WorldWideScience

Sample records for technology center stc

  1. Solar Technology Center

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, Bob

    2011-04-27

    The Department of Energy, Golden Field Office, awarded a grant to the UNLV Research Foundation (UNLVRF) on August 1, 2005 to develop a solar and renewable energy information center. The Solar Technology Center (STC) is to be developed in two phases, with Phase I consisting of all activities necessary to determine feasibility of the project, including design and engineering, identification of land access issues and permitting necessary to determine project viability without permanently disturbing the project site, and completion of a National Environmental Policy Act (NEPA) Environmental Assessment. Phase II is the installation of infrastructure and related structures, which leads to commencement of operations of the STC. The STC is located in the Boulder City designated 3,000-acre Eldorado Valley Energy Zone, approximately 15 miles southwest of downtown Boulder City and fronting on Eldorado Valley Drive. The 33-acre vacant parcel has been leased to the Nevada Test Site Development Corporation (NTSDC) by Boulder City to accommodate a planned facility that will be synergistic with present and planned energy projects in the Zone. The parcel will be developed by the UNLVRF. The NTSDC is the economic development arm of the UNLVRF. UNLVRF will be the entity responsible for overseeing the lease and the development project to assure compliance with the lease stipulations established by Boulder City. The STC will be operated and maintained by University of Nevada, Las Vegas (UNLV) and its Center for Energy Research (UNLV-CER). Land parcels in the Eldorado Valley Energy Zone near the 33-acre lease are committed to the construction and operation of an electrical grid connected solar energy production facility. Other projects supporting renewable and solar technologies have been developed within the energy zone, with several more developments in the horizon.

  2. Technology Can Help Young Children Succeed. PACER Center ACTion Information Sheets: PHP-c70

    Science.gov (United States)

    PACER Center, 2014

    2014-01-01

    Parents of young children with disabilities are discovering that carefully selected computer software and mobile apps can provide many benefits such as improved self-esteem, a longer attention span, and inclusion among family and other children that help their children succeed at home and in school. PACER's Simon Technology Center (STC) can help…

  3. Process Engineering Technology Center Initiative

    Science.gov (United States)

    Centeno, Martha A.

    2002-01-01

    NASA's Kennedy Space Center (KSC) is developing as a world-class Spaceport Technology Center (STC). From a process engineering (PE) perspective, the facilities used for flight hardware processing at KSC are NASA's premier factories. The products of these factories are safe, successful shuttle and expendable vehicle launches carrying state-of-the-art payloads. PE is devoted to process design, process management, and process improvement, rather than product design. PE also emphasizes the relationships of workers with systems and processes. Thus, it is difficult to speak of having a laboratory for PE at K.S.C. because the entire facility is practically a laboratory when observed from a macro level perspective. However, it becomes necessary, at times, to show and display how K.S.C. has benefited from PE and how K.S.C. has contributed to the development of PE; hence, it has been proposed that a Process Engineering Technology Center (PETC) be developed to offer a place with a centralized focus on PE projects, and a place where K.S.C.'s PE capabilities can be showcased, and a venue where new Process Engineering technologies can be investigated and tested. Graphics for showcasing PE capabilities have been designed, and two initial test beds for PE technology research have been identified. Specifically, one test bed will look into the use of wearable computers with head mounted displays to deliver work instructions; the other test bed will look into developing simulation models that can be assembled into one to create a hierarchical model.

  4. CMOS detectors: lessons learned during the STC stereo channel preflight calibration

    Science.gov (United States)

    Simioni, E.; De Sio, A.; Da Deppo, V.; Naletto, G.; Cremonese, G.

    2017-09-01

    The Stereo Camera (STC), mounted on-board the BepiColombo spacecraft, will acquire in push frame stereo mode the entire surface of Mercury. STC will provide the images for the global three-dimensional reconstruction of the surface of the innermost planet of the Solar System. The launch of BepiColombo is foreseen in 2018. STC has an innovative optical system configuration, which allows good optical performances with a mass and volume reduction of a factor two with respect to classical stereo camera approach. In such a telescope, two different optical paths inclined of +/-20°, with respect to the nadir direction, are merged together in a unique off axis path and focused on a single detector. The focal plane is equipped with a 2k x 2k hybrid Si-PIN detector, based on CMOS technology, combining low read-out noise, high radiation hardness, compactness, lack of parasitic light, capability of snapshot image acquisition and short exposure times (less than 1 ms) and small pixel size (10 μm). During the preflight calibration campaign of STC, some detector spurious effects have been noticed. Analyzing the images taken during the calibration phase, two different signals affecting the background level have been measured. These signals can reduce the detector dynamics down to a factor of 1/4th and they are not due to dark current, stray light or similar effects. In this work we will describe all the features of these unwilled effects, and the calibration procedures we developed to analyze them.

  5. Status of international cooperation in nuclear technology on testing/research reactors between JAEA and INP-NNC

    International Nuclear Information System (INIS)

    Kawamura, Hiroshi; Tsuchiya, Kunihiko; Takemoto, Noriyuki; Kimura, Akihiro; Tanimoto, Masataka; Izumo, Hironobu; Chakrov, Petr; Gizatulin, Shamil; Chakrova, Yelena; Ludmila, Chkushuina; Asset, Shaimerdenov; Nataliya, Romanova

    2012-02-01

    Based on the implementing arrangement between National Nuclear Center of the Republic of Kazakhstan (NNC) and the Japan Atomic Energy Agency (JAEA) for 'Nuclear Technology on Testing/Research Reactors' in cooperation in Research and Development in Nuclear Energy and Technology, four specific topics of cooperation (STC) have been carried out from June, 2009. Four STCs are as follows; (1) STC No.II-1 : International Standard of Instrumentation. (2) STC No.II-2 : Irradiation Technology of RI Production. (3) STC No.II-3 : Lifetime Expansion of Beryllium Reflector. (4) STC No.II-4 : Irradiation Technology for NTD-Si. The information exchange, personal exchange and cooperation experiments are carried out under these STCs. The status in the field of nuclear technology on testing/research reactors in the implementing arrangement is summarized, and future plans of these specific topics of cooperation are described in this report. (author)

  6. Long Term Success of Endo-DCR with Silicone Tube Catheter (STC versus Endo-DCR without STC: A Comparative Study

    Directory of Open Access Journals (Sweden)

    Bidhan Ray

    2016-08-01

    Full Text Available Introduction   Epiphora  caused by  mechanical block at puncta, canaliculi, lacrimal sac and nasolacrimal duct need surgical correction. EndoDCR  is gaining  popularity over conventional surgery. This study aims at evaluating the role of Silicone Tube Catheter (STC to improve the long term outcome of endoDCR .               Materials and Method   This retrospective study was conducted on 58 consecutive endoDCR surgeries between 2012 and 2014. 22 subjects had endoDCR without STC, 36 subjects had endoDCR with STC, of whom in 20 cases STC was removed in  3 weeks and in 16 cases in  12 weeks. Clinical and endoscopic data collected post-operatively after 3 weeks,12 weeks and at 1 year. Analysis was done on intention to get suggestion for better result from endoDCR operations.                                           Results   Complications were identified as early and late. Complications like granulations, synaechia, echymosis, eyelid haematoma and surgical emphysema were searched for in every follow up. Development of obliterating scar was the main cause of failure. Epistaxis was negligible. No retrobulbar haematoma or rectus injury was noted. Minor synaechia between middle turbinate and nasal wall noted in 13.6 to 20%  of cases in all groups. Granulations were more in cases had STC for 12 weeks but managed with conservative measures. Obliterating scar was slightly less in this group in comparison to other groups.                                         Discussion    The present study emphasises the use of indwelling STC in endoDCR for a longer period .

  7. Dynamic Analysis and Test Results for an STC Stirling Generator

    Science.gov (United States)

    Qiu, Songgang; Peterson, Allen A.

    2004-02-01

    Long-life, high-efficiency generators based on free-piston Stirling machines are a future energy-conversion solution for both space and commercial applications. To aid in design and system integration efforts, Stirling Technology Company (STC) has developed dynamic simulation models for the internal moving subassemblies and for complete Stirling convertor assemblies. These dynamic models have been validated using test data from operating prototypes. Simplified versions of these models are presented to help explain the operating characteristics of the Stirling convertor. Power spectrum analysis is presented for the test data for casing acceleration, piston motion, displacer motion, and controller current/voltage during full power operation. The harmonics of a Stirling convertor and its moving components are identified for the STC zener-diode control scheme. The dynamic behavior of each moving component and its contribution to the system dynamics and resultant vibration forces are discussed. Additionally, the effects of a passive balancer and external suspension are predicted by another simplified system model.

  8. STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition.

    Science.gov (United States)

    Terra, Silvia R; Cardoso, João Carlos R; Félix, Rute C; Martins, Leo Anderson M; Souza, Diogo Onofre G; Guma, Fatima C R; Canário, Adelino Vicente M; Schein, Vanessa

    2015-03-05

    Stanniocalcin 1 (STC1) and calcitonin gene-related peptide (CGRP) are involved in bone formation/remodeling. Here we investigate the effects of STC1 on functional heterodimer complex CALCRL/RAMP1, expression and activity during osteoblastogenesis. STC1 did not modify CALCRL and ramp1 gene expression during osteoblastogenesis when compared to controls. However, plasma membrane spatial distribution of CALCRL/RAMP1 was modified in 7-day pre-osteoblasts exposed to either CGRP or STC1, and both peptides induced CALCRL and RAMP1 assembly. CGRP, but not STC1 stimulated cAMP accumulation in 7-day osteoblasts and in CALCRL/RAMP1 transfected HEK293 cells. Furthermore, STC1 inhibited forskolin stimulated cAMP accumulation of HEK293 cells, but not in CALCRL/RAMP1 transfected HEK293 cells. However, STC1 inhibited cAMP accumulation in calcitonin receptor (CTR) HEK293 transfected cells stimulated by calcitonin. In conclusion, STC1 signals through inhibitory G-protein modulates CGRP receptor spatial localization during osteoblastogenesis and may function as a regulatory factor interacting with calcitonin peptide members during bone formation. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  9. Characterization of 3D-stc detectors fabricated at ITC-irst

    International Nuclear Information System (INIS)

    Boscardin, Maurizio; Bosisio, Luciano; Bruzzi, Mara; Dalla Betta, Gian-Franco; Piemonte, Claudio; Pozza, Alberto; Ronchin, Sabina; Tosi, Carlo; Zorzi, Nicola

    2007-01-01

    3D silicon radiation detectors offer many advantages over planar detectors, including improved radiation tolerance and faster charge collection time. We proposed a new 3D architecture (referred to as 3D-stc), which features columnar electrodes of one doping type only, thus, allowing a considerable simplification of the manufacturing process. In this paper, we report selected results from the electrical characterization of 3D diodes fabricated with this technology, along with preliminary results on the charge collection efficiency of these devices

  10. Short p-type silicon microstrip detectors in 3D-stc technology

    Energy Technology Data Exchange (ETDEWEB)

    Eckert, S. [Physikalisches Institut, Albert-Ludwigs-Universitaet Freiburg, Hermann-Herder Strasse 3b, D-79104 Freiburg i. Br. (Germany)], E-mail: simon.eckert@physik.uni-freiburg.de; Jakobs, K.; Kuehn, S.; Parzefall, U. [Physikalisches Institut, Albert-Ludwigs-Universitaet Freiburg, Hermann-Herder Strasse 3b, D-79104 Freiburg i. Br. (Germany); Dalla-Betta, G.-F.; Zoboli, A. [Dipartimento di Ingegneria e Scienza dell' Informazione, Universita degli Studi di Trento, via Sommarive 14, I-38050 Povo di Trento (Italy); Pozza, A.; Zorzi, N. [FBK-irst Trento, Microsystems Division, via Sommarive 18, I-38050 Povo di Trento (Italy)

    2008-10-21

    The luminosity upgrade of the Large Hadron Collider (LHC), the sLHC, will constitute an extremely challenging radiation environment for tracking detectors. Significant improvements in radiation hardness are needed to cope with the increased radiation dose, requiring new tracking detectors. In the upgraded ATLAS detector the region from 20 to 50 cm distance to the beam will be covered by silicon strip detectors (SSD) with short strips. These will have to withstand a 1 MeV neutron equivalent fluence of about 1x10{sup 15}n{sub eq}/cm{sup 2}, hence extreme radiation resistance is necessary. For the short strips, we propose to use SSD realised in the radiation tolerant 3D technology, where rows of columns-etched into the silicon bulk-are joined together to form strips. To demonstrate the feasibility of 3D SSD for the sLHC, we have built prototype modules using 3D-single-type-column (stc) SSD with short strips and front-end electronics from the present ATLAS SCT. The modules were read out with the SCT Data Acquisition system and tested with an IR-laser. We report on the performance of these 3D modules, in particular the noise at 40 MHz which constitutes a measurement of the effective detector capacitance. Conclusions about options for using 3D SSD detectors for tracking at the sLHC are drawn.

  11. Indoor calibration for stereoscopic camera STC: a new method

    Science.gov (United States)

    Simioni, E.; Re, C.; Da Deppo, V.; Naletto, G.; Borrelli, D.; Dami, M.; Ficai Veltroni, I.; Cremonese, G.

    2017-11-01

    In the framework of the ESA-JAXA BepiColombo mission to Mercury, the global mapping of the planet will be performed by the on-board Stereo Camera (STC), part of the SIMBIO-SYS suite [1]. In this paper we propose a new technique for the validation of the 3D reconstruction of planetary surface from images acquired with a stereo camera. STC will provide a three-dimensional reconstruction of Mercury surface. The generation of a DTM of the observed features is based on the processing of the acquired images and on the knowledge of the intrinsic and extrinsic parameters of the optical system. The new stereo concept developed for STC needs a pre-flight verification of the actual capabilities to obtain elevation information from stereo couples: for this, a stereo validation setup to get an indoor reproduction of the flight observing condition of the instrument would give a much greater confidence to the developed instrument design. STC is the first stereo satellite camera with two optical channels converging in a unique sensor. Its optical model is based on a brand new concept to minimize mass and volume and to allow push-frame imaging. This model imposed to define a new calibration pipeline to test the reconstruction method in a controlled ambient. An ad-hoc indoor set-up has been realized for validating the instrument designed to operate in deep space, i.e. in-flight STC will have to deal with source/target essentially placed at infinity. This auxiliary indoor setup permits on one side to rescale the stereo reconstruction problem from the operative distance in-flight of 400 km to almost 1 meter in lab; on the other side it allows to replicate different viewing angles for the considered targets. Neglecting for sake of simplicity the Mercury curvature, the STC observing geometry of the same portion of the planet surface at periherm corresponds to a rotation of the spacecraft (SC) around the observed target by twice the 20° separation of each channel with respect to nadir

  12. High-sensitivity HLA typing by Saturated Tiling Capture Sequencing (STC-Seq).

    Science.gov (United States)

    Jiao, Yang; Li, Ran; Wu, Chao; Ding, Yibin; Liu, Yanning; Jia, Danmei; Wang, Lifeng; Xu, Xiang; Zhu, Jing; Zheng, Min; Jia, Junling

    2018-01-15

    Highly polymorphic human leukocyte antigen (HLA) genes are responsible for fine-tuning the adaptive immune system. High-resolution HLA typing is important for the treatment of autoimmune and infectious diseases. Additionally, it is routinely performed for identifying matched donors in transplantation medicine. Although many HLA typing approaches have been developed, the complexity, low-efficiency and high-cost of current HLA-typing assays limit their application in population-based high-throughput HLA typing for donors, which is required for creating large-scale databases for transplantation and precision medicine. Here, we present a cost-efficient Saturated Tiling Capture Sequencing (STC-Seq) approach to capturing 14 HLA class I and II genes. The highly efficient capture (an approximately 23,000-fold enrichment) of these genes allows for simplified allele calling. Tests on five genes (HLA-A/B/C/DRB1/DQB1) from 31 human samples and 351 datasets using STC-Seq showed results that were 98% consistent with the known two sets of digitals (field1 and field2) genotypes. Additionally, STC can capture genomic DNA fragments longer than 3 kb from HLA loci, making the library compatible with the third-generation sequencing. STC-Seq is a highly accurate and cost-efficient method for HLA typing which can be used to facilitate the establishment of population-based HLA databases for the precision and transplantation medicine.

  13. SILICATE TECHNOLOGY CORPORATION'S SOLIDIFICATION/ STABILIZATION TECHNOLOGY FOR ORGANIC AND INORGANIC CONTAMINANTS IN SOILS - APPLICATIONS ANALYSIS REPORT

    Science.gov (United States)

    This Applications Analysis Report evaluates the solidification/stabilization treatment process of Silicate Technology Corporation (STC) for the on-site treatment of hazardous waste. The STC immobilization technology utilizes a proprietary product (FMS Silicate) to chemically stab...

  14. TECHNOLOGY EVALUATION REPORT: SILICATE TECHNOLOGY CORPORATION - SOLIDIFICATION/STABILIZATION OF PCP AND INORGANIC CONTAMINANTS IN SOILS - SELMA, CA

    Science.gov (United States)

    This Technolgy Evaluation Report evaluates the solidification/stabilization process of Silicate Technology Corporation (STC) for the on-site treatment of contaminated soil The STC immobilization technology uses a proprietary product (FMS Silicate) to chemically stabilize and ...

  15. Sustainability of the Catalytic Activity of a Silica-Titania Composite (STC) for Long-Term Indoor Air Quality Control

    Science.gov (United States)

    Coutts, Janelle L.; Levine, Lanfang H.; Richards, Jeffrey T.

    2011-01-01

    TiO2-assisted photocatalytic oxidation (PCO) is an emerging technology for indoor air quality control and is also being evaluated as an alternative trace contaminant control technology for crew habitats in space exploration. Though there exists a vast range of literature on the development of photocatalysts and associated reactor systems, including catalyst performance and performance-influencing factors, the critical question of whether photocatalysts can sustain their initial catalytic activity over an extended period of operation has not been adequately addressed. For a catalyst to effectively serve as an air quality control product, it must be rugged enough to withstand exposure to a multitude of low concentration volatile organic compounds (VOCs) over long periods of time with minimal loss of activity. The objective of this study was to determine the functional lifetime of a promising photocatalyst - the silica-titania composite (STC) from Sol Gel Solutions, LLC in a real-world scenario. A bench-scale STC-packed annular reactor under continuous irradiation by a UV-A fluorescent black-light blue lamp ((lambda)max = 365 nm) was exposed to laboratory air continuously at an apparent contact time of 0.27 sand challenged with a known concentration of ethanol periodically to assess any changes in catalytic activity. Laboratory air was also episodically spiked with halocarbons (e.g., octafluoropropane), organosulfur compounds (e.g., sulfur hexafluoride), and organosilicons (e.g., siloxanes) to simulate accidental releases or leaks of such VOCs. Total organic carbon (TOC) loading and contaminant profiles of the laboratory air were also monitored. Changes in STC photocatalytic performance were evaluated using the ethanol mineralization rate, mineralization efficiency, and oxidation intermediate (acetaldehyde) formation. Results provide insights to any potential catalyst poisoning by trace halocarbons and organosulfur compounds.

  16. Nicotine-Induced Effects on Nicotinic Acetylcholine Receptors (nAChRs), Ca2+ and Brain-Derived Neurotrophic Factor (BDNF) in STC-1 Cells.

    Science.gov (United States)

    Qian, Jie; Mummalaneni, Shobha K; Alkahtani, Reem M; Mahavadi, Sunila; Murthy, Karnam S; Grider, John R; Lyall, Vijay

    2016-01-01

    In addition to the T2R bitter taste receptors, neuronal nicotinic acetylcholine receptors (nAChRs) have recently been shown to be involved in the bitter taste transduction of nicotine, acetylcholine and ethanol. However, at present it is not clear if nAChRs are expressed in enteroendocrine cells other than beta cells of the pancreas and enterochromaffin cells, and if they play a role in the synthesis and release of neurohumoral peptides. Accordingly, we investigated the expression and functional role of nAChRs in enteroendocrine STC-1 cells. Our studies using RT-PCR, qRT-PCR, immunohistochemical and Western blotting techniques demonstrate that STC-1 cells express several α and β nAChR subunits. Exposing STC-1 cells to nicotine acutely (24h) or chronically (4 days) induced a differential increase in the expression of nAChR subunit mRNA and protein in a dose- and time-dependent fashion. Mecamylamine, a non-selective antagonist of nAChRs, inhibited the nicotine-induced increase in mRNA expression of nAChRs. Exposing STC-1 cells to nicotine increased intracellular Ca2+ in a dose-dependent manner that was inhibited in the presence of mecamylamine or dihydro-β-erythroidine, a α4β2 nAChR antagonist. Brain-derived neurotrophic factor (BDNF) mRNA and protein were detected in STC-1 cells using RT-PCR, specific BDNF antibody, and enzyme-linked immunosorbent assay. Acute nicotine exposure (30 min) decreased the cellular content of BDNF in STC-1 cells. The nicotine-induced decrease in BDNF was inhibited in the presence of mecamylamine. We also detected α3 and β4 mRNA in intestinal mucosal cells and α3 protein expression in intestinal enteroendocrine cells. We conclude that STC-1 cells and intestinal enteroendocrine cells express nAChRs. In STC-1 cells nAChR expression is modulated by exposure to nicotine in a dose- and time-dependent manner. Nicotine interacts with nAChRs and inhibits BDNF expression in STC-1 cells.

  17. Research of digital controlled DC/DC converter based on STC12C5410AD

    Science.gov (United States)

    Chen, Dan-Jiang; Jin, Xin; Xiao, Zhi-Hong

    2010-02-01

    In order to study application of digital control technology on DC/DC converter, principle of increment mode PID control algorithm was analyzed in the paper. Then, a SCM named STC12C5410AD was introduced with its internal resources and characteristics. The PID control algorithm can be implemented easily based on it. The output of PID control was used to change the value of a variable that is 255 times than duty cycle, and this reduced the error of calculation. The valid of the presented algorithm was verified by an experiment for a BUCK DC/DC converter. The experimental results indicated that output voltage of the BUCK converter is stable with low ripple.

  18. Technology development for a Stirling radioisotope power system

    International Nuclear Information System (INIS)

    Thieme, Lanny G.; Qiu, Songgang; White, Maurice A.

    2000-01-01

    NASA Glenn Research Center and the Department of Energy are developing a Stirling convertor for an advanced radioisotope power system to provide spacecraft on-board electric power for NASA deep space missions. NASA Glenn is addressing key technology issues through the use of two NASA Phase II SBIRs with Stirling Technology Company (STC) of Kennewick, WA. Under the first SBIR, STC demonstrated a synchronous connection of two thermodynamically independent free-piston Stirling convertors and a 40 to 50 fold reduction in vibrations compared to an unbalanced convertor. The second SBIR is for the development of an Adaptive Vibration Reduction System (AVRS) that will essentially eliminate vibrations over the mission lifetime, even in the unlikely event of a failed convertor. This paper presents the status and results for these two SBIR projects and also discusses a new NASA Glenn in-house project to provide supporting technology for the overall Stirling radioisotope power system development. Tasks for this new effort include convertor performance verification, controls development, heater head structural life assessment, magnet characterization and thermal aging tests, FEA analysis for a lightweight alternator concept, and demonstration of convertor operation under launch and orbit transfer load conditions

  19. Satisfaction rates with the current Special Type Consultation (STC) reimbursement scheme among General Practitioners – A Mixed Methods Study.

    LENUS (Irish Health Repository)

    Kiely, A

    2017-03-01

    The Special Type Consultation (STC) scheme is a fee-for-service reimbursement scheme for General Practitioners (GPs) in Ireland. Introduced in 1989, the scheme includes specified patient services involving the application of a learned skill, e.g. suturing. This study aims to establish the extent to which GPs believe this scheme is appropriate for current General Practice. This is an embedded mixed-methods study combining quantitative data on GPs working experience of and qualitative data on GPs attitudes towards the scheme. Data were collected by means of an anonymous postal questionnaire. The response rate was 60.4% (n=159.) Twenty-nine percent (n=46) disagreed and 65% (n=104) strongly disagreed that the current list of special items is satisfactory. Two overriding themes were identified: economics and advancement of the STC process. This study demonstrates an overwhelming consensus among GPs that the current STC scheme is outdated and in urgent need of revision to reflect modern General Practice.

  20. STC synthesis of research results for water quality management at construction sites : research project capsule.

    Science.gov (United States)

    2012-07-01

    The RAC Region II has initiated a collaborative research program consortium through the : Transportation Pooled Fund (TPF) Program. The research program is called the Southeast : Transportation Consortium (STC) and is intended to encourage coordinati...

  1. Variation in SPC/STC Ratio as an Indicator of Age: A Computer-aided Forensic Odontology

    Directory of Open Access Journals (Sweden)

    Priyanka Debta

    2010-01-01

    Results: Pearson correlation between SPC/STC ratio with different age group was found to be statistically significant. So, measurement of amount of secondary dentin seems to be reliable and rapid method in forensic odontology.

  2. Technology Information Center

    International Nuclear Information System (INIS)

    Emerson, E.L.; Shepherd, E.W.; Minor, E.E.

    1980-01-01

    A Transportation Technology Center (TTC) has been established at Sandia to address the transportation of nuclear waste and spent fuel. The Technology Information Center (TIC) acts as TTC's clearing house for nuclear material transportation information. TIC's activities are divided into three activities: public information, policy information, and technical information. Some of the uses of TIC's activities are briefly outlined

  3. Stepwise threshold clustering: a new method for genotyping MHC loci using next-generation sequencing technology.

    Directory of Open Access Journals (Sweden)

    William E Stutz

    Full Text Available Genes of the vertebrate major histocompatibility complex (MHC are of great interest to biologists because of their important role in immunity and disease, and their extremely high levels of genetic diversity. Next generation sequencing (NGS technologies are quickly becoming the method of choice for high-throughput genotyping of multi-locus templates like MHC in non-model organisms. Previous approaches to genotyping MHC genes using NGS technologies suffer from two problems:1 a "gray zone" where low frequency alleles and high frequency artifacts can be difficult to disentangle and 2 a similar sequence problem, where very similar alleles can be difficult to distinguish as two distinct alleles. Here were present a new method for genotyping MHC loci--Stepwise Threshold Clustering (STC--that addresses these problems by taking full advantage of the increase in sequence data provided by NGS technologies. Unlike previous approaches for genotyping MHC with NGS data that attempt to classify individual sequences as alleles or artifacts, STC uses a quasi-Dirichlet clustering algorithm to cluster similar sequences at increasing levels of sequence similarity. By applying frequency and similarity based criteria to clusters rather than individual sequences, STC is able to successfully identify clusters of sequences that correspond to individual or similar alleles present in the genomes of individual samples. Furthermore, STC does not require duplicate runs of all samples, increasing the number of samples that can be genotyped in a given project. We show how the STC method works using a single sample library. We then apply STC to 295 threespine stickleback (Gasterosteus aculeatus samples from four populations and show that neighboring populations differ significantly in MHC allele pools. We show that STC is a reliable, accurate, efficient, and flexible method for genotyping MHC that will be of use to biologists interested in a variety of downstream applications.

  4. "Infotonics Technology Center"

    Energy Technology Data Exchange (ETDEWEB)

    Fritzemeier, L. [Infotonics Technology Center Inc., Canandaigua, NY (United States); Boysel, M. B. [Infotonics Technology Center Inc., Canandaigua, NY (United States); Smith, D. R. [Infotonics Technology Center Inc., Canandaigua, NY (United States)

    2004-09-30

    During this grant period July 15, 2002 thru September 30, 2004, the Infotonics Technology Center developed the critical infrastructure and technical expertise necessary to accelerate the development of sensors, alternative lighting and power sources, and other specific subtopics of interest to Department of Energy. Infotonics fosters collaboration among industry, universities and government and operates as a national center of excellence to drive photonics and microsystems development and commercialization. A main goal of the Center is to establish a unique, world-class research and development facility. A state-of-the-art microsystems prototype and pilot fabrication facility was established to enable rapid commercialization of new products of particular interest to DOE. The Center has three primary areas of photonics and microsystems competency: device research and engineering, packaging and assembly, and prototype and pilot-scale fabrication. Center activities focused on next generation optical communication networks, advanced imaging and information sensors and systems, micro-fluidic systems, assembly and packaging technologies, and biochemical sensors. With targeted research programs guided by the wealth of expertise of Infotonics business and scientific staff, the fabrication and packaging facility supports and accelerates innovative technology development of special interest to DOE in support of its mission and strategic defense, energy, and science goals.

  5. 76 FR 20720 - Advisory Panel for Integrative Activities; Notice of Meeting

    Science.gov (United States)

    2011-04-13

    ... Foundation announces the following meeting: Name: Committee of Visitors Panel for the Experimental Program to Stimulate Competitive Research Science and Technology Centers (STC) 1373. Dates: May 16, 2011; 6 p.m.-8 p.m... materials. Agenda May 16, 2011 6 p.m.-8 p.m. Open Session; Welcome, overview of STC program. May 17, 2011 8...

  6. Design and Implementation of Mobile Car with Wireless Video Monitoring System Based on STC89C52

    Directory of Open Access Journals (Sweden)

    Yang Hong

    2014-05-01

    Full Text Available With the rapid development of wireless networks and image acquisition technology, wireless video transmission technology has been widely applied in various communication systems. The traditional video monitoring technology is restricted by some conditions such as layout, environmental, the relatively large volume, cost, and so on. In view of this problem, this paper proposes a method that the mobile car can be equipped with wireless video monitoring system. The mobile car which has some functions such as detection, video acquisition and wireless data transmission is developed based on STC89C52 Micro Control Unit (MCU and WiFi router. Firstly, information such as image, temperature and humidity is processed by the MCU and communicated with the router, and then returned by the WiFi router to the host computer phone. Secondly, control information issued by the host computer phone is received by WiFi router and sent to the MCU, and then the MCU sends relevant instructions. Lastly, the wireless transmission of video images and the remote control of the car are realized. The results prove that the system has some features such as simple operation, high stability, fast response, low cost, strong flexibility, widely application, and so on. The system has certain practical value and popularization value.

  7. International Center for Gas Technology Information

    International Nuclear Information System (INIS)

    Gad, L.H.

    1993-01-01

    Based on an acknowledgement of the growing importance of natural gas, a number of European countries, USA, Japan and the Russian Federation have worked together in order to establish a common center of information on natural gas technology under the auspices of the International Energy Agency. Centers were to be established in Washington and in Denmark. The centers will concern themselves with establishing an international information center for gas technology, effecting natural gas technology transfer between global regions, carrying out analytical studies on the energy market and the development of technology within the field of natural gas. The structure of the decision-making processes that will be employed is explained in addition to the organization and economy. The centers should build up a global information network between the relevant countries, their gas companies, institutions etc. (AB)

  8. Detailed characterisation of STC-1 cells and the pGIP/Neo sub-clone suggests the incretin hormones are translationally regulated.

    Science.gov (United States)

    Gillespie, Anna L; Pan, Xiaobei; Marco-Ramell, Anna; Meharg, Caroline; Green, Brian D

    2017-10-01

    STC-1 is a heterogeneous plurihormonal cell line producing several prominent gut peptide hormones. pGIP/Neo is a genetically selected sub-clone of STC-1 with augmented levels of glucose-dependent insulinotropic peptide (GIP). Morphometric parameters, hormone concentrations, mRNA transcripts, hormone immunocytochemistry and nutrient utilisation/production of these two cell lines were compared. Proglucagon-derived peptides (Glucagon-like peptide-1 (GLP-1) and - 2(GLP-2)) were lower in sub-clone cells than progenitor cells. High Content Analysis found altered intracellular GLP-1, GIP, cholecystokinin (CCK) and peptide YY (PYY) levels and differing hormone co-localisation. The proportion pGIP/Neo cells containing GIP immunoreactivity (82%) was greater than STC-1 (65%), as were the proportion with 'GIP only', 'GLP-1+GIP' or 'GIP+PYY' immunoreactivity. Most surprisingly mRNA transcripts of the proglucagon and GIP genes were inversely correlated to the levels of their translated peptides. This strongly suggests that proglucagon and GIP are encoded on 'translationally regulated genes' - a characteristic possessed by other endocrine hormones. Metabolomic profiling revealed differences in cellular nutrient utilisation/production and that under normal culture conditions both cell lines exhibit signs of overflow metabolism. These studies provide an insight into the metabolism and properties of these valuable cells, suggesting for the first time that incretin hormone genes are translationally regulated. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Non-centered spike-triggered covariance analysis reveals neurotrophin-3 as a developmental regulator of receptive field properties of ON-OFF retinal ganglion cells.

    Directory of Open Access Journals (Sweden)

    Donald R Cantrell

    2010-10-01

    Full Text Available The functional separation of ON and OFF pathways, one of the fundamental features of the visual system, starts in the retina. During postnatal development, some retinal ganglion cells (RGCs whose dendrites arborize in both ON and OFF sublaminae of the inner plexiform layer transform into RGCs with dendrites that monostratify in either the ON or OFF sublamina, acquiring final dendritic morphology in a subtype-dependent manner. Little is known about how the receptive field (RF properties of ON, OFF, and ON-OFF RGCs mature during this time because of the lack of a reliable and efficient method to classify RGCs into these subtypes. To address this deficiency, we developed an innovative variant of Spike Triggered Covariance (STC analysis, which we term Spike Triggered Covariance - Non-Centered (STC-NC analysis. Using a multi-electrode array (MEA, we recorded the responses of a large population of mouse RGCs to a Gaussian white noise stimulus. As expected, the Spike-Triggered Average (STA fails to identify responses driven by symmetric static nonlinearities such as those that underlie ON-OFF center RGC behavior. The STC-NC technique, in contrast, provides an efficient means to identify ON-OFF responses and quantify their RF center sizes accurately. Using this new tool, we find that RGCs gradually develop sensitivity to focal stimulation after eye opening, that the percentage of ON-OFF center cells decreases with age, and that RF centers of ON and ON-OFF cells become smaller. Importantly, we demonstrate for the first time that neurotrophin-3 (NT-3 regulates the development of physiological properties of ON-OFF center RGCs. Overexpression of NT-3 leads to the precocious maturation of RGC responsiveness and accelerates the developmental decrease of RF center size in ON-OFF cells. In summary, our study introduces STC-NC analysis which successfully identifies subtype RGCs and demonstrates how RF development relates to a neurotrophic driver in the retina.

  10. Technologies for learner-centered feedback

    Directory of Open Access Journals (Sweden)

    Jane Costello

    2013-09-01

    Full Text Available As the number, type, and use of technologies to support learning increases, so do the opportunities for using these technologies for feedback. Learner-centered feedback is a core to the teaching-learning process. It is related to assessment in describing how learners perform in their learning, their gain in knowledge, skills, and attitudes. Feedback, types of feedback, guidelines for effective learner-centered feedback, and feedback’s relationship to assessment are presented. Methods of providing feedback, for example, automated, audio scribe pens, digital audio, etc., and the related technologies are described. Technologies that allow instructors to make informed decisions about the use of various methods for feedback are discussed.

  11. 2017 Technology Showcase | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    The 2017 Technology Showcase is an inaugural, half-day event showcased technologies developed by the National Cancer Institute's Center for Cancer Research (CCR) and the Frederick National Laboratory for Cancer Research (FNLCR).

  12. Energetics Manufacturing Technology Center (EMTC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Energetics Manufacturing Technology Center (EMTC), established in 1994 by the Office of Naval Research (ONR) Manufacturing Technology (ManTech) Program, is Navy...

  13. Center for Advanced Computational Technology

    Science.gov (United States)

    Noor, Ahmed K.

    2000-01-01

    The Center for Advanced Computational Technology (ACT) was established to serve as a focal point for diverse research activities pertaining to application of advanced computational technology to future aerospace systems. These activities include the use of numerical simulations, artificial intelligence methods, multimedia and synthetic environments, and computational intelligence, in the modeling, analysis, sensitivity studies, optimization, design and operation of future aerospace systems. The Center is located at NASA Langley and is an integral part of the School of Engineering and Applied Science of the University of Virginia. The Center has four specific objectives: 1) conduct innovative research on applications of advanced computational technology to aerospace systems; 2) act as pathfinder by demonstrating to the research community what can be done (high-potential, high-risk research); 3) help in identifying future directions of research in support of the aeronautical and space missions of the twenty-first century; and 4) help in the rapid transfer of research results to industry and in broadening awareness among researchers and engineers of the state-of-the-art in applications of advanced computational technology to the analysis, design prototyping and operations of aerospace and other high-performance engineering systems. In addition to research, Center activities include helping in the planning and coordination of the activities of a multi-center team of NASA and JPL researchers who are developing an intelligent synthesis environment for future aerospace systems; organizing workshops and national symposia; as well as writing state-of-the-art monographs and NASA special publications on timely topics.

