7--6) line at 806 GHz, and in two fine-structure lines of atomic carbon. A continuum map of the galactic center at 850 microns could be produced using the new 19-channel bolometer array. Even external galaxies, where
Tricerascope: The Triple Threat Robotic Telescope of the Community College of Southern Nevada
Nations, H. L.; Erwin, T. D.
2005-12-01
With over 34000 students and three primary campuses, the Community College of Southern Nevada is the largest college or university in the state. It is also the largest provider of astronomy education, with a total of forty sections of introductory astronomy classes and labs in the Fall of 2005, six full time astronomy faculty, and a busy planetarium which has just been upgraded to a digital projector. Unfortunately, it is also located in the light pollution capital of the observable universe, Las Vegas, Nevada. But to counterbalance that somewhat, we do have over 300 clear, sunny days per year. This has led us to develop Tricerascope, our triple threat robotic telescope. Given the busy teaching schedules of our faculty, Tricerascope was designed to use, as much as possible, commercial, off-the-shelf technology. The primary hardware consists of a Coronado Solarmax 60 Halpha telescope with a bandpass of Robo-Focus devices. The telescopes themselves are piggy-backed on an eight inch Meade LX200GPS which has an SBIG ST7 XME camera and CFW filter wheel. All of these reside in a Technical Innovations RoboDome . The overall software controlling the observatory is Astronomy Control Panel 4.1. We show details of the hardware (including an unique shutter for the LX200) and software and how they work together as well as daytime and nighttime images. We will also discuss how the observatory is being integrated into the astronomy curriculum at the college and in local secondary schools.
Yang, Eui-Hyeok; Shcheglov, Kirill
2002-01-01
Future concepts of ultra large space telescopes include segmented silicon mirrors and inflatable polymer mirrors. Primary mirrors for these systems cannot meet optical surface figure requirements and are likely to generate over several microns of wavefront errors. In order to correct for these large wavefront errors, high stroke optical quality deformable mirrors are required. JPL has recently developed a new technology for transferring an entire wafer-level mirror membrane from one substrate to another. A thin membrane, 100 mm in diameter, has been successfully transferred without using adhesives or polymers. The measured peak-to-valley surface error of a transferred and patterned membrane (1 mm x 1 mm x 0.016 mm) is only 9 nm. The mirror element actuation principle is based on a piezoelectric unimorph. A voltage applied to the piezoelectric layer induces stress in the longitudinal direction causing the film to deform and pull on the mirror connected to it. The advantage of this approach is that the small longitudinal strains obtainable from a piezoelectric material at modest voltages are thus translated into large vertical displacements. Modeling is performed for a unimorph membrane consisting of clamped rectangular membrane with a PZT layer with variable dimensions. The membrane transfer technology is combined with the piezoelectric bimorph actuator concept to constitute a compact deformable mirror device with a large stroke actuation of a continuous mirror membrane, resulting in a compact A0 systems for use in ultra large space telescopes.
Reed, S. L.; McMahon, R. G.; Martini, P.; Banerji, M.; Auger, M.; Hewett, P. C.; Koposov, S. E.; Gibbons, S. L. J.; Gonzalez-Solares, E.; Ostrovski, F.; Tie, S. S.; Abdalla, F. B.; Allam, S.; Benoit-Lévy, A.; Bertin, E.; Brooks, D.; Buckley-Geer, E.; Burke, D. L.; Carnero Rosell, A.; Carrasco Kind, M.; Carretero, J.; da Costa, L. N.; DePoy, D. L.; Desai, S.; Diehl, H. T.; Doel, P.; Evrard, A. E.; Finley, D. A.; Flaugher, B.; Fosalba, P.; Frieman, J.; García-Bellido, J.; Gaztanaga, E.; Goldstein, D. A.; Gruen, D.; Gruendl, R. A.; Gutierrez, G.; James, D. J.; Kuehn, K.; Kuropatkin, N.; Lahav, O.; Lima, M.; Maia, M. A. G.; Marshall, J. L.; Melchior, P.; Miller, C. J.; Miquel, R.; Nord, B.; Ogando, R.; Plazas, A. A.; Romer, A. K.; Sanchez, E.; Scarpine, V.; Schubnell, M.; Sevilla-Noarbe, I.; Smith, R. C.; Sobreira, F.; Suchyta, E.; Swanson, M. E. C.; Tarle, G.; Tucker, D. L.; Walker, A. R.; Wester, W.