  14. Morgantown Energy Technology Center, technology summary

    International Nuclear Information System (INIS)

    1994-06-01

    This document has been prepared by the DOE Environmental Management (EM) Office of Technology Development (OTD) to highlight its research, development, demonstration, testing, and evaluation activities funded through the Morgantown Energy Technology Center (METC). Technologies and processes described have the potential to enhance DOE's cleanup and waste management efforts, as well as improve US industry's competitiveness in global environmental markets. METC's R ampersand D programs are focused on commercialization of technologies that will be carried out in the private sector. META has solicited two PRDAs for EM. The first, in the area of groundwater and soil technologies, resulted in twenty-one contact awards to private sector and university technology developers. The second PRDA solicited novel decontamination and decommissioning technologies and resulted in eighteen contract awards. In addition to the PRDAs, METC solicited the first EM ROA in 1993. The ROA solicited research in a broad range of EM-related topics including in situ remediation, characterization, sensors, and monitoring technologies, efficient separation technologies, mixed waste treatment technologies, and robotics. This document describes these technology development activities

  15. Overcoming STC2 mediated drug resistance through drug and gene co-delivery by PHB-PDMAEMA cationic polyester in liver cancer cells.

    Science.gov (United States)

    Cheng, Hongwei; Wu, Zhixian; Wu, Caisheng; Wang, Xiaoyuan; Liow, Sing Shy; Li, Zibiao; Wu, Yun-Long

    2018-02-01

    Stanniocalcin 2 (STC2) overexpression in hepatocellular carcinoma (HCC) could lead to poor prognosis, which might be due to its induced P-glycoprotein and Bcl-2 protein expression level increase. P-glycoprotein or membrane pump induced drug efflux and altered prosurvival Bcl-2 expression are key mechanisms for drug resistance leading to failure of chemotherapy in HCC. However, current strategy to overcome both P-glycoprotein and Bcl-2 protein induced drug resistance was rarely reported. In this work, we utilized an amphiphilic poly[(R)-3-hydroxybutyrate] (PHB)-b-poly(2-(dimethylamino)ethyl methacrylate) (PDMAEMA) cationic polyester to encapsulate chemotherapeutic paclitaxel (PTX) in hydrophobic PHB domain and Bcl-2 convertor Nur77/ΔDBD gene (Nur77 without DNA binding domain for mitochondria localization) by formation of polyplex due to cationic PDMAEMA segment, to effectively inhibit the drug resistant HepG2/STC2 and SMCC7721/STC2 liver cancer cell growth. Thanks to the cationic nanoparticle complex formation ability and high transfection efficiency to express Bcl-2 conversion proteins, PHB-PDMAEMA/PTX@polyplex could partially impair P-glycoprotein induced PTX efflux and activate the apoptotic function of previous prosurvival Bcl-2 protein. This is the pioneer report of cationic amphiphilic polyester PHB-PDMAEMA to codeliver anticancer drug and therapeutic plasmid to overcome both pump and non-pump mediated chemotherapeutic resistance in liver cancer cells, which might be inspiring for the application of polyester in personalized cancer therapy. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Update on the NASA GRC Stirling Technology development project

    Science.gov (United States)

    Thieme, Lanny G.; Schreiber, Jeffrey G.

    2001-02-01

    The Department of Energy, NASA Glenn Research Center (GRC), and Stirling Technology Company (STC) are developing a free-piston Stirling convertor for a Stirling radioisotope power system (SRPS) to provide spacecraft on-board electric power for NASA deep space missions. The SRPS has recently been identified for potential use on the Europa Orbiter and Solar Probe Space Science missions. Stirling is also now being considered for unmanned Mars rovers. NASA GRC is conducting an in-house project to assist in developing the Stirling convertor for readiness for space qualification and mission implementation. As part of this continuing effort, the Stirling convertor will be further characterized under launch environment random vibration testing, methods to reduce convertor electromagnetic interference (EMI) will be developed, and an independent performance verification will be completed. Convertor life assessment and permanent magnet aging characterization tasks are also underway. Substitute organic materials for the linear alternator and piston bearing coatings for use in a high radiation environment have been identified and have now been incorporated in Stirling convertors built by STC for GRC. Electromagnetic and thermal finite element analyses for the alternator are also being conducted. This paper discusses the recent results and status for this NASA GRC in-house project. .

  17. National Rehabilitation Hospital Assistive Technology Research Center

    Science.gov (United States)

    1995-10-01

    Shoulder-Arm Orthoses Several years ago, the Rehabilitation Engineering Research Center (RERC) on Rehabilitation Robotics in Delaware1 identified a... exoskeletal applications for persons with disabilities. 2. Create a center of expertise in rehabilitation technology transfer that benefits persons with...AD COOPERATIVE AGREEMENT NUMBER: DAMD17-94-V-4036 TITLE: National Rehabilitation Hospital Assistive Technology- Research Center PRINCIPAL

  18. Engineering Technology Showcase to feature high-tech products from 18 companies

    OpenAIRE

    Gilbert, Karen

    2007-01-01

    The Student Technology Council (STC) at Virginia Tech is sponsoring an Engineering Technology Showcase on Tuesday, March 27. In addition to providing a platform for technology companies to show off their most recent innovations, technology presentations will be offered by Virginia Tech faculty and staff on topics ranging from a virtual greenhouse to the System X supercomputer.

  19. Patent portfolio structure for single technology companies

    OpenAIRE

    Hartwell, Ian P.

    2004-01-01

    Single technology companies (STCs) are defined in this thesis as companies that (a) have the fundamental rights to a new technology, (b) have development of that technology as their core competence, (c) seek to exploit that technology primarily by licensing the patent rights, and (d) are driven primarily by 'technology push'. These factors often result in much of the value of the STC residing in its patent portfolio. This in turn may place significant - and often conflicting - ...

  20. Supporting learner-centered technology integration through situated mentoring

    Science.gov (United States)

    Rosenberg, Marian Goode

    Situated mentoring was used as a professional development method to help 11 high school science teachers integrate learner-centered technology. The teachers' learner-centered technology beliefs and practices as well as their perception of barriers to learner-centered technology integration were explored before and after participating in the mentoring program. In addition, the participants' thoughts about the effectiveness of various components of the mentoring program were analyzed along with the mentor's observations of their practices. Situated mentoring can be effective for supporting learner-centered technology integration, in particular decreasing the barriers teachers experience. Goal setting, collaborative planning, reflection, and onsite just-in-time support were thought to be the most valuable components of the mentoring program.

  1. The Stanford University US-Japan Technology Management Center

    National Research Council Canada - National Science Library

    Dasher, Richard

    2002-01-01

    This grant established the U.S.-Japan Technology Management Center, Stanford University School of Engineering, as an ongoing center of excellence for the study of emerging trends and interrelationships between technology...

  2. Building the Southern California Earthquake Center

    Science.gov (United States)

    Jordan, T. H.; Henyey, T.; McRaney, J. K.

    2004-12-01

    Kei Aki was the founding director of the Southern California Earthquake Center (SCEC), a multi-institutional collaboration formed in 1991 as a Science and Technology Center (STC) under the National Science Foundation (NSF) and the U. S. Geological Survey (USGS). Aki and his colleagues articulated a system-level vision for the Center: investigations by disciplinary working groups would be woven together into a "Master Model" for Southern California. In this presentation, we will outline how the Master-Model concept has evolved and how SCEC's structure has adapted to meet scientific challenges of system-level earthquake science. In its first decade, SCEC conducted two regional imaging experiments (LARSE I & II); published the "Phase-N" reports on (1) the Landers earthquake, (2) a new earthquake rupture forecast for Southern California, and (3) new models for seismic attenuation and site effects; it developed two prototype "Community Models" (the Crustal Motion Map and Community Velocity Model) and, perhaps most important, sustained a long-term, multi-institutional, interdisciplinary collaboration. The latter fostered pioneering numerical simulations of earthquake ruptures, fault interactions, and wave propagation. These accomplishments provided the impetus for a successful proposal in 2000 to reestablish SCEC as a "stand alone" center under NSF/USGS auspices. SCEC remains consistent with the founders' vision: it continues to advance seismic hazard analysis through a system-level synthesis that is based on community models and an ever expanding array of information technology. SCEC now represents a fully articulated "collaboratory" for earthquake science, and many of its features are extensible to other active-fault systems and other system-level collaborations. We will discuss the implications of the SCEC experience for EarthScope, the USGS's program in seismic hazard analysis, NSF's nascent Cyberinfrastructure Initiative, and other large collaboratory programs.

  3. Technologies for Learner-Centered Feedback

    Science.gov (United States)

    Costello, Jane; Crane, Daph

    2013-01-01

    As the number, type, and use of technologies to support learning increases, so do the opportunities for using these technologies for feedback. Learner-centered feedback is a core to the teaching-learning process. It is related to assessment in describing how learners perform in their learning, their gain in knowledge, skills, and attitudes.…

  4. Design of music player based on MCU STC12C5A60S2%一种基于51单片机的音乐播放器的设计

    Institute of Scientific and Technical Information of China (English)

    何谐; 唐大权; 张淑廷; 陈雪

    2014-01-01

    The hardware design method of the music player based on MCU STC12C5A60S2 is introduced in this paper. The program design of the music player based on principle of FAT32 file system is studied. In the music player, MCU STC12C5A60S2 is taken as a main controller,SD card as a memory medium of music files and VS1003 chip as a decoder unit. When the player is running,MCU STC12C5A60S2 reads the music file from the SD card and continuously transfers data flow to VS1003 for decoding. In the meantime,the OLED liquid crystal display shows the message of the music in real time. The tested results from experiments show the music player can play the music files in multiple formats fluently if the player is connected with ear phone.%主要介绍一种基于51单片机的音乐播放器的硬件设计方法,并研究在FAT32文件系统下音乐播放器的程序设计。该音乐播放器采用STC12C5A60S2单片机为主控制器,SD卡作为音乐文件的存储介质,VS1003芯片作为解码器。STC12C5A60S2单片机从 SD卡中读取音乐文件,并不断将数据流传送至VS1003解码,最后连接耳机播放,同时STC12C5A60S2连接OLED液晶显示屏实时显示音乐播放信息。实验表明,该音乐播放器连接耳机能流畅播放多种格式的音乐文件。

  5. 76 FR 39811 - International Center for Technology Assessment and the Center for Food Safety; Noxious Weed...

    Science.gov (United States)

    2011-07-07

    ... dated July 18, 2002, the International Center for Technology Assessment and the Center for Food Safety... Inspection Service [Docket No. APHIS-2011-0081] International Center for Technology Assessment and the Center for Food Safety; Noxious Weed Status of Kentucky Bluegrass Genetically Engineered for Herbicide...

  6. Stirling Technology Development at NASA GRC

    Science.gov (United States)

    Thieme, Lanny G.; Schreiber, Jeffrey G.; Mason, Lee S.

    2001-01-01

    The Department of Energy, Stirling Technology Company (STC), and NASA Glenn Research Center (NASA Glenn) are developing a free-piston Stirling convertor for a high efficiency Stirling Radioisotope Generator (SRG) for NASA Space Science missions. The SRG is being developed for multimission use, including providing electric power for unmanned Mars rovers and deep space missions. NASA Glenn is conducting an in-house technology project to assist in developing the convertor for space qualification and mission implementation. Recent testing of 55-We Technology Demonstration Convertors (TDCs) built by STC includes mapping of a second pair of TDCs, single TDC testing, and TDC electromagnetic interference and electromagnetic compatibility characterization on a nonmagnetic test stand. Launch environment tests of a single TDC without its pressure vessel to better understand the convertor internal structural dynamics and of dual-opposed TDCs with several engineering mounting structures with different natural frequencies have recently been completed. A preliminary life assessment has been completed for the TDC heater head, and creep testing of the IN718 material to be used for the flight convertors is underway. Long-term magnet aging tests are continuing to characterize any potential aging in the strength or demagnetization resistance of the magnets used in the linear alternator (LA). Evaluations are now beginning on key organic materials used in the LA and piston/rod surface coatings. NASA Glenn is also conducting finite element analyses for the LA, in part to look at the demagnetization margin on the permanent magnets. The world's first known integrated test of a dynamic power system with electric propulsion was achieved at NASA Glenn when a Hall-effect thruster was successfully operated with a free-piston Stirling power source. Cleveland State University is developing a multidimensional Stirling computational fluid dynamics code to significantly improve Stirling loss

  7. Stirling technology development at NASA GRC

    Science.gov (United States)

    Thieme, Lanny G.; Schreiber, Jeffrey G.; Mason, Lee S.

    2002-01-01

    The Department of Energy, Stirling Technology Company (STC), and NASA Glenn Research Center (GRC) are developing a free-piston Stirling convertor for a high-efficiency Stirling Radioisotope Generator (SRG) for NASA Space Science missions. The SRG is being developed for multimission use, including providing electric power for unmanned Mars rovers and deep space missions. NASA GRC is conducting an in-house technology project to assist in developing the convertor for space qualification and mission implementation. Recent testing of 55-We Technology Demonstration Convertors (TDC's) built by STC includes mapping of a second pair of TDC's, single TDC testing, and TDC electromagnetic interference and electromagnetic compatibility characterization on a non-magnetic test stand. Launch environment tests of a single TDC without its pressure vessel to better understand the convertor internal structural dynamics and of dual-opposed TDC's with several engineering mounting structures with different natural frequencies have recently been completed. A preliminary life assessment has been completed for the TDC heater head, and creep testing of the IN718 material to be used for the flight convertors is underway. Long-term magnet aging tests are continuing to characterize any potential aging in the strength or demagnetization resistance of the magnets used in the linear alternator (LA). Evaluations are now beginning on key organic materials used in the LA and piston/rod surface coatings. GRC is also conducting finite element analyses for the LA, in part to look at the demagnetization margin on the permanent magnets. The world's first known integrated test of a dynamic power system with electric propulsion was achieved at GRC when a Hall-effect thruster was successfully operated with a free-piston Stirling power source. Cleveland State University is developing a multi-dimensional Stirling computational fluid dynamics code to significantly improve Stirling loss predictions and assist in

  8. A feasibility study for a manufacturing technology deployment center

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-31

    The Automation & Robotics Research Institute (ARRI) and the Texas Engineering Extension Service (TEEX) were funded by the U.S. Department of Energy to determine the feasibility of a regional industrial technology institute to be located at the Superconducting Super Collider (SSC) Central Facility in Waxahachie, Texas. In response to this opportunity, ARRI and TEEX teamed with the DOE Kansas City Plant (managed by Allied Signal, Inc.), Los Alamos National Laboratory (managed by the University of California), Vought Aircraft Company, National Center for Manufacturing Sciences (NCMS), SSC Laboratory, KPMG Peat Marwick, Dallas County Community College, Navarro Community College, Texas Department of Commerce (TDOC), Texas Manufacturing Assistance Center (TMAC), Oklahoma Center for the Advancement of Science and Technology, Arkansas Science and Technology Authority, Louisiana Productivity Center, and the NASA Mid-Continent Technology Transfer Center (MCTTC) to develop a series of options, perform the feasibility analysis and secure industrial reviews of the selected concepts. The final report for this study is presented in three sections: Executive Summary, Business Plan, and Technical Plan. The results from the analysis of the proposed concept support the recommendation of creating a regional technology alliance formed by the states of Texas, New Mexico, Oklahoma, Arkansas and Louisiana through the conversion of the SSC Central facility into a Manufacturing Technology Deployment Center (MTDC).

  9. Design, fabrication and transportation of Si rotating device

    International Nuclear Information System (INIS)

    Kimura, Nobuaki; Imaizumi, Tomomi; Takemoto, Noriyuki; Tanimoto, Masataka; Saito, Takashi; Hori, Naohiko; Tsuchiya, Kunihiko; Romanova, Nataliya; Gizatulin, Shamil; Martyushov, Alexandr; Nakipov, Darkhan; Chakrov, Petr; Tanaka, Futoshi; Nakajima, Takeshi

    2012-06-01

    Si semiconductor production by Neutron Transmutation Doping (NTD) method using the Japan Materials Testing Reactor (JMTR) has been investigated in Neutron Irradiation and Testing Reactor Center, Japan Atomic Energy Agency (JAEA) in order to expand industry use. As a part of investigations, irradiation test of silicon ingot for development of NTD-Si with high quality was planned using WWR-K in Institute of Nuclear Physics (INP), National Nuclear Center of Republic of Kazakhstan (NNC-RK) based on one of specific topics of cooperation (STC), Irradiation Technology for NTD-Si (STC No.II-4), on the implementing arrangement between NNC-RK and the JAEA for 'Nuclear Technology on Testing/Research Reactors' in cooperation in research and development in nuclear energy and technology. As for the irradiation test, Si rotating device was fabricated in JAEA, and the fabricated device was transported with irradiation specimens from JAEA to INP-NNC-RK. This report described the design, the fabrication, the performance test of the Si rotating device and transportation procedures. (author)

  10. Validating a Technology Enhanced Student-Centered Learning Model

    Science.gov (United States)

    Kang, Myunghee; Hahn, Jungsun; Chung, Warren

    2015-01-01

    The Technology Enhanced Student Centered Learning (TESCL) Model in this study presents the core factors that ensure the quality of learning in a technology-supported environment. Although the model was conceptually constructed using a student-centered learning framework and drawing upon previous studies, it should be validated through real-world…

  11. License Agreements | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    NCI Technology Transfer Center (TTC) licenses the discoveries of NCI and nine other NIH Institutes so new technologies can be developed and commercialized, to convert them into public health benefits.

  12. KBTAC [Knowledge-Based Technology Application Center] - The EPRI [Electric Power Research Institute]-sponsored knowledge-based technology application center

    International Nuclear Information System (INIS)

    Meyer, W.; Wood, R.M.; Scherer, J.

    1990-01-01

    The Electric Power Research Institute (EPRI) has announced the establishment of the Knowledge-Based Technology Application Center (KBTAC), whose goal is to assist member utilities with expert system technology and applications. The center, established November 7, 1989, is located on the campus of Syracuse University, Syracuse, New York, and will be operated jointly by Kaman Sciences Corporation and the university. The mission of the KBTAC is to assist EPRI member utilities to develop, test, and transfer expert systems into nuclear power plant operations, maintenance, and administration

  13. The 10th Anniversary Of Daejeon Environmental Technology Development Center

    International Nuclear Information System (INIS)

    2010-12-01

    This book describes the Daejeon Environment Technology Development Center with pictures for ten years. It also introduces the purpose of the foundation and background of center, structure of the center, main project and role of the center, center logo, current situation of cost of project, research business for 10 years, business supporting the environmental corporate, environment education, public relations activity and vision and prospect of the Daejeon Environmental Technology Development Center.

  14. Stirling Technology Development at NASA GRC. Revised

    Science.gov (United States)

    Thieme, Lanny G.; Schreiber, Jeffrey G.; Mason, Lee S.

    2002-01-01

    The Department of Energy, Stirling Technology Company (STC), and NASA Glenn Research Center (NASA Glenn) are developing a free-piston Stirling convertor for a high-efficiency Stirling Radioisotope Generator (SRG) for NASA Space Science missions. The SRG is being developed for multimission use, including providing electric power for unmanned Mars rovers and deep space missions. NASA Glenn is conducting an in-house technology project to assist in developing the convertor for space qualification and mission implementation. Recent testing, of 55-We Technology Demonstration Convertors (TDC's) built by STC includes mapping, of a second pair of TDC's, single TDC testing, and TDC electromagnetic interference and electromagnetic compatibility characterization on a nonmagnetic test stand. Launch environment tests of a single TDC without its pressure vessel to better understand the convertor internal structural dynamics and of dual-opposed TDC's with several engineering mounting structures with different natural frequencies have recently been completed. A preliminary life assessment has been completed for the TDC heater head, and creep testing of the IN718 material to be used for the flight convertors is underway. Long-term magnet aging tests are continuing to characterize any potential aging in the strength or demagnetization resistance of the magnets used in the linear alternator (LA). Evaluations are now beginning on key organic materials used in the LA and piston/rod surface coatings. NASA Glenn is also conducting finite element analyses for the LA, in part to look at the demagnetization margin on the permanent magnets. The world's first known integrated test of a dynamic power system with electric propulsion was achieved at NASA Glenn when a Hall-effect thruster was successfully operated with a free-piston Stirling power source. Cleveland State University is developing a multidimensional Stirling computational fluid dynamics code to significantly improve Stirling loss

  15. Partners in Community Service: Making a Community Connection Is Part of "The Stafford Way" at Vermont's Stafford Technical Center

    Science.gov (United States)

    Lucci, William, Jr.

    2005-01-01

    The Stafford Technical Center (STC) in Rutland, Vermont, operates with a mission statement that proudly touts its desire to "create a learning environment that promotes pride in work, a sense of self-worth and the ability to respect others by developing effective communication and life skills." Stafford acknowledges that these learning…

  16. Sandia National Laboratories: Microsystems Science & Technology Center

    Science.gov (United States)

    Environmental Management System Pollution Prevention History 60 impacts Diversity Locations Facts & Figures Programs Nuclear Weapons About Nuclear Weapons Safety & Security Weapons Science & Technology Robotics R&D 100 Awards Laboratory Directed Research & Development Technology Deployment Centers

  17. Mid-Atlantic Technology Applications Center. Quarters 1-4

    Science.gov (United States)

    1997-01-01

    Mid-atlantic Technology Application Center (MTAC) pursued a number of initiatives designed to enhance the strategic position of the Langley Research Center (LaRC) and NASA in industry. Among these was a closer association with the ISA, International Society for Measurement and Control. During 1997, MTAC placed articles regarding NASA-developed technologies in each In Tech magazine. The monthly magazine is sent to 46,000 sensors and instrumentation professionals. In addition, MTAC coordinated NASXs participation in the ISA Tech 97 Conference, securing $112,000 of free exhibit space, 1500 NASA sensors posters at no cost to NASA, and thousands of dollars of free publicity. MTAC was awarded a contract by ISA to operate its Technical Resource Center (TRC). The goal of this project is to determine what user needs are in order to identify opportunities for collaboration between NASA centers and companies. In addition, the TRC work will lay the groundwork for the Technology Development Consortium (TDC) proposed by MTAC. The purpose of the TDC is to: match current industry needs with NASA technologies available now, and to identify future needs of NASA and industry which may lead to dual use projects. The goal of these activities is twofold: to infuse NASA technologies into the sensors and instrumentation industry and to secure industry funds to support NASA technology development projects. The instrumentation and sensors industry is valued at $30 billion worldwide, with $12 billion in sales in the United States. The growth rate averages 13.5%, so that by the year 2000, the industry will produce products worth $49 billion. More than 80% of instruments, sensors and control systems are currently manufactured in the United States. NASA and the industry do not have a history of collaborative projects; MTAC's initiatives in this area are designed to foster working relationships between the two parties that will help maintain U.S. leadership in this field. Mid-atlantic Technology

  18. HEMISPHERIC CENTER FOR ENVIRONMENTAL TECHNOLOGY

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian

    1999-10-31

    The Deactivation and Decommissioning (D&D) Technology Assessment Program (TAP) was developed to provide detailed, comparable data for environmental technologies and to disseminate this data to D&D professionals in a manner that will facilitate the review and selection of technologies to perform decontamination and decommissioning. The objectives for this project include the following: Determine technology needs through review of the Site Technology Coordination Group (STCG) information and other applicable websites and needs databases; Perform a detailed review of industries that perform similar activities as those required in D&D operations to identify additional technologies; Define the technology assessment program for characterization and waste management problem sets; Define the data management program for characterization, dismantlement, and waste management problem sets; Evaluate baseline and innovative technologies under standard test conditions at Florida International University's Hemispheric Center for Environmental Technology (FIU-HCET) and other locations and collect data in the areas of performance, cost, health and safety, operations and maintenance, and primary and secondary waste generation; Continue to locate, verify, and incorporate technology performance data from other sources into the multimedia information system; and Develop the conceptual design for a dismantlement technology decision analysis tool for dismantlement technologies.

  19. CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

    Energy Technology Data Exchange (ETDEWEB)

    Hugh W. Rimmer

    2004-05-12

    This Technical Progress Report describes progress made on the seventeen subprojects awarded in the first year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices. Due to the time taken up by the solicitation/selection process, these cover the initial 6-month period of project activity only. The U.S. is the largest producer of mining products in the world. In 1999, U.S. mining operations produced $66.7 billion worth of raw materials that contributed a total of $533 billion to the nation's wealth. Despite these contributions, the mining industry has not been well supported with research and development funds as compared to mining industries in other countries. To overcome this problem, the Center for Advanced Separation Technologies (CAST) was established to develop technologies that can be used by the U.S. mining industry to create new products, reduce production costs, and meet environmental regulations. Originally set up by Virginia Tech and West Virginia University, this endeavor has been expanded into a seven-university consortium--Virginia Tech, West Virginia University, University of Kentucky, University of Utah, Montana Tech, New Mexico Tech and University of Nevada, Reno--that is supported through U.S. DOE Cooperative Agreement No. DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. Much of the research to be conducted with Cooperative Agreement funds will be longer-term, high-risk, basic research and will be carried out in five broad areas: (1) Solid-solid separation (2) Solid-liquid separation (3) Chemical/Biological Extraction (4) Modeling and Control, and (5) Environmental Control.

  20. Research and technology, 1991. Langley Research Center

    Science.gov (United States)

    1992-01-01

    The mission of the NASA Langley Research Center is to increase the knowledge and capability of the United States in a full range of aeronautics disciplines and in selected space disciplines. This mission will be accomplished by performing innovative research relevant to national needs and Agency goals, transferring technology to users in a timely manner, and providing development support to other United States Government agencies, industry, and other NASA centers. Highlights are given of the major accomplishments and applications that have been made during the past year. The highlights illustrate both the broad range of the research and technology (R&T) activities at NASA Langley Research Center and the contributions of this work toward maintaining United States leadership in aeronautics and space research.

  1. CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

    Energy Technology Data Exchange (ETDEWEB)

    Christopher E. Hull

    2005-11-04

    This Technical Progress Report describes progress made on the twenty nine subprojects awarded in the second year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

  2. Crosscutting Technology Development at the Center for Advanced Separation Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Christopher E. Hull

    2006-09-30

    This Technical Progress Report describes progress made on the twenty nine subprojects awarded in the second year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

  3. CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

    Energy Technology Data Exchange (ETDEWEB)

    Christopher E. Hull

    2006-05-15

    This Technical Progress Report describes progress made on the twenty nine subprojects awarded in the second year of Cooperative Agreement DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

  4. Marshall Space Flight Center Technology Investments Overview

    Science.gov (United States)

    Tinker, Mike

    2014-01-01

    NASA is moving forward with prioritized technology investments that will support NASA's exploration and science missions, while benefiting other Government agencies and the U.S. aerospace enterprise. center dotThe plan provides the guidance for NASA's space technology investments during the next four years, within the context of a 20-year horizon center dotThis plan will help ensure that NASA develops technologies that enable its 4 goals to: 1.Sustain and extend human activities in space, 2.Explore the structure, origin, and evolution of the solar system, and search for life past and present, 3.Expand our understanding of the Earth and the universe and have a direct and measurable impact on how we work and live, and 4.Energize domestic space enterprise and extend benefits of space for the Nation.

  5. Program strategy document for the Nuclear Materials Transportation Technology Center

    International Nuclear Information System (INIS)

    Jefferson, R.M.

    1979-07-01

    A multiyear program plan is presented which describes the program of the Nuclear Materials Transportation Technology Center (TIC) at Sandia Laboratories. The work element plans, along with their corresponding work breakdown structures, are presented for TTC activities in the areas of Technology and Information Center, Systems Development, Technology, and Institutional Issues for the years from 1979 to 1985

  6. Applied technology center business plan and market survey

    Science.gov (United States)

    Hodgin, Robert F.; Marchesini, Roberto

    1990-01-01

    Business plan and market survey for the Applied Technology Center (ATC), computer technology transfer and development non-profit corporation, is presented. The mission of the ATC is to stimulate innovation in state-of-the-art and leading edge computer based technology. The ATC encourages the practical utilization of late-breaking computer technologies by firms of all variety.

  7. Intelligent Processing Equipment Developments Within the Navy's Manufacturing Technology Centers of Excellence

    Science.gov (United States)

    Nanzetta, Philip

    1992-01-01

    The U.S. Navy has had an active Manufacturing Technology (MANTECH) Program aimed at developing advanced production processes and equipment since the late-1960's. During the past decade, however, the resources of the MANTECH program were concentrated in Centers of Excellence. Today, the Navy sponsors four manufacturing technology Centers of Excellence: the Automated Manufacturing Research Facility (AMRF); the Electronics Manufacturing Productivity Facility (EMPF); the National Center for Excellence in Metalworking Technology (NCEMT); and the Center of Excellence for Composites Manufacturing Technology (CECMT). This paper briefly describes each of the centers and summarizes typical Intelligent Equipment Processing (IEP) projects that were undertaken.

  8. Center for Advanced Separation Technology

    Energy Technology Data Exchange (ETDEWEB)

    Honaker, Rick

    2013-09-30

    The U.S. is the largest producer of mining products in the world. In 2011, U.S. mining operations contributed a total of $232 billion to the nation’s GDP plus $138 billion in labor income. Of this the coal mining industry contributed a total of $97.5 billion to GDP plus $53 billion in labor income. Despite these contributions, the industry has not been well supported with research and development funds as compared to mining industries in other countries. To overcome this problem, the Center for Advanced Separation Technologies (CAST) was established to develop technologies that can be used by the U.S. mining industry to create new products, reduce production costs, and meet environmental regulations. Originally set up by Virginia Tech and West Virginia University, CAST is now a five-university consortium – Virginia Tech, West Virginia University, University of Kentucky, University of Utah and Montana Tech, - that is supported through U.S. DOE Cooperative Agreement No. DE-FE0000699, Center for Advanced Separation Technology. Much of the research to be conducted with Cooperative Agreement funds will be longer term, high-risk, basic research and will be carried out in two broad areas: Advanced Pre-Combustion Clean Coal Technologies and Gas-Gas Separations. Distribution of funds is handled via competitive solicitation of research proposals through Site Coordinators at the five member universities. These were reviewed and the selected proposals were forwarded these to the DOE/NETL Project Officer for final review and approval. The successful projects are listed below by category, along with abstracts from their final reports.

  9. Solar Energy: Its Technologies and Applications

    Science.gov (United States)

    Auh, P. C.

    1978-06-01

    Solar heat, as a potential source of clean energy, is available to all of us. Extensive R and D efforts are being made to effectively utilize this renewable energy source. A variety of different technologies for utilizing solar energy have been proven to be technically feasible. Here, some of the most promising technologies and their applications are briefly described. These are: Solar Heating and Cooling of Buildings (SHACOB), Solar Thermal Energy Conversion (STC), Wind Energy Conversion (WECS), Bioconversion to Fuels (BCF), Ocean Thermal Energy Conversion (OTEC), and Photovoltaic Electric Power Systems (PEPS). Special emphasis is placed on the discussion of the SHACOB technologies, since the technologies are being expeditiously developed for the near commercialization.

  10. Center for Coastline Security Technology, Year-2

    National Research Council Canada - National Science Library

    Glegg, Stewart; Glenn, William; Furht, Borko; Beaujean, P. P; Frisk, G; Schock, S; VonEllenrieder, K; Ananthakrishnan, P; An, E; Granata, R

    2007-01-01

    ...), the Imaging Technology Center, the Department of Computer Science and Engineering, and the University Consortium for Intermodal Transportation Safety and Security at Florida Atlantic University...

  11. Building Technologies Research and Integration Center (BTRIC)

    Data.gov (United States)

    Federal Laboratory Consortium — The Building Technologies Research and Integration Center (BTRIC), in the Energy and Transportation Science Division (ETSD) of Oak Ridge National Laboratory (ORNL),...

  12. SciDAC Visualization and Analytics Center for Enabling Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Joy, Kenneth I. [Univ. of California, Davis, CA (United States)

    2014-09-14

    This project focuses on leveraging scientific visualization and analytics software technology as an enabling technology for increasing scientific productivity and insight. Advances in computational technology have resulted in an "information big bang," which in turn has created a significant data understanding challenge. This challenge is widely acknowledged to be one of the primary bottlenecks in contemporary science. The vision for our Center is to respond directly to that challenge by adapting, extending, creating when necessary and deploying visualization and data understanding technologies for our science stakeholders. Using an organizational model as a Visualization and Analytics Center for Enabling Technologies (VACET), we are well positioned to be responsive to the needs of a diverse set of scientific stakeholders in a coordinated fashion using a range of visualization, mathematics, statistics, computer and computational science and data management technologies.

  13. Customizing graphical user interface technology for spacecraft control centers

    Science.gov (United States)

    Beach, Edward; Giancola, Peter; Gibson, Steven; Mahmot, Ronald

    1993-01-01

    The Transportable Payload Operations Control Center (TPOCC) project is applying the latest in graphical user interface technology to the spacecraft control center environment. This project of the Mission Operations Division's (MOD) Control Center Systems Branch (CCSB) at NASA Goddard Space Flight Center (GSFC) has developed an architecture for control centers which makes use of a distributed processing approach and the latest in Unix workstation technology. The TPOCC project is committed to following industry standards and using commercial off-the-shelf (COTS) hardware and software components wherever possible to reduce development costs and to improve operational support. TPOCC's most successful use of commercial software products and standards has been in the development of its graphical user interface. This paper describes TPOCC's successful use and customization of four separate layers of commercial software products to create a flexible and powerful user interface that is uniquely suited to spacecraft monitoring and control.

  14. Smart Grid Technology and Consumer Call Center Readiness

    OpenAIRE

    Schamber, Kelsey L.

    2010-01-01

    The following reasearch project deals with utility call center readiness to address customer concerns and questions about the Smart Grid and smart meter technology. Since consumer engagement is important for the benefits of the Smart Grid to be realized, the readiness and ability of utilities to answer consumer questions is an important issue. Assessing the readiness of utility call centers to address pertinant customer concerns was accomplished by calling utility call centers with Smart Grid...

  15. Manufacturing Technology Information Analysis Center: Knowledge Is Strength

    Science.gov (United States)

    Safar, Michal

    1992-01-01

    The Center's primary function is to facilitate technology transfer within DoD, other government agencies and industry. The DoD has recognized the importance of technology transfer, not only to support specific weapon system manufacture, but to strengthen the industrial base that sustains DoD. MTIAC uses an experienced technical staff of engineers and information specialists to acquire, analyze, and disseminate technical information. Besides ManTech project data, MTIAC collects manufacturing technology from other government agencies, commercial publications, proceedings, and various international sources. MTIAC has various means of disseminating this information. Much of the technical data is on user accessible data bases. The Center researches and writes a number of technical reports each year and publishes a newsletter monthly. Customized research is performed in response to specific inquiries from government and industry. MTIAC serves as a link between Government and Industry to strengthen the manufacturing technology base through the dissemination of advanced manufacturing information.

  16. Research and Technology at the John F. Kennedy Space Center 1993

    Science.gov (United States)

    1993-01-01

    As the NASA Center responsible for assembly, checkout, servicing, launch, recovery, and operational support of Space Transportation System elements and payloads, the John F. Kennedy Space Center is placing increasing emphasis on its advanced technology development program. This program encompasses the efforts of the Engineering Development Directorate laboratories, most of the KSC operations contractors, academia, and selected commercial industries - all working in a team effort within their own areas of expertise. This edition of the Kennedy Space Center Research and Technology 1993 Annual Report covers efforts of all these contributors to the KSC advanced technology development program, as well as our technology transfer activities. Major areas of research include material science, advanced software, industrial engineering, nondestructive evaluation, life sciences, atmospheric sciences, environmental technology, robotics, and electronics and instrumentation.

  17. Selection and evaluation of technologies for oil rim preparation of Zapolyarnoye oilfield

    Science.gov (United States)

    Vazhenina, L. V.

    2017-10-01

    The article deals with various technologies for the oil rims preparation of Zapolyarnoye oil and gas condensate field. The following circuits were considered for the selection of the technology of preparation of extracted fluid: low-temperature separation (STC); low-temperature condensation (LTC); a low-temperature rectification (NTR); low-temperature absorption (LTA); membrane technology (Mt). Diagrams of these processes were collected and tested in the system HYSYS process simulation. Efficiency analysis of hydrocarbon raw materials preparation on the basis of functions, selection of components and narrow fractions.

  18. Better Broader Impacts through National Science Foundation Centers

    Science.gov (United States)

    Campbell, K. M.

    2010-12-01

    National Science Foundation Science and Technology Centers (STCs) play a leading role in developing and evaluating “Better Broader Impacts”; best practices for recruiting a broad spectrum of American students into STEM fields and for educating these future professionals, as well as their families, teachers and the general public. With staff devoted full time to Broader Impacts activities, over the ten year life of a Center, STCs are able to address both a broad range of audiences and a broad range of topics. Along with other NSF funded centers, such as Centers for Ocean Sciences Education Excellence, Engineering Research Centers and Materials Research Science and Engineering Centers, STCs develop both models and materials that individual researchers can adopt, as well as, in some cases, direct opportunities for individual researchers to offer their disciplinary research expertise to existing center Broader Impacts Programs. The National Center for Earth-surface Dynamics is an STC headquartered at the University of Minnesota. NCED’s disciplinary research spans the physical, biological and engineering issues associated with developing an integrative, quantitative and predictive understanding of rivers and river basins. Funded in 2002, we have had the opportunity to partner with individuals and institutions ranging from formal to informal education and from science museums to Tribal and women’s colleges. We have developed simple table top physical models, complete museum exhibitions, 3D paper maps and interactive computer based visualizations, all of which have helped us communicate with this wide variety of learners. Many of these materials themselves or plans to construct them are available online; in many cases they have also been formally evaluated. We have also listened to the formal and informal educators with whom we partner, from whom we have learned a great deal about how to design Broader Impacts activities and programs. Using NCED as a case study

  19. NCI Technology Transfer Center | TTC

    Science.gov (United States)

    The National Cancer Institute’s Technology Transfer Center (TTC) facilitates partnerships between the NIH research laboratories and external partners. With specialized teams, TTC guides the interactions of our partners from the point of discovery to patenting, from invention development to licensing. We play a key role in helping to accelerate development of cutting-edge research by connecting our partners to NIH’s world-class researchers, facilities, and knowledge.

  20. Center Director Bridges visits Disability Awareness and Action working Group Technology Fair

    Science.gov (United States)

    1999-01-01

    Center Director Roy Bridges (standing, center) poses with members of the Disability Awareness and Action Working Group (DAAWG), which is holding the 1999 Technology Fair Oct. 20-21 at Kennedy Space Center. The Fair is highlighting vendors demonstrating mobility, hearing, vision and silent disability assistive technology. The purpose is to create an awareness of the types of technology currently available to assist people with various disabilities in the workplace. The theme is that of this year's National Disability Employment Awareness Month, 'Opening Doors to Ability.' Some of the vendors participating are Canine Companions for Independence, Goodwill Industries, Accessible Structures, Division of Blind Services, Space Coast Center for Independent Living, KSC Fitness Center and Delaware North Parks Services.

  1. Center for BioBased Binders and Pollution Reduction Technology

    Energy Technology Data Exchange (ETDEWEB)

    Thiel, Jerry [Univ. of Northern Iowa, Cedar Falls, IA (United States)

    2013-07-01

    Funding will support the continuation of the Center for Advanced Bio-based Binders and Pollution Reduction Technology Center (CABB) in the development of bio-based polymers and emission reduction technologies for the metal casting industry. Since the formation of the center several new polymers based on agricultural materials have been developed. These new materials have show decreases in hazardous air pollutants, phenol and formaldehyde as much as 50 to 80% respectively. The polymers termed bio-polymers show a great potential to utilize current renewable agricultural resources to replace petroleum based products and reduce our dependence on importing of foreign oil. The agricultural technology has shown drastic reductions in the emission of hazardous air pollutants and volatile organic compounds and requires further development to maintain competitive costs and productivity. The project will also research new and improved inorganic binders that promise to eliminate hazardous emissions from foundry casting operations and allow for the beneficial reuse of the materials and avoiding the burdening of overcrowded landfills.

  2. SciDAC visualization and analytics center for enabling technology

    International Nuclear Information System (INIS)

    Bethel, E Wes; Johnson, Chris; Joy, Ken; Ahern, Sean; Pascucci, Valerio; Childs, Hank; Cohen, Jonathan; Duchaineau, Mark; Hamann, Bernd; Hansen, Charles; Laney, Dan; Lindstrom, Peter; Meredith, Jeremy; Ostrouchov, George; Parker, Steven; Silva, Claudio; Sanderson, Allen; Tricoche, Xavier

    2007-01-01

    The Visualization and Analytics Center for Enabling Technologies (VACET) focuses on leveraging scientific visualization and analytics software technology as an enabling technology for increasing scientific productivity and insight. Advances in computational technology have resulted in an 'information big bang,' which in turn has created a significant data understanding challenge. This challenge is widely acknowledged to be one of the primary bottlenecks in contemporary science. The vision of VACET is to adapt, extend, create when necessary, and deploy visual data analysis solutions that are responsive to the needs of DOE's computational and experimental scientists. Our center is engineered to be directly responsive to those needs and to deliver solutions for use in DOE's large open computing facilities. The research and development directly target data understanding problems provided by our scientific application stakeholders. VACET draws from a diverse set of visualization technology ranging from production quality applications and application frameworks to state-of-the-art algorithms for visualization, analysis, analytics, data manipulation, and data management

  3. The roles and functions of a lunar base Nuclear Technology Center

    International Nuclear Information System (INIS)

    Buden, D.; Angelo, J.A. Jr.

    1991-01-01

    This paper describes the roles and functions of a special Nuclear Technology Center which is developed as an integral part of a permanent lunar base. Numerous contemporary studies clearly point out that nuclear energy technology will play a major role in any successful lunar/Mars initiative program and in the overall establishment of humanity's solar system civilization. The key role of nuclear energy in the providing power has been recognized. A Nuclear Technology Center developed as part of of a permanent lunar base can also help bring about many other nuclear technology applications, such as producing radioisotopes for self-illumination, food preservation, waste sterilization, and medical treatment; providing thermal energy for mining, materials processing and agricultural; and as a source of emergency habitat power. Designing such a center will involve the deployment, operation, servicing and waste product management and disposal of megawatt class reactor power plants. This challenge must be met with a minimum of direct human support at the facility. Furthermore, to support the timely, efficient integration of this Nuclear Technology Center in the evolving lunar base infrastructure, an analog of such a facility will be needed here on Earth. 12 refs., 4 figs., 1 tab

  4. Information and consulting center in plasma technologies

    International Nuclear Information System (INIS)

    Vizireanu, S.; Aldea, E.; Mitu, B.; Dinescu, G.

    2001-01-01

    Plasma technologies are clean, non-expensive, and easy to adapt to small-scale production. They are largely used in various modern sectors of research, industry, medicine, biology and environmental protection. At the present time a pressure to transfer the knowledge from education and research sectors toward the industrial ones was established by the financing policies at national and European levels. Nevertheless, mainly in the last decade, an informational gap sets up in Romania between the suppliers of know-how in the plasma technologies and their beneficiaries. The newly appearing companies have little knowledge about the possibilities of our research and education. In turn, the research and education sectors do not know what companies are using nowadays plasma technologies, what kinds of technologies are needed and what aspects should be stressed in educational activity. The Information and Consulting Center in Plasma Technologies is an infrastructure project aiming at gathering information and expertise in plasma technologies with emphasizing on the Romanian capabilities. The information is accessible via Internet at the address http://www.alpha2.infim.ro. By accessing the center web page one enters into the main menu or it is possible to navigate by choosing key words, as for instance: objectives, plasma diagnostics, plasma technologies, which are listed in a dedicated search box. The information is organized in databases. In the database frame there are three main categories, which lead to detailed information about: - Users of plasma technologies, the technology type, the address; - Suppliers of plasma technologies, including the main research institutes with links to the relating Internet sites; - Education and training centers including the universities and their departments dedicated to plasma physics. The expertise is organized in three categories. They are instrumentation and equipment, plasma diagnostics and plasma technologies. In the

  5. The Center for Environmental Technology Innovative Technology Screening Process

    International Nuclear Information System (INIS)

    Bertrand, C.M.

    1995-02-01

    The Center for Environmental Technology's (CET) mission is to provide a fully integrated system for accelerated evaluation, development, commercialization, and public acceptance of creative environmental solutions which match the foremost demands in today's environmentally sensitive world. In short, CET will create a means to provide quick, effective solutions for environmental needs. To meet this mission objective, CET has created a unique and innovative approach to eliminating the usual barriers in developing and testing environmental technologies. The approach paves the way for these emerging, cutting-edge technologies by coordinating environmental restoration and waste management activities of industry, universities, and the government to: efficiently and effectively transfer technology to these users, provide market-driven, cost-effective technology programs to the public and DOE, and aid in developing innovative ideas by initiating efforts between DOE facilities and private industry. The central part to this mission is selecting and evaluating specific innovative technologies for demonstration and application at United States Department of Energy (DOE) installations. The methodology and criteria used for this selection, which is called the CET Innovative Technology Screening Process, is the subject of this paper. The selection criteria used for the screening process were modeled after other DOE technology transfer programs and were further developed by CET's Technology Screening and Evaluation Board (TSEB). The process benefits both CET and the proposing vendors by providing objective selection procedures based on predefined criteria. The selection process ensures a rapid response to proposing vendors, all technologies will have the opportunity to enter the selection process, and all technologies are evaluated on the same scale and with identical criteria

  6. Planning and Management of Technology Deployment Center

    International Nuclear Information System (INIS)

    Park, Jae Won; Joo, Po Kook; Kim, Jun Yeon and others

    2005-08-01

    The R and D contents are summarized as follows ; Models were set-up for transferring the developed technologies to the industry and managing technology deployment center to vitalize the commercialization and then the set-up model was tried to apply for transferring technologies for commercialization and to define interfaces between the R and D and industrial applications In this project, new products and processes were developed for promoting the commercialization. Infra-structures were firmly set-up for the venture company promotion and technology deployment developed during executing the proton Engineering frontier Project. Commercialization methodology connection with industrial companies were studied by outside specializing institute. Development of gem-stone coloring and new photo catalyst producing techniques are very high value-adding technologies, therefore, experimental and theoretical R and D were transacted simultaneously to obtain the originality of the technology. The theoretical R and D was committed to a specialist outside

  7. The Advanced Technology Environmental Education Center Summer Fellows Institute.

    Science.gov (United States)

    Depken, Diane E.; Zeman, Catherine L.; Lensch, Ellen Kabat; Brown, Edward J.

    2002-01-01

    Describes the background, activities, and outcomes of the Advanced Technology Environmental Education Center (ATEEC) and its Summer Fellows Institutes as a model for disciplinary and cross-disciplinary infusion of environmental science and technology content, curriculum, and methods into the classroom. Presents experiences, themes, and activities…

  8. MDEP STC self assessment report

    International Nuclear Information System (INIS)

    2013-01-01

    definition of convergence to be used for MDEP activities, in the form of a revision to the Terms of Reference; - Modify the MDEP Terms of Reference to remove the objective of improving public understanding and acceptance of safety goals; - Develop a communication plan that identifies stakeholders and specific communication products; - Open at least a part of the MDEP library to non-MDEP representatives and invite non-MDEP organisations to attend issue-specific working group meetings as appropriate; - Enhance interactions with its IAEA counterparts to identify areas in which MDEP can provide useful input to IAEA safety standards under development; - Identify completion strategies (including final products, recommendations to SDOs or other organisations for follow-up activity) in the issue-specific working group Program Plans; - Continue the activities of the design-specific working groups at least through the construction oversight phase; - Address advanced reactor issues, through an STC Subcommittee or Working Group that would explore the issues of most interest to the MDEP member countries; - Act quickly to approve the formation of new design-specific working groups (consistent with the existing Rule of Three for forming design specific working groups); - Support increasing MDEP membership consistent with the existing guidance, and encourage participation in MDEP by any national regulators who are considering designs under MDEP review

  9. Advertising Technology and Visual Attraction of Cities Centers

    Directory of Open Access Journals (Sweden)

    Inaam Albazzaz

    2017-09-01

    Full Text Available Advertising technology represents a component of elements of the visual attraction in the urban scape, made its way transmission process of messages between the ends of the source ofinformation (sender and the Destination information (receiver of the final recipient of themessage, It serves as a social marked and a means of cultural expression, It is part of the inalienable in creating identity and determine the spatial relationships and also is a reflection ofurban culture to the community. This technology has become an increasing feature of the present era, characterized as the era of the three revolutions: (the information revolution, the technologyrevolution, and the media revolution, Where it became an integral part of the visual system surrounding of urban our environment in which we live,, And it worked to change the contemporary urban experience through the attraction and love to stay and stimulating social interactions within a decade and urban spaces that contain the contemporary urban forms, and this is what it will focus the research. The research’s problem is determined by :there is no clear perception about the definition of advertisement technology and its impact on the urban scape of the city centers according the concept of visual attraction. And clarify the goal of research in : Definition advertising technology and determine the most important aspects and indicators according the concept of visual attraction of the city centers. To achieve this goal was adopted the following approach: building a conceptual framework for technology advertising through definition of the basic concepts of research and review the historical development of it within the framework of the urban scape, and then a study of the most important intellectual concepts associated represented by (communication theory and built in investigating this technology (communication channel aims to deliver a message or information from the sender to the receiver

  10. Research and technology: 1994 annual report of the John F. Kennedy Space Center

    Science.gov (United States)

    1994-01-01

    As the NASA Center responsible for assembly, checkout, servicing, launch, recovery, and operational support of Space Transportation System elements and payloads, the John F. Kennedy Space Center is placing increasing emphasis on its advanced technology development program. This program encompasses the efforts of the Engineering Development Directorate laboratories, most of the KSC operations contractors, academia, and selected commercial industries - all working in a team effort within their own areas of expertise. This edition of the Kennedy Space Center Research and Technology 1994 Annual Report covers efforts of all these contributors to the KSC advanced technology development program, as well as our technology transfer activities. The Technology Programs and Commercialization Office (DE-TPO), (407) 867-3017, is responsible for publication of this report and should be contacted for any desired information regarding the advanced technology program.

  11. Workshop on APEC virtual center for environmental technology exchange; APEC kankyo gijutsu koryu virtual center workshop hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    At the 'policy maker workshop of the virtual center of APEC technology exchange' held in November 1997 in Osaka, Japan, it was agreed to organize study groups to discuss the scope of information provided by the virtual center, and to make common the classification systems and retrieval functions. In addition, the necessity was confirmed on international cooperation to promote establishment of virtual centers in different countries and territories. On the first day, Professor Ueda at the Kyoto University gave the basic lecture entitled 'global environment preservation and environmental technology transfer: problems and prospects'. Mr. Dan, the workshop manager gave the basic proposal entitled 'the future directionality of environmental technology exchange inside the APEC territories by using Internet'. Based on the basic proposal made on the first day, reports and discussions were given in the following sessions, where confirmation was made on the future directions. S1: establishment of the virtual centers in other countries and territories; S2: assurance of interchangeability of classification systems and retrieval functions in providing information, and S3: presentation of examples of inter-territorial exchange and the future directionality. (NEDO)

  12. Workshop on APEC virtual center for environmental technology exchange; APEC kankyo gijutsu koryu virtual center workshop hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    At the 'policy maker workshop of the virtual center of APEC technology exchange' held in November 1997 in Osaka, Japan, it was agreed to organize study groups to discuss the scope of information provided by the virtual center, and to make common the classification systems and retrieval functions. In addition, the necessity was confirmed on international cooperation to promote establishment of virtual centers in different countries and territories. On the first day, Professor Ueda at the Kyoto University gave the basic lecture entitled 'global environment preservation and environmental technology transfer: problems and prospects'. Mr. Dan, the workshop manager gave the basic proposal entitled 'the future directionality of environmental technology exchange inside the APEC territories by using Internet'. Based on the basic proposal made on the first day, reports and discussions were given in the following sessions, where confirmation was made on the future directions. S1: establishment of the virtual centers in other countries and territories; S2: assurance of interchangeability of classification systems and retrieval functions in providing information, and S3: presentation of examples of inter-territorial exchange and the future directionality. (NEDO)

  13. Crosscutting Technology Development at the Center for Advanced Separation Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Christopher Hull

    2009-10-31

    The U.S. is the largest producer of mining products in the world. In 2003, U.S. mining operations produced $57 billion worth of raw materials that contributed a total of $564 billion to the nation's wealth. Despite these contributions, the mining industry has not been well supported with research and development funds as compared to mining industries in other countries. To overcome this problem, the Center for Advanced Separation Technologies (CAST) was established to develop technologies that can be used by the U.S. mining industry to create new products, reduce production costs, and meet environmental regulations. Originally set up by Virginia Tech and West Virginia University, this endeavor has been expanded into a seven-university consortium -- Virginia Tech, West Virginia University, University of Kentucky, University of Utah, Montana Tech, New Mexico Tech and University of Nevada, Reno - that is supported through U.S. DOE Cooperative Agreement No. DE-FC26-02NT41607: Crosscutting Technology Development at the Center for Advanced Separation Technologies. Much of the research to be conducted with Cooperative Agreement funds will be longer-term, high-risk, basic research and will be carried out in five broad areas: (1) Solid-solid separation; (2) Solid-liquid separation; (3) Chemical/biological extraction; (4) Modeling and control; and (5) Environmental control. Distribution of funds is handled via competitive solicitation of research proposals through Site Coordinators at the seven member universities. These were first reviewed and ranked by a group of technical reviewers (selected primarily from industry). Based on these reviews, and an assessment of overall program requirements, the CAST Technical Committee made an initial selection/ranking of proposals and forwarded these to the DOE/NETL Project Officer for final review and approval. The successful projects are listed by category, along with brief abstracts of their aims and objectives.

  14. Summary of Stirling Convertor Testing at NASA Glenn Research Center in Support of Stirling Radioisotope Power System Development

    Science.gov (United States)

    Schifer, Nicholas A.; Oriti, Salvatore M.

    2013-01-01

    The NASA Glenn Research Center (GRC) has been testing 100 We class, free-piston Stirling convertors for potential use in Stirling Radioisotope Power Systems (RPS) for space science and exploration missions. Free-piston Stirling convertors are capable of achieving a 38% conversion efficiency, making Stirling attractive for meeting future power system needs in light of the shrinking U.S. plutonium fuel supply. Convertors currently on test include four Stirling Technology Demonstration Convertors (TDCs), manufactured by the Stirling Technology Company (STC), and six Advanced Stirling Convertors (ASCs), manufactured by Sunpower, Inc. Total hours of operation is greater than 514,000 hours (59 years). Several tests have been initiated to demonstrate the functionality of Stirling convertors for space applications, including: in-air extended operation, thermal vacuum extended operation. Other tests have also been conducted to characterize Stirling performance in anticipated mission scenarios. Data collected during testing has been used to support life and reliability estimates, drive design changes and improve quality, and plan for expected mission scenarios. This paper will provide a summary of convertors tested at NASA GRC and discuss lessons learned through extended testing.

  15. Technology transfer program at the Morgantown Energy Technology Center: FY 87 program report

    Energy Technology Data Exchange (ETDEWEB)

    Brown, W.A.; Lessing, K.B.

    1987-10-01

    The Morgantown Energy Technology Center (METC), located in Morgantown, West Virginia, is an energy research center of the US Department of Energy's (DOE's) Office of Fossil Energy. The research and development work is different from research work conducted by other Government agencies. In DOE research, the Government is not the ultimate ''customer'' for the technologies developed; the ''customer'' is business and industry in the private sector. Thus, tehcnology transfer is a fundamental goal of the DOE. The mission of the Fossil Energy program is to enhance the use of the nations's fossil energy resources. METC's mission applies to certain technologies within the broad scope of technologies encompassed by the Office of Fossil Energy. The Government functions as an underwriter of risk and as a catalyst to stimulate the development of technologies and technical information that might otherwise proceed at a slower pace because of the high-risk nature of the research involved. The research programs and priorities are industry driven; the purpose is to address the perceived needs of industry such that industry will ultimately bring the technologies to the commercial market. As evidenced in this report, METC has an active and effective technology transfer program that is incorporated into all aspects of project planning and execution. Technology transfer at METC is a way of life---a part of everyday activities to further this goal. Each person has a charge to communicate the ideas from within METC to those best able to utilize that information. 4 figs., 20 tabs.

  16. 75 FR 80830 - Proposed Collection; Comment Request; Technology Transfer Center External Customer Satisfaction...

    Science.gov (United States)

    2010-12-23

    ... Request; Technology Transfer Center External Customer Satisfaction Survey (NCI) SUMMARY: In compliance...: Technology Transfer Center External Customer Satisfaction Survey (NCI). Type of Information Collection...: Obtain information on the satisfaction of TTC's external customers with TTC customer services; collect...

  17. Applied wind energy research at the National Wind Technology Center

    International Nuclear Information System (INIS)

    Robinson, M.C.; Tu, P.

    1997-01-01

    Applied research activities currently being undertaken at the National Wind Technology Center, part of the National Renewable Energy Laboratory, in the United States, are divided into several technical disciplines. An integrated multi-disciplinary approach is urged for the future in order to evaluate advanced turbine designs. The risk associated with any new turbine development program can thus be mitigated through the provision of the advanced technology, analysis tools and innovative designs available at the Center, and wind power can be promoted as a viable renewable energy alternative. (UK)

  18. Mission & Role | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    The NCI TTC serves as the focal point for implementing the Federal Technology Transfer Act to utilize patents as incentive for commercial development of technologies and to establish research collaborations and licensing among academia, federal laboratories, non-profit organizations, and industry. The TTC supports technology development activities for the National Cancer Institute and nine other NIH Institutes and Centers. TTC staff negotiate co-development agreements and licenses with universities, non-profit organizations, and pharmaceutical and biotechnology companies to ensure compliance with Federal statutes, regulations and the policies of the National Institutes of Health. TTC also reviews employee invention reports and makes recommendations concerning filing of domestic and foreign patent applications. | [google6f4cd5334ac394ab.html

  19. St. Luke's Medical Center: technologizing health care

    International Nuclear Information System (INIS)

    Tumanguil, S.S.

    1994-01-01

    The computerization of the St. Luke's Medical Center improved the hospital administration and management, particularly in nuclear medicine department. The use of computer-aided X-ray simulator machine and computerized linear accelerator machine in diagnosing and treating cancer are the most recent medical technological breakthroughs that benefited thousands of Filipino cancer patients. 4 photos

  20. Test and Approval Center for Fuel Cell and Hydrogen Technologies: Phase I. Initiation

    DEFF Research Database (Denmark)

    already spent on these technologies also lead to commercial success. The project ‘Test and Approval Center for Fuel Cell and Hydrogen Technologies: Phase I. Initiation’ was aiming at starting with the Establishment of such a center. The following report documents the achievements within the project...... of the fluctuating wind energy. As the fuel cell and hydrogen technologies come closer to commercialization, development of testing methodology, qualified testing and demonstration become increasingly important. Danish industrial players have expressed a strong need for support in the process to push fuel cell...... and hydrogen technologies from the research and development stage into the commercial domain. A Center to support industry with test, development, analysis, approval, certification, consultation, and training in the areas of fuel cell and hydrogen technologies was needed. Denmark has demonstrated leading...

  1. SAVANNAH RIVER TECHNOLOGY CENTER MONTHLY REPORT AUGUST 1992

    Energy Technology Data Exchange (ETDEWEB)

    Ferrell, J.M.

    1999-06-21

    'This monthly report summarizes Programs and Accomplishments of the Savannah River Technology Center in support of activities at the Savannah River Site. The following categories are addressed: Reactor, Tritium, Separations, Environmental, Waste Management, General, and Items of Interest.'

  2. SLJ's Technology Survey 2006: New Technologies--Like Blogs and Wikis--Are Taking Their Place in the School Media Center

    Science.gov (United States)

    Brewer, Sally; Milam, Peggy

    2006-01-01

    This article presents findings from the School Library Journal's 2006 national technology survey that investigated the trend in today's library media centers. As this study demonstrates, technology continues to be a significant aspect of K-12 media centers. Despite restricted funding and schedules stretched to the limit, media specialists have…

  3. Episode-Centered Guidelines for Teacher Belief Change toward Technology Integration

    Science.gov (United States)

    Er, Erkan; Kim, ChanMin

    2017-01-01

    Teachers' episodic memories influence their beliefs. The investigation of episodic memories can help identify the teacher beliefs that limit technology-integration. We propose the Episode-Centered Belief Change (ECBC) model that utilizes teachers' episodic memories for changing beliefs impeding effective technology integration. We also propose…

  4. La educación en casa o homeschooling: la STC de 2 de diciembre de 2010

    Directory of Open Access Journals (Sweden)

    María Monzón Julve

    2011-09-01

    Full Text Available El artículo analiza los conflictos que surgen entre el derecho a la educación de los menores y la libertad de enseñanza reconocida a los padres o tutores, todo ello según el complejo art. 27 CE, concretamente, y con ocasión de la reciente STC de 2 de diciembre de 2010, en relación a la posibilidad de impartir la enseñanza básica no a través de la escolarización obligatoria sino mediante la educación en el propio hogar familiar (homeschooling.This article analyses raising conflicts between children´ education´s right and freedom of education belonging to parents and tutors, according to the complex article 27 of Spanish Constitution, especially after the recent sentence of Constitucional Court dated from 2nd December 2010, all of this in relation with the possiblility of giving basic education not through compulsory education but homeschooling.

  5. Thermal analysis on NAC-STC spent fuel transport cask under different transport conditions

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Yumei [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Yang, Jian, E-mail: zdhjkz@zju.edu.cn [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Xu, Chao; Wang, Weiping [Institute of Process Equipment, Zhejiang University, Hangzhou (China); Ma, Zhijun [Department of Material Engineering, South China University of Technology, Guangzhou (China)

    2013-12-15

    Highlights: • Spent fuel cask was investigated as a whole instead of fuel assembly alone. • The cask was successfully modeled and meshed after several simplifications. • Equivalence method was used to calculate the properties of parts. • Both the integral thermal field and peak values are captured to verify safety. • The temperature variations of key parts were also plotted. - Abstract: Transport casks used for conveying spent nuclear fuel are inseparably related to the safety of the whole reprocessing system for spent nuclear fuel. Thus they must be designed according to rigorous safety standards including thermal analysis. In this paper, for NAC-STC cask, a finite element model is established based on some proper simplifications on configurations and the heat transfer mechanisms. Considering the complex components and gaps, the equivalence method is presented to define their material properties. Then an equivalent convection coefficient is introduced to define boundary conditions. Finally, the temperature field is captured and analyzed under both normal and accident transport conditions by using ANSYS software. The validity of numerical calculation is given by comparing its results with theoretical calculation. Obtaining the integral distribution laws of temperature and peak temperature values of all vital components, the security of the cask can be evaluated and verified.

  6. Center Director Bridges visits Disability Awareness and Action working Group Technology Fair

    Science.gov (United States)

    1999-01-01

    Center Director Roy Bridges stops to pet one of the dogs that serves with Canine Companions for Independence, a vendor displaying its capabilities at the Disability Awareness and Action Working Group (DAAWG) 1999 Technology Fair being held Oct. 20-21 at Kennedy Space Center. Standing at the right is Carol Cavanaugh, with KSC Public Services; behind Bridges is Nancie Strott (left), a multi-media specialist with Dynacs and chairperson of the Fair, and Sterling Walker (right), director of Engineering Development and chairman of DAAWG. The Fair is highlighting vendors demonstrating mobility, hearing, vision and silent disability assistive technology. The purpose is to create an awareness of the types of technology currently available to assist people with various disabilities in the workplace. The theme is that of this year's National Disability Employment Awareness Month, 'Opening Doors to Ability.' Some of the other vendors participating are Goodwill Industries, Accessible Structures, Division of Blind Services, Space Coast Center for Independent Living, KSC Fitness Center and Delaware North Parks Services.

  7. International Experience of the Establishing Technology Transfer Centers at the Universities

    Directory of Open Access Journals (Sweden)

    Lysenko, V.S.

    2015-01-01

    Full Text Available The analysis of the experience of creation and operation of technology transfer centers on the basis of US universities with the aim of using positive methods for the creation of such centers in Ukraine is presented.

  8. VACET: Proposed SciDAC2 Visualization and Analytics Center for Enabling Technologies

    International Nuclear Information System (INIS)

    Bethel, W; Johnson, C; Hansen, C; Parker, S; Sanderson, A; Silva, C; Tricoche, X; Pascucci, V; Childs, H; Cohen, J; Duchaineau, M; Laney, D; Lindstrom, P; Ahern, S; Meredith, J; Ostrouchov, G; Joy, K; Hamann, B

    2006-01-01

    This project focuses on leveraging scientific visualization and analytics software technology as an enabling technology for increasing scientific productivity and insight. Advances in computational technology have resulted in an 'information big bang',' which in turn has created a significant data understanding challenge. This challenge is widely acknowledged to be one of the primary bottlenecks in contemporary science. The vision for our Center is to respond directly to that challenge by adapting, extending, creating when necessary and deploying visualization and data understanding technologies for our science stakeholders. Using an organizational model as a Visualization and Analytics Center for Enabling Technologies (VACET), we are well positioned to be responsive to the needs of a diverse set of scientific stakeholders in a coordinated fashion using a range of visualization, mathematics, statistics, computer and computational science and data management technologies

  9. Technology for the Stars: Extending Our Reach. [Research and Technology: 1995 Annual Report of the Marshall Space Flight Center.

    Science.gov (United States)

    1996-01-01

    Marshall Space Flight Center's (MSFC's) Advanced Studies, Research, Technology, and Technology Transfer projects are summarized in this report. The focus of the report is on the three spotlights at MSFC in 1995: space transportation technology, microgravity research, and technology transfer.

  10. La revocación de senadores de designación autonómica (la Ley valenciana 10/2016 y la STC 123/2017 // The Revocation of Senators of autonomic designation (Valencian Law 10/2016 and STC 123/2017

    Directory of Open Access Journals (Sweden)

    Vicente Navarro Marchante

    2018-04-01

    The Valencian Autonomous Community approved at the end of last year the Law 10/2016 that modified several aspects of the territorial law that regulated different aspects about the appointment of senators in representation of the Autonomous Community. The new norm introduces, in a novel way in our right, the possibility of revocation of the senator appointed by the autonomic parliament, in addition to establishing the mandatory of the senator of appearance in the designating chamber as a form of accountability. The possibility of revocation of the senator due to loss of confidence of the autonomous chamber raises doubts of constitutionality by, among others, possible violation of the prohibition of imperative mandate of the members of the Cortes Generales, already resolved by STC 123/2017. This article, along the lines of the analysis of the Valencian norm and its constitutional reserve, reflects over the nature of the representative mandate and the peculiar function of the chamber of territorial representation.

  11. User-centered Technologies For Blind Children

    Directory of Open Access Journals (Sweden)

    Jaime Sánchez

    2008-01-01

    Full Text Available The purpose of this paper is to review, summarize, and illustrate research work involving four audio-based games created within a user-centered design methodology through successive usability tasks and evaluations. These games were designed by considering the mental model of blind children and their styles of interaction to perceive and process data and information. The goal of these games was to enhance the cognitive development of spatial structures, memory, haptic perception, mathematical skills, navigation and orientation, and problem solving of blind children. Findings indicate significant improvements in learning and cognition from using audio-based tools specially tailored for the blind. That is, technologies for blind children, carefully tailored through user-centered design approaches, can make a significant contribution to cognitive development of these children. This paper contributes new insight into the design and implementation of audio-based virtual environments to facilitate learning and cognition in blind children.

  12. 76 FR 8371 - Notice Correction; Generic Submission of Technology Transfer Center (TTC) External Customer...

    Science.gov (United States)

    2011-02-14

    ... Submission of Technology Transfer Center (TTC) External Customer Satisfaction Surveys (NCI) The Federal... project titled, ``Technology Transfer Center (TTC) External Customer Satisfaction Survey (NCI)'' was... will include multiple customer satisfaction surveys over the course of three years. At this time, only...

  13. Centers for manufacturing technology: Industrial Advisory Committee Review

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    An advisory committee, composed of senior managers form industrial- sector companies and major manufacturing trade associations and representatives from appropriate educational institutions, meets semi-annually to review and advise the Oak Ridge Centers for Manufacturing Technology (ORCMT) on its economic security program. Individual papers have been indexed separately for the database.

  14. CENTER FOR ADVANCED SEPARATION TECHNOLOGY (CAST) PROGRAM

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Roe-Hoan; Hull, Christopher

    2014-09-30

    The U.S. is the largest producer of mining products in the world. In 2011, U.S. mining operations contributed a total of $232 billion to the nation’s GDP plus $138 billion in labor income. Of this the coal mining industry contributed a total of $97.5 billion to GDP plus $53 billion in labor income. Despite these contributions, the industry has not been well supported with research and development funds as compared to mining industries in other countries. To overcome this problem, the Center for Advanced Separation Technologies (CAST) was established to develop technologies that can be used by the U.S. mining industry to create new products, reduce production costs, and meet environmental regulations.

  15. Technology Transfer Center to Assume Patenting and Licensing Responsibilities | Poster

    Science.gov (United States)

    The NCI Technology Transfer Center (TTC) is undergoing a reorganization that will bring patenting and licensing responsibilities to the Shady Grove and Frederick offices by October 2015. The reorganization is a result of an effort begun in 2014 by NIH to improve the organizational structure of technology transfer at NIH to meet the rapid rate of change within science, technology, and industry, and to better align the science and laboratory goals with the licensing and patenting process.

  16. 76 FR 2147 - UAW-Chrysler National Training Center Technology Training Joint Programs Staff, Detroit, MI; UAW...

    Science.gov (United States)

    2011-01-12

    ...-Chrysler National Training Center Technology Training Joint Programs Staff, Detroit, MI; UAW-Chrysler Technical Training Center Technology Training Joint Programs Staff, Warren, MI; Notice of Revised... investigation, the Department confirmed that the proportion of Technology Training Joint Programs Staff...

  17. Program strategy document for the nuclear materials. Transportation Technology Center (FY 80)

    International Nuclear Information System (INIS)

    Jefferson, R.M.

    1980-04-01

    The TTC's program is divided into four principal areas, Technology and Information Center, Systems Development, Technology, and Institutional Issues. These areas are broken into activities, elements, and subelements which are delineated in this document

  18. CROSSCUTTING TECHNOLOGY DEVELOPMENT AT THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

    Energy Technology Data Exchange (ETDEWEB)

    Christopher E. Hull

    2005-01-20

    The U.S. is the largest producer of mining products in the world. In 2003, U.S. mining operations produced $57 billion worth of raw materials that contributed a total of $564 billion to the nation's wealth. Despite these contributions, the mining industry has not been well supported with research and development funds as compared to mining industries in other countries. To overcome this problem, the Center for Advanced Separation Technologies (CAST) was established to develop technologies that can be used by the U.S. mining industry to create new products, reduce production costs, and meet environmental regulations. Much of the research to be conducted with Cooperative Agreement funds will be longer-term, high-risk, basic research and will be carried out in five broad areas: (1) Solid-solid separation; (2) Solid-liquid separation; (3) Chemical/Biological Extraction; (4) Modeling and Control; and (5) Environmental Control.

  19. Establishment of the Center for Advanced Separation Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Christopher E. Hull

    2006-09-30

    This Final Technical Report covers the eight sub-projects awarded in the first year and the five projects awarded in the second year of Cooperative Agreement DE-FC26-01NT41091: Establishment of the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices.

  20. 76 FR 35474 - UAW-Chrysler Technical Training Center, Technology Training Joint Programs Staff, Including On...

    Science.gov (United States)

    2011-06-17

    ...-Chrysler Technical Training Center, Technology Training Joint Programs Staff, Including On-Site Leased Workers From Cranks, O/E Learning, DBSI, IDEA, and Tonic/MVP, Detroit, MI; UAW-Chrysler Technical Training... workers and former workers of UAW-Chrysler Technical Training Center, Technology Training Joint Programs...

  1. 78 FR 65300 - Notice of Availability (NOA) for General Purpose Warehouse and Information Technology Center...

    Science.gov (United States)

    2013-10-31

    ... (NOA) for General Purpose Warehouse and Information Technology Center Construction (GPW/IT)--Tracy Site... proposed action to construct a General Purpose Warehouse and Information Technology Center at Defense..., Suite 02G09, Alexandria, VA 22350- 3100. FOR FURTHER INFORMATION CONTACT: Ann Engelberger at (703) 767...

  2. Mobile STEMship Discovery Center: K-12 Aerospace-Based Science, Technology, Engineering, and Mathematics (STEM) Mobile Teaching Vehicle

    Science.gov (United States)

    2015-08-03

    AND SUBTITLE Mobile STEMship Discovery Center: K-12 Aerospace-Based Science, Technology, Engineering, and Mathematics (STEM) Mobile Teaching Vehicle...Center program to be able to expose Science Technology, Engineering and Mathematics (STEM) space-inspired science centers for DC Metro beltway schools

  3. Digital Technologies Supporting Person-Centered Integrated Care - A Perspective.

    Science.gov (United States)

    Øvretveit, John

    2017-09-25

    Shared electronic health and social care records in some service systems are already showing some of the benefits of digital technology and digital data for integrating health and social care. These records are one example of the beginning "digitalisation" of services that gives a glimpse of the potential of digital technology and systems for building coordinated and individualized integrated care. Yet the promise has been greater than the benefits, and progress has been slow compared to other industries. This paper describes for non-technical readers how information technology was used to support integrated care schemes in six EU services, and suggests practical ways forward to use the new opportunities to build person-centered integrated care.

  4. NASA Johnson Space Center SBIR STTR Program Technology Innovations

    Science.gov (United States)

    Krishen, Kumar

    2007-01-01

    The Small Business Innovation Research (SBIR) Program increases opportunities for small businesses to participate in research and development (R&D), increases employment, and improves U.S. competitiveness. Specifically the program stimulates U.S. technological innovation by using small businesses to meet federal R&D needs, increasing private-sector commercialization of innovations derived from federal R&D, and fostering and encouraging the participation of socially disadvantaged businesses. In 2000, the Small Business Technology Transfer (STTR) Program extended and strengthened the SBIR Program, increasing its emphasis on pursuing commercial applications by awarding contracts to small business concerns for cooperative R&D with a nonprofit research institution. Modeled after the SBIR Program, STTR is nevertheless a separately funded activity. Technologies that have resulted from the Johnson Space Center SBIR STTR Program include: a device for regenerating iodinated resin beds; laser-assisted in-situ keratomileusis or LASIK; a miniature physiological monitoring device capable of collecting and analyzing a multitude of real-time signals to transmit medical data from remote locations to medical centers for diagnosis and intervention; a new thermal management system for fibers and fabrics giving rise to new line of garments and thermal-enhancing environments; and a highly electropositive material that attracts and retains electronegative particles in water.