2017-07-01
We present the discovery and spectroscopic confirmation with the European Southern Observatory New Technology Telescope (NTT) and Gemini South telescopes of eight new, and the rediscovery of two previously known, 6.0 VISTA Hemisphere Survey (J, H, K) and Wide-field Infrared Survey Explorer (W1, W2). The photometric data were fitted with a grid of quasar model SEDs with redshift-dependent Ly α forest absorption and a range of intrinsic reddening as well as a series of low-mass cool star models. Candidates were ranked using an SED-model-based χ2-statistic, which is extendable to other future imaging surveys (e.g. LSST and Euclid). Our spectral confirmation success rate is 100 per cent without the need for follow-up photometric observations as used in other studies of this type. Combined with automatic removal of the main types of non-astrophysical contaminants, the method allows large data sets to be processed without human intervention and without being overrun by spurious false candidates. We also present a robust parametric redshift estimator that gives comparable accuracy to Mg II and CO-based redshift estimators. We find two z ˜ 6.2 quasars with H II near zone sizes ≤3 proper Mpc that could indicate that these quasars may be young with ages ≲ 106-107 years or lie in over dense regions of the IGM. The z = 6.5 quasar VDES J0224-4711 has JAB = 19.75 and is the second most luminous quasar known with z ≥ 6.5.
Black holes at neutrino telescopes
International Nuclear Information System (INIS)
Kowalski, M.; Ringwald, A.; Tu, H.
2002-01-01
In scenarios with extra dimensions and TeV-scale quantum gravity, black holes are expected to be produced in the collision of light particles at center-of-mass energies above the fundamental Planck scale with small impact parameters. Black hole production and evaporation may thus be studied in detail at the large hadron collider (LHC). But even before the LHC starts operating, neutrino telescopes such as AMANDA/IceCube, ANTARES, Baikal, and RICE have an opportunity to search for black hole signatures. Black hole production in the scattering of ultrahigh energy cosmic neutrinos on nucleons in the ice or water may initiate cascades and through-going muons with distinct characteristics above the Standard Model rate. In this Letter, we investigate the sensitivity of neutrino telescopes to black hole production and compare it to the one expected at the Pierre Auger Observatory, an air shower array currently under construction, and at the LHC. We find that, already with the currently available data, AMANDA and RICE should be able to place sensible constraints in black hole production parameter space, which are competitive with the present ones from the air shower facilities Fly's Eye and AGASA. In the optimistic case that a ultrahigh energy cosmic neutrino flux significantly higher than the one expected from cosmic ray interactions with the cosmic microwave background radiation is realized in nature, one even has discovery potential for black holes at neutrino telescopes beyond the reach of LHC. (orig.)
Resurfacing the Jodrell Bank Mk II radio telescope
Spencer, R. E.; Haggis, J. S.; Morrison, I.; Davis, R. J.; Melling, R. J.
The improvement of the short-wavelength performance of the Jodrell Bank Mk II radio telescope is described. A final rms profile error of 0.6 mm was achieved due to the invention of an inexpensive technique of panel construction and measurement combined with the use of radio-astronomical holographic techniques to measure the telescope under actual operating conditions. Some further improvements to extend the short wavelength performance are suggested.
Teets, Donald
2012-01-01
Two coordinate systems are related here, one defined by the earth's equator and north pole, the other by the orientation of a telescope at some location on the surface of the earth. Applying an interesting though somewhat obscure property of orthogonal matrices and using the cross-product simplifies this relationship, revealing that a surprisingly…
The Status of the Telescope Array experiment
Energy Technology Data Exchange (ETDEWEB)
Tokuno, H; Azuma, R [Tokyo Institute of Technology, Meguro, Tokyo (Japan); Abu-Zayyad, T; Allen, M; Barcikowski, E; Belz, J W; Blake, S A; Brusova, O; Cady, R [University of Utah, High Energy Astrophysics Institute, Salt Lake City, Utah (United States); Aida, R [University of Yamanashi, Interdisciplinary Graduate School of Medicine and Engineering, Kofu, Yamanashi (Japan); Benno, T; Chikawa, M; Doura, K [Kinki University, Higashi Osaka, Osaka (Japan); Bergman, D R [Rutgers University, Piscataway (United States); Cheon, B G; Cho, E J [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Chiba, J [Tokyo University of Science, Noda, Chiba (Japan); Cho, L S; Cho, W R [Yonsei University, Seodaemun-gu, Seoul (Korea, Republic of); Cohen, F, E-mail: htokuno@cr.phys.titech.ac.jp [Institute for Cosmic Ray Research, University of Tokyo, Kashiwa, Chiba (Japan)
2011-04-01
The purpose of The Telescope Array experiment is to identify origin of the ultra high energy cosmic rays. The Telescope Array is a hybrid detector consists of a surface detector array and air fluorescence detectors. This hybrid detector is observing extensive air showers to measure the energy spectrum, anisotropy and composition of Ultra High Energy Cosmic Rays. The detector construction has been completed in March 2008, and the hybrid observation with the full configuration has been running since that time. In this talk, the status of observation and our prospects are described.
Brandner, Wolfgang; Hormuth, Felix
Lucky Imaging improves the angular resolution of astronomical observations hampered by atmospheric turbulence ("seeing"). Unlike adaptive optics, Lucky Imaging is a passive observing technique with individual integration times comparable to the atmospheric coherence time. Thanks to the advent of essentially noise free "Electron multiplying CCD" detectors, Lucky Imaging saw a renewed interest in the past decade. It is now routinely used at a number of 2-5-m class telescopes, such as ESO's NTT. We review the history of Lucky Imaging, present the technical implementation, describe the data analysis philosophy, and show some recent results obtained with this technique. We also discuss the advantages and limitations of Lucky Imaging compared to other passive and active high angular resolution observing techniques.
Engaging Undergraduate Students in Transiting Exoplanet Research with Small Telescopes
Stephens, Denise C.; Stoker, E.; Gaillard, C.; Ranquist, E.; Lara, P.; Wright, K.
2013-10-01
Brigham Young University has a relatively large undergraduate physics program with 300 to 360 physics majors. Each of these students is required to be engaged in a research group and to produce a senior thesis before graduating. For the astronomy professors, this means that each of us is mentoring at least 4-6 undergraduate students at any given time. For the past few years I have been searching for meaningful research projects that make use of our telescope resources and are exciting for both myself and my students. We first started following up Kepler Objects of Interest with our 0.9 meter telescope, but quickly realized that most of the transits we could observe were better analyzed with Kepler data and were false positive objects. So now we have joined a team that is searching for transiting planets, and my students are using our 16" telescope to do ground based follow-up on the hundreds of possible transiting planet candidates produced by this survey. In this presentation I will describe our current telescopes, the observational setup, and how we use our telescopes to search for transiting planets. I'll describe some of the software the students have written. I'll also explain how to use the NASA Exoplanet Archive to gather data on known transiting planets and Kepler Objects of Interests. These databases are useful for determining the observational limits of your small telescopes and teaching your students how to reduce and report data on transiting planets. Once that is in place, you are potentially ready to join existing transiting planet missions by doing ground-based follow-up. I will explain how easy it can be to implement this type of research at any high school, college, or university with a small telescope and CCD camera.
A concept for a thirty-meter telescope
Burgarella, Denis; Zamkotsian, Frederic; Dohlen, Kjetil; Ferrari, Marc; Hammer, Francois; Sayede, Frederic; Rigaud, Francois
2004-07-01
In May 2000, the Canada-France-Hawaii (CFHT) Telescope Science Advisory Committee solicited the Canadian, Hawaiian and French communities to propose concepts to replace the present CFH telescope by a larger telescope. Three groups were selected: Carlberg et al. (2001) in Canada, Khun et al. (2001) in Hawaii and Burgarella et al. (2001a) in France. The reports were delivered to CFHT in May 2001 and are now available throughout the CFHT website. One of the main constraints was due to the fact that the new and larger telescope should use as much as possible the existing site and be compliant with the Mauna Kea Science reserve Master Plan (2000). This plan analyses all aspects of the Mauna Kea summit but most of them are related to the facts that the mountain must be considered as a sacred area for indigenous Hawaiian people and that the ecosystem is fragile. But in addition, the plan also tries to account for the fact that the summit of Mauna Kea is a world famous site for astronomy. The points that we can highlight in the context of our project are of two types. Since then, the project evolved and Hawaii is not considered as the one and only site to build an Extremely Large Telescope (ELT). Moreover, the size of the primary mirror, which was strongly dependent on the above constraints, is no more limited to the 16 - 20 m which was our conclusion at this time. Nevertheless, the three points of the resolution are still valid and since then, we have kept on working on the concept by launching differnt follow-up studies that are necessary to start such a project. Of course, the main point is the Science Objectives which drive the main specifications for an ELT. But related technical studies are also mandatory e.g. Adaptive Optics, Building of a primary mirror larger than 30 m in diameter, Image Quality as a function of the segment size and shape.