  5. Energy Science and Technology Software Center

    Energy Technology Data Exchange (ETDEWEB)

    Kidd, E.M.

    1995-03-01

    The Energy Science and Technology Software Center (ESTSC), is the U.S. Department of Energy`s (DOE) centralized software management facility. It is operated under contract for the DOE Office of Scientific and Technical Information (OSTI) and is located in Oak Ridge, Tennessee. The ESTSC is authorized by DOE and the U.S. Nuclear Regulatory Commission (NRC) to license and distribute DOE-and NRC-sponsored software developed by national laboratories and other facilities and by contractors of DOE and NRC. ESTSC also has selected software from the Nuclear Energy Agency (NEA) of the Organisation for Economic Cooperation and Development (OECD) through a software exchange agreement that DOE has with the agency.

  6. Development of a National Center for Hydrogen Technology. A Summary Report of Activities Completed at the National Center for Hydrogen Technology - Year 6

    Energy Technology Data Exchange (ETDEWEB)

    Holmes, Michael [Univ. of North Dakota, Grand Forks, ND (United States)

    2012-08-01

    The Energy & Environmental Research Center (EERC) located in Grand Forks, North Dakota, has operated the National Center for Hydrogen Technology (NCHT) since 2005 under a Cooperative Agreement with the U.S. Department of Energy (DOE) National Energy Technology Laboratory (NETL). The EERC has a long history of hydrogen generation and utilization from fossil fuels, and under the NCHT Program, the EERC has accelerated its research on hydrogen generation and utilization topics. Since the NCHT's inception, the EERC has received more than $65 million in funding for hydrogen-related projects ($24 million for projects in the NCHT, which includes federal and corporate partner development funds) involving more than 85 partners (27 with the NCHT). The NCHT Program's nine activities span a broad range of technologies that align well with the Advanced Fuels Program goals and, specifically, those described in the Hydrogen from Coal Program research, development, and demonstration (RD&D) plan that refers to realistic testing of technologies at adequate scale, process intensification, and contaminant control. A number of projects have been completed that range from technical feasibility of several hydrogen generation and utilization technologies to public and technical education and outreach tools. Projects under the NCHT have produced hydrogen from natural gas, coal, liquid hydrocarbons, and biomass. The hydrogen or syngas generated by these processes has also been purified in many of these instances or burned directly for power generation. Also, several activities are still undergoing research, development, demonstration, and commercialization at the NCHT. This report provides a summary overview of the projects completed in Year 6 of the NCHT. Individual activity reports are referenced as a source of detailed information on each activity.

  7. Volpe Center Office of Research and Technology Applications (ORTA) : FY 2013 Annual Report

    Science.gov (United States)

    2013-12-01

    Technology transfer activities performed by the Volpe National Transportation Systems Center during fiscal year 2013 in fulfillment of statutory Office of Research and Technology Applications (ORTA) responsibilities are summarized in this report. Dur...

  8. Role of national centers of research and development in nuclear technology transfer

    International Nuclear Information System (INIS)

    Graf, J.-J.; Millies, Pierre.

    1977-01-01

    National Research Centers are shown to play a leading role in nuclear technology transfer, whatever may be the directing scheme of nuclear development in the country envisaged. The first act of the Center consists in training specialists in the various nuclear fields. It must ensure the transfer of technological knowledge towards industry (in metallurgy, mechanics, electronics) and other nuclear auxiliary techniques, together with the transfer towards administration (laws). A simplified scheme of nuclear development strategy based on the French scheme (the French Atomic Energy Commission (CEA) with its subsidiary Companies) is presented that is usable for developing countries [fr

  9. Copper Disk Manufactured at the Space Optics Manufacturing and Technology Center

    Science.gov (United States)

    2001-01-01

    This photograph shows Wes Brown, Marshall Space Flight Center's (MSFC's) lead diamond tuner, an expert in the science of using diamond-tipped tools to cut metal, inspecting the mold's physical characteristics to ensure the uniformity of its more than 6,000 grooves. This king-size copper disk, manufactured at the Space Optics Manufacturing and Technology Center (SOMTC) at MSFC, is a special mold for making high resolution monitor screens. This master mold will be used to make several other molds, each capable of forming hundreds of screens that have a type of lens called a fresnel lens. Weighing much less than conventional optics, fresnel lenses have multiple concentric grooves, each formed to a precise angle, that together create the curvature needed to focus and project images. The MSFC leads NASA's space optics manufacturing technology development as a technology leader for diamond turning. The machine used to manufacture this mold is among many one-of-a-kind pieces of equipment of MSFC's SOMTC.

  10. Annual report of nuclear technology and education center. April 1, 2002 - March 31, 2003

    International Nuclear Information System (INIS)

    2003-10-01

    This report summarizes the activities of Nuclear Technology and Education Center (NuTEC) in Japan Atomic Energy Research Institute in FY 2002. It includes the domestic educational activities in Tokyo Education Center in Komagome Tokyo for RI and radiation engineers and Tokai Education Center in Tokai for nuclear engineers, and the international training activities for Asia-Pacific region which were planned and administrated by International Technology Transfer Division. The new course so called 'Introductory Course for the Use and the Experiment of Neutron' was started with good appreciation by the participants. All scheduled course plan in Tokyo Education Center and Tokai Education Center was accomplished and the total number of the trainee of both Center was 1,297. The courses for RI and radiation engineers implemented in Tokyo Education Center were closed in this FY and transferred to Tokai Establishment in next FY where the course will be integrated with the ones at Tokai Education Center. The land of Tokyo Education Center will be returned to land-owner by the end of FY 2003 after dismantlement of the facilities. The equipments and instruments used in Tokyo Education Center were transferred to Tokai Education Center after finishing all courses in Tokyo in this FY. The improvement and re-arrangement of the facilities in Tokyo Education Center were proceeded to prepare the courses from Tokyo Education Center. (author)

  11. Massachusetts Institute of Technology, Plasma Fusion Center, Technical Research Programs

    International Nuclear Information System (INIS)

    1980-08-01

    A review is given of the technical programs carried out by the Plasma Fusion Center. The major divisions of work areas are applied plasma research, confinement experiments, fusion technology and engineering, and fusion systems. Some objectives and results of each program are described

  12. Two Micron Laser Technology Advancements at NASA Langley Research Center

    Science.gov (United States)

    Singh, Upendra N.

    2010-01-01

    An Independent Laser Review Panel set up to examine NASA s space-based lidar missions and the technology readiness of lasers appropriate for space-based lidars indicated a critical need for an integrated research and development strategy to move laser transmitter technology from low technical readiness levels to the higher levels required for space missions. Based on the review, a multiyear Laser Risk Reduction Program (LRRP) was initiated by NASA in 2002 to develop technologies that ensure the successful development of the broad range of lidar missions envisioned by NASA. This presentation will provide an overview of the development of pulsed 2-micron solid-state laser technologies at NASA Langley Research Center for enabling space-based measurement of wind and carbon dioxide.

  13. Tiger Team Assessment, Energy Technology Engineering Center

    International Nuclear Information System (INIS)

    1991-04-01

    The Office Special Projects within the Office of Environment, Safety, and Health (EH) has the responsibility to conduct Tiger Team Assessments for the Secretary of Energy. This report presents the assessment of the buildings, facilities, and activities under the DOE/Rockwell Contract No. DE-AM03-76SF00700 for the Energy Technology Engineering Center (ETEC) and of other DOE-owned buildings and facilities at the Santa Susana Field Laboratory (SSFL) site in southeastern Ventura County, California, not covered under Contract No. DE-AM03-76SF00700, but constructed over the years under various other contracts between DOE and Rockwell International. ETEC is an engineering development complex operated for DOE by the Rocketdyne Division of Rockwell International Corporation. ETEC is located within SSFL on land owned by Rockwell. The balance of the SSFL complex is owned and operated by Rocketdyne, with the exception of a 42-acre parcel owned by the National Aeronautics and Space Administration (NASA). The primary mission of ETEC is to provide engineering, testing, and development of components related to liquid metals technology and to conduct applied engineering development of emerging energy technologies

  14. Tiger Team Assessment, Energy Technology Engineering Center

    Energy Technology Data Exchange (ETDEWEB)

    1991-04-01

    The Office Special Projects within the Office of Environment, Safety, and Health (EH) has the responsibility to conduct Tiger Team Assessments for the Secretary of Energy. This report presents the assessment of the buildings, facilities, and activities under the DOE/Rockwell Contract No. DE-AM03-76SF00700 for the Energy Technology Engineering Center (ETEC) and of other DOE-owned buildings and facilities at the Santa Susana Field Laboratory (SSFL) site in southeastern Ventura County, California, not covered under Contract No. DE-AM03-76SF00700, but constructed over the years under various other contracts between DOE and Rockwell International. ETEC is an engineering development complex operated for DOE by the Rocketdyne Division of Rockwell International Corporation. ETEC is located within SSFL on land owned by Rockwell. The balance of the SSFL complex is owned and operated by Rocketdyne, with the exception of a 42-acre parcel owned by the National Aeronautics and Space Administration (NASA). The primary mission of ETEC is to provide engineering, testing, and development of components related to liquid metals technology and to conduct applied engineering development of emerging energy technologies.

  15. Evaluation of Technological Trends and Demands of the Manufacturing Industry to a Center of R&D&I

    Directory of Open Access Journals (Sweden)

    Leone Peter Correia da Silva Andrade

    2015-10-01

    Full Text Available The manufacturing industry is fairly representative in the Brazilian economy. The research activities in technology, development and innovation promoted by technology centers are of great importance to boost the competitiveness of this segment. In this context, this work aims presenting the development of the strategic planning for a Center of R&D&I (Research & Development & Innovation, looking 20 years ahead, on a macro level, creating a master plan which summarizes the future focus areas of competence for technology research, development and innovation, coping with manufacturing trends, using a participative workshop approach. Thus, it is expected that this center offer integrated technological solutions with high added value that promote the development and competitiveness of the manufacturing industry, in the prospects for medium and long term. In order to achieve the project objectives taking the principle of strategic planning was followed. On the one hand, focus was placed on the internal perspective analyzing the current status of the Center. On the other hand, the environment of the Center (external perspective was analyzed. Matching the analysis results regarding both perspectives future competence areas were derived, according to global technological trends as well as national and local industrial demand. Thus, the competencies required to be developed by a technology center to meet the manufacturing industry over the next twenty years would be derived.

  16. Massachusetts Institute of Technology, Plasma Fusion Center, Technical Research Programs

    Energy Technology Data Exchange (ETDEWEB)

    Davidson, Ronald C.

    1980-08-01

    A review is given of the technical programs carried out by the Plasma Fusion Center. The major divisions of work areas are applied plasma research, confinement experiments, fusion technology and engineering, and fusion systems. Some objectives and results of each program are described. (MOW)

  17. User-Centered Design and Interactive Health Technologies for Patients

    Science.gov (United States)

    De Vito Dabbs, Annette; Myers, Brad A.; Mc Curry, Kenneth R.; Dunbar-Jacob, Jacqueline; Hawkins, Robert P.; Begey, Alex; Dew, Mary Amanda

    2010-01-01

    Despite recommendations that patients be involved in the design and testing of health technologies, few reports describe how to involve patients in systematic and meaningful ways to ensure that applications are customized to meet their needs. User-centered design (UCD) is an approach that involves end-users throughout the development process so that technology support tasks, are easy to operate, and are of value to users. In this paper we provide an overview of UCD and use the development of Pocket Personal Assistant for Tracking Health (Pocket PATH), to illustrate how these principles and techniques were applied to involve patients in the development of this interactive health technology. Involving patient-users in the design and testing ensured functionality and usability, therefore increasing the likelihood of promoting the intended health outcomes. PMID:19411947

  18. A future perspective on technological obsolescenceat NASA, Langley Research Center

    Science.gov (United States)

    Mcintyre, Robert M.

    1990-01-01

    The present research effort was the first phase of a study to forecast whether technological obsolescence will be a problem for the engineers, scientists, and technicians at NASA Langley Research Center (LaRC). There were four goals of the research: to review the literature on technological obsolescence; to determine through interviews of division chiefs and branch heads Langley's perspective on future technological obsolescence; to begin making contacts with outside industries to find out how they view the possibility of technological obsolescence; and to make preliminary recommendations for dealing with the problem. A complete description of the findings of this research can be reviewed in a technical report in preparation. The following are a small subset of the key findings of the study: NASA's centers and divisions vary in their missions and because of this, in their capability to control obsolescence; research-oriented organizations within NASA are believed by respondents to keep up to date more than the project-oriented organizations; asked what are the signs of a professional's technological obsolescence, respondents had a variety of responses; top performing scientists were viewed as continuous learners, keeping up to date by a variety of means; when asked what incentives were available to aerospace technologists for keeping up to data, respondents specified a number of ideas; respondents identified many obstacles to professionals' keeping up to date in the future; and most respondents expressed some concern for the future of the professionals at NASA vis a vis the issue of professional obsolescence.

  19. Assessing Community Informatics: A Review of Methodological Approaches for Evaluating Community Networks and Community Technology Centers.

    Science.gov (United States)

    O'Neil, Dara

    2002-01-01

    Analyzes the emerging community informatics evaluation literature to develop an understanding of the indicators used to gauge project impacts in community networks and community technology centers. The study finds that community networks and community technology center assessments fall into five key areas: strong democracy; social capital;…

  20. Overview of Stirling Technology Research at NASA Glenn Research Center

    Science.gov (United States)

    Wilson, Scott D.; Schifer, Nicholas A.; Williams, Zachary D.; Metscher, Jonathan F.

    2016-01-01

    Stirling Radioisotope Power Systems (RPSs) are under development to provide power on future space science missions where robotic spacecraft will orbit, fly by, land, or rove using less than a quarter of the plutonium the currently available RPS uses to produce about the same power. NASA Glenn Research Center's newly formulated Stirling Cycle Technology Development Project (SCTDP) continues development of Stirling-based systems and subsystems, which include a flight-like generator and related housing assembly, controller, and convertors. The project also develops less mature technologies under Stirling Technology Research, with a focus on demonstration in representative environments to increase the technology readiness level (TRL). Matured technologies are evaluated for selection in future generator designs. Stirling Technology Research tasks focus on a wide variety of objectives, including increasing temperature capability to enable new environments, reducing generator mass and/or size, improving reliability and system fault tolerance, and developing alternative designs. The task objectives and status are summarized.

  1. NASA Centers and Universities Collaborate Through Smallsat Technology Partnerships

    Science.gov (United States)

    Cockrell, James

    2018-01-01

    The Small Spacecraft Technology (SST) Program within the NASA Space Technology Mission Directorate is chartered develop and demonstrate the capabilities that enable small spacecraft to achieve science and exploration missions in "unique" and "more affordable" ways. Specifically, the SST program seeks to enable new mission architectures through the use of small spacecraft, to expand the reach of small spacecraft to new destinations, and to make possible the augmentation existing assets and future missions with supporting small spacecraft. The SST program sponsors smallsat technology development partnerships between universities and NASA Centers in order to engage the unique talents and fresh perspectives of the university community and to share NASA experience and expertise in relevant university projects to develop new technologies and capabilities for small spacecraft. These partnerships also engage NASA personnel in the rapid, agile and cost-conscious small spacecraft approaches that have evolved in the university community, as well as increase support to university efforts and foster a new generation of innovators for NASA and the nation.

  2. New Cryogenic Optical Test Capability at Marshall Space Flight Center's Space Optics Manufacturing Technology Center

    Science.gov (United States)

    Kegley, Jeff; Burdine, Robert V. (Technical Monitor)

    2002-01-01

    A new cryogenic optical testing capability exists at Marshall Space Flight Center's Space Optics Manufacturing Technology Center (SOMTC). SOMTC has been performing optical wavefront testing at cryogenic temperatures since 1999 in the X-ray Cryogenic Test Facility's (XRCF's) large vacuum chamber. Recently the cryogenic optical testing capability has been extended to a smaller vacuum chamber. This smaller horizontal cylindrical vacuum chamber has been outfitted with a helium-cooled liner that can be connected to the facility's helium refrigeration system bringing the existing kilowatt of refrigeration capacity to bear on a 1 meter diameter x 2 meter long test envelope. Cryogenic environments to less than 20 Kelvin are now possible in only a few hours. SOMTC's existing instruments (the Instantaneous Phase-shifting Interferometer (IPI) from ADE Phase-Shift Technologies and the PhaseCam from 4D Vision Technologies) view the optic under test through a 150 mm clear aperture BK-7 window. Since activation and chamber characterization tests in September 2001, the new chamber has been used to perform a cryogenic (less than 30 Kelvin) optical test of a 22.5 cm diameter x 127 cm radius of curvature Si02 mirror, a cryogenic survival (less than 30 Kelvin) test of an adhesive, and a cryogenic cycle (less than 20 Kelvin) test of a ULE mirror. A vibration survey has also been performed on the test chamber. Chamber specifications and performance data, vibration environment data, and limited test results will be presented.

  3. How You Can Partner with NIH | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    NCI Technology Transfer Center (TTC) provides an array of agreements to support the National Cancer Institute's partnering. Deciding which type of agreement to use can be a challenge: CRADA, MTA, collaboration, agreement, CTA, Materials-CRADA

  4. Career and Technology Center Honors Julie Hartman | Poster

    Science.gov (United States)

    By Carolynne Keenan, Contributing Writer On May 7, Julie Hartman was honored by the Frederick County Career and Technology Center (CTC) for her support of the CTC’s Biomedical Sciences Program. As an education program specialist for Outreach and Special Programs at NCI at Frederick, Hartman is responsible for NCI at Frederick’s participation in the program, which is designed to offer Frederick County high school students hands-on, practical laboratory experience beyond the typical classroom setting. 

  5. ESTABLISHMENT OF THE CENTER FOR ADVANCED SEPARATION TECHNOLOGIES

    Energy Technology Data Exchange (ETDEWEB)

    Hugh W. Rimmer

    2003-07-01

    Technical Progress Report describes progress made on the eight sub-projects awarded in the first year of Cooperative Agreement DE-FC26-01NT41091: Establishment of the Center for Advanced Separation Technologies. This work is summarized in the body of the main report: the individual sub-project Technical Progress Reports are attached as Appendices. Due to the time taken up by the solicitation/selection process, these cover the initial 6-month period of activity only.

  6. Volpe Center Office of Research and Technology Applications (ORTA) : fiscal year 2014 annual report

    Science.gov (United States)

    2014-12-01

    Technology transfer activities performed by the Volpe National Transportation Systems Center during fiscal year 2014 in fulfillment of statutory Office of Research and Technology Applications (ORTA) responsibilities are summarized in this report.

  7. The development of a low vibration, long life pulse tube employing flexural bearings

    International Nuclear Information System (INIS)

    Olson, D.B.; Riggle, P.; Gedeon, D.

    1992-01-01

    This paper reports on a 1/3 watt, 80 K Technology Demonstration Model (TDM) pulse tube cryocooler which has been developed by Stirling Technology Company (STC). The pulse tube expander has no moving parts, making it simpler, more reliable, lower in cost, and lower in vibration than a Stirling expander. The pulse tube expander was designed, built, and tested with SBIR Phase I funding from NASA Ames Research Center. The pulse tube expander was driven using an existing dual opposed compressor module from a TDM Stirling cryocooler. Two numerical models were developed for pulse tube cryocoler design, evaluation, and analysis

  8. Digital Technologies Supporting Person-Centered Integrated Care – A Perspective

    Directory of Open Access Journals (Sweden)

    John Øvretveit

    2017-09-01

    Full Text Available Shared electronic health and social care records in some service systems are already showing some of the benefits of digital technology and digital data for integrating health and social care. These records are one example of the beginning “digitalisation” of services that gives a glimpse of the potential of digital technology and systems for building coordinated and individualized integrated care. Yet the promise has been greater than the benefits, and progress has been slow compared to other industries. This paper describes for non-technical readers how information technology was used to support integrated care schemes in six EU services, and suggests practical ways forward to use the new opportunities to build person-centered integrated care.

  9. Digital Technologies Supporting Person-Centered Integrated Care – A Perspective

    Science.gov (United States)

    2017-01-01

    Shared electronic health and social care records in some service systems are already showing some of the benefits of digital technology and digital data for integrating health and social care. These records are one example of the beginning “digitalisation” of services that gives a glimpse of the potential of digital technology and systems for building coordinated and individualized integrated care. Yet the promise has been greater than the benefits, and progress has been slow compared to other industries. This paper describes for non-technical readers how information technology was used to support integrated care schemes in six EU services, and suggests practical ways forward to use the new opportunities to build person-centered integrated care. PMID:29588629

  10. Patient safety goals for the proposed Federal Health Information Technology Safety Center.

    Science.gov (United States)

    Sittig, Dean F; Classen, David C; Singh, Hardeep

    2015-03-01

    The Office of the National Coordinator for Health Information Technology is expected to oversee creation of a Health Information Technology (HIT) Safety Center. While its functions are still being defined, the center is envisioned as a public-private entity focusing on promotion of HIT related patient safety. We propose that the HIT Safety Center leverages its unique position to work with key administrative and policy stakeholders, healthcare organizations (HCOs), and HIT vendors to achieve four goals: (1) facilitate creation of a nationwide 'post-marketing' surveillance system to monitor HIT related safety events; (2) develop methods and governance structures to support investigation of major HIT related safety events; (3) create the infrastructure and methods needed to carry out random assessments of HIT related safety in complex HCOs; and (4) advocate for HIT safety with government and private entities. The convening ability of a federally supported HIT Safety Center could be critically important to our transformation to a safe and effective HIT enabled healthcare system. © The Author 2014. Published by Oxford University Press on behalf of the American Medical Informatics Association. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. IAEA and International Science and Technology Center sign cooperative agreement

    International Nuclear Information System (INIS)

    2008-01-01

    Full text: The IAEA and the International Science and Technology Center (ISTC) today signed an agreement that calls for an increase in cooperation between the two organizations. The memorandum of understanding seeks to amplify their collaboration in the research and development of applications and technology that could contribute to the IAEA's activities in the fields of verification and nuclear security, including training and capacity building. IAEA Safeguards Director of Technical Support Nikolay Khlebnikov and ISTC Executive Director Adriaan van der Meer signed the Agreement at IAEA headquarters in Vienna on 22 October 2008. (IAEA)

  12. Personalized Integrated Educational System: Technology Functions for the Learner- Centered Paradigm of Education

    Science.gov (United States)

    Reigeluth, Charles M.; Aslan, Sinem; Chen, Zengguan; Dutta, Pratima; Huh, Yeol; Lee, Dabae; Lin, Chun-Yi; Lu, Ya-Huei; Min, Mina; Tan, Verily; Watson, Sunnie Lee; Watson, William R.

    2015-01-01

    The learner-centered paradigm of instruction differs in such fundamental ways from the teacher-centered paradigm that it requires technology to serve very different functions. In 2006, a research team at Indiana University began to work on identifying those functions and published their results in 2008. Subsequently, the team elaborated and…

  13. Accelerated Adoption of Advanced Health Information Technology in Beacon Community Health Centers.

    Science.gov (United States)

    Jones, Emily; Wittie, Michael

    2015-01-01

    To complement national and state-level HITECH Act programs, 17 Beacon communities were funded to fuel community-wide use of health information technology to improve quality. Health centers in Beacon communities received supplemental funding. This article explores the association between participation in the Beacon program and the adoption of electronic health records. Using the 2010-2012 Uniform Data System, trends in health information technology adoption among health centers located within and outside of Beacon communities were explored using differences in mean t tests and multivariate logistic regression. Electronic health record adoption was widespread and rapidly growing in all health centers, especially quality improvement functionalities: structured data capture, order and results management, and clinical decision support. Adoption lagged for functionalities supporting patient engagement, performance measurement, care coordination, and public health. The use of advanced functionalities such as care coordination grew faster in Beacon health centers, and Beacon health centers had 1.7 times higher odds of adopting health records with basic safety and quality functionalities in 2010-2012. Three factors likely underlie these findings: technical assistance, community-wide activation supporting health information exchange, and the layering of financial incentives. Additional technical assistance and community-wide activation is needed to support the use of functionalities that are currently lagging. © Copyright 2015 by the American Board of Family Medicine.

  14. Are health centers in Thailand ready for health information technology? : a national survey.

    Science.gov (United States)

    Kijsanayotin, Boonchai; Speedie, Stuart

    2006-01-01

    The Thailand universal health care coverage scheme was instituted in 2001 and The Thailand Ministry of Public Health (MOPH) is restructuring its information systems to support this reform. The MOPH anticipates developing computerized health information systems which can provide information for administration tasks and can improve both healthcare delivery and public health services. To achieve these target goals, knowledge about users and organizations is vital. The knowledge of how health center workers currently use information technology (IT), their knowledge of IT, and acceptance of IT are not only beneficial to policy makers but also to system designers and implementers. The primary objective of this study is to learn how health centers in Thailand use IT, the level of basic IT knowledge among their workers, and their acceptance of health IT. We surveyed a random cross sectional sample of 1,607 health centers representing the total of 9,806 in Thailand in 2005. With an 82% response rate, the preliminary results indicate that information technology usage is pervasive in health centers. The respondents showed a moderately high degree of health information technology acceptance with a modest level of basic IT knowledge. There were no differences in degrees of acceptance among the four geographic regions. The mean score of "intention to use IT" was 5.6 on a scale of 7 and the average basic IT knowledge score was 13 out of 20. These results suggests the possibility of project success if the national health center information system projects are developed and implemented.

  15. Scientific Data Management Center for Enabling Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Vouk, Mladen A.

    2013-01-15

    Managing scientific data has been identified by the scientific community as one of the most important emerging needs because of the sheer volume and increasing complexity of data being collected. Effectively generating, managing, and analyzing this information requires a comprehensive, end-to-end approach to data management that encompasses all of the stages from the initial data acquisition to the final analysis of the data. Fortunately, the data management problems encountered by most scientific domains are common enough to be addressed through shared technology solutions. Based on community input, we have identified three significant requirements. First, more efficient access to storage systems is needed. In particular, parallel file system and I/O system improvements are needed to write and read large volumes of data without slowing a simulation, analysis, or visualization engine. These processes are complicated by the fact that scientific data are structured differently for specific application domains, and are stored in specialized file formats. Second, scientists require technologies to facilitate better understanding of their data, in particular the ability to effectively perform complex data analysis and searches over extremely large data sets. Specialized feature discovery and statistical analysis techniques are needed before the data can be understood or visualized. Furthermore, interactive analysis requires techniques for efficiently selecting subsets of the data. Finally, generating the data, collecting and storing the results, keeping track of data provenance, data post-processing, and analysis of results is a tedious, fragmented process. Tools for automation of this process in a robust, tractable, and recoverable fashion are required to enhance scientific exploration. The SDM center was established under the SciDAC program to address these issues. The SciDAC-1 Scientific Data Management (SDM) Center succeeded in bringing an initial set of advanced

  16. Recent advances in Ni-H2 technology at NASA Lewis Research Center

    Science.gov (United States)

    Gonzalezsanabria, O. D.; Britton, D. L.; Smithrick, J. J.; Reid, M. A.

    1986-01-01

    The NASA Lewis Research Center has concentrated its efforts on advancing the Ni-H2 system technology for low Earth orbit applications. Component technology as well as the design principles were studied in an effort to understand the system behavior and failure mechanisms in order to increase performance and extend cycle life. The design principles were previously addressed. The component development is discussed, in particular the separator and nickel electrode and how these efforts will advance the Ni-H2 system technology.

  17. Final Report for 'Center for Technology for Advanced Scientific Component Software'

    International Nuclear Information System (INIS)

    Shasharina, Svetlana

    2010-01-01

    The goal of the Center for Technology for Advanced Scientific Component Software is to fundamentally changing the way scientific software is developed and used by bringing component-based software development technologies to high-performance scientific and engineering computing. The role of Tech-X work in TASCS project is to provide an outreach to accelerator physics and fusion applications by introducing TASCS tools into applications, testing tools in the applications and modifying the tools to be more usable.

  18. Development of a national center for hydrogen technology. A summary report of activities completed at the national center hydrogen technology from 2005 to 2010

    Energy Technology Data Exchange (ETDEWEB)

    Holmes, Michael J. [Univ. of North Dakota, Grand Forks, ND (United States)

    2011-06-01

    The Energy & Environmental Research Center (EERC) located in Grand Forks, North Dakota, has operated the National Center for Hydrogen Technology® (NCHT®) since 2005 under a Cooperative Agreement with the U.S. Department of Energy's (DOE) National Energy Technology Laboratory (NETL). The EERC has a long history of hydrogen generation and utilization from fossil fuels, and under the NCHT Program, the EERC has accelerated its research of hydrogen generation and utilization topics. Since the NCHT's inception, the EERC has received more than $65 million in funding of hydrogen-related projects ($20 million for the NCHT project which includes federal and corporate development partner funds) involving more than 85 partners (27 with the NCHT). The NCHT project's 19 activities span a broad range of technologies that align well with the Advanced Fuels Program goals and, specifically, those described in the Hydrogen from Coal Program research, development, and demonstration (RD&D) plan. A number of projects have been completed which range from technical feasibility of several hydrogen generation and utilization technologies to public and technical education and outreach tools. Projects under the NCHT have produced hydrogen from natural gas, coal, liquid hydrocarbons, and biomass. The hydrogen or syngas generated by these processes has also been purified to transportation-grade quality in many of these instances or burned directly for power generation. Also, several activities are still undergoing research, development, demonstration, and commercialization at the NCHT. This report provides a summary overview of the projects completed in the first 5 years of the NCHT. Individual activity reports are referenced as a source of detailed information on each activity.

  19. Idaho Nuclear Technology and Engineering Center Low-Activity Waste Process Technology Program FY-98 Status Report

    International Nuclear Information System (INIS)

    Herbst, A.K.; McCray, J.A.; Rogers, A.Z.; Simmons, R.F.; Palethrope, S.J.

    1999-01-01

    The Low-Activity Waste Process Technology Program at the Idaho Nuclear Technology and Engineering Center (INTEC) anticipates that large volumes of low-level/low-activity wastes will need to be grouted prior to near-surface disposal. During fiscal year 1998, three grout formulations were studied for low-activity wastes derived from INTEC liquid sodium-bearing waste. Compressive strength and leach results are presented for phosphate bonding cement, acidic grout, and alkaline grout formulations. In an additional study, grout formulations are recommended for stabilization of the INTEC underground storage tank residual heels

  20. Manpower development and international cooperation in Nuclear Technology and Education Center, JAERI

    International Nuclear Information System (INIS)

    Shiba, Koreyuki; Tojo, Takao; Takada, Kazuo; Nomura, Masayuki

    1996-01-01

    Nuclear Technology and Education Center was founded in 1958 and now has two branches, Tokyo Education Center at Bunkyo-ku, Tokyo and Tokai Education Center at Tokai, Ibaraki-ken. The objective was to educate and train nuclear engineers and scientists for implementing the nation's program of atomic energy research, development and utilization. A variety of training courses have been prepared and carried out to meet the requirements of the nuclear community. In recent years, activities of getting the public acceptance have become important for nuclear energy deployment in Japan. Many short courses have been implemented at JAERI sites and cities for providing the public including high school teachers with basic knowledge on nuclear energy. International training programs of the center were started with the cooperation of the Japan International Cooperation Agency (JICA) in 1985 and of the International Atomic Energy Agency (IAEA) in 1987. International seminars were implemented for improving nuclear safety by inviting participants from the former Soviet Union, central/east European countries and the neighboring countries of Japan under the direction of the Science and Technology Agency (STA) in 1992. STA and JAERI are starting new programs of helping Asian and Pacific countries to develop nuclear manpower. (author)

  1. A review of the design and development processes of simulation for training in healthcare - A technology-centered versus a human-centered perspective.

    Science.gov (United States)

    Persson, Johanna

    2017-01-01

    This article reviews literature about simulation systems for training in healthcare regarding the prevalence of human-centered approaches in the design and development of these systems, motivated by a tradition in this field of working technology-centered. The results show that the focus on human needs and context of use is limited. It is argued that a reduction of the focus on technical advancements in favor of the needs of the users and the healthcare community, underpinned by human factors and ergonomics theory, is favorable. Due to the low number of identified articles describing or discussing human-centered approaches it is furthermore concluded that the publication culture promotes technical descriptions and summative evaluations rather than descriptions and reflections regarding the design and development processes. Shifting the focus from a technology-centered approach to a human-centered one can aid in the process of creating simulation systems for training in healthcare that are: 1) relevant to the learning objectives, 2) adapted to the needs of users, context and task, and 3) not selected based on technical or fidelity criteria. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Center for Center for Technology for Advanced Scientific Component Software (TASCS)

    Energy Technology Data Exchange (ETDEWEB)

    Kostadin, Damevski [Virginia State Univ., Petersburg, VA (United States)

    2015-01-25

    A resounding success of the Scientific Discovery through Advanced Computing (SciDAC) program is that high-performance computational science is now universally recognized as a critical aspect of scientific discovery [71], complementing both theoretical and experimental research. As scientific communities prepare to exploit unprecedented computing capabilities of emerging leadership-class machines for multi-model simulations at the extreme scale [72], it is more important than ever to address the technical and social challenges of geographically distributed teams that combine expertise in domain science, applied mathematics, and computer science to build robust and flexible codes that can incorporate changes over time. The Center for Technology for Advanced Scientific Component Software (TASCS)1 tackles these these issues by exploiting component-based software development to facilitate collaborative high-performance scientific computing.

  3. Algorithms and Architectures for Elastic-Wave Inversion Final Report CRADA No. TC02144.0

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lindtjorn, O. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-15

    This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Schlumberger Technology Corporation (STC), to perform a computational feasibility study that investigates hardware platforms and software algorithms applicable to STC for Reverse Time Migration (RTM) / Reverse Time Inversion (RTI) of 3-D seismic data.

  4. National Energy Research Scientific Computing Center (NERSC): Advancing the frontiers of computational science and technology

    Energy Technology Data Exchange (ETDEWEB)

    Hules, J. [ed.

    1996-11-01

    National Energy Research Scientific Computing Center (NERSC) provides researchers with high-performance computing tools to tackle science`s biggest and most challenging problems. Founded in 1974 by DOE/ER, the Controlled Thermonuclear Research Computer Center was the first unclassified supercomputer center and was the model for those that followed. Over the years the center`s name was changed to the National Magnetic Fusion Energy Computer Center and then to NERSC; it was relocated to LBNL. NERSC, one of the largest unclassified scientific computing resources in the world, is the principal provider of general-purpose computing services to DOE/ER programs: Magnetic Fusion Energy, High Energy and Nuclear Physics, Basic Energy Sciences, Health and Environmental Research, and the Office of Computational and Technology Research. NERSC users are a diverse community located throughout US and in several foreign countries. This brochure describes: the NERSC advantage, its computational resources and services, future technologies, scientific resources, and computational science of scale (interdisciplinary research over a decade or longer; examples: combustion in engines, waste management chemistry, global climate change modeling).