Completion of the Southern African Large Telescope
Buckley, D. A. H.; Charles, P. A.; O'Donoghue, D.; Nordsieck, K. H.
2006-08-01
The Southern African Large Telescope (SALT) is a low cost (19.7M), innovative, 10-m class optical telescope, which was inaugurated on 10 November 2005, just 5 years after ground-breaking. SALT and its first-light instruments are currently being commissioned, and full science operations are expected to begin later this year. This paper describes the design and construction of SALT, including the first-light instruments, SALTICAM and the Robert Stobie Spectrograph (RSS). A rigorous Systems Engineering approach was adopted to ensure that SALT was built to specification, on budget, close to the original schedule and using a relatively small project team. The design trade-offs, which include an active spherical primary mirror array in a fixed altitude telescope with a prime focus tracker, although restrictive in comparison to conventional telescopes, have resulted in an affordable and capable 10-m class telescope for South Africa and its ten partners. Coupled with an initial set of two seeing-limited instruments that concentrate on the UV-visible region (320 - 900nm) and featuring some unique observational capabilities, SALT will have an ability to conduct a wide range of science programs. These will include high time resolution studies, for which some initial results have already been obtained and are presented here. Many of the versatile modes available with the RSS will provide unparalleled opportunities for imaging polarimetry and spectropolarimetry. Likewise, Multi-Object Spectroscopy (using laser cut graphite slit masks) and imaging spectroscopy with the RSS, the latter using Fabry-Perot etalons and interference filters, will extend the multiplex advantage over resolutions from R = 300 to 9000 over fields of view of 2 to 8 arcminutes. Future instrumentation plans include an extremely stable, fibre-fed, high resolution échelle spectrograph and a near-IR (possibly to 1.7 μm) extension to the RSS. Future development possibilities include phasing the primary mirror
SALTICAM: $0.5M acquisition camera: every big telescope should have one
O'Donoghue, Darragh; Bauermeister, Etienne; Carter, David B.; Evans, Geoffrey P.; Koorts, Willie P.; O'Connor, James; Osman, Faranah; van der Merwe, Stan; Bigelow, Bruce C.
2003-03-01
The Southern African Large Telescope (SALT) is a 10-m class telescope presently under construction at Sutherland in South Africa. It is designed along the lines of the Hobby-Eberly Telescope (HET) at McDonald Observatory in West Texas. SALTICAM will be the Acquisition Camera and simple Science Imager (ACSI) for this telescope. It will also function as the Verification Instrument (VI) to check the performance of the telescope during commissioning. In VI mode, SALTICAM will comprise a filter unit, shutter and cryostat with a 2x1 mosaic of 2k x 4k x 15 micron pixel CCDs. It will be mounted at the f/4.2 corrected prime focus of the telescope. In ACSI mode it will be fed by a folding flat located close to the exit pupil of the telescope. ACSI mode will have the same functional components as VI mode but it will in addition be garnished with focal conversion lenses to re-image the corrected prime focal plane at f/2. The lenses will be made from UV transmitting crystals as the wavelength range for which the instrument is designed will span 320 to 950 nm. In addition to acting as Verification Instrument and Acquisition Camera, SALTICAM will perform simple science imaging in support of other instruments, but will also have a high time resolution capability which is not widely available on large telescopes. This paper will describe the design of the instrument, emphasizing features of particular interest.
Magnetospheric particle detection efficiency of a conical telescope
International Nuclear Information System (INIS)
Miah, M.A.; Mitchell, J.W.; Wefel, J.P.