  5. Development of laser technology in Research Center of Laser Fusion

    International Nuclear Information System (INIS)

    Zheng Wanguo; Deng Ying; Zhou Wei

    2013-01-01

    This paper reviews the progress in the construction of SG-Ⅲ laser facility, integrated Testbed and XG-Ⅲ laser facility and that in the upgrade of the prototype of SG-Ⅲ, and the development in assembling and installing technology, and the achievements in maintaining cleanliness project and metrology in Laser Fusion Research Center, China Academy of Engineering Physics in China in 2012. (authors)

  6. Technological drivers in data centers and telecom systems: Multiscale thermal, electrical, and energy management

    International Nuclear Information System (INIS)

    Garimella, Suresh V.; Persoons, Tim; Weibel, Justin; Yeh, Lian-Tuu

    2013-01-01

    Highlights: ► Thermal management approaches reviewed against energy usage of IT industry. ► Challenges of energy efficiency in large-scale electronic systems highlighted. ► Underlying drivers for progress at the business and technology levels identified. ► Thermal, electrical and energy management challenges discussed as drivers. ► Views of IT system operators, manufacturers and integrators represented. - Abstract: We identify technological drivers for tomorrow’s data centers and telecommunications systems, including thermal, electrical and energy management challenges, based on discussions at the 2nd Workshop on Thermal Management in Telecommunication Systems and Data Centers in Santa Clara, California, on April 25–26, 2012. The relevance of thermal management in electronic systems is reviewed against the background of the energy usage of the information technology (IT) industry, encompassing perspectives of different sectors of the industry. The underlying drivers for progress at the business and technology levels are identified. The technological challenges are reviewed in two main categories – immediate needs and future needs. Enabling cooling techniques that are currently under development are also discussed

  7. Development of New Materials and Technologies for Welding and Surfacing at Research and Production Center 'Welding Processes and Technologies'

    International Nuclear Information System (INIS)

    Kozyrev, N A; Kryukov, R E; Galevsky, G V; Titov, D A; Shurupov, V M

    2015-01-01

    The paper provides description of research into the influence of new materials and technologies on quality parameters of welds and added metal carried out at research and production center «Welding processes and technologies».New welding technologies of tanks for northern conditions are considered, as well as technologies of submerged arc welding involving fluxing agents AN - 348, AN - 60, AN - 67, OK. 10.71 and carbon-fluorine containing additives, new flux cored wires and surfacing technologies, teaching programs and a trainer for welders are designed. (paper)

  8. Texas Manufacturing Technology Center feasibility study for the Inland Regional Industrial Technology Institute

    International Nuclear Information System (INIS)

    1994-01-01

    This document presents the Texas Manufacturing Technology Center (TMTC) Business Plan to convert the Central Facility of the Superconducting Super Collider project to alternate uses. The plan is divided into six sections: (1) Executive Summary, (2) Market and Benefit Analysis, (3) Marketing Strategy, (4) Services, (5) Organization and Operations Overview, and (6) Financial Plan. Each area is supported by separate documents that address individual opportunities and challenges associated with transitioning the facility, and its asset base to new uses for benefit of the locality, state, region and nation

  9. Jackson State University (JSU)’s Center of Excellence in Science, Technology, Engineering, and Mathematics Education (CESTEME)

    Science.gov (United States)

    2016-01-08

    Actuarial Science Taylor, Triniti Lanier Alcorn State University Animal Science Tchounwou, Hervey Madison Central Jackson State University Computer...for Public Release; Distribution Unlimited Final Report: Jackson State University (JSU)’s Center of Excellence in Science , Technology, Engineering...Final Report: Jackson State University (JSU)’s Center of Excellence in Science , Technology, Engineering, and Mathematics Education (CESTEME) Report

  10. The World Wide Web and Technology Transfer at NASA Langley Research Center

    Science.gov (United States)

    Nelson, Michael L.; Bianco, David J.

    1994-01-01

    NASA Langley Research Center (LaRC) began using the World Wide Web (WWW) in the summer of 1993, becoming the first NASA installation to provide a Center-wide home page. This coincided with a reorganization of LaRC to provide a more concentrated focus on technology transfer to both aerospace and non-aerospace industry. Use of the WWW and NCSA Mosaic not only provides automated information dissemination, but also allows for the implementation, evolution and integration of many technology transfer applications. This paper describes several of these innovative applications, including the on-line presentation of the entire Technology Opportunities Showcase (TOPS), an industrial partnering showcase that exists on the Web long after the actual 3-day event ended. During its first year on the Web, LaRC also developed several WWW-based information repositories. The Langley Technical Report Server (LTRS), a technical paper delivery system with integrated searching and retrieval, has proved to be quite popular. The NASA Technical Report Server (NTRS), an outgrowth of LTRS, provides uniform access to many logically similar, yet physically distributed NASA report servers. WWW is also the foundation of the Langley Software Server (LSS), an experimental software distribution system which will distribute LaRC-developed software with the possible phase-out of NASA's COSMIC program. In addition to the more formal technology distribution projects, WWW has been successful in connecting people with technologies and people with other people. With the completion of the LaRC reorganization, the Technology Applications Group, charged with interfacing with non-aerospace companies, opened for business with a popular home page.

  11. Novel Mechanism of Fatty Acid Sensing in Enteroendocrine Cells: Specific Structures in Oxo-Fatty Acids Produced by Gut Bacteria are Responsible for CCK Secretion in STC-1 Cells via GPR40.

    Science.gov (United States)

    Hira, Tohru; Ogasawara, Shono; Yahagi, Asuka; Kamachi, Minami; Li, Jiaxin; Nishimura, Saki; Sakaino, Masayoshi; Yamashita, Takatoshi; Kishino, Shigenobu; Ogawa, Jun; Hara, Hiroshi

    2018-06-25

    The secretion of gut hormones, such as cholecystokinin (CCK) is stimulated by fatty acids. Although a chain length-dependent mechanism has been proposed, other structural relationships to releasing activity remain unclear. We aimed to elucidate specific structures in fatty acids that are responsible for their CCK-releasing activity, and related sensing mechanisms in enteroendocrine cells. We examined CCK secretory activities in a murine CCK-producing cell line STC-1 by exposing the cells to various modified fatty acids produced by gut lactic acid bacteria. The effects of fatty acids on gastric emptying rate as a CCK-mediated function were examined using acetaminophen- and phenol red-methods in rats. Out of more than thirty octadecanoic (C18)-derived fatty acids tested, five oxo-fatty acids potently stimulated CCK secretion without cytotoxic effects in STC-1 cells. Three fatty acids had a distinct specific structure containing one double-bond, whereas the other two had two double-bonds, nearby an oxo residue. CCK secretion induced by representative fatty acids (10-oxo-trans-11-18:1 and 13-oxo-cis-9,cis-15-18:2) was attenuated by a fatty acid-receptor GPR40 antagonist. Oral administration of 13-oxo-cis-9,cis-15-18:2 lowered the gastric emptying rate in rats in a dose- and structure-dependent manner. These results revealed a novel fatty acid-sensing mechanism in enteroendocrine cells. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  12. Accelerator laboratories: development centers for experimental physics and technology in Mexico

    International Nuclear Information System (INIS)

    Mazari, M.

    1989-01-01

    Three years ago in this Nuclear Center the author and Professor Graef expounded the inception and development of experimental physics and new techniques centered about laboratories and equipped in our country with positive ion accelerators. Extracted here is the information on the laboratories that have allowed professional training as well as the furtherance of scientific productivity in each group. An additional proposal as to how the technical groups knowledgeable in advanced technology might contribute significantly to adequate preparation of youth at the intermediate level able to generate innocuous micro industries in their own neighbourhood. (Author). 5 refs, 2 figs, 2 tabs

  13. Publications in academic medical centers: technology-facilitated culture clash.

    Science.gov (United States)

    Berner, Eta S

    2014-05-01

    Academic culture has a set of norms, expectations, and values that are sometimes tacit and sometimes very explicit. In medical school and other health professions educational settings, probably the most common norm includes placing a high value on peer-reviewed research publications, which are seen as the major evidence of scholarly productivity. Other features of academic culture include encouraging junior faculty and graduate students to share their research results at professional conferences and lecturing with slides as a major way to convey information. Major values that faculty share with journal editors include responsible conduct of research and proper attribution of others' words and ideas. Medical school faculty also value technology and are often quick to embrace technological advances that can assist them in their teaching and research. This article addresses the effects of technology on three aspects of academic culture: education, presentations at professional meetings, and research publications.The technologies discussed include online instruction, dissemination of conference proceedings on the Internet, plagiarism-detection software, and new technologies deployed by the National Center for Biotechnology Information, the home of PubMed. The author describes how the ease of deploying new technologies without faculty changing their norms and behavior in the areas of teaching and research can lead to conflicts of values among key stakeholders in the academic medical community, including faculty, journal editors, and professional associations. The implications of these conflicts and strategies for managing them are discussed.

  14. Technologies and experimental approaches in the NIH Botanical Research Centers

    Science.gov (United States)

    Barnes, Stephen; Birt, Diane F; Cassileth, Barrie R; Cefalu, William T; Chilton, Floyd H; Farnsworth, Norman R; Raskin, Ilya; van Breemen, Richard B; Weaver, Connie M

    2009-01-01

    There are many similarities between research on combinatorial chemistry and natural products and research on dietary supplements and botanicals in the NIH Botanical Research Centers. The technologies in the centers are similar to those used by other NIH-sponsored investigators. All centers rigorously examine the authenticity of botanical dietary supplements and determine the composition and concentrations of the phytochemicals therein, most often by liquid chromatography–mass spectrometry. Several of the centers specialize in fractionation and high-throughput evaluation to identify the individual bioactive agent or a combination of agents. Some centers are using DNA microarray analyses to determine the effects of botanicals on gene transcription with the goal of uncovering the important biochemical pathways they regulate. Other centers focus on bioavailability and uptake, distribution, metabolism, and excretion of the phytochemicals as for all xenobiotics. Because phytochemicals are often complex molecules, synthesis of isotopically labeled forms is carried out by plant cells in culture, followed by careful fractionation. These labeled phytochemicals allow the use of accelerator mass spectrometry to trace the tissue distribution of 14C-labeled proanthocyanidins in animal models of disease. State-of-the-art proteomics and mass spectrometry are also used to identify proteins in selected tissues whose expression and posttranslational modification are influenced by botanicals and dietary supplements. In summary, the skills needed to carry out botanical centers’ research are extensive and may exceed those practiced by most NIH investigators. PMID:18258642

  15. The rehabilitation engineering research center for the advancement of cognitive technologies.

    Science.gov (United States)

    Heyn, Patricia Cristine; Cassidy, Joy Lucille; Bodine, Cathy

    2015-02-01

    Barring few exceptions, allied health professionals, engineers, manufacturers of assistive technologies (ATs), and consumer product manufacturers have developed few technologies for individuals with cognitive impairments (CIs). In 2004, the National Institute on Disability Rehabilitation Research (NIDRR) recognized the need to support research in this emergent field. They funded the first Rehabilitation Engineering Research Center for the Advancement of Cognitive Technologies (RERC-ACT). The RERC-ACT has since designed and evaluated existing and emerging technologies through rigorous research, improving upon existing AT devices, and creating new technologies for individuals with CIs. The RERC-ACT has contributed to the development and testing of AT products that assist persons with CIs to actively engage in tasks of daily living at home, school, work, and in the community. This article highlights the RERC-ACT's engineering development and research projects and discusses how current research may impact the quality of life for an aging population. © The Author(s) 2014.

  16. What's new with nurseries and reforestation projects at the Missoula Technology and Development Center?

    Science.gov (United States)

    Bob Simonson

    2011-01-01

    The USDA Forest Service Missoula Technology and Development Center (MTDC) offers technical expertise, technology transfer, and new equipment development to federal, state, and private forest nurseries. Current and recently completed projects at MTDC include a front and mid-mount tractor evaluation, ATV-pulled mechanical tree planter, greenhouse snow remover, freeze...

  17. Armstrong Flight Research Center Research Technology and Engineering Report 2015

    Science.gov (United States)

    Voracek, David F.

    2016-01-01

    I am honored to endorse the 2015 Neil A. Armstrong Flight Research Center’s Research, Technology, and Engineering Report. The talented researchers, engineers, and scientists at Armstrong are continuing a long, rich legacy of creating innovative approaches to solving some of the difficult problems and challenges facing NASA and the aerospace community.Projects at NASA Armstrong advance technologies that will improve aerodynamic efficiency, increase fuel economy, reduce emissions and aircraft noise, and enable the integration of unmanned aircraft into the national airspace. The work represented in this report highlights the Center’s agility to develop technologies supporting each of NASA’s core missions and, more importantly, technologies that are preparing us for the future of aviation and space exploration.We are excited about our role in NASA’s mission to develop transformative aviation capabilities and open new markets for industry. One of our key strengths is the ability to rapidly move emerging techniques and technologies into flight evaluation so that we can quickly identify their strengths, shortcomings, and potential applications.This report presents a brief summary of the technology work of the Center. It also contains contact information for the associated technologists responsible for the work. Don’t hesitate to contact them for more information or for collaboration ideas.

  18. Using Technology, Clinical Workflow Redesign, and Team Solutions to Achieve the Patient Centered Medical Home

    Science.gov (United States)

    2011-01-01

    Redesign, and Team Solutions to Achieve the Patient Centered Medical Home LTC Nicole Kerkenbush, MHA, MN Army Medical Department, Office of the...TITLE AND SUBTITLE Using Technology, Clinical Workflow Redesign, and Team Solutions to Achieve the Patient Centered Medical Home 5a. CONTRACT...Describe how these tools are being used to implement the Patient Centered Medical Home care model 2 2011 MHS Conference MEDCOM AHLTA Provider Satisfaction

  19. The Importance of Innovation: Diffusion Theory and Technological Progress in Writing Centers.

    Science.gov (United States)

    Inman, James A.

    2000-01-01

    Suggests that all stakeholders should share a focus on "innovations," referring here simultaneously to technologies and their social, cultural, political, and historical contexts. Introduces a new perspective through which writing center professionals can approach collaborative relationships with other stakeholders in the move towards…

  20. The Savannah River Technology Center environmental monitoring field test platform

    International Nuclear Information System (INIS)

    Rossabi, J.

    1993-01-01

    Nearly all industrial facilities have been responsible for introducing synthetic chemicals into the environment. The Savannah River Site is no exception. Several areas at the site have been contaminated by chlorinated volatile organic chemicals. Because of the persistence and refractory nature of these contaminants, a complete clean up of the site will take many years. A major focus of the mission of the Environmental Sciences Section of the Savannah River Technology Center is to develop better, faster, and less expensive methods for characterizing, monitoring, and remediating the subsurface. These new methods can then be applied directly at the Savannah River Site and at other contaminated areas in the United States and throughout the world. The Environmental Sciences Section has hosted field testing of many different monitoring technologies over the past two years primarily as a result of the Integrated Demonstration Program sponsored by the Department of Energy's Office of Technology Development. This paper provides an overview of some of the technologies that have been demonstrated at the site and briefly discusses the applicability of these techniques

  1. Combined Neutron Center for European Research and Technology

    International Nuclear Information System (INIS)

    Lagniel, Jean-Michel

    2002-01-01

    High-power proton linacs are needed as driver for several applications, namely transmutation of nuclear waste using Accelerator Driven Systems (ADS), spallation neutron sources (ESS in Europe) and other fields of basic and applied research (next generation of radioactive ion beam facilities, neutrino factories, muon colliders, irradiation facilities for material testing...). The possible synergies among these projects will be pointed out and the feasibility study of high-power proton linac used as driver of a multi-user facility (CONCERT) will be presented. There was excellent scientific, technical and economic reasons to study a Combined Neutron Center for European Research and Technology (CONCERT) based on a high-power proton accelerator. Such an installation would serve condensed matter studies by spallation neutron scattering, a technological irradiation tool and R and D facility for an hybrid reactor demonstrator, a radioactive ion beam facility for nuclear physics, R and D developments for a muon/neutrino facility. The installation could therefore constitute a European center of excellence in the field of neutronics where a large number of scientific and technical executives could be trained. The CONCERT Project Team has performed the feasibility study of such a multi-user facility with: - a review of the beam needs for the different applications, - an analyze of their compatibility, - the definition of the scope of a site-independent project, - a selection of the most appropriate options regarding scientific, technical, financial, organizational and administrative aspects, - an estimation of the costs for construction, operation and the needs in manpower. The conceptual design report [17] is sufficiently detailed to minimize contingencies on those parts of the project having a large potential impact in terms of performances, costs or delays. (author)

  2. Career and Technology Center Guides Students in Real-Life Careers | Poster

    Science.gov (United States)

    By Carolynne Keenan, Contributing Writer Frederick County Public School students have a unique opportunity—a chance to get a real-world, hands-on experience in biomedical science and biotechnology before they even graduate from high school, thanks to the Frederick County Career and Technology Center (CTC). Several years ago, the CTC established its biomedical sciences program

  3. Calcined Waste Storage at the Idaho Nuclear Technology and Engineering Center

    Energy Technology Data Exchange (ETDEWEB)

    M. D. Staiger

    2007-06-01

    This report provides a quantitative inventory and composition (chemical and radioactivity) of calcined waste stored at the Idaho Nuclear Technology and Engineering Center. From December 1963 through May 2000, liquid radioactive wastes generated by spent nuclear fuel reprocessing were converted into a solid, granular form called calcine. This report also contains a description of the calcine storage bins.

  4. Design of smart home terminal controller based on ZigBee

    Science.gov (United States)

    Li, Biqing; Li, Zhao; Zhang, Hongyan

    2018-04-01

    With the development in scienc and technology, and the improvement of living conditions, people pay more and more attention to the comfort of household life. Therefore, smart home has become the development trend of the future furniture. This design is composed of three blocks: transmitting module, receiving module and data acquisition module. ZigBee and STC89C52 belong to launch module as well as belong to receive module. Launch module contains ZigBee, serial communication module and monolithic STC89C52. The receiving module contains light control parts, curtain control part, ZigBee and microcontroller STC89C52. Data acquisition module includes temperature and humidity detection.

  5. 7. Annual seminar of the scientific initiation of the Center for Development of Nuclear Technology. Abstracts

    International Nuclear Information System (INIS)

    2012-01-01

    This seminar presents the Scientific Initiation Program developed at the CDTN - Brazilian Center for the Development of Nuclear Technology and focuses on activities of the sectors of: radiopharmaceutical production; radiation applied to health; waste management; structural integrity; environment; nanotechnology and nuclear materials; reactor technology; mineral technology; reactor and analytical techniques

  6. Distance Learning With NASA Lewis Research Center's Learning Technologies Project

    Science.gov (United States)

    Petersen, Ruth

    1998-01-01

    The NASA Lewis Research Center's Learning Technologies Project (LTP) has responded to requests from local school district technology coordinators to provide content for videoconferencing workshops. Over the past year we have offered three teacher professional development workshops that showcase NASA Lewis-developed educational products and NASA educational Internet sites. In order to determine the direction of our involvement with distance learning, the LTP staff conducted a survey of 500 U.S. schools. We received responses from 72 schools that either currently use distance learning or will be using distance learning in 98-99 school year. The results of the survey are summarized in the article. In addition, the article provides information on distance learners, distance learning technologies, and the NASA Lewis LTP videoconferencing workshops. The LTP staff will continue to offer teacher development workshops through videoconferencing during the 98-99 school year. We hope to add workshops on new educational products as they are developed at NASA Lewis.

  7. Information technology leadership in academic medical centers: a tale of four cultures.

    Science.gov (United States)

    Friedman, C P

    1999-07-01

    Persons and groups within academic medical centers bring consistent and predictable viewpoints to planning and decision making. The varied professional and academic cultures of these individuals appear to account primarily for the diversity of their viewpoints. Understanding these professional cultures can help leaders achieve some predictability in the complex environments for which they are responsible. Leaders in information technology in particular, in order to be successful, must become part-time anthropologists, immersing themselves in the varied workplaces of their constituents to understand the work they do and the cultures that have grown up around this work. Only in this way will they be able to manage the challenges that arise continuously as the technology and the needs it can address change over time. In this article, the author briefly describes the concept of culture, portrays four specific professional cultures that typically coexist in academic medical centers, and argues that understanding these cultures is absolutely critical to effective management and use of information resources.

  8. Allocation of Tutors and Study Centers in Distance Learning Using Geospatial Technologies

    Directory of Open Access Journals (Sweden)

    Shahid Nawaz Khan

    2018-05-01

    Full Text Available Allama Iqbal Open University (AIOU is Pakistan’s largest distance learning institute, providing education to 1.4 million students. This is a fairly large setup across a country where students are highly geographically distributed. Currently, the system works using a manual approach, which is not efficient. Allocation of tutors and study centers to students plays a key role in creating a better learning environment for distance learning. Assigning tutors and study centers to distance learning students is a challenging task when there is a huge geographic spread. Using geospatial technologies in open and distance learning can fix allocation problems. This research analyzes real data from the twin cities Islamabad and Rawalpindi. The results show that geospatial technologies can be used for efficient and proper resource utilization and allocation, which in turn can save time and money. The overall idea fits into an improved distance learning framework and related analytics.

  9. Available decontamination and decommissioning capabilities at the Savannah River Technology Center

    International Nuclear Information System (INIS)

    Polizzi, L.M.; Norkus, J.K.; Paik, I.K.; Wooten, L.A.

    1992-01-01

    The Safety Analysis and Engineering Services Group has performed a survey of the Savannah River Technology Center (SRTC) technical capabilities, skills, and experience in Decontamination and Decommissioning (D ampersand D) activities. The goal of this survey is to enhance the integration of the SRTC capabilities with the technical needs of the Environmental Restoration Department D ampersand D program and the DOE Office of Technology Development through the Integrated Demonstration Program. This survey has identified technical capabilities, skills, and experience in the following D ampersand D areas: Characterization, Decontamination, Dismantlement, Material Disposal, Remote Systems, and support on Safety Technology for D ampersand D. This review demonstrates the depth and wealth of technical capability resident in the SRTC in relation to these activities, and the unique qualifications of the SRTC to supply technical support in the area of DOE facility D ampersand D. Additional details on specific technologies and applications to D ampersand D will be made available on request

  10. Solid and liquid radioactive waste management of the Nuclear Technology Development Center (CDTN) - NUCLEBRAS

    International Nuclear Information System (INIS)

    Guzella, M.F.R.; Miaw, S.T.W.; Mourao, R.P.; Prado, M.A.S. do; Reis, L.C.A.; Santos, P.O.; Silva, E.M.P.

    1986-01-01

    Low level liquid and solid wastes are produced in several laboratories of the NUCLEAR TECHNOLOGY DEVELOPMENT CENTER (CDTN)-NUCLEBRAS. In the last years, the intensification of technical activities at the Center has increased the radioactive waste volumes. Therefore, the implementation of a Radioactive Waste Management Program has begun. This Program includes the systematic of activities from the waste collection to the transportation for the final disposal. The liquid and solid waste are collected separately in proper containers and stored for later treatment according to the processes available or under development at the Center. (Author) [pt

  11. Solid and liquid radioactive waste management of the Nuclear Technology Development Center (CDTN)- Nuclebras

    International Nuclear Information System (INIS)

    Guzella, M.F.R.; Mourao, R.P.; Reis, L.C.A.; Silva, E.M.P.; Miaw, S.T.W.; Prado, M.A.S.; Santos, P.O.

    1986-01-01

    Low level liquid and solid wastes are produced in several laboratories of the NUCLEAR TECHNOLOGY DEVELOPMENT CENTER (CDTN) - NUCLEBRAS. In the last years, the intensification of technical activities at the Center has increased the radioactive waste volumes. Therefore, the implementation of a Radioactive Waste Management Program has begun. This Program includes the systematic of activities from the waste collection to the transportation for the final disposal. The liquid and solid waste are collected separately in proper containers and stored for later treatment according to the processes available or under development at the Center. (Author) [pt

  12. A proposal for improving data center management through strategic implementation of Server virtualization technology to support Malaysian Nuclear Agency's activities

    International Nuclear Information System (INIS)

    Mohamad Safuan Sulaiman; Abdul Muin Abdul Rahman; Raja Murzaferi Raja Moktar; Saaidi Ismail

    2010-01-01

    Management of servers in Nuclear Malaysia's data center poses a big challenge to IT Center as well as to the general management. Traditional server management techniques have been used to provide reliable and continuous support for the ever increasing services and applications demanded by researchers and the other staffs of Nuclear Malaysia. Data centers are cost centers which need logistical support such as electricity, air conditioning, room space, manpower and other resources. To save cost and comply with Green Technology while maintaining or improving the level of services, a new concept called server virtualization is proposed and a feasibility study of this technology has been initiated to explore its potential to accommodate IT centers ever demanding services while reducing the need for such logistical supports, hence adhering to the Green IT concept. Server virtualization is a new technology where a single high performance physical server can host multiple high processing services, and different types operating systems with different hardware and software requirements which are traditionally performed by multiple server machines. This paper briefly explains server virtualization concepts, tools and techniques and proposes an implementation strategy of the technology for Nuclear Malaysia's data center. (author)

  13. National Wind Technology Center sitewide, Golden, CO: Environmental assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    The National Renewable Energy Laboratory (NREL), the nation`s primary solar and renewable energy research laboratory, proposes to expand its wind technology research and development program activities at its National Wind Technology Center (NWTC) near Golden, Colorado. NWTC is an existing wind energy research facility operated by NREL for the US Department of Energy (DOE). Proposed activities include the construction and reuse of buildings and facilities, installation of up to 20 wind turbine test sites, improvements in infrastructure, and subsequent research activities, technology testing, and site operations. In addition to wind turbine test activities, NWTC may be used to support other NREL program activities and small-scale demonstration projects. This document assesses potential consequences to resources within the physical, biological, and human environment, including potential impacts to: air quality, geology and soils, water resources, biological resources, cultural and historic resources, socioeconomic resources, land use, visual resources, noise environment, hazardous materials and waste management, and health and safety conditions. Comment letters were received from several agencies in response to the scoping and predecisional draft reviews. The comments have been incorporated as appropriate into the document with full text of the letters contained in the Appendices. Additionally, information from the Rocky Flats Environmental Technology Site on going sitewide assessment of potential environmental impacts has been reviewed and discussed by representatives of both parties and incorporated into the document as appropriate.

  14. National Wind Technology Center sitewide, Golden, CO: Environmental assessment

    International Nuclear Information System (INIS)

    1996-11-01

    The National Renewable Energy Laboratory (NREL), the nation's primary solar and renewable energy research laboratory, proposes to expand its wind technology research and development program activities at its National Wind Technology Center (NWTC) near Golden, Colorado. NWTC is an existing wind energy research facility operated by NREL for the US Department of Energy (DOE). Proposed activities include the construction and reuse of buildings and facilities, installation of up to 20 wind turbine test sites, improvements in infrastructure, and subsequent research activities, technology testing, and site operations. In addition to wind turbine test activities, NWTC may be used to support other NREL program activities and small-scale demonstration projects. This document assesses potential consequences to resources within the physical, biological, and human environment, including potential impacts to: air quality, geology and soils, water resources, biological resources, cultural and historic resources, socioeconomic resources, land use, visual resources, noise environment, hazardous materials and waste management, and health and safety conditions. Comment letters were received from several agencies in response to the scoping and predecisional draft reviews. The comments have been incorporated as appropriate into the document with full text of the letters contained in the Appendices. Additionally, information from the Rocky Flats Environmental Technology Site on going sitewide assessment of potential environmental impacts has been reviewed and discussed by representatives of both parties and incorporated into the document as appropriate

  15. Test facilities for radioactive materials transport packages (Transportation Technology Center Inc., Pueblo, Colorado, USA)

    International Nuclear Information System (INIS)

    Conlon, P.C.L.

    2001-01-01

    Transportation Technology Center, Inc. is capable of conducting tests on rail vehicle systems designed for transporting radioactive materials including low level waste debris, transuranic waste, and spent nuclear fuel and high level waste. Services include rail vehicle dynamics modelling, on-track performance testing, full scale structural fatigue testing, rail vehicle impact tests, engineering design and technology consulting, and emergency response training. (author)

  16. A regional technology transfer program. [North Carolina Industrial Applications Center for the Southeast

    Science.gov (United States)

    1979-01-01

    The proliferation of online searching capabilities among its industrial clients, changes in marketing staff and direction, use of Dun and Bradstreet marketing service files, growth of the Annual Service Package program, and services delivered to clients at the NASA funded North Carolina Science and Technology Research Center are described. The library search service was reactivated and enlarged, and a survey was conducted on the NC/STRC Technical Bulletin's effectiveness. Several quotations from clients assess the overall value of the Center's services.

  17. Fleet Readiness Center - Southeast Technology Development Program (Cadmium & Hexavalent Chromium Reduction)

    Science.gov (United States)

    2014-11-01

    Fleet Readiness Center - Southeast TECHNOLOGY DEVELOPMENT PROGRAM (Cadmium & Hexavalent Chromium Reduction) Jack Benfer Senior Materials...Development Program (Cadmium & Hexavalent Chromium Reduction) 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT...Rinse Black Oxide Rinse CRES Passivation Chrome Plating Cadmium Plating Cadmium Brush Plating Class N (TRL 9) Class N (TRL 7) Class N (TRL 6

  18. The project of Esfahan Nuclear Technology Center (ENTEC) and the transfer of nuclear tecnology in Iran

    International Nuclear Information System (INIS)

    Khazaneh, Reza

    1977-01-01

    In 1974, the Atomic Energy Organization of Iran (AEOI) decided to set up a Nuclear Technology Center on Esfahan (ENTEC) in collaboration with France's Technicatome Company and the CEA. This center is scheduled to go into operation during 1976-1980. The purposes for setting up ENTEC are threefold: a. to give scientific and technical support to the operation of nuclear power plants and nuclear industries in Iran. b. to carry out research and development in the area of nuclear technology on an industrial level. c. to give supplementary education and training to the manpower needs for the AEOI. To carry out the program of technology transfer, temporary laboratories have been set up in Tehran for engineers, technicians and training programs have been organized primarily in France. The ENTEC project will also include a school for education of junior scientists and engineers in the field of nuclear technology

  19. [Technology: training centers--a new method for learning surgery in visceral surgery].

    Science.gov (United States)

    Troidl, H

    1996-01-01

    The importance of training centers can be best described after first answering a few questions like: 1. What kind of surgery will we deal with in the future? 2. What kind of surgeon do we need for this surgery, if it is basically different? 3. How will this surgeon have to be educated/trained for this different surgery? Although I am aware of the fact, that statements about future prospects are usually doomed to fail, I maintain that endoscopic surgery will be an essential part of general surgery. If this is so, surgery will be dominated by extremely complicated technology, new techniques and new instruments. It will be a "different" surgery. It will offer more comfort at the same safety. The surgeon of the future will still need a certain personality; he will still need intuition and creativity. To survive in our society, he will have to be an organiser and even a businessman. Additionally, something new has to be added: he will have to understand modern, complicated technology and will have to use totally different instruments for curing surgical illness. This makes it clear that we will need a different education/training and may be even a different selection of surgeons. We should learn from other professions sharing common interests with surgery, for example, sports where the common interest is achieving most complicated motions and necessarily highly differentiated coordination. Common interest with airline pilots is the target of achieving absolute security. They have a highly differentiated selection and training concept. Training centers may be-under certain prerequisites-a true alternative for this necessary form of training. They must have a concept, i.e. contents and aims have to be defined, structured and oriented on the requirements of surgery for the patient. Responsibility for the concept, performance and control can only be in the hands of Surgical Societies and Universities. These prerequisites correspond most likely to training centers being

  20. Comparing spatial tuning curves, spectral ripple resolution, and speech perception in cochlear implant users.

    Science.gov (United States)

    Anderson, Elizabeth S; Nelson, David A; Kreft, Heather; Nelson, Peggy B; Oxenham, Andrew J

    2011-07-01

    Spectral ripple discrimination thresholds were measured in 15 cochlear-implant users with broadband (350-5600 Hz) and octave-band noise stimuli. The results were compared with spatial tuning curve (STC) bandwidths previously obtained from the same subjects. Spatial tuning curve bandwidths did not correlate significantly with broadband spectral ripple discrimination thresholds but did correlate significantly with ripple discrimination thresholds when the rippled noise was confined to an octave-wide passband, centered on the STC's probe electrode frequency allocation. Ripple discrimination thresholds were also measured for octave-band stimuli in four contiguous octaves, with center frequencies from 500 Hz to 4000 Hz. Substantial variations in thresholds with center frequency were found in individuals, but no general trends of increasing or decreasing resolution from apex to base were observed in the pooled data. Neither ripple nor STC measures correlated consistently with speech measures in noise and quiet in the sample of subjects in this study. Overall, the results suggest that spectral ripple discrimination measures provide a reasonable measure of spectral resolution that correlates well with more direct, but more time-consuming, measures of spectral resolution, but that such measures do not always provide a clear and robust predictor of performance in speech perception tasks. © 2011 Acoustical Society of America

  1. The Research Results of Radioactive Waste Management Technology Center Year 1997/1998

    International Nuclear Information System (INIS)

    1998-12-01

    The research results of Radioactive Waste Management Technology Center, National Atomic Energy Agency of Indonesia year 1997/1998 contain paper as form of research results on radioactive waste management related fields. There were included many aspects such as radioactive waste processing, storage, decontamination, decommissioning, safety and environmental aspects. There are 26 papers indexed individually (ID)

  2. Annual energy yield of different photovoltaic technologies at different climatic conditions; Jahresenergieertraege unterschiedlicher Photovoltaik-Technologien bei verschiedenen klimatischen Bedingungen

    Energy Technology Data Exchange (ETDEWEB)

    Zinsser, Bastian

    2010-10-04

    It is very important for engineers as well as for investors to know which amount of energy E [kWh] a photovoltaic (PV) system produces under real operating conditions. In most cases the costs [Euroct/kWh] for the solar electricity are the main question. Most data sheets contain the efficiency of the PV modules only for standard test conditions (STC) in the laboratory. In reality higher module temperatures, lower irradiation G and a modified spectrum of the irradiation G change the standard test conditions efficiency. However, standard test conditions never appear at real live in Germany. In southern countries, which have more sun, the operation conditions differ much more from standard test conditions. Therefore, the effects on the annual energy yield are even bigger. To answer the question which PV technology gives the highest energy yield at specific climate conditions, this thesis set up thirteen PV systems using different technologies in Stuttgart, Nicosia, and Cairo. An extensive data acquisition is added to monitor weather and system data. Mono- and multicrystalline silicon (Si) as well as several thin film technologies like amorphous silicon, Cu(InGa)Se{sub 2} (CIGS), and CdTe are investigated. First the thesis extracts the temperature and low light behavior from the measured field data. At the end it models the PV systems to forecast the annual energy yield EJahr and compares with the measured values. The analysis of the field data reconfirms the better temperature behavior of the thin film technologies reported in literature. The HIT technology exhibits a better low light behavior, than the crystalline Si technologies, which all show a similar low light behavior. In the field the CIGS technology shows a contrary low light behavior compared to the laboratory. Field data show, that amorphous Si and CdTe technologies have a much better low light behavior than the crystalline Si technologies. The tolerances of the nominal power PSTC have the biggest influence

  3. Systems analysis support to the waste management technology center

    International Nuclear Information System (INIS)

    Rivera, A.L.; Osborne-Lee, I.W.; DePaoli, S.M.

    1988-01-01

    This paper describes a systems analysis concept being developed in support of waste management planning and analysis activities for Martin Marietta Energy Systems, Inc. (Energy Systems), sites. This integrated systems model serves as a focus for the accumulation and documentation of technical and economic information from current waste management practices, improved operations projects, remedial actions, and new system development activities. The approach is generic and could be applied to a larger group of sites. This integrated model is a source of technical support to waste management groups in the Energy Systems complex for integrated waste management planning and related technology assessment activities. This problem-solving methodology for low-level waste (LLW) management is being developed through the Waste Management Technology Center (WMTC) for the Low-Level Waste Disposal, Development, and Demonstration (LLWDDD) Program. In support of long-range planning activities, this capability will include the development of management support tools such as specialized systems models, data bases, and information systems. These management support tools will provide continuing support in the identification and definition of technical and economic uncertainties to be addressed by technology demonstration programs. Technical planning activities and current efforts in the development of this system analysis capability for the LLWDDD Program are presented in this paper

  4. Semi-annual report of Nuclear Technology and Development Center (CDTN) - July to December 1988

    International Nuclear Information System (INIS)

    1989-01-01

    The main activities developed by the several divisions of Nuclear Technology Development Center (CDTN) are described, including areas of reactor tecnologies, fuel cycle, materials and component, nuclear safety and tecnical substructure. (C.G.C.) [pt

  5. Examining Health Information Technology Implementations: Case of the Patient-Centered Medical Home

    Science.gov (United States)

    Behkami, Nima A.

    2012-01-01

    It has been shown that the use of Health Information Technology (HIT) is associated with reduced cost and increased quality of care. This dissertation examined the use of registries in Patient Centered Medical Home (PCMH) practices. A survey questionnaire was sent to a nationwide group of clinics certified for being a PCMH. They were asked to…

  6. Solid State Technology Branch of NASA Lewis Research Center: Fifth Annual Digest

    International Nuclear Information System (INIS)

    1993-08-01

    The digest is a collection of papers written by the members of the Solid State Technology Branch of NASA Lewis Research Center from June 1992-June 1993. The papers cover a range of topics relating to superconductivity, monolithic microwave integrated circuits (MMIC's), coplanar waveguide, and material characterization. Individual papers are abstracted separately on the data base

  7. The Research Results of Radioactive Waste Management Technology Center Year 1996/1997

    International Nuclear Information System (INIS)

    Budiman, P.; Martono, H.; Las, T.; Lubis, E.; Mulyanto; Wisnubroto, D. S.; Sucipta

    1997-12-01

    The research results of Radioactive Waste Management Technology Center, National Atomic Energy Agency of Indonesia year 1996/1997 contain paper as form of research results on radioactive waste management related fields. There were included many aspects such as radioactive waste processing, storage, decontamination, decommissioning, safety and environmental aspects. There are 24 papers and 12 short communications indexed individually(ID)

  8. The National Space Science and Technology Center's Education and Public Outreach Program

    Science.gov (United States)

    Cox, G. N.; Denson, R. L.

    2004-12-01

    The objective of the National Space Science and Technology Center's (NSSTC) Education and Public Outreach program (EPO) is to support K-20 education by coalescing academic, government, and business constituents awareness, implementing best business/education practices, and providing stewardship over funds and programs that promote a symbiotic relationship among these entities, specifically in the area of K-20 Science, Technology, Engineering, and Mathematics (STEM) education. NSSTC EPO Program's long-term objective is to showcase its effective community-based integrated stakeholder model in support of STEM education and to expand its influence across the Southeast region for scaling ultimately across the United States. The Education and Public Outreach program (EPO) is coordinated by a supporting arm of the NSSTC Administrative Council called the EPO Council (EPOC). The EPOC is funded through federal, state, and private grants, donations, and in-kind contributions. It is comprised of representatives of NSSTC Research Centers, both educators and scientists from the Alabama Space Science and Technology Alliance (SSTA) member institutions, the Alabama Space Grant Consortium and the NASA Marshall Space Flight Center's (MSFC) Education Office. Through its affiliation with MSFC and the SSTA - a consortium of Alabama's research universities that comprise the NSSTC, EPO fosters the education and development of the next generation of Alabama scientists and engineers by coordinating activities at the K-20 level in cooperation with the Alabama Department of Education, the Alabama Commission on Higher Education, and Alabama's businesses and industries. The EPO program's primary objective is to be Alabama's premiere organization in uniting academia, government, and private industry by way of providing its support to the State and Federal Departments of Education involved in systemic STEM education reform, workforce development, and innovative uses of technology. The NSSTC EPO

  9. Technology requirements to be addressed by the NASA Lewis Research Center Cryogenic Fluid Management Facility program

    Science.gov (United States)

    Aydelott, J. C.; Rudland, R. S.

    1985-01-01

    The NASA Lewis Research Center is responsible for the planning and execution of a scientific program which will provide advance in space cryogenic fluid management technology. A number of future space missions were identified that require or could benefit from this technology. These fluid management technology needs were prioritized and a shuttle attached reuseable test bed, the cryogenic fluid management facility (CFMF), is being designed to provide the experimental data necessary for the technology development effort.

  10. Assisted Reproductive Technology in Iran: The First National Report on Centers, 2011

    Directory of Open Access Journals (Sweden)

    Mehrandokht Abedini

    2016-09-01

    Full Text Available Background: Due to the worldwide increase in infertility, it is both necessary and important to have assisted reproductive technology (ART registries. In Iran, donation and surrogacy programs are approved by decrees from religious scholars. ART has been used since 1984 in Iran and the first Iranian infant conceived by gamete intra-fallopian transfer (GIFT was born in 1989. This report, however, is the first national report on Iranian ART centers. Materials and Methods: This cross-sectional study, conducted under the supervision of the Iranian Ministry of Health, presented a summary of the numbers and percentages of centers that provided infertility services in Iran, as well as the status of ART in Iran during 2011. Results: A total of 52 centers reported treatment cycles and performed approximately 29000 intrauterine insemination (IUI, in addition to 35000 in vitro fertilization (IVF and intra-cytoplasmic sperm injection (ICSI cycles. Conclusion: Iran has considerable potential to provide IVF services for both Iranians as well as other nationalities throughout the region. This proves the need for a national center that will implement a registry system.

  11. PTC test bed upgrades to provide ACSES testing support capabilities at transportation technology center.

    Science.gov (United States)

    2015-06-01

    FRA Task Order 314 upgraded the Positive Train Control (PTC) Test Bed at the Transportation Technology Center to support : testing of PTC systems, components, and related equipment associated with the Advanced Civil Speed Enforcement System : (ACSES)...

  12. Oklahoma State University proposed Advanced Technology Research Center. Environmental Assessment

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    The Department of Energy (DOE) has prepared an Environmental Assessment (EA) evaluating the construction and equipping of the proposed Advanced Technology Research Center (ATRC) at Oklahoma State University (OSU) in Stillwater, Oklahoma. Based on the analysis in the EA, the DOE has determined that the proposed action does not constitute a major federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act (NEPA) of 1969. Therefore, the preparation of an Environmental Impact Statement is not required.

  13. Robotic Technology Efforts at the NASA/Johnson Space Center

    Science.gov (United States)

    Diftler, Ron

    2017-01-01

    The NASA/Johnson Space Center has been developing robotic systems in support of space exploration for more than two decades. The goal of the Center’s Robotic Systems Technology Branch is to design and build hardware and software to assist astronauts in performing their mission. These systems include: rovers, humanoid robots, inspection devices and wearable robotics. Inspection systems provide external views of space vehicles to search for surface damage and also maneuver inside restricted areas to verify proper connections. New concepts in human and robotic rovers offer solutions for navigating difficult terrain expected in future planetary missions. An important objective for humanoid robots is to relieve the crew of “dull, dirty or dangerous” tasks allowing them more time to perform their important science and exploration missions. Wearable robotics one of the Center’s newest development areas can provide crew with low mass exercise capability and also augment an astronaut’s strength while wearing a space suit.This presentation will describe the robotic technology and prototypes developed at the Johnson Space Center that are the basis for future flight systems. An overview of inspection robots will show their operation on the ground and in-orbit. Rovers with independent wheel modules, crab steering, and active suspension are able to climb over large obstacles, and nimbly maneuver around others. Humanoid robots, including the First Humanoid Robot in Space: Robonaut 2, demonstrate capabilities that will lead to robotic caretakers for human habitats in space, and on Mars. The Center’s Wearable Robotics Lab supports work in assistive and sensing devices, including exoskeletons, force measuring shoes, and grasp assist gloves.

  14. Technologies in the patient-centered medical home: examining the model from an enterprise perspective.

    Science.gov (United States)

    Hughes, Cortney L; Marshall, Capt Robert; Murphy, Edward; Mun, Seong K

    2011-01-01

    Fee-for-service reimbursement has fragmented the healthcare system. Providers are paid based on the number of services rendered instead of quality, leading to the cost of care rising at a faster rate than its value. One approach to counter this is the Patient-Centered Medical Home (PCMH), a primary care model that emphasizes team-based medicine, a partnership between patients and providers, and expanded access and communication. The transition to PCMH is facilitated by innovative technologies, such as telemedicine for additional services, electronic medical records to document patients' health needs, and online portals for electronic visits and communication between patients and providers. Implementing these technologies involves tremendous investment of funds and time from practices and healthcare organizations. Although PCMH does not require such technologies, they facilitate its success, as care coordination and population management necessitated by the model are difficult to do without. This article argues that there is a paradox in PCMH and technology is at its center. Although PCMH intends to be cost effective by reducing hospital admissions and ER visits through providing better preventative services, it is actually a financial risk due to the very real upfront costs of implementing and sustaining technologies needed to carry out the intent of the PCMH model, which may not be made up immediately, if ever. This article delves into the rationale behind why payers, providers, and patients have adopted PCMH regardless of this risk and in doing so, maps out the roles that innovative technologies play in the conversion to PCMH.

  15. Influences of tropical-extratropical interaction on the multidecadal AMOC variability in the NCEP climate forecast system

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Bohua; Schneider, Edwin K.; Klinger, Barry [Gorge Mason University, Department of Atmospheric, Oceanic, and Earth Sciences, College of Science, Fairfax, VA (United States); Institute of Global Environment and Society, Center for Ocean-Land-Atmosphere Studies, Calverton, MD (United States); Hu, Zeng-Zhen; Xue, Yan [National Centers for Environmental Prediction/NOAA, Climate Prediction Center, Camp Springs, MD (United States); Wu, Zhaohua [Florida State University, Department of Earth, Ocean, and Atmospheric Science, Center for Ocean-Atmospheric Prediction Studies, Tallahassee, FL (United States)

    2012-08-15

    We have examined the mechanisms of a multidecadal oscillation of the Atlantic Meridional Overturning Circulation (AMOC) in a 335-year simulation of the Climate Forecast System (CFS), the climate prediction model developed at the National Centers for Environmental Prediction (NCEP). Both the mean and seasonal cycle of the AMOC in the CFS are generally consistent with observation-based estimates with a maximum northward volume transport of 16 Sv (10{sup 6} m{sup 3}/s) near 35 N at 1.2 km. The annual mean AMOC shows an intermittent quasi 30-year oscillation. Its dominant structure includes a deep anomalous overturning cell (referred to as the anomalous AMOC) with amplitude of 0.6 Sv near 35 N and an anomalous subtropical cell (STC) of shallow overturning spanning across the equator. The mechanism for the oscillation includes a positive feedback between the anomalous AMOC and surface wind stress anomalies in mid-latitudes and a negative feedback between the anomalous STC and AMOC. A strong AMOC is associated with warm sea surface temperature anomaly (SSTA) centered near 45 N, which generates an anticyclonic easterly surface wind anomaly. This anticyclonic wind anomaly enhances the regional downwelling and reinforces the anomalous AMOC. In the mean time, a wind-evaporation-SST (WES) feedback extends the warm SSTA to the tropics and induces a cyclonic wind stress anomaly there, which drives a tropical upwelling and weakens the STC north of the equator. The STC anomaly, in turn, drives a cold upper ocean heat content anomaly (HCA) in the northern tropical Atlantic and weakens the meridional heat transport from the tropics to the mid-latitude through an anomalous southward western boundary current. The anomalous STC transports cold HCA from the subtropics to the mid-latitudes, weakening the mid-latitude deep overturning. (orig.)

  16. Preliminary test results from a free-piston Stirling engine technology demonstration program to support advanced radioisotope space power applications

    International Nuclear Information System (INIS)

    White, Maurice A.; Qiu Songgang; Augenblick, Jack E.

    2000-01-01

    Free-piston Stirling engines offer a relatively mature, proven, long-life technology that is well-suited for advanced, high-efficiency radioisotope space power systems. Contracts from DOE and NASA are being conducted by Stirling Technology Company (STC) for the purpose of demonstrating the Stirling technology in a configuration and power level that is representative of an eventual space power system. The long-term objective is to develop a power system with an efficiency exceeding 20% that can function with a high degree of reliability for up to 15 years on deep space missions. The current technology demonstration convertors (TDC's) are completing shakedown testing and have recently demonstrated performance levels that are virtually identical to projections made during the preliminary design phase. This paper describes preliminary test results for power output, efficiency, and vibration levels. These early results demonstrate the ability of the free-piston Stirling technology to exceed objectives by approximately quadrupling the efficiency of conventional radioisotope thermoelectric generators (RTG's)

  17. Preliminary test results from a free-piston Stirling engine technology demonstration program to support advanced radioisotope space power applications

    Science.gov (United States)

    White, Maurice A.; Qiu, Songgang; Augenblick, Jack E.

    2000-01-01

    Free-piston Stirling engines offer a relatively mature, proven, long-life technology that is well-suited for advanced, high-efficiency radioisotope space power systems. Contracts from DOE and NASA are being conducted by Stirling Technology Company (STC) for the purpose of demonstrating the Stirling technology in a configuration and power level that is representative of an eventual space power system. The long-term objective is to develop a power system with an efficiency exceeding 20% that can function with a high degree of reliability for up to 15 years on deep space missions. The current technology demonstration convertors (TDC's) are completing shakedown testing and have recently demonstrated performance levels that are virtually identical to projections made during the preliminary design phase. This paper describes preliminary test results for power output, efficiency, and vibration levels. These early results demonstrate the ability of the free-piston Stirling technology to exceed objectives by approximately quadrupling the efficiency of conventional radioisotope thermoelectric generators (RTG's). .

  18. Armstrong Flight Research Center Research Technology and Engineering 2017

    Science.gov (United States)

    Voracek, David F. (Editor)

    2018-01-01

    I am delighted to present this report of accomplishments at NASA's Armstrong Flight Research Center. Our dedicated innovators possess a wealth of performance, safety, and technical capabilities spanning a wide variety of research areas involving aircraft, electronic sensors, instrumentation, environmental and earth science, celestial observations, and much more. They not only perform tasks necessary to safely and successfully accomplish Armstrong's flight research and test missions but also support NASA missions across the entire Agency. Armstrong's project teams have successfully accomplished many of the nation's most complex flight research projects by crafting creative solutions that advance emerging technologies from concept development and experimental formulation to final testing. We are developing and refining technologies for ultra-efficient aircraft, electric propulsion vehicles, a low boom flight demonstrator, air launch systems, and experimental x-planes, to name a few. Additionally, with our unique location and airborne research laboratories, we are testing and validating new research concepts. Summaries of each project highlighting key results and benefits of the effort are provided in the following pages. Technology areas for the projects include electric propulsion, vehicle efficiency, supersonics, space and hypersonics, autonomous systems, flight and ground experimental test technologies, and much more. Additional technical information is available in the appendix, as well as contact information for the Principal Investigator of each project. I am proud of the work we do here at Armstrong and am pleased to share these details with you. We welcome opportunities for partnership and collaboration, so please contact us to learn more about these cutting-edge innovations and how they might align with your needs.

  19. Establishing and evaluating bar-code technology in blood sampling system: a model based on human centered human-centered design method.

    Science.gov (United States)

    Chou, Shin-Shang; Yan, Hsiu-Fang; Huang, Hsiu-Ya; Tseng, Kuan-Jui; Kuo, Shu-Chen

    2012-01-01

    This study intended to use a human-centered design study method to develop a bar-code technology in blood sampling process. By using the multilevel analysis to gather the information, the bar-code technology has been constructed to identify the patient's identification, simplify the work process, and prevent medical error rates. A Technology Acceptance Model questionnaire was developed to assess the effectiveness of system and the data of patient's identification and sample errors were collected daily. The average scores of 8 items users' perceived ease of use was 25.21(3.72), 9 items users' perceived usefulness was 28.53(5.00), and 14 items task-technology fit was 52.24(7.09), the rate of patient identification error and samples with order cancelled were down to zero, however, new errors were generated after the new system deployed; which were the position of barcode stickers on the sample tubes. Overall, more than half of nurses (62.5%) were willing to use the new system.

  20. 76 FR 59166 - Navistar Truck Development and Technology Center, a Subsidiary of Navistar International...

    Science.gov (United States)

    2011-09-23

    ... Development and Technology Center, a Subsidiary of Navistar International Corporation Truck Division, Fort... International Corporation, Truck Division, Fort Wayne, Indiana (subject firm). The negative determination was... is a headcount reduction across the nation, made possible by the Global Outsourcing. * * * '' The...

  1. Search Technologies | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Our team of technology transfer specialists has specialized training in invention reporting, patenting, patent strategy, executing technology transfer agreements and marketing. TTC is comprised of professionals with diverse legal, scientific, and business/marketing expertise. Most of our staff hold doctorate-level technical and/or legal training.

  2. Available Technologies | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Our team of technology transfer specialists has specialized training in invention reporting, patenting, patent strategy, executing technology transfer agreements and marketing. TTC is comprised of professionals with diverse legal, scientific, and business/marketing expertise. Most of our staff hold doctorate-level technical and/or legal training.

  3. HEMISPHERIC CENTER FOR ENVIRONMENTAL TECHNOLOGY

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian

    1999-01-31

    FIU-HCET participated in an ICT meeting at Mound during the second week of December and presented a brief videotape of the testing of the Robotic Climber technology. During this meeting, FIU-HCET proposed the TechXtract technology for possible testing at Mound and agreed to develop a five-page proposal for review by team members. FIU-HCET provided assistance to Bartlett Inc. and General Lasertronics Corporation in developing a proposal for a Program Opportunity Notice (PON). The proposal was submitted by these companies on January 5, 1999. The search for new equipment dismantlement technologies is continuing. The following vendors have responded to requests for demonstration: LUMONICS, Laser Solutions technology; CRYO-BEAM, Cryogenic cutting technology; Waterjet Technology Association, Waterjet Cutting technology; and DIAJET, Waterjet Cutting technology. Based on the tasks done in FY98, FIU-HCET is working closely with Numatec Hanford Corporation (NHC) and Pacific Northwest National Laboratory (PNNL) to revise the plan and scope of work of the pipeline plugging project in FY99, which involves activities of lab-scale flow loop experiments and a large-scale demonstration test bed.

  4. HEMISPHERIC CENTER FOR ENVIRONMENTAL TECHNOLOGY

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian

    1999-04-30

    The final data package has been completed for the Mississippi State University, DIAL FTP Wall Depth Removal Characterization Technology. The package has been sent to DIAL for comments. Work is progressing on completing the transfer of glove boxes and tanks from Rocky Flats to FIU-HCET for the purpose of performing size reduction technology assessments. Vendors are being identified and security measures are being put in place to meet the High Risk Property criteria required by Rocky Flats. The FIU-HCET Technology Assessment Program has been included as one of 11 verification programs across the US and Canada described in the Interstate Technology Regulatory Cooperation (ITRC) document, ''Multi-state Evaluation of Elements Important to the Verification of Remediation Technologies'', dated January 1999. FIU-HCET will also participate in a panel discussion on technology verification programs at the International Environmental Technology Expo '99.

  5. Education, Technology, and Media: A Peak into My Summer Internship at NASA Glenn Research Center in Cleveland, Ohio

    Science.gov (United States)

    Moon, James

    2004-01-01

    My name is James Moon and I am a senor at Tennessee State University where my major is Aeronautical and Industrial Technology with a concentration in industrial electronics. I am currently serving my internship in the Engineering and Technical Services Directorate at the Glenn Research Center (GRC). The Engineering and Technical Service Directorate provides the services and infrastructure for the Glenn Research Center to take research concepts to reality. They provide a full range of integrated services including engineering, advanced prototyping and testing, facility management, and information technology for NASA, industry, and academia. Engineering and Technical Services contains the core knowledge in Information Technology (IT). This includes data systems and analysis, inter and intranet based systems design and data security. Including the design and development of embedded real-time sohare applications for flight and supporting ground systems, Engineering and Technical Services provide a wide range of IT services and products specific to the Glenn Research Center research and engineering community.

  6. Research on fabrication of aspheres at the Center of Optics Technology (University of Applied Science in Aalen); Techical Digest

    Science.gov (United States)

    Boerret, Rainer; Burger, Jochen; Bich, Andreas; Gall, Christoph; Hellmuth, Thomas

    2005-05-01

    The Center of Optics Technology at the University of Applied Science, founded in 2003, is part of the School of Optics and Mechatronics. It completes the existing optical engineering department with a full optical fabrication and metrology chain and serves in parallel as a technology transfer center, to provide area industries with the most up-to-date technology in optical fabrication and engineering. Two examples of research work will be presented. The first example is the optimizing of the grinding process for high precision aspheres, the other is generating and polishing of a freeform optical element which is used as a phase plate.

  7. Continuing Development for Free-Piston Stirling Space Power Systems

    Science.gov (United States)

    Peterson, Allen A.; Qiu, Songgang; Redinger, Darin L.; Augenblick, John E.; Petersen, Stephen L.

    2004-02-01

    Long-life radioisotope power generators based on free-piston Stirling engines are an energy-conversion solution for future space applications. The high efficiency of Stirling machines makes them more attractive than the thermoelectric generators currently used in space. Stirling Technology Company (STC) has been developing free-piston Stirling machines for over 30 years, and its family of Stirling generators is ideally suited for reliable, maintenance-free operation. This paper describes recent progress and status of the STC RemoteGen™ 55 W-class Stirling generator (RG-55), presents an overview of recent testing, and discusses how the technology demonstration design has evolved toward space-qualified hardware.

  8. Massachusetts Institute of Technology Plasma Fusion Center 1987--1988 report to the President

    International Nuclear Information System (INIS)

    1988-06-01

    During the past year, technical progress has been made in all Plasma Fusion Center (PFC) research programs. The Plasma Fusion Center is recognized as one of the leading university research laboratories in the physics and engineering aspects of magnetic confinement fusion. Its research programs have produced significant results on several fronts: the basic physics of high-temperature plasmas (plasmas theory, RF heating, free electron lasers, development of advanced diagnostics, and intermediate-scale experiments on the Versator tokamak and Constance mirror devices), major confinement results on the Alcator C tokamak, including pioneering investigations of the stability, heating, and confinement properties of plasmas at high densities, temperatures and magnetic fields, experiments on the medium-scale TARA tandem mirror, including the development of novel MHD stabilization techniques in axisymmetric geometry, and a broad program of fusion technology and engineering development that addresses problems in several critical subsystem areas (e.g., magnet systems, superconducting materials development, environmental and safety studies, advanced millimeter-wave source development, and system studies of fusion reactor design, operation, and technology requirements

  9. The Use of DOE Technologies at The World Trade Center Incident: Lessons Learned

    Energy Technology Data Exchange (ETDEWEB)

    McCabe, B.; Kovach, J.; Carpenter, C.; Blair, D.

    2003-02-25

    In response to the attack of the World Trade Center (WTC) on September 11, 2001, the International Union of Operating Engineers (IUOE) National Hazmat Program (OENHP) assembled and deployed a HAZMAT Emergency Management Team (Team) to the disaster site (Site). The response team consisted of a Certified Industrial Hygienist and a rotating team of industrial hygienists, safety professionals, and certified HAZMAT instructors. Through research funded by the Department of Energy (DOE) Office of Environmental Management (EM) and managed by the National Energy Technology Laboratory (NETL), the IUOE conducted human factors assessments on baseline and innovative technologies during real-world conditions and served as an advocate at the WTC disaster site to identify opportunities for the use and evaluation of DOE technologies. From this work, it is clear that opportunities exist for more DOE technologies to be made readily available for use in future emergencies.

  10. The Use of DOE Technologies at The World Trade Center Incident: Lessons Learned

    International Nuclear Information System (INIS)

    McCabe, B.; Kovach, J.; Carpenter, C.; Blair, D.

    2003-01-01

    In response to the attack of the World Trade Center (WTC) on September 11, 2001, the International Union of Operating Engineers (IUOE) National Hazmat Program (OENHP) assembled and deployed a HAZMAT Emergency Management Team (Team) to the disaster site (Site). The response team consisted of a Certified Industrial Hygienist and a rotating team of industrial hygienists, safety professionals, and certified HAZMAT instructors. Through research funded by the Department of Energy (DOE) Office of Environmental Management (EM) and managed by the National Energy Technology Laboratory (NETL), the IUOE conducted human factors assessments on baseline and innovative technologies during real-world conditions and served as an advocate at the WTC disaster site to identify opportunities for the use and evaluation of DOE technologies. From this work, it is clear that opportunities exist for more DOE technologies to be made readily available for use in future emergencies

  11. Importance of the documentation of the manual of quality and procedures handbook in the nuclear technology center

    International Nuclear Information System (INIS)

    Domech More, J.; Bolanos Hernandez, R.; Quitero Rosello, R.; Fernandez Rondon, M.; Milian Lorenzo, D.; Rodriguez Gual, M.

    1997-01-01

    In the present work is presented the methodology used for the elaboration of manual of quality of the Nuclear Technology Center and the technical Procedures Handbook for the execution of Preliminary Safety report of the Juragua Nuclear Power Plant, as well as the importance that has this documentation for the work of the center

  12. Technical Data Management Center: a focal point for meteorological and other environmental transport computing technology

    International Nuclear Information System (INIS)

    McGill, B.; Maskewitz, B.F.; Trubey, D.K.

    1981-01-01

    The Technical Data Management Center, collecting, packaging, analyzing, and distributing information, computer technology and data which includes meteorological and other environmental transport work is located at the Oak Ridge National Laboratory, within the Engineering Physics Division. Major activities include maintaining a collection of computing technology and associated literature citations to provide capabilities for meteorological and environmental work. Details of the activities on behalf of TDMC's sponsoring agency, the US Nuclear Regulatory Commission, are described

  13. Contributions to nuclear safety and radiation technologies in Ukraine by the Science and Technology Center in Ukraine (STCU)

    International Nuclear Information System (INIS)

    Taranenko, L.; Janouch, F.; Owsiacki, L.

    2001-01-01

    This paper presents Science and Technology Center in Ukraine (STCU) activities devoted to furthering nuclear and radiation safety, which is a prioritized STCU area. The STCU, an intergovernmental organization with the principle objective of non-proliferation, administers financial support from the USA, Canada, and the EU to Ukrainian projects in various scientific and technological areas; coordinates projects; and promotes the integration of Ukrainian scientists into the international scientific community, including involving western collaborators. The paper focuses on STCU's largest project to date 'Program Supporting Y2K Readiness at Ukrainian NPPs' initiated in April 1999 and designed to address possible Y2K readiness problems at 14 Ukrainian nuclear reactors. Other presented projects demonstrate a wide diversity of supported directions in the fields of nuclear and radiation safety, including reactor material improvement ('Improved Zirconium-Based Elements for Nuclear Reactors'), information technologies for nuclear industries ('Ukrainian Nuclear Data Bank in Slavutich'), and radiation health science ('Diagnostics and Treatment of Radiation-Induced Injuries of Human Biopolymers').

  14. Have "new" methods in medical education reached German-speaking Central Europe: a survey.

    Science.gov (United States)

    Fandler, Martin; Habersack, Marion; Dimai, Hans P

    2014-08-16

    Simulation-based-training (SBT) in the education of health professionals is discussed as an effective alternative for knowledge and skills enhancement as well as for the establishment of a secure learning environment, for learners and patients. In the Anglo-American region, SBT and simulation and training centers (STC) are numbered as standard for medical training. In German-speaking Central Europe, priority is still given to the establishment of SBT and STC. The purpose of this study was (i) to survey the status quo relating to the existence and facilities of simulation and training centers at medical universities in German-speaking Central Europe and (ii) the evaluation of training methods, especially in the area of emergency medicine skills. All public and private medical universities or medical faculties in Germany (36), Austria (4) and German-speaking Switzerland (3) were interviewed. In the survey, information regarding the existence and facilities of STCs and information with regards to the use of SBT in the area of emergency medicine was requested. The questions were partly posed in a closed-ended-, in an open-ended- and in a multiple choice format (with the possibility of selecting more than one answer). Of a total of 43 contacted medical universities/medical faculties, 40 ultimately participated in the survey. As decisive for the establishment of a STC the potential to improve the clinical-practical training and the demand by students were listed. Obligatory training in a STC during the first and sixth academic year was confirmed only by 12 institutions, before the first invasive procedure on patients by 17 institutions. 13 institutions confirmed the use of the STC for the further training of physicians and care-staff. Training for the acute care and emergency medicine skills in the field of pediatrics, for the most part, occurs decentralized. New methods in medical training have reached German-speaking Central Europe, but the simulation and training

  15. Decommissioning and environmental restoration of nuclear facilities in China

    International Nuclear Information System (INIS)

    Pan Ziqiang

    2000-01-01

    In the beginning of the 1980s, the Scientific and Technological Commission (STC) began the study on the environmental impact of the nuclear industry in China. At the end of the 1980s, the STC initiated the study on the decommissioning of nuclear facilities and environmental restoration. In 1989 the STC completed the project entitled ''Radiological and Environmental Quality Assessment of the Nuclear Industry in China Over the Past Thirty Years''. The status of the environmental pollution of various nuclear facility sites was subsequently analysed. In 1994, the decommissioning and environmental restoration of the first research and manufacture complex for nuclear weapons was completed. The complex is now accessible to the public without restriction and the site has become a town. Some nuclear related facilities, such as uranium mines, are currently being decommissioned. Although uranium mining and milling has a more serious impact on the environment, the technology for decommissioning and environmental restoration in mining and milling installations is not much more complicated than that used for reactor and reprocessing facilities: much has been achieved in the area of mining and milling. (author)

  16. A Review of User-Centered Design for Diabetes-Related Consumer Health Informatics Technologies

    Science.gov (United States)

    LeRouge, Cynthia; Wickramasinghe, Nilmini

    2013-01-01

    User-centered design (UCD) is well recognized as an effective human factor engineering strategy for designing ease of use in the total customer experience with products and information technology that has been applied specifically to health care information technology systems. We conducted a literature review to analyze the current research regarding the use of UCD methods and principles to support the development or evaluation of diabetes-related consumer health informatics technology (CHIT) initiatives. Findings indicate that (1) UCD activities have been applied across the technology development life cycle stages, (2) there are benefits to incorporating UCD to better inform CHIT development in this area, and (3) the degree of adoption of the UCD process is quite uneven across diabetes CHIT studies. In addition, few to no studies report on methods used across all phases of the life cycle with process detail. To address that void, the Appendix provides an illustrative case study example of UCD techniques across development stages. PMID:23911188

  17. [Medical equipment companies and their ties with technology development centers in Mexico].

    Science.gov (United States)

    Hernández, B; Arredondo, A; Cruz, C; Sánchez, E; Damián, T

    1993-10-01

    The purpose of this study was to determine the characteristics of the companies that produce, distribute, and service medical equipment in Mexico and the factors related to whether or not they had established ties with research and technology development centers. The data analyzed came from a survey of such companies carried out in Mexico City and environs in 1989. The information was updated in 1991. Multivariate analyses were carried out in order to identify the characteristics of companies that had established ties or wished to do so and the areas of interest of those companies. Of 208 companies surveyed, only 23% had ties with research centers. The companies that had such ties or were interested in establishing them tended to invest in research and to have made plans for expansion. The establishment of ties appeared to be a two-way process, with positive consequences for the companies involved, the research centers, and the health sector. It was concluded that it would be advantageous to design programs to promote ties with companies having the characteristics mentioned.

  18. Center for Technology for Advanced Scientific Component Software (TASCS)

    Energy Technology Data Exchange (ETDEWEB)

    Damevski, Kostadin [Virginia State Univ., Petersburg, VA (United States)

    2009-03-30

    A resounding success of the Scientific Discover through Advanced Computing (SciDAC) program is that high-performance computational science is now universally recognized as a critical aspect of scientific discovery [71], complementing both theoretical and experimental research. As scientific communities prepare to exploit unprecedened computing capabilities of emerging leadership-class machines for multi-model simulations at the extreme scale [72], it is more important than ever to address the technical and social challenges of geographically distributed teams that combine expertise in domain science, applied mathematics, and computer science to build robust and flexible codes that can incorporate changes over time. The Center for Technology for Advanced Scientific Component Software (TASCS) tackles these issues by exploiting component-based software development to facilitate collaborative hig-performance scientific computing.

  19. Institutional overviews. Overview of the JAEA and the Nuclear Nonproliferation Science and Technology Center

    International Nuclear Information System (INIS)

    Senzaki, Masao

    2006-01-01

    The Nuclear Nonproliferation Science and Technology Center (NPSTC) was formed within the new Japan Atomic Energy Agency (JAEA) to carry out safeguards and material control duties for the JAEA. Development of technologies and procedures for safeguards is an important duty. In addition, the new NPSTC will assume a 'think tank' role in support of the nonproliferation regime, help train nonproliferation experts, and cooperate with academic, government and non-governmental organizations on nonproliferation issues. This report briefly summarizes the formation of the JAEA and describes the duties and structure of the NPSTC in detail. (author)

  20. Artificial pinning center technology to enhance vortex pinning in YBCO coated conductors

    International Nuclear Information System (INIS)

    Matsumoto, Kaname; Mele, Paolo

    2010-01-01

    Crystalline defects on the nano-scale, which are called artificial pinning centers (APCs), were successfully introduced into high-temperature superconductors (HTS) by nanotechnology, in order to strongly pin the quantized vortices. The critical current densities, J c , of the HTS films were dramatically improved by APCs. It is possible to form APCs in high-quality epitaxial films, keeping the desired dimensionality, volume fraction, spatial distribution and so on. The in-field J c of HTS films at 77 K was improved by one order of magnitude compared with previous values using APCs. This technology can be applied to the coated conductor technology in progress, and a high J c has already been reported. A current outline of the research is described in this review.

  1. Massachusetts Institute of Technology, Plasma Fusion Center, 1984-1985. Report to the President

    International Nuclear Information System (INIS)

    1985-07-01

    During the past year, technical progress has been made in all Plasma Fusion Center (PFC) research programs. The Plasma Fusion Center is recognized as one of the leading university research laboratories in the physics and engineering aspects of magnetic confinement fusion. Its research programs have produced significant results on four fronts: (1) the basic physics of high-temperature plasmas (plasma theory, rf heating, free electron lasers, development of advanced diagnostics and small-scale experiments on the Versator tokamak and Constance mirror devices); (2) major confinement results on the Alcator C tokamak, including pioneering investigations of the stability, heating, and confinement properties of plasmas at high densities, temperatures and magnetic fields; (3) development of an innovative design for axisymmetric tandem mirrors with inboard thermal barriers, with initial operation of the TARA tandem mirror experiment beginning in 1984; and (4) a broad program of fusion technology and engineering development that addresses problems in several critical subsystem areas (e.g., magnet systems, superconducting materials development, environmental and safety studies, advanced millimeter wave source development, and system studies of fusion reactor design, operation, and technology requirements). A review of these programs is given

  2. Space Technology Demonstrations Using Low Cost, Short-Schedule Airborne and Range Facilities at the Dryden Flight Research Center

    Science.gov (United States)

    Carter, John; Kelly, John; Jones, Dan; Lee, James

    2013-01-01

    There is a national effort to expedite advanced space technologies on new space systems for both government and commercial applications. In order to lower risk, these technologies should be demonstrated in a relevant environment before being installed in new space systems. This presentation introduces several low cost, short schedule space technology demonstrations using airborne and range facilities available at the Dryden Flight Research Center.

  3. Feasibility Demonstration of a Multi-Cylinder Stirling Convertor with a Duplex Linear Alternator, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Stirling Technology Company (STC) proposes to integrate an existing Multi-Cylinder Free-Piston Stirling Engine (MPFPSE) with innovative compact linear alternators....

  4. Mode 2 in action. Working across sectors to create a Center for Humanities and Technology

    NARCIS (Netherlands)

    Wyatt, S.M.E.

    2015-01-01

    This article examines recent developments in Amsterdam to establish a Center for Humanities and Technology (CHAT). The project is a collaboration between public research institutions and a private partner. To date, a White Paper has been produced that sets out a shared research agenda addressing

  5. Development and Implementation of the Midwest Geological Sequestration Consortium CO2-Technology Transfer Center

    Energy Technology Data Exchange (ETDEWEB)

    Greenberg, Sallie E. [Univ. of Illinois, Champaign, IL (United States)

    2015-06-30

    In 2009, the Illinois State Geological Survey (ISGS), in collaboration with the Midwest Geological Sequestration Consortium (MGSC), created a regional technology training center to disseminate carbon capture and sequestration (CCS) technology gained through leadership and participation in regional carbon sequestration projects. This technology training center was titled and branded as the Sequestration Training and Education Program (STEP). Over the last six years STEP has provided local, regional, national, and international education and training opportunities for engineers, geologists, service providers, regulators, executives, K-12 students, K-12 educators, undergraduate students, graduate students, university and community college faculty members, and participants of community programs and functions, community organizations, and others. The goal for STEP educational programs has been on knowledge sharing and capacity building to stimulate economic recovery and development by training personnel for commercial CCS projects. STEP has worked with local, national and international professional organizations and regional experts to leverage existing training opportunities and provide stand-alone training. This report gives detailed information on STEP activities during the grant period (2009-2015).

  6. Short-term capture of the Earth-Moon system

    Science.gov (United States)

    Qi, Yi; de Ruiter, Anton

    2018-06-01

    In this paper, the short-term capture (STC) of an asteroid in the Earth-Moon system is proposed and investigated. First, the space condition of STC is analysed and five subsets of the feasible region are defined and discussed. Then, the time condition of STC is studied by parameter scanning in the Sun-Earth-Moon-asteroid restricted four-body problem. Numerical results indicate that there is a clear association between the distributions of the time probability of STC and the five subsets. Next, the influence of the Jacobi constant on STC is examined using the space and time probabilities of STC. Combining the space and time probabilities of STC, we propose a STC index to evaluate the probability of STC comprehensively. Finally, three potential STC asteroids are found and analysed.

  7. Contributions to nuclear safety and radiation technologies in Ukraine by the Science and Technology Center in Ukraine (STCU)

    Energy Technology Data Exchange (ETDEWEB)

    Taranenko, L. E-mail: lyubov@stcu.kiev.ua; Janouch, F.; Owsiacki, L

    2001-06-01

    This paper presents Science and Technology Center in Ukraine (STCU) activities devoted to furthering nuclear and radiation safety, which is a prioritized STCU area. The STCU, an intergovernmental organization with the principle objective of non-proliferation, administers financial support from the USA, Canada, and the EU to Ukrainian projects in various scientific and technological areas; coordinates projects; and promotes the integration of Ukrainian scientists into the international scientific community, including involving western collaborators. The paper focuses on STCU's largest project to date 'Program Supporting Y2K Readiness at Ukrainian NPPs' initiated in April 1999 and designed to address possible Y2K readiness problems at 14 Ukrainian nuclear reactors. Other presented projects demonstrate a wide diversity of supported directions in the fields of nuclear and radiation safety, including reactor material improvement ('Improved Zirconium-Based Elements for Nuclear Reactors'), information technologies for nuclear industries ('Ukrainian Nuclear Data Bank in Slavutich'), and radiation health science ('Diagnostics and Treatment of Radiation-Induced Injuries of Human Biopolymers')

  8. 77 FR 5580 - Notice of Intent To Seek Approval To Extend an Information Collection

    Science.gov (United States)

    2012-02-03

    ... society. STCs enable and foster excellent education, integrate research and education, and create bonds... activities; descriptions of significant advances and other outcomes of the STC effort. Part of this reporting..., electronic, mechanical, or other technological collection techniques or other forms of information technology...