1989-01-01
A semianalytic program has been developed to map the pitch angles of magnetospheric particles onto a detector telescope acceptance cone. The telescope fractional efficiency is defined as the fraction of the pitch angle cone in common with the telescope cone multiplied by the fractional perpendicular component of the exposed detector area, and normalized by 2π. Calculations have been performed as a function of the satellite's location, orbital inclination and the zenith angle of the telescope axis, both in dipole and real geomagnetic field models. At the dipole equator, the peak efficiency occurs at 90 0 pitch angle. In the real geomagnetic field model, the average value of the pitch angle for maximum efficiency is ≅ 88 0 . The efficiency function depends strongly upon latitude and is independent of longitude in a dipole field, but depends on longitude in the real field model. In either field model, altitude, angle of tilt and orbital inclination have little effect upon efficiency. The efficiency function calculated at the dipole equator can be used at the minimum magnetic field equator with little error, but not for points away from the B min position. The results are applied to calculate the absolute flux of magnetospheric particles observed near the equator. (orig.)
Can Telescopes Help Leo Satellites Dodge Most Lethal Impacts?
GUDIEL, ANDREA; Carroll, Joseph; Rowe, David
2018-01-01
Authors: Joseph Carroll and David RoweABSTRACT LEO objects are tracked by radar because it works day and night, in all weather. This fits military interest in potentially hostile objects. There is less interest in objects too small to be credible active threats. But accidental hypervelocity impact by even 5-10 mm objects can disable most LEO satellites. Such “cm-class” objects greatly outnumber objects of military interest, and will cause most accidental impact losses.Under good viewing conditions, a sunlit 5mm sphere with 0.15 albedo at 800 km altitude is a 19th magnitude object. A ground-based 0.5m telescope tracking it against a 20 mag/arcsec2 sky can see it in seconds, and provide 1 million such objects in LEO, nearly all debris fragments, mostly cm-class and at 600-1200 km altitude.Maintaining a ~million-item catalog requires a world-wide network of several dozen telescope sites with several telescopes at each site. Each telescope needs a mount capable of ~1,000,000 fast slews/year without wearing out.The paper discusses recent advances that make such a service far more feasible:1. Automated tasking and remote control of distributed telescope networks,2. Direct-drive mounts that can make millions of fast slews without wearing out,3. Telescope optics with low focal curvature that are in focus across large imagers,4. CMOS imagers with 95% peak QE and 1.5e- noise at 2E8 pix/sec readout rates,5. Methods for uncued detection of most lethal LEO debris (eg., >5 mm at 800 km),6. Initial orbit determination using 3 alt-az fixes made during the discovery pass,7. High-speed photometry to infer debris spin axis, to predict drag area changes,8. Better conjunction predictions using explicit modeling of drag area variations.
Taiwan Automated Telescope Network
Directory of Open Access Journals (Sweden)
Dean-Yi Chou
2010-01-01
can be operated either interactively or fully automatically. In the interactive mode, it can be controlled through the Internet. In the fully automatic mode, the telescope operates with preset parameters without any human care, including taking dark frames and flat frames. The network can also be used for studies that require continuous observations for selected objects.
Relay telescope for high power laser alignment system
Dane, C. Brent; Hackel, Lloyd; Harris, Fritz B.
2006-09-19
A laser system includes an optical path having an intracavity relay telescope with a telescope focal point for imaging an output of the gain medium between an image location at or near the gain medium and an image location at or near an output coupler for the laser system. A kinematic mount is provided within a vacuum chamber, and adapted to secure beam baffles near the telescope focal point. An access port on the vacuum chamber is adapted for allowing insertion and removal of the beam baffles. A first baffle formed using an alignment pinhole aperture is used during alignment of the laser system. A second tapered baffle replaces the alignment aperture during operation and acts as a far-field baffle in which off angle beams strike the baffle a grazing angle of incidence, reducing fluence levels at the impact areas.
Recent results on galactic sources with MAGIC telescope
International Nuclear Information System (INIS)
De los Reyes, R.
2009-01-01
Located at the Canary island of La Palma, the single-dish MAGIC telescope currently has the lowest energy threshold achieved by any Cherenkov telescope, which can be as low as 25 GeV. In the last two years, the MAGIC telescope has detected a significant amount of galactic sources that emit at very high energies (up to several TeV). Here we present the most recent results that have yielded important scientific highlights in astrophysics, which include the first detection of gamma-ray emission from a pulsar, an X-ray binary system and a stellar-mass black hole. We also make a review of the latest results of the MAGIC observations on galactic sources, which will include also γ-ray unidentified sources (TeV J2032+4130), the Galactic Centre, X-ray binaries (LSI +61 303), pulsars (Crab pulsar) and SNRs (IC443).