  9. Status of an advanced radioisotope space power system using free-piston Stirling technology

    International Nuclear Information System (INIS)

    White, M.A.; Qiu, S.; Erbeznik, R.M.; Olan, R.W.; Welty, S.C.

    1998-01-01

    This paper describes a free-piston Stirling engine technology project to demonstrate a high efficiency power system capable of being further developed for deep space missions using a radioisotope (RI) heat source. The key objective is to develop a power system with an efficiency exceeding 20% that can function with a high degree of reliability for 10 years or longer on deep space missions. Primary issues being addressed for Stirling space power systems are weight and the vibration associated with reciprocating pistons. Similar weight and vibration issues have been successfully addressed with Stirling cryocoolers, which are the accepted standard for cryogenic cooling in space. Integrated long-life Stirling engine-generator (or convertor) operation has been demonstrated by the terrestrial Radioisotope Stirling Generator (RSG) and other Stirling Technology Company (STC) programs. Extensive RSG endurance testing includes more than 40,000 maintenance-free, degradation-free hours for the complete convertor, in addition to several critical component and subsystem endurance tests. The Stirling space power convertor project is being conducted by STC under DOE Contract, and NASA SBIR Phase II contracts. The DOE contract objective is to demonstrate a two-convertor module that represents half of a nominal 150-W(e) power system. Each convertor is referred to as a Technology Demonstration Convertor (TDC). The ultimate Stirling power system would be fueled by three general purpose heat source (GPHS) modules, and is projected to produce substantially more electric power than the 150-watt target. The system is capable of full power output with one failed convertor. One NASA contract, nearing completion, uses existing 350-W(e) RG-350 convertors to evaluate interactivity of two back-to-back balanced convertors with various degrees of electrical and mechanical interaction. This effort has recently provided the first successful synchronization of two convertors by means of parallel

  10. KBTAC: EPRI's center to assist the nuclear industry to apply the knowledge-based technology

    International Nuclear Information System (INIS)

    Lin, Chinglu; Naser, J.A.; Sun, B.K.H.

    1993-01-01

    The nuclear utility industry's complex engineering and procedure systems offer many opportunities for use of the knowledge-based technology such as expert systems and neural networks. The ability of expert systems to enhance human experts makes them an important tool in the areas of engineering, operations and maintenance. However, many current industry applications are research projects or turnkey systems supplied by vendors. These often do not impart to utility technical staff a clear understanding of the capabilities of knowledge-based systems (KBS). More importantly, simply using completed applications does not meet utilities' need to acquire the capabilities to build their own knowledge-based systems. Thus, EPRI is supporting its member utilities utilization of knowledge-based technology for power plant engineering, operations, and maintenance applications through the establishment of the Knowledge-Based Technology Application Center (KBTAC)

  11. Technology Transfer Challenges: A Case Study of User-Centered Design in NASA's Systems Engineering Culture

    Science.gov (United States)

    Quick, Jason

    2009-01-01

    The Upper Stage (US) section of the National Aeronautics and Space Administration's (NASA) Ares I rocket will require internal access platforms for maintenance tasks performed by humans inside the vehicle. Tasks will occur during expensive critical path operations at Kennedy Space Center (KSC) including vehicle stacking and launch preparation activities. Platforms must be translated through a small human access hatch, installed in an enclosed worksite environment, support the weight of ground operators and be removed before flight - and their design must minimize additional vehicle mass at attachment points. This paper describes the application of a user-centered conceptual design process and the unique challenges encountered within NASA's systems engineering culture focused on requirements and "heritage hardware". The NASA design team at Marshall Space Flight Center (MSFC) initiated the user-centered design process by studying heritage internal access kits and proposing new design concepts during brainstorming sessions. Simultaneously, they partnered with the Technology Transfer/Innovative Partnerships Program to research inflatable structures and dynamic scaffolding solutions that could enable ground operator access. While this creative, technology-oriented exploration was encouraged by upper management, some design stakeholders consistently opposed ideas utilizing novel, untested equipment. Subsequent collaboration with an engineering consulting firm improved the technical credibility of several options, however, there was continued resistance from team members focused on meeting system requirements with pre-certified hardware. After a six-month idea-generating phase, an intensive six-week effort produced viable design concepts that justified additional vehicle mass while optimizing the human factors of platform installation and use. Although these selected final concepts closely resemble heritage internal access platforms, challenges from the application of the

  12. Status update of a free-piston Stirling convertor for radioisotope space power systems

    International Nuclear Information System (INIS)

    White, Maurice; Qiu Songgang; Augenblick, Jack; Peterson, Allen; Faultersack, Frank

    2001-01-01

    Free-piston Stirling engines offer a relatively mature technology that is well-suited for advanced, high-efficiency radioisotope space power systems. This paper updates results from a combination of DOE and NASA contracts with Stirling Technology Company (STC). These contracts have demonstrated STC's Stirling convertor technology in a configuration and power level representative of a space power system. Based on demonstrated performance, long-life maintenance-free technology heritage, and success with aggressively imposed vibration testing. DOE has awarded system integration contracts to Boeing, Lockheed Martin and Teledyne Energy Systems. The objectives of these competitive Phase I contracts are to develop complete spacecraft power system conceptual designs based on the STC Stirling convertor, and to plan subsequent phases for two launches. Performance results for the DOE 55-W(e) Technology Demonstration Convertors (TDC's) have met original projections. Although the TDC's were intended only for technology demonstration, they have achieved very aggressive efficiency goals, demonstrated convertor-induced vibration levels below the Jet Propulsion Laboratory (JPL) specifications, passed a simulated launch load vibration test at 0.2 g2/Hz (12.3 g rms), and met EMI/EMC goals for most contemplated missions. No consideration for EMI reduction was included in the TDC design. Minor changes are underway to reduce EMI levels, with a goal of meeting specifications for missions such as Solar Probe with highly sensitive instrumentation. The long-term objective for DOE is to develop a power system with a system efficiency exceeding 20% that can function with a high degree of reliability for 10 years and longer on deep space missions

  13. Status update of a free-piston Stirling convertor for radioisotope space power systems

    Science.gov (United States)

    White, Maurice; Qiu, Songgang; Augenblick, Jack; Peterson, Allen; Faultersack, Frank

    2001-02-01

    Free-piston Stirling engines offer a relatively mature technology that is well-suited for advanced, high-efficiency radioisotope space power systems. This paper updates results from a combination of DOE and NASA contracts with Stirling Technology Company (STC). These contracts have demonstrated STC's Stirling convertor technology in a configuration and power level representative of a space power system. Based on demonstrated performance, long-life maintenance-free technology heritage, and success with aggressively imposed vibration testing. DOE has awarded system integration contracts to Boeing, Lockheed Martin and Teledyne Energy Systems. The objectives of these competitive Phase I contracts are to develop complete spacecraft power system conceptual designs based on the STC Stirling convertor, and to plan subsequent phases for two launches. Performance results for the DOE 55-W(e) Technology Demonstration Convertors (TDC's) have met original projections. Although the TDC's were intended only for technology demonstration, they have achieved very aggressive efficiency goals, demonstrated convertor-induced vibration levels below the Jet Propulsion Laboratory (JPL) specifications, passed a simulated launch load vibration test at 0.2 g2/Hz (12.3 g rms), and met EMI/EMC goals for most contemplated missions. No consideration for EMI reduction was included in the TDC design. Minor changes are underway to reduce EMI levels, with a goal of meeting specifications for missions such as Solar Probe with highly sensitive instrumentation. The long-term objective for DOE is to develop a power system with a system efficiency exceeding 20% that can function with a high degree of reliability for 10 years and longer on deep space missions. .

  14. Research Center for Optical Physics: Education and Technology for the 21st Century

    Science.gov (United States)

    2003-01-01

    During the past eleven years since its inception, RCOP has excelled in its two primary goals: 1) training of the scientists and engineers needed for the twenty-first century with special emphasis on underrepresented citizens and 2) research and technological development in areas of relevance to NASA. In the category of research training, as of May 2003, RCOP produced 36 Bachelors degrees, 25 Masters degrees, and 13 Doctoral degrees. Of these, all 36 Bachelors degrees, 16 of the Masters degrees and 9 of the Doctoral degrees were awarded to African Americans. Four of the Doctoral graduates and one of the Masters graduates are working at NASA Field Centers. RCOP has also provided research experiences to 130 undergraduate students and 22 high school students through a number of outreach programs held during the summer and the academic year. RCOP has also been crucial to the development of the Ph.D. program in physics at Hampton University by providing high quality research training and technical electives required for a Doctoral degree in physics. RCOP has also excelled in research and technological development. Since 1992, RCOP researchers have leveraged over 8 million dollars in additional research funding, published 152 papers in refereed journals and proceedings, and given 125 presentations at refereed international conferences in the United States and eight other countries. RCOP also developed numerous collaborations with other research centers, universities and industries. In recognition of this outstanding work, RCOP is the first research center in the United States invited to join the Joint Open Laboratory for Laser Crystals and Precise Laser Systems headed by Dr. Alexander Kaminiskii of the Russian Academy of Sciences.

  15. CAD/BIM Technology Center

    Data.gov (United States)

    Federal Laboratory Consortium — Supporting Better Decisions in Facility, Infrastructure, and Environment ManagementAccess to technology tools to model structures before they are built can provide...

  16. Mississippi State University Center for Air Sea Technology FY95 Research Program

    Science.gov (United States)

    Yeske, Lanny; Corbin, James H.

    1995-01-01

    The Mississippi State University (MSU) Center for Air Sea Technology (CAST) evolved from the Institute for Naval Oceanography's (INO) Experimental Center for Mesoscale Ocean Prediction (ECMOP) which was started in 1989. MSU CAST subsequently began operation on 1 October 1992 under an Office of Naval Research (ONR) two-year grant which ended on 30 September 1994. In FY95 MSU CAST was successful in obtaining five additional research grants from ONR, as well as several other research contracts from the Naval Oceanographic Office via NASA, the Naval Research Laboratory, the Army Corps of Engineers, and private industry. In the past, MSU CAST technical research and development has produced tools, systems, techniques, and procedures that improve efficiency and overcome deficiency for both the operational and research communities residing with the Department of Defense, private industry, and university ocean modeling community. We continued this effort with the following thrust areas: to develop advanced methodologies and tools for model evaluation, validation and visualization, both oceanographic and atmospheric; to develop a system-level capability for conducting temporally and ; spatially scaled ocean simulations driven by or are responsive to ocean models, and take into consideration coupling to atmospheric models; to continue the existing oceanographic/atmospheric data management task with emphasis on distributed databases in a network environment, with database optimization and standardization, including use of Mosaic and World Wide Web (WWW) access; and to implement a high performance parallel computing technology for CAST ocean models

  17. Standards, Firewalls, and General Classroom Mayhem: Implementing Student-Centered Technology Projects in the Elementary Classroom

    Science.gov (United States)

    Hofer, Mark; Swan, Kathleen Owings

    2006-01-01

    Educators are simultaneously bombarded with both calls to integrate technology in meaningful ways into their teaching and to promote more student-centered activities which combine both content learning and higher-order thinking. This is no small task given the range of student abilities and interests, the increasing emphasis on state standards and…

  18. Two new research melters at the Savannah River Technology Center

    International Nuclear Information System (INIS)

    Gordon, J.R.; Coughlin, J.T.; Minichan, R.L.; Zamecnik, J.R.

    2000-01-01

    The Savannah River Technology Center (SRTC) is a US Department of Energy (DOE) complex leader in the development of vitrification technology. To maintain and expand this SRTC core technology, two new melter systems are currently under construction in SRTC. This paper discusses the development of these two new systems, which will be used to support current as well as future vitrification programs in the DOE complex. The first of these is the new minimelter, which is a joule-heated glass melter intended for experimental melting studies with nonradioactive glass waste forms. Testing will include surrogates of Defense Waste processing Facility (DWPF) high-level wastes. To support the DWPF testing, the new minimelter was scaled to the DWPF melter based on melt surface area. This new minimelter will replace an existing system and provide a platform for the research and development necessary to support the SRTC vitrification core technology mission. The second new melter is the British Nuclear Fuels, Inc., research melter system (BNFL melter), which is a scaled version of the BNFL low-activity-waste (LAW) melter proposed for vitrification of LAW at Hanford. It is designed to process a relatively large amount of actual radiative Hanford tank waste and to gather data on the composition of off-gases that will be generated by the LAW melter. Both the minimelter and BNFL melter systems consist of five primary subsystems: melter vessel, off-gas treatment, feed, power supply, and instrumentation and controls. The configuration and design of these subsystems are tailored to match the current system requirements and provide the flexibility to support future DOE vitrification programs. This paper presents a detailed discussion of the unique design challenges represented by these two new melter systems

  19. 15 CFR 290.8 - Reviews of centers.

    Science.gov (United States)

    2010-01-01

    ... TRANSFER OF MANUFACTURING TECHNOLOGY § 290.8 Reviews of centers. (a) Overview. Each Center will be reviewed... involved Center, and Federal officials. An official of NIST shall chair the panel. Each Merit Review Panel... Center be provided by the NIST Manufacturing Technology Centers Program after the sixth year of support...

  20. SDM center technologies for accelerating scientific discoveries

    International Nuclear Information System (INIS)

    Shoshani, Arie; Altintas, Ilkay; Choudhary, Alok; Critchlow, Terence; Kamath, Chandrika; Ludaescher, Bertram; Nieplocha, Jarek; Parker, Steve; Ross, Rob; Samatova, Nagiza; Vouk, Mladen

    2007-01-01

    With the increasing volume and complexity of data produced by ultra-scale simulations and high-throughput experiments, understanding the science is largely hampered by the lack of comprehensive, end-to-end data management solutions ranging from initial data acquisition to final analysis and visualization. The SciDAC-1 Scientific Data Management (SDM) Center succeeded in bringing an initial set of advanced data management technologies to DOE application scientists in astrophysics, climate, fusion, and biology. Equally important, it established collaborations with these scientists to better understand their science as well as their forthcoming data management and data analytics challenges. Our future focus is on improving the SDM framework to address the needs of ultra-scale science during SciDAC-2. Specifically, we are enhancing and extending our existing tools to allow for more interactivity and fault tolerance when managing scientists' workflows, for better parallelism and feature extraction capabilities in their data analytics operations, and for greater efficiency and functionality in users' interactions with local parallel file systems, active storage, and access to remote storage. These improvements are necessary for the scalability and complexity challenges presented by hardware and applications at ultra scale, and are complemented by continued efforts to work with application scientists in various domains

  1. DOE's SciDAC Visualization and Analytics Center for EnablingTechnologies -- Strategy for Petascale Visual Data Analysis Success

    Energy Technology Data Exchange (ETDEWEB)

    Bethel, E Wes; Johnson, Chris; Aragon, Cecilia; Rubel, Oliver; Weber, Gunther; Pascucci, Valerio; Childs, Hank; Bremer, Peer-Timo; Whitlock, Brad; Ahern, Sean; Meredith, Jeremey; Ostrouchov, George; Joy, Ken; Hamann, Bernd; Garth, Christoph; Cole, Martin; Hansen, Charles; Parker, Steven; Sanderson, Allen; Silva, Claudio; Tricoche, Xavier

    2007-10-01

    The focus of this article is on how one group of researchersthe DOE SciDAC Visualization and Analytics Center for EnablingTechnologies (VACET) is tackling the daunting task of enabling knowledgediscovery through visualization and analytics on some of the world slargest and most complex datasets and on some of the world's largestcomputational platforms. As a Center for Enabling Technology, VACET smission is the creation of usable, production-quality visualization andknowledge discovery software infrastructure that runs on large, parallelcomputer systems at DOE's Open Computing facilities and that providessolutions to challenging visual data exploration and knowledge discoveryneeds of modern science, particularly the DOE sciencecommunity.

  2. Stanniocalcin-2 is a HIF-1 target gene that promotes cell proliferation in hypoxia

    Energy Technology Data Exchange (ETDEWEB)

    Law, Alice Y.S. [Department of Biology, Hong Kong Baptist University, Kowloon Tong (Hong Kong); Wong, Chris K.C., E-mail: ckcwong@hkbu.edu.hk [Department of Biology, Hong Kong Baptist University, Kowloon Tong (Hong Kong)

    2010-02-01

    Stanniocalcin-2 (STC2), the paralog of STC1, has been suggested as a novel target of oxidative stress response to protect cells from apoptosis. The expression of STC2 has been reported to be highly correlated with human cancer development. In this study, we reported that STC2 is a HIF-1 target gene and is involved in the regulation of cell proliferation. STC2 was shown to be up-regulated in different breast and ovarian cancer cells, following exposure to hypoxia. Using ovarian cancer cells (SKOV3), the underlying mechanism of HIF-1 mediated STC2 gene transactivation was characterized. Hypoxia-induced STC2 expression was found to be HIF-1{alpha} dependent and required the recruitment of p300 and HDAC7. Using STC2 promoter deletion constructs and site-directed mutagenesis, two authentic consensus HIF-1 binding sites were identified. Under hypoxic condition, the silencing of STC2 reduced while the overexpression of STC2 increased the levels of phosphorylated retinoblastoma and cyclin D in both SKOV3 and MCF7 cells. The change in cell cycle proteins correlated with the data of the serial cell counts. The results indicated that cell proliferation was reduced in STC2-silenced cells but was increased in STC2-overexpressing hypoxic cells. Solid tumor progression is usually associated with hypoxia. The identification and functional analysis of STC2 up-regulation by hypoxia, a feature of the tumor microenvironment, sheds light on a possible role for STC2 in tumors.

  3. The Clean Energy Manufacturing Analysis Center (CEMAC): Providing Analysis and Insights on Clean Technology Manufacturing

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Nicholi S [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-09-28

    The U.S. Department of Energy's Clean Energy Manufacturing Analysis Center (CEMAC) provides objective analysis and up-to-date data on global supply chains and manufacturing of clean energy technologies. Policymakers and industry leaders seek CEMAC insights to inform choices to promote economic growth and the transition to a clean energy economy.

  4. Techniques for evaluating optimum data center operation

    Science.gov (United States)

    Hamann, Hendrik F.; Rodriguez, Sergio Adolfo Bermudez; Wehle, Hans-Dieter

    2017-06-14

    Techniques for modeling a data center are provided. In one aspect, a method for determining data center efficiency is provided. The method includes the following steps. Target parameters for the data center are obtained. Technology pre-requisite parameters for the data center are obtained. An optimum data center efficiency is determined given the target parameters for the data center and the technology pre-requisite parameters for the data center.

  5. Recombinant adeno-associated virus-delivered hypoxia-inducible stanniocalcin-1 expression effectively inhibits hypoxia-induced cell apoptosis in cardiomyocytes.

    Science.gov (United States)

    Shi, Xin; Wang, Jianzhong; Qin, Yan

    2014-12-01

    Ischemia/hypoxia-induced oxidative stress is detrimental for the survival of cardiomyocytes and cardiac function. Stanniocalcin-1 (STC-1), a glycoprotein, has been found to play an inhibitory role in the production of reactive oxygen species (ROS). Here, we speculated that the overexpression of STC-1 might alleviate oxidative damage in cardiomyocytes under conditions of hypoxia. To control the expression of STC-1 in hypoxia, we constructed a recombinant adeno-associated virus (AAV) carrying the hypoxia-responsive element (HRE) to mediate hypoxia induction. Cardiomyocytes were infected with AAV-HRE-STC-1 and cultured in normoxic or hypoxic conditions, and STC-1 overexpression was only detected in hypoxic cultured cardiomyocytes by using quantitative real-time polymerase chain reaction and Western blot analysis. Using the 3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay, AAV-HRE-STC-1 infection was shown to significantly enhance cell survival under hypoxia. Hypoxia-induced cell apoptosis was inhibited by AAV-HRE-STC-1 infection by using the Annexin V-fluorescein isothiocyanate (FITC)/propidium iodide apoptosis assay. Moreover, the proapoptotic protein Caspase-3 and anti-apoptotic protein Bcl-2, which were dysregulated by hypoxia, were reversed by AAV-HRE-STC-1 infection. AAV-HRE-STC-1-mediated STC-1 overexpression markedly inhibited ROS production in cardiomyocytes cultured under hypoxic conditions. AAV-HRE-STC-1 infection significantly upregulated uncoupled protein 3 (UCP3), whereas silencing of UCP3 blocked the inhibitory effect of AAV-HRE-STC-1 on ROS production. In contrast, AAV-HRE-STC-1 infection had no effect on UCP2, and knockdown of UCP2 did not block the inhibitory effect of AAV-HRE-STC-1 on ROS production in the cardiomyocytes cultured under hypoxic conditions. Taken together, STC1 activates antioxidant pathway in cardiomyocytes through the induction of UCP3, implying that AAV-HRE-STC-1 has potential in the treatment of ischemic

  6. How a diverse research ecosystem has generated new rehabilitation technologies: Review of NIDILRR's Rehabilitation Engineering Research Centers.

    Science.gov (United States)

    Reinkensmeyer, David J; Blackstone, Sarah; Bodine, Cathy; Brabyn, John; Brienza, David; Caves, Kevin; DeRuyter, Frank; Durfee, Edmund; Fatone, Stefania; Fernie, Geoff; Gard, Steven; Karg, Patricia; Kuiken, Todd A; Harris, Gerald F; Jones, Mike; Li, Yue; Maisel, Jordana; McCue, Michael; Meade, Michelle A; Mitchell, Helena; Mitzner, Tracy L; Patton, James L; Requejo, Philip S; Rimmer, James H; Rogers, Wendy A; Zev Rymer, W; Sanford, Jon A; Schneider, Lawrence; Sliker, Levin; Sprigle, Stephen; Steinfeld, Aaron; Steinfeld, Edward; Vanderheiden, Gregg; Winstein, Carolee; Zhang, Li-Qun; Corfman, Thomas

    2017-11-06

    Over 50 million United States citizens (1 in 6 people in the US) have a developmental, acquired, or degenerative disability. The average US citizen can expect to live 20% of his or her life with a disability. Rehabilitation technologies play a major role in improving the quality of life for people with a disability, yet widespread and highly challenging needs remain. Within the US, a major effort aimed at the creation and evaluation of rehabilitation technology has been the Rehabilitation Engineering Research Centers (RERCs) sponsored by the National Institute on Disability, Independent Living, and Rehabilitation Research. As envisioned at their conception by a panel of the National Academy of Science in 1970, these centers were intended to take a "total approach to rehabilitation", combining medicine, engineering, and related science, to improve the quality of life of individuals with a disability. Here, we review the scope, achievements, and ongoing projects of an unbiased sample of 19 currently active or recently terminated RERCs. Specifically, for each center, we briefly explain the needs it targets, summarize key historical advances, identify emerging innovations, and consider future directions. Our assessment from this review is that the RERC program indeed involves a multidisciplinary approach, with 36 professional fields involved, although 70% of research and development staff are in engineering fields, 23% in clinical fields, and only 7% in basic science fields; significantly, 11% of the professional staff have a disability related to their research. We observe that the RERC program has substantially diversified the scope of its work since the 1970's, addressing more types of disabilities using more technologies, and, in particular, often now focusing on information technologies. RERC work also now often views users as integrated into an interdependent society through technologies that both people with and without disabilities co-use (such as the internet

  7. Annual report of nuclear technology and education center. April 1, 2003 - March 31, 2004

    International Nuclear Information System (INIS)

    2004-10-01

    This report summarizes the activities of Nuclear Technology and Education Center (NuTEC) is Japan Atomic Energy Research Institute in FY 2003. It includes the domestic educational activities and the international training activities mainly for Asia-Pacific region as well as the activities of the research and the development for training courses and administrative aspects. The courses yet carried out in Tokyo Education Center were begun to operate in the facilities of the Tokai Research Establishment. Aiming at carrying out training activities more effectively and efficiently, the training division system related to the training fields have started together with that. Most of the scheduled training courses for the FY2003 have been carried out as planned and the total number of the trainees completing the courses was 1,311. The building of the Tokyo Education Center was demolished and removed after the decontamination, decommissioning procedures. The land was returned to the land owner by the end of FY 2003. In addition to these activities, research and development for the improvement of education and training were carried out. (author)

  8. Production technology readiness assessment of surfactant in the research center for Chemistry-Indonesian Institute of Sciences

    Science.gov (United States)

    Setiawan, Arief Ameir Rahman; Sulaswatty, Anny

    2017-11-01

    The common problem faced by the institution working on research, innovation and technology development is lack of quantitative measures to determine the technology readiness of research. No common communication language between R & D Institutions and industry about the level of preparedness of a research resulting a barrier to technology diffusion interaction. This lack of connection between R & D institutes with industry may lead to "sluggishness" occurs in innovating. For such circumstance, assessing technology readiness of research is very important. One of wide spread methods for the assessment is Technology Readiness Level (TRL, also known as Technometer), which is introduced by NASA (National Aeronautics and Space Administration). TRL is a general guide that provides an overview of maturity level of a technology. This study aims to identify and demonstrate the implementation of TRL to assess a number of surfactant researches in the Research Center for Chemistry, Indonesian Institute of Sciences. According to the assessment, it has been obtained the surfactant recommended for further development towards commercialization of R & D results, i.e. Glycerol Mono Stearate (GMS), which has reached the level of TRL 7.

  9. Mobilizing Learning Resources in a Transnational Classroom: Translocal and Digital Resources in a Community Technology Center

    Science.gov (United States)

    Noguerón-Liu, Silvia

    2014-01-01

    Drawing from transnational and activity theory frameworks, this study analyzes the ways translocal flows shape learning in a community technology center serving adult immigrants in the US Southwest. It also explores students' constructions of the transnational nature of the courses they took, where they had access to both online and face-to-face…

  10. HEMISPHERIC CENTER FOR ENVIRONMENTAL TECHNOLOGY

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian

    1999-03-30

    A vendor was selected for the diamond wire technology demonstration scheduled for this summer at Princeton Plasma Physics Laboratory (PPPL). A team consisting of personnel from FIU-HCET, PPPL, and AEA Technology reviewed the submitted bids. FIU-HCET will contract this vendor. At the SRS Ninth ICT teleconference, the ICT team discussed the status of the following demonstrations: LRAD; x-ray, K-edge; Strippable Coatings; Thermal Spray Vitrification; Cutting/Shearing/Dismantlement/Size Reduction; and Electrets. The LRAD demo is complete, and the x-ray/K-edge, Strippable Coatings, and Electrets demos are ongoing. The Asbestos and Thermal Spray Vitrification demos require more laboratory testing. The Cutting/Shearing/Dismantlement/Size Reduction demo is undergoing procurement. Five FIU-HCET staff members took the 1S0 14000 environmental auditor training course February 22-26, 1999, given by ASC. The test plan for the Facility Dismantlement Technology Assessment is finished and ready for internal review.

  11. Installation of a technological center for highly efficient optical gratings at Helmholtz-Zentrum Berlin (HZB)

    International Nuclear Information System (INIS)

    Loechel, B; Erko, A; Lemke, St; Senf, F; Nelles, B; Schmidt, M

    2013-01-01

    In 2009 Carl Zeiss stopped the manufacture of precision gratings. All users of their gratings were very concerned about this decision, since they all need precision gratings for their experiments. One of the institutes of the HZB, the Institute for Nanometer Optics and Technology (INT), has extensive experience in micro fabrication (technology group). In spring 2010, HZB decided to take over the old C. Zeiss grating fabrication and build up its own technology center for grating fabrication. In March 2010, the INT applied to the Senate of Berlin for funding for our project from the European Regional Development Fund (ERDF). In October 2010, HZB received an approval of its application from the Senate of Berlin (contract No 20072013 2/43). Using this governmental support, HZB will install all necessary equipment and processes to fulfill these demands until end of 2013.

  12. The International Science and Technology Center: Scope of activities and scientific projects in the field of nuclear data

    International Nuclear Information System (INIS)

    Klepatsky, Alexander B.

    2002-01-01

    The review of the ISTC (The International Science and Technology Center) Programs and activities including Science Project Program, Partner Program, Seminar Program and others is presented. Project funding by technology area, by funding Parties, by CIS (Commonwealth of Independent States) States etc. is demonstrated with emphasis on projects in the field of nuclear data. The ISTC opportunities for international cooperation in the fields of nuclear data measurements, calculation, evaluation and dissemination are discussed. (author)

  13. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2017-03-15

    Mar 15, 2017 ... 53. ORIGINAL ARTICLE. Predictors of Hospitalization among Children on ART in Ethiopia: a .... Technology Commission (STC) the now renamed as Ministry of Science ..... The effect of highly active antiretroviral therapy on the ...

  14. Information technology-enabled team-based, patient-centered care: The example of depression screening and management in cancer care.

    Science.gov (United States)

    Randhawa, Gurvaneet S; Ahern, David K; Hesse, Bradford W

    2017-03-01

    The existing healthcare delivery systems across the world need to be redesigned to ensure high-quality care is delivered to all patients. This redesign needs to ensure care is knowledge-based, patient-centered and systems-minded. The rapid advances in the capabilities of information and communication technology and its recent rapid adoption in healthcare delivery have ensured this technology will play a vital role in the redesign of the healthcare delivery system. This commentary highlights promising new developments in health information technology (IT) that can support patient engagement and self-management as well as team-based, patient-centered care. Collaborative care is an effective approach to screen and treat depression in cancer patients and it is a good example of the benefits of team-based and patient-centered care. However, this approach was developed prior to the widespread adoption and use of health IT. We provide examples to illustrate how health IT can improve prevention and treatment of depression in cancer patients. We found several knowledge gaps that limit our ability to realize the full potential of health IT in the context of cancer and comorbid depression care. These gaps need to be filled to improve patient engagement; enhance the reach and effectiveness of collaborative care and web-based programs to prevent and treat depression in cancer patients. We also identify knowledge gaps in health IT design and implementation. Filling these gaps will help shape policies that enable clinical teams to deliver high-quality cancer care globally.

  15. NASA Center for Climate Simulation (NCCS) Advanced Technology AT5 Virtualized Infiniband Report

    Science.gov (United States)

    Thompson, John H.; Bledsoe, Benjamin C.; Wagner, Mark; Shakshober, John; Fromkin, Russ

    2013-01-01

    The NCCS is part of the Computational and Information Sciences and Technology Office (CISTO) of Goddard Space Flight Center's (GSFC) Sciences and Exploration Directorate. The NCCS's mission is to enable scientists to increase their understanding of the Earth, the solar system, and the universe by supplying state-of-the-art high performance computing (HPC) solutions. To accomplish this mission, the NCCS (https://www.nccs.nasa.gov) provides high performance compute engines, mass storage, and network solutions to meet the specialized needs of the Earth and space science user communities

  16. Electric Power Research Institute Environmental Control Technology Center Report to the Steering Committee

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1998-01-12

    Operations and maintenance continued this month at the Electric Power Research Institute's (EPRI's) Environmental Control Technology Center (ECTC). Testing for the month involved the Dry Sorbent Injection (DSI) test block with the Carbon Injection System. The 1.0 MW Cold-Side Selective Catalytic Reduction (SCR) unit, the 0.4 MW Mini-Pilot Wet Scrubber, and the 4.0 MW Pilot Wet Scrubber remained idle this month in a cold-standby mode and were inspected regularly. These units remain available for testing as future project work is identified.

  17. The International Science and Technology Center (ISTC) and ISTC projects related to nuclear safety. Information review

    International Nuclear Information System (INIS)

    Tocheny, Lev V.

    2003-01-01

    The ISTC is an intergovernmental organization created ten years ago by Russia, USA, EU and Japan in Moscow. The Center supports numerous science and technology projects in different areas, from biotechnologies and environmental problems to all aspects of nuclear studies, including those focused on the development of effective innovative concepts and technologies in the nuclear field, in general, and for improvement of nuclear safety, in particular. The presentation addresses some technical results of the ISTC projects as well as methods and approaches employed by the ISTC to foster close international collaboration and manage projects towards fruitful results. (author)

  18. Tiger Team Assessment of the Pittsburgh Energy Technology Center, [August 19--September 13, 1991

    International Nuclear Information System (INIS)

    1991-09-01

    This report documents the results of the Department of Energy (DOE) Tiger Team Assessment conducted at Pittsburgh Energy Technology Center (PETC) near Pittsburgh, Pennsylvania, between August 19 and September 13, 1991. A team comprised of professionals from the Department, its contractors, and consultants conducted the assessment. The purpose of the assessment was to provide the Secretary of Energy the status of environment, safety, and health (ES ampersand H) programs at PETC. A management assessment was performed

  19. Space Solar Power Satellite Technology Development at the Glenn Research Center: An Overview

    Science.gov (United States)

    Dudenhoefer, James E.; George, Patrick J.

    2000-01-01

    NASA Glenn Research Center (GRC). is participating in the Space Solar Power Exploratory Research and Technology program (SERT) for the development of a solar power satellite concept. The aim of the program is to provide electrical power to Earth by converting the Sun's energy and beaming it to the surface. This paper will give an overall view of the technologies being pursued at GRC including thin film photovoltaics, solar dynamic power systems, space environmental effects, power management and distribution, and electric propulsion. The developmental path not only provides solutions to gigawatt sized space power systems for the future, but provides synergistic opportunities for contemporary space power architectures. More details of Space Solar Power can be found by reading the references sited in this paper and by connecting to the web site http://moonbase.msfc.nasa.gov/ and accessing the "Space Solar Power" section "Public Access" area.

  20. A new concept for medical imaging centered on cellular phone technology.

    Directory of Open Access Journals (Sweden)

    Yair Granot

    2008-04-01

    Full Text Available According to World Health Organization reports, some three quarters of the world population does not have access to medical imaging. In addition, in developing countries over 50% of medical equipment that is available is not being used because it is too sophisticated or in disrepair or because the health personnel are not trained to use it. The goal of this study is to introduce and demonstrate the feasibility of a new concept in medical imaging that is centered on cellular phone technology and which may provide a solution to medical imaging in underserved areas. The new system replaces the conventional stand-alone medical imaging device with a new medical imaging system made of two independent components connected through cellular phone technology. The independent units are: a a data acquisition device (DAD at a remote patient site that is simple, with limited controls and no image display capability and b an advanced image reconstruction and hardware control multiserver unit at a central site. The cellular phone technology transmits unprocessed raw data from the patient site DAD and receives and displays the processed image from the central site. (This is different from conventional telemedicine where the image reconstruction and control is at the patient site and telecommunication is used to transmit processed images from the patient site. The primary goal of this study is to demonstrate that the cellular phone technology can function in the proposed mode. The feasibility of the concept is demonstrated using a new frequency division multiplexing electrical impedance tomography system, which we have developed for dynamic medical imaging, as the medical imaging modality. The system is used to image through a cellular phone a simulation of breast cancer tumors in a medical imaging diagnostic mode and to image minimally invasive tissue ablation with irreversible electroporation in a medical imaging interventional mode.

  1. Developing a Free-Piston Stirling Convertor for advanced radioisotope space power systems

    Science.gov (United States)

    Qiu, Songgang; Augenblick, John E.; White, Maurice A.; Peterson, Allen A.; Redinger, Darin L.; Petersen, Stephen L.

    2002-01-01

    The Department of Energy (DOE) has selected Free-Piston Stirling Convertors as a technology for future advanced radioisotope space power systems. In August 2000, DOE awarded competitive Phase I, Stirling Radioisotope Generator (SRG) power system integration contracts to three major aerospace contractors, resulting in SRG conceptual designs in February 2001. All three contractors based their designs on the Technology Demonstration Convertor (TDC) developed by Stirling Technology Company (STC) for DOE. The contract award to a single system integration contractor for Phases II and III of the SRG program is anticipated in late 2001. The first potential SRG mission is targeted for a Mars rover. This paper provides a description of the Flight Prototype (FP) Stirling convertor design as compared to the previous TDC design. The initial flight prototype units are already undergoing performance tuning at STC. The new design will be hermetically scaled and will provide a weight reduction from approximately 4.8 kg to approximately 3.9 kg. .

  2. Secure thin client architecture for DICOM image analysis

    Science.gov (United States)

    Mogatala, Harsha V. R.; Gallet, Jacqueline

    2005-04-01

    This paper presents a concept of Secure Thin Client (STC) Architecture for Digital Imaging and Communications in Medicine (DICOM) image analysis over Internet. STC Architecture provides in-depth analysis and design of customized reports for DICOM images using drag-and-drop and data warehouse technology. Using a personal computer and a common set of browsing software, STC can be used for analyzing and reporting detailed patient information, type of examinations, date, Computer Tomography (CT) dose index, and other relevant information stored within the images header files as well as in the hospital databases. STC Architecture is three-tier architecture. The First-Tier consists of drag-and-drop web based interface and web server, which provides customized analysis and reporting ability to the users. The Second-Tier consists of an online analytical processing (OLAP) server and database system, which serves fast, real-time, aggregated multi-dimensional data using OLAP technology. The Third-Tier consists of a smart algorithm based software program which extracts DICOM tags from CT images in this particular application, irrespective of CT vendor's, and transfers these tags into a secure database system. This architecture provides Winnipeg Regional Health Authorities (WRHA) with quality indicators for CT examinations in the hospitals. It also provides health care professionals with analytical tool to optimize radiation dose and image quality parameters. The information is provided to the user by way of a secure socket layer (SSL) and role based security criteria over Internet. Although this particular application has been developed for WRHA, this paper also discusses the effort to extend the Architecture to other hospitals in the region. Any DICOM tag from any imaging modality could be tracked with this software.

  3. Impact of new technologies on stress, attrition and well-being in emergency call centers: the NextGeneration 9-1-1 study protocol.

    Science.gov (United States)

    Baseman, Janet; Revere, Debra; Painter, Ian; Stangenes, Scott; Lilly, Michelle; Beaton, Randal; Calhoun, Rebecca; Meischke, Hendrika

    2018-05-04

    Our public health emergency response system relies on the "first of the first responders"-the emergency call center workforce that handles the emergency needs of a public in distress. Call centers across the United States have been preparing for the "Next Generation 9-1-1" initiative, which will allow citizens to place 9-1-1 calls using a variety of digital technologies. The impacts of this initiative on a workforce that is already highly stressed is unknown. There is concern that these technology changes will increase stress, reduce job performance, contribute to maladaptive coping strategies, lower employee retention, or change morale in the workplace. Understanding these impacts to inform approaches for mitigating the health and performance risks associated with new technologies is crucial for ensuring the 911 system fulfills its mission of providing optimal emergency response to the public. Our project is an observational, prospective cohort study framed by the first new technology that will be implemented: text-to-911 calling. Emergency center call takers will be recruited nationwide. Data will be collected by online surveys distributed at each center before text-to-911 implementation; within the first month of implementation; and 6 months after implementation. Primary outcome measures are stress as measured by the Calgary Symptoms of Stress Index, use of sick leave, job performance, and job satisfaction. Primary analyses will use mixed effects regression models and mixed effects logistic regression models to estimate the change in outcome variables associated with text-to-911 implementation. Multiple secondary analyses will examine effects of stress on absenteeism; associations between technology attitudes and stress; effects of implementation on attitudes towards technology; and mitigating effects of job demands, job satisfaction, attitudes towards workplace technology and workplace support on change in stress. Our public health dependence on this workforce

  4. 4 years of successful knowledge transfer - the nuclear technology training center of the TUeV Nord Group

    International Nuclear Information System (INIS)

    Willenbockel, I.; Tietze, U.

    2007-01-01

    In connection with the 2002 amendment to the German Atomic Energy Act, the topics of generational change and maintenance of competence grew in importance and necessitated new solution approaches. To this end, various activities were launched, with the aim of conducting conceptual analyses of these topics. Examples include the 'National Competence Network for Nuclear Technology' (Nationaler Kompetenzverbund fuer Kerntechnik), various networks established by colleges and universities, the 'Knowledge Management for the Maintenance and Transfer of Competence in Reactor Safety' (Wissensmanagement zum Kompetenzerhalt und -transfer in der Reaktorsicherheit) workshop held in 2001 in Garching near Munich (Germany) and the 'Ad-hoc Workgroup on the Maintenance of Competence' (Ad-hoc-Arbeitskreis Kompetenzerhalt) of the VdTUeV. The nuclear technology departments of the TUeV Nord Group were aware of te challenges associated with the generational change early on. By establishing the 'Nuclear Technology Training Center' (Ausbildungszentrum fuer Kerntechnik, AfK), the TUeV Nord Group intended to ensure the required knowledge transfer during the generational change as well as maintain the renowned high qualification as regards the subject of nuclear technology and thus continue to provide - in the sense of social responsibility - crucial contribution to the long-term safety of nuclear plants. Four years have passed since the training center held the first courses in the fall of 2002. Up to now, more than 350 participants have been trained in the courses conducted by the AfK. In the opinion of the TUeV Nord Group, the activities of the AfK have laid the foundation for a successful change of generations within the group's nuclear technology organizations. (orig.)

  5. From chemicals to cold plasma: Non-thermal food processing technologies research at the USDA's Eastern Regional Research Center

    Science.gov (United States)

    Foodborne pathogens cause millions of illnesses every year. At the US Department of Agriculture’s Eastern Regional Research Center, scientists and engineers have focused on developing new ways to improve food safety and shelf life while retaining quality and nutritional value. A variety of technolog...

  6. Ceramic High Efficiency Particulate Air (HEPA) Filter Final Report CRADA No. TC02102.0

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Morse, T. [Flanders Corp., Washington, DC (United States)

    2017-09-06

    This was a collaborative effort between Lawrence Livermore National Security, LLC (formerly The Regents of the University of California)/Lawrence Livermor e National Laboratory (LLNL) and Flanders-Precisionaire (Flanders), to develop ceramic HEP A filters under a Thrust II Initiative for Proliferation Prevention (IPP) project. The research was conducted via the IPP Program at Commonwe alth of Independent States (CIS) Institutes, which are handled under a separate agreement. The institutes (collectively referred to as "CIS Institutes") involved with this project were: Bochvar: Federal State Unitarian Enterprise All-Russia Scientific and Research Institute of Inorganic Materials (FSUE VNIINM); Radium Khlopin: Federal State Unitarian Enterprise NPO Radium Institute named (FSUE NPO Radium Institute); and Bakor: Science and Technology Center Bakor (STC Bakor).

  7. Idaho Nuclear Technology and Engineering Center Newly Generated Liquid Waste Demonstration Project Feasibility Study

    International Nuclear Information System (INIS)

    Herbst, A.K.

    2000-01-01

    A research, development, and demonstration project for the grouting of newly generated liquid waste (NGLW) at the Idaho Nuclear Technology and Engineering Center is considered feasible. NGLW is expected from process equipment waste, decontamination waste, analytical laboratory waste, fuel storage basin waste water, and high-level liquid waste evaporator condensate. The potential grouted waste would be classed as mixed low-level waste, stabilized and immobilized to meet RCRA LDR disposal in a grouting process in the CPP-604 facility, and then transported to the state

  8. Business of Nuclear Safety Analysis Office, Nuclear Technology Test Center

    International Nuclear Information System (INIS)

    Hayakawa, Masahiko

    1981-01-01

    The Nuclear Technology Test Center established the Nuclear Safety Analysis Office to execute newly the works concerning nuclear safety analysis in addition to the works related to the proving tests of nuclear machinery and equipments. The regulations for the Nuclear Safety Analysis Office concerning its organization, business and others were specially decided, and it started the business formally in August, 1980. It is a most important subject to secure the safety of nuclear facilities in nuclear fuel cycle as the premise of developing atomic energy. In Japan, the strict regulation of safety is executed by the government at each stage of the installation, construction, operation and maintenance of nuclear facilities, based on the responsibility for the security of installers themselves. The Nuclear Safety Analysis Office was established as the special organ to help the safety examination related to the installation of nuclear power stations and others by the government. It improves and puts in order the safety analysis codes required for the cross checking in the safety examination, and carries out safety analysis calculation. It is operated by the cooperation of the Science and Technology Agency and the Agency of Natural Resources and Energy. The purpose of establishment, the operation and the business of the Nuclear Safety Analysis Office, the plan of improving and putting in order of analysis codes, and the state of the similar organs in foreign countries are described. (Kako, I.)

  9. Optical wireless communication in data centers

    Science.gov (United States)

    Arnon, Shlomi

    2018-01-01

    In the last decade data centers have become a crucial element in modern human society. However, to keep pace with internet data rate growth, new technologies supporting data center should develop. Integration of optical wireless communication (OWC) in data centers is one of the proposed technologies as augmented technology to the fiber network. One implementation of the OWC technology is deployment of optical wireless transceiver on top of the existing cable/fiber network as extension to the top of rack (TOR) switch; in this way, a dynamic and flexible network is created. Optical wireless communication could reduce energy consumption, increase the data rate, reduce the communication latency, increase flexibility and scalability, and reduce maintenance time and cost, in comparison to extra fiber network deployment. In this paper we review up to date literature in the field, propose an implementation scheme of OWC network, discuss ways to reduce energy consumption by parallel link communication and report preliminary measurement result of university data center environment.

  10. Effect of Sea Tangle ( and Charcoal Supplementation as Alternatives to Antibiotics on Growth Performance and Meat Quality of Ducks

    Directory of Open Access Journals (Sweden)

    M. M. Islam

    2014-02-01

    Full Text Available A total of 150 growing ducks were assigned to five dietary treatments to study the effect of sea tangle and charcoal (STC supplementation on growth performance and meat characteristics in a completely randomized design. There were six replicates and five ducklings in each replication. The five dietary treatments were control, antibiotic, and 0.1%, 0.5%, and 1% STC supplemented diets. No significant differences were found on ADG, ADFI, and gain:feed among treatments in different weeks. The overall (0 to 3 weeks ADFI decreased in antibiotic treatment (p<0.05 whereas the gain:feed increased significantly upon 1.0% STC supplementation compared to control (p<0.05. No significant variation was found in meat chemical composition except crude fat content which was high in 1.0% STC dietary group (p<0.05. Meat cholesterol was reduced in 0.1% STC group (p<0.05 compared to other dose levels while serum cholesterol was unaffected. High density lipoprotein (HDL content was high in 1.0% STC (p<0.05 and low density lipoprotein (LDL was low in 0.1% and 1.0% STC dietary groups (p = 0.06. No significant effect was found on the thiobarbituric acid reactive substances (TBARS of fresh meat, whereas the TBARS value of meat preserved for 1 week was reduced significantly in STC dietary groups (p<0.05. The 0.1% STC dietary group showed an increased myristic acid (p = 0.07 content whereas, the content of eicosapentaenoic (EPA and docosahexaenoic (DHA acids increased in STC supplementation than antibiotic group (p<0.05. An increased concentration of omega-3 fatty acids and a reduced ratio of n-6/n-3 PUFA ratio was found upon 1.0% STC supplementation compared to antibiotic dietary group (p<0.05. Therefore, 1.0% STC dietary supplementation can be used as alternatives to antibiotics in duck production.

  11. Orthographic dependency in the neural correlates of reading: Evidence from audiovisual integration in English readers

    NARCIS (Netherlands)

    Holloway, I.; van Atteveldt, N.M.; Blomert, L.; Ansari, D.

    2015-01-01

    Reading skills are indispensible in modern technological societies. In transparent alphabetic orthographies, such as Dutch, reading skills build on associations between letters and speech sounds (LS pairs). Previously, we showed that the superior temporal cortex (STC) of Dutch readers is sensitive

  12. Stanniocalcin 1 effects on the renal gluconeogenesis pathway in rat and fish.

    Science.gov (United States)

    Schein, Vanessa; Kucharski, Luiz C; Guerreiro, Pedro M G; Martins, Tiago Leal; Morgado, Isabel; Power, Deborah M; Canario, Adelino V M; da Silva, Roselis S M

    2015-10-15

    The mammalian kidney contributes significantly to glucose homeostasis through gluconeogenesis. Considering that stanniocalcin 1 (STC1) regulates ATP production, is synthesized and acts in different cell types of the nephron, the present study hypothesized that STC1 may be implicated in the regulation of gluconeogenesis in the vertebrate kidney. Human STC1 strongly reduced gluconeogenesis from (14)C-glutamine in rat renal medulla (MD) slices but not in renal cortex (CX), nor from (14)C-lactic acid. Total PEPCK activity was markedly reduced by hSTC1 in MD but not in CX. Pck2 (mitochondrial PEPCK isoform) was down-regulated by hSTC1 in MD but not in CX. In fish (Dicentrarchus labrax) kidney slices, both STC1-A and -B isoforms decreased gluconeogenesis from (14)C-acid lactic, while STC1-A increased gluconeogenesis from (14)C-glutamine. Overall, our results demonstrate a role for STC1 in the control of glucose synthesis via renal gluconeogenesis in mammals and suggest that it may have a similar role in teleost fishes. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  13. Persons with Mild or Moderate Alzheimer's Disease Use a Basic Orientation Technology to Travel to Different Rooms within a Day Center

    Science.gov (United States)

    Lancioni, Giulio E.; Perilli, Viviana; Singh, Nirbhay N.; O'Reilly, Mark F.; Sigafoos, Jeff; Bosco, Andrea; De Caro, Maria Fara; Cassano, Germana; Pinto, Katia; Minervini, Mauro

    2011-01-01

    This study assessed whether three patients with Alzheimer's disease could learn to use a basic orientation technology to reach different rooms within a day center. At each travel instance, the technology provided verbal messages (cues) from the room to reach. For the first two patients, the messages were presented at intervals of about 15 s. For…

  14. Stanniocalcin 2 promotes cell proliferation and cisplatin resistance in cervical cancer

    International Nuclear Information System (INIS)

    Wang, Yuxia; Gao, Ying; Cheng, Hairong; Yang, Guichun; Tan, Wenhua

    2015-01-01

    Cervical cancer is one of the most common carcinomas in the female reproductive system. Treatment of cervical cancer involves surgical removal and chemotherapy. Resistance to platinum-based chemotherapy drugs including cisplatin has increasingly become an important problem in the treatment of cervical cancer patients. We found in this study that stanniocalcin 2 (STC2) expression was upregulated in both cervical cancer tissues and cell lines. The levels of STC2 expression in cervical cancer cell lines were positively correlated with the rate of cell proliferation. Furthermore, in cisplatin resistant cervical cancer cells, the levels of STC2 expression were significantly elevated. Modulation of STC2 expression by siRNA or overexpression in cisplatin resistant cells resulted in altered cell survival, apoptosis, and cisplatin resistance. Finally, we found that there was significant difference in the activity of the MAPK signaling pathway between cisplatin sensitive and resistant cervical cancer cells, and that STC2 could regulate the activity of the MAPK signaling pathway. - Highlights: • STC2 was upregulated in cervical cancer and promoted cervical cancer cell proliferation. • Cisplatin resistant cells had elevated STC2 levels and enhanced proliferation. • STC2 regulated cisplatin chemosensitivity in cervical cancer cells. • STC2 regulated the activity of the MAPK signaling pathway.

  15. How Auditory Experience Differentially Influences the Function of Left and Right Superior Temporal Cortices.

    Science.gov (United States)

    Twomey, Tae; Waters, Dafydd; Price, Cathy J; Evans, Samuel; MacSweeney, Mairéad

    2017-09-27

    To investigate how hearing status, sign language experience, and task demands influence functional responses in the human superior temporal cortices (STC) we collected fMRI data from deaf and hearing participants (male and female), who either acquired sign language early or late in life. Our stimuli in all tasks were pictures of objects. We varied the linguistic and visuospatial processing demands in three different tasks that involved decisions about (1) the sublexical (phonological) structure of the British Sign Language (BSL) signs for the objects, (2) the semantic category of the objects, and (3) the physical features of the objects.Neuroimaging data revealed that in participants who were deaf from birth, STC showed increased activation during visual processing tasks. Importantly, this differed across hemispheres. Right STC was consistently activated regardless of the task whereas left STC was sensitive to task demands. Significant activation was detected in the left STC only for the BSL phonological task. This task, we argue, placed greater demands on visuospatial processing than the other two tasks. In hearing signers, enhanced activation was absent in both left and right STC during all three tasks. Lateralization analyses demonstrated that the effect of deafness was more task-dependent in the left than the right STC whereas it was more task-independent in the right than the left STC. These findings indicate how the absence of auditory input from birth leads to dissociable and altered functions of left and right STC in deaf participants. SIGNIFICANCE STATEMENT Those born deaf can offer unique insights into neuroplasticity, in particular in regions of superior temporal cortex (STC) that primarily respond to auditory input in hearing people. Here we demonstrate that in those deaf from birth the left and the right STC have altered and dissociable functions. The right STC was activated regardless of demands on visual processing. In contrast, the left STC was

  16. Impact of Information Technology, Clinical Resource Constraints, and Patient-Centered Practice Characteristics on Quality of Care

    Directory of Open Access Journals (Sweden)

    JongDeuk Baek

    2015-02-01

    Full Text Available Objective: Factors in the practice environment, such as health information technology (IT infrastructure, availability of other clinical resources, and financial incentives, may influence whether practices are able to successfully implement the patient-centered medical home (PCMH model and realize its benefits. This study investigates the impacts of those PCMH-related elements on primary care physicians’ perception of quality of care. Methods: A multiple logistic regression model was estimated using the 2004 to 2005 CTS Physician Survey, a national sample of salaried primary care physicians (n = 1733. Results: The patient-centered practice environment and availability of clinical resources increased physicians’ perceived quality of care. Although IT use for clinical information access did enhance physicians’ ability to provide high quality of care, a similar positive impact of IT use was not found for e-prescribing or the exchange of clinical patient information. Lack of resources was negatively associated with physician perception of quality of care. Conclusion: Since health IT is an important foundation of PCMH, patient-centered practices are more likely to have health IT in place to support care delivery. However, despite its potential to enhance delivery of primary care, simply making health IT available does not necessarily translate into physicians’ perceptions that it enhances the quality of care they provide. It is critical for health-care managers and policy makers to ensure that primary care physicians fully recognize and embrace the use of new technology to improve both the quality of care provided and the patient outcomes.

  17. Stanniocalcin-1 Potently Inhibits the Proteolytic Activity of the Metalloproteinase Pregnancy-associated Plasma Protein-A

    DEFF Research Database (Denmark)

    Kløverpris, Søren; Mikkelsen, Jakob Hauge; Pedersen, Josefine Hvidkjær

    2015-01-01

    regulation in these species. Several physiological functions of STC1 have been reported, although many molecular details are still lacking. We here demonstrate that STC1 is an inhibitor of the metzincin metalloproteinase, pregnancy-associated plasma protein-A (PAPP-A), which modulates insulin-like growth...... that the homologous STC2 inhibits PAPP-A proteolytic activity, and that this depends on the formation of a covalent complex between the inhibitor and the proteinase, mediated by Cys-120 of STC2. We find that STC1 is unable to bind covalently to PAPP-A, in agreement with the absence of a corresponding cysteine residue....... It rather binds to PAPP-A with high affinity (KD = 75 pm). We further demonstrate that both STC1 and STC2 show inhibitory activity toward PAPP-A2, but not selected serine proteinases and metalloproteinases. We therefore conclude that the STCs are proteinase inhibitors, probably restricted in specificity...

  18. Calcine Waste Storage at the Idaho Nuclear Technology and Engineering Center

    Energy Technology Data Exchange (ETDEWEB)

    M. D. Staiger

    1999-06-01

    A potential option in the program for long-term management of high-level wastes at the Idaho Nuclear Technology and Engineering Center (INTEC), at the Idaho National Engineering and Environmental Laboratory, calls for retrieving calcine waste and converting it to a more stable and less dispersible form. An inventory of calcine produced during the period December 1963 to May 1999 has been prepared based on calciner run, solids storage facilities operating, and miscellaneous operational information, which gives the range of chemical compositions of calcine waste stored at INTEC. Information researched includes calciner startup data, waste solution analyses and volumes calcined, calciner operating schedules, solids storage bin capacities, calcine storage bin distributor systems, and solids storage bin design and temperature monitoring records. Unique information on calcine solids storage facilities design of potential interest to remote retrieval operators is given.

  19. Funding and Strategic Alignment Guidance for Infusing Small Business Innovation Research Technology Into Science Mission Directorate Projects at Glenn Research Center for 2015

    Science.gov (United States)

    Nguyen, Hung D.; Steele, Gynelle C.

    2016-01-01

    This report is intended to help NASA program and project managers incorporate Glenn ResearchCenter Small Business Innovation Research/Small Business Technology Transfer (SBIR)/(STTR)technologies into NASA Science Mission Directorate (SMD) programs/projects. Other Government and commercial project managers can also find this useful.

  20. The Effects of Information Technology on Library and Documentation Centers: A Review of Social, Structural, Managerial and Functional Aspects

    Directory of Open Access Journals (Sweden)

    Mesut Kurulgan

    2013-11-01

    Full Text Available In the context of protecting academic and cultural heritage, the purpose of libraries and information and documentation centers is to research, document, and archive and to transfer to future generations, domestically and internationally, a society ’s culture. This study examines the structural, functional and administrative innovations that have resulted from the implementation of information technology (IT in libraries since the 1990 ’s. The study also mentions how IT can be used in an efficient way in libraries and information and documentation centers.

  1. Academic Medical Centers as digital health catalysts.

    Science.gov (United States)

    DePasse, Jacqueline W; Chen, Connie E; Sawyer, Aenor; Jethwani, Kamal; Sim, Ida

    2014-09-01

    Emerging digital technologies offer enormous potential to improve quality, reduce cost, and increase patient-centeredness in healthcare. Academic Medical Centers (AMCs) play a key role in advancing medical care through cutting-edge medical research, yet traditional models for invention, validation and commercialization at AMCs have been designed around biomedical initiatives, and are less well suited for new digital health technologies. Recently, two large bi-coastal Academic Medical Centers, the University of California, San Francisco (UCSF) through the Center for Digital Health Innovation (CDHI) and Partners Healthcare through the Center for Connected Health (CCH) have launched centers focused on digital health innovation. These centers show great promise but are also subject to significant financial, organizational, and visionary challenges. We explore these AMC initiatives, which share the following characteristics: a focus on academic research methodology; integration of digital technology in educational programming; evolving models to support "clinician innovators"; strategic academic-industry collaboration and emergence of novel revenue models. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Stanniocalcin 1 binds hemin through a partially conserved heme regulatory motif

    International Nuclear Information System (INIS)

    Westberg, Johan A.; Jiang, Ji; Andersson, Leif C.

    2011-01-01

    Highlights: → Stanniocalcin 1 (STC1) binds heme through novel heme binding motif. → Central iron atom of heme and cysteine-114 of STC1 are essential for binding. → STC1 binds Fe 2+ and Fe 3+ heme. → STC1 peptide prevents oxidative decay of heme. -- Abstract: Hemin (iron protoporphyrin IX) is a necessary component of many proteins, functioning either as a cofactor or an intracellular messenger. Hemoproteins have diverse functions, such as transportation of gases, gas detection, chemical catalysis and electron transfer. Stanniocalcin 1 (STC1) is a protein involved in respiratory responses of the cell but whose mechanism of action is still undetermined. We examined the ability of STC1 to bind hemin in both its reduced and oxidized states and located Cys 114 as the axial ligand of the central iron atom of hemin. The amino acid sequence differs from the established (Cys-Pro) heme regulatory motif (HRM) and therefore presents a novel heme binding motif (Cys-Ser). A STC1 peptide containing the heme binding sequence was able to inhibit both spontaneous and H 2 O 2 induced decay of hemin. Binding of hemin does not affect the mitochondrial localization of STC1.

  3. How Do You Keep 'Em down on the Farm after They've Seen Technology? The Stone Barns Center for Food and Agriculture

    Science.gov (United States)

    Donlevy, Jim

    2004-01-01

    In an age dominated by technology, teachers are challenged as never before to help students understand the deep connections they share with people from earlier times and nowhere is this more dramatically revealed than in basic farm life. This article discusses the Stone Barns Center for Food and Agriculture and describes technology use that…

  4. Stirling Convertor Performance Mapping Test Results for Future Radioisotope Power Systems

    Science.gov (United States)

    Qiu, Songgang; Peterson, Allen A.; Faultersack, Franklyn D.; Redinger, Darin L.; Augenblick, John E.

    2004-02-01

    Long-life radioisotope-fueled generators based on free-piston Stirling convertors are an energy-conversion solution for future space applications. The high efficiency of Stirling machines makes them more attractive than the thermoelectric generators currently used in space. Stirling Technology Company (STC) has been performance-testing its Stirling generators to provide data for potential system integration contractors. This paper describes the most recent test results from the STC RemoteGen™ 55 W-class Stirling generators (RG-55). Comparisons are made between the new data and previous Stirling thermodynamic simulation models. Performance-mapping tests are presented including variations in: internal charge pressure, cold end temperature, hot end temperature, alternator temperature, input power, and variation of control voltage.

  5. Sp1 is a transcription repressor to stanniocalcin-1 expression in TSA-treated human colon cancer cells, HT29.

    Science.gov (United States)

    Law, Alice Y S; Yeung, B H Y; Ching, L Y; Wong, Chris K C

    2011-08-01

    Our previous study demonstrated that, stanniocalcin-1 (STC1) was a target of histone deacetylase (HDAC) inhibitors and was involved in trichostatin A (TSA) induced apoptosis in the human colon cancer cells, HT29. In this study, we reported that the transcriptional factor, specificity protein 1 (Sp1) in association with retinoblastoma (Rb) repressed STC1 gene transcription in TSA-treated HT29 cells. Our data demonstrated that, a co-treatment of the cells with TSA and Sp1 inhibitor, mithramycin A (MTM) led to a marked synergistic induction of STC1 transcript levels, STC1 promoter (1 kb)-driven luciferase activity and an increase of apoptotic cell population. The knockdown of Sp1 gene expression in TSA treated cells, revealed the repressor role of Sp1 in STC1 transcription. Using a protein phosphatase inhibitor okadaic acid (OKA), an increase of Sp1 hyperphosphorylation and so a reduction of its transcriptional activity, led to a significant induction of STC1 gene expression. Chromatin immunoprecipitation (ChIP) assay revealed that Sp1 binding on STC1 proximal promoter in TSA treated cells. The binding of Sp1 to STC1 promoter was abolished by the co-treatment of MTM or OKA in TSA-treated cells. Re-ChIP assay illustrated that Sp1-mediated inhibition of STC1 transcription was associated with the recruitment of another repressor molecule, Rb. Collectively our findings identify STC1 is a downstream target of Sp1. Copyright © 2011 Wiley-Liss, Inc.

  6. Remediation of cadmium-contaminated soil by extraction with para-sulphonato-thiacalix[4]arene, a novel supramolecular receptor

    International Nuclear Information System (INIS)

    Li Yushuang; Hu Xiaojun; Song Xueying; Sun Tieheng

    2012-01-01

    Batch extractions were conducted to evaluate the performance of para-sulphonato-thiacalix[4]arene (STC[4]A), a novel supramolecular receptor, for removing cadmium (Cd) from soil. The extraction mechanism was investigated by determination of the conditional stability constants (log K) of the STC[4]A-Cd complex. The influences of various variables were examined, including pH, contact time, and extractant concentration. The Cd extraction efficiency increased with increasing pH, reaching the maximum at pH 11 and then declining at higher pH values. This pH dependence was explained by the variation in the log K value of the STC[4]A-Cd complex along with pH change. When the STC[4]A dose was increased to an STC[4]A:Cd molar ratio of 2.5:1, Cd was exhaustively removed (up to 96.8%). The comparison experiment revealed that the Cd extraction performance of STC[4]A was almost equivalent to that of EDTA and significantly better than that of natural organic acids. STC[4]A extraction could efficiently prevent co-dissolution of soil minerals. - Highlights: ► First report on para-sulphonato-thiacalix[4]arene (STC[4]A) as extractant for soil washing. ► The Cd extraction performance of STC[4]A was almost equivalent to that of EDTA. ► STC[4]A extraction could efficiently avoid the dissolution of soil minerals, such as K, Ca, Mn. ► Extraction mechanism was investigated by determination of log K values of STC[4]A-Cd complex. ► A rational explanation for the pH dependence of extraction performance was given. - This is the first report on para-sulphonato-thiacalix[4]arene as an extractant for soil washing, which proved to be very efficient for Cd removal and could prevent co-dissolution of soil minerals.

  7. Cloud networking understanding cloud-based data center networks

    CERN Document Server

    Lee, Gary

    2014-01-01

    Cloud Networking: Understanding Cloud-Based Data Center Networks explains the evolution of established networking technologies into distributed, cloud-based networks. Starting with an overview of cloud technologies, the book explains how cloud data center networks leverage distributed systems for network virtualization, storage networking, and software-defined networking. The author offers insider perspective to key components that make a cloud network possible such as switch fabric technology and data center networking standards. The final chapters look ahead to developments in architectures

  8. FBR Plant Engineering Center annual report 2012

    International Nuclear Information System (INIS)

    2013-12-01

    This annual report shows the last year's R and D activities of currently-reorganized FBR Plant Engineering Center, which was established on April 1, 2009. FBR Safety Technology Center was founded on April 1, 2013 by the consolidation of both the activities of 'former FBR Plant Engineering Center' and a portion of 'FBR Safety Evaluation Unit, Advanced Nuclear System Research and Development Directorate', especially concentrating on safety evaluations and analyses for severe accidents. As for FBR safety technology, it is necessary to continuously make an effort for compliance with new safety regulations in preparation for 'Monju' to restart, for safety enhancement evaluation and for safety technology upgrading. In this context, the new organization was founded in order to reinforce the safety evaluation capability, which will surely and steadily promote FBR safety-technology related activities. As a result, FBR Plant Engineering Center was abolished. This report summarizes the R and D activities at the former FBR Plant Engineering Center, aiming at contributing to the commercialization by using operation experiences and technology development results derived from the actual reactor 'Monju'. The activities are divided into five areas of operation-and-maintenance engineering, sodium engineering, reactor-core-and-fuel engineering, plant engineering, and safety engineering. This annual report is intended for a report of the activities of individual researcher in the center rather than that of the progress of the center as a whole. This will clarify the individual themes, progresses and problems of each researcher, which will, hopefully, facilitate communication with the outside researchers. (author)

  9. A Measurement Management Technology for Improving Energy Efficiency in Data Centers and Telecommunication Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Hendrik Hamann, Levente Klein

    2012-06-28

    Data center (DC) electricity use is increasing at an annual rate of over 20% and presents a concern for the Information Technology (IT) industry, governments, and the society. A large fraction of the energy use is consumed by the compressor cooling to maintain the recommended operating conditions for IT equipment. The most common way to improve the DC efficiency is achieved by optimally provisioning the cooling power to match the global heat dissipation in the DC. However, at a more granular level, the large range of heat densities of today's IT equipment makes the task of provisioning cooling power optimized to the level of individual computer room air conditioning (CRAC) units much more challenging. Distributed sensing within a DC enables the development of new strategies to improve energy efficiency, such as hot spot elimination through targeted cooling, matching power consumption at rack level with workload schedule, and minimizing power losses. The scope of Measurement and Management Technologies (MMT) is to develop a software tool and the underlying sensing technology to provide critical decision support and control for DC and telecommunication facilities (TF) operations. A key aspect of MMT technology is integration of modeling tools to understand how changes in one operational parameter affect the overall DC response. It is demonstrated that reduced ordered models for DC can generate, in less than 2 seconds computational time, a three dimensional thermal model in a 50 kft{sup 2} DC. This rapid modeling enables real time visualization of the DC conditions and enables 'what if' scenarios simulations to characterize response to 'disturbances'. One such example is thermal zone modeling that matches the cooling power to the heat generated at a local level by identifying DC zones cooled by a specific CRAC. Turning off a CRAC unit can be simulated to understand how the other CRAC utilization changes and how server temperature responds

  10. Public Communication of Science and Technology in Museums and Interactive Centers in MedellÍn (Colombia

    Directory of Open Access Journals (Sweden)

    Silvia Inés Jiménez-G.

    2010-01-01

    Full Text Available Following the simple and complex deficit and democratic model approaches, this paper analyses the communication strategies applied in several museums and interactive centers —Parque Explora, Museo Interactivo Empresas Públicas de Medellín, Planetario Jesús Emilio Ramírez and Museo Universitario from the University of Antioquia in the city of Medellín—. We argue that communicating scientific and technological developments at a conjunctural moment —because of the pressure exerted by the demand side to bring knowledge within the reach of the man in the street— involves recognizing science and technology issues should not be conveyed in a language increasingly distanced from layman’s understanding and should allow for citizens’ critical thinking formation face to techno-scientific developments. By analysing the communication approaches mentioned above, we found significant obstacles to be overcome in the communication strategies applied by museum staff in order to come to an understanding of science and technology.

  11. Technology Development and Innovation | Wind | NREL

    Science.gov (United States)

    Technology Development and Innovation Technology Development and Innovation Technology Development Technology Center (NWTC) supports efforts to reduce bird and bat fatalities at wind energy projects and photo of wind turbines at the National Wind Technology Center. Wildlife technology research and

  12. Bridging the digital divide by increasing computer and cancer literacy: community technology centers for head-start parents and families.

    Science.gov (United States)

    Salovey, Peter; Williams-Piehota, Pamela; Mowad, Linda; Moret, Marta Elisa; Edlund, Denielle; Andersen, Judith

    2009-01-01

    This article describes the establishment of two community technology centers affiliated with Head Start early childhood education programs focused especially on Latino and African American parents of children enrolled in Head Start. A 6-hour course concerned with computer and cancer literacy was presented to 120 parents and other community residents who earned a free, refurbished, Internet-ready computer after completing the program. Focus groups provided the basis for designing the structure and content of the course and modifying it during the project period. An outcomes-based assessment comparing program participants with 70 nonparticipants at baseline, immediately after the course ended, and 3 months later suggested that the program increased knowledge about computers and their use, knowledge about cancer and its prevention, and computer use including health information-seeking via the Internet. The creation of community computer technology centers requires the availability of secure space, capacity of a community partner to oversee project implementation, and resources of this partner to ensure sustainability beyond core funding.

  13. Impact of Mobile Dose-Tracking Technology on Medication Distribution at an Academic Medical Center.

    Science.gov (United States)

    Kelm, Matthew; Campbell, Udobi

    2016-05-01

    Medication dose-tracking technologies have the potential to improve efficiency and reduce costs associated with re-dispensing doses reported as missing. Data describing this technology and its impact on the medication use process are limited. The purpose of this study is to assess the impact of dose-tracking technology on pharmacy workload and drug expense at an academic, acute care medical center. Dose-tracking technology was implemented in June 2014. Pre-implementation data were collected from February to April 2014. Post-implementation data were collected from July to September 2014. The primary endpoint was the percent of re-dispensed oral syringe and compounded sterile product (CSP) doses within the pre- and post-implementation periods per 1,000 discharges. Secondary endpoints included pharmaceutical expense generated from re-dispensing doses, labor costs, and staff satisfaction with the medication distribution process. We observed an average 6% decrease in re-dispensing of oral syringe and CSP doses from pre- to post-implementation (15,440 vs 14,547 doses; p = .047). However, when values were adjusted per 1,000 discharges, this trend did not reach statistical significance (p = .074). Pharmaceutical expense generated from re-dispensing doses was significantly reduced from pre- to post-implementation ($834,830 vs $746,466 [savings of $88,364]; p = .047). We estimated that $2,563 worth of technician labor was avoided in re-dispensing missing doses. We also saw significant improvement in staff perception of technology assisting in reducing missing doses (p = .0003), as well as improvement in effectiveness of resolving or minimizing missing doses (p = .01). The use of mobile dose-tracking technology demonstrated meaningful reductions in both the number of doses re-dispensed and cost of pharmaceuticals dispensed.

  14. Assessing consumer benefits of selected gas appliance technology center tasks. Topical report, April-December 1992

    International Nuclear Information System (INIS)

    Smith, T.R.; Bournakis, A.D.; Worek, W.M.; Kalensky, D.C.; Dombrowski, L.P.

    1992-12-01

    The Gas Appliance Technology Center (GATC) was created in 1983 to assist the gas industry in bringing about a new generation of reasonably priced, advanced gas appliances. The objective of the report is to evaluate consumer benefits of sixteen selected GATC tasks for the time period between 1983 and 1990. Tasks were selected for review based upon their degree of industry impact and how well they represented activities in the four targeted research areas of Space Conditioning, Commercial Appliances, Residential Appliances, and Codes and Standards

  15. PACS strategy for imaging centers.

    Science.gov (United States)

    Bedel, Victoria; Zdanowicz, Mark

    2004-01-01

    Picture archiving and communications systems (PACS) have been available in imaging centers for many years, but they often were less functional, were not well integrated into patient information systems, and lacked the network backbone to implement a system. As modalities are replaced and technology improves, the ability and time for an imaging center to acquire, integrate, and utilize PACS has arrived. However, each imaging center must determine why it should invest in PACS. A business plan is the fundamental need. Each imaging center must understand its target market, growth rate, and staffing plans. Additional considerations lie in current and future modality availability, the need for offsite delivery of images and reports, and the potential need for remote transmission of images. These issues must be identified and prioritized. A multidisciplinary team is essential. The most successful PACS implementation begins with complete involvement from all levels. The team should be comprised of people with complementary skills who are committed to a common purpose, set of performance goals, and approach for which they hold themselves mutually accountable. The team must jointly decide on the project's objectives. These objectives fall under 4 categories: clinical, service, financial, and performance. PACS must be considered a tool to help accomplish each objective. The imaging center must determine its top priorities, then translate them into a technology "wish list." The center can then list those pieces of technology that are most important and prioritize them. There are even more considerations for connecting multiple imaging centers. The team must create a comprehensive request for proposal (RFP) and determine the vendors that will receive the document. Once the RFP responses have been received and the vendor has been selected, an effective training plan must be executed. Training plans should be competency-based, ensuring comfort and competency among all staff. Upon

  16. Results of Occupational Monitoring Program in Technologic Navy Center in Sao Paulo

    International Nuclear Information System (INIS)

    Perez, Clarice F.A.; Bitelli, Ricardo D.; Oliveira, Rodemir

    2013-01-01

    The CTMSP, Centro Tecnologico da Marinha em Sao Paulo, is a nuclear research Center located in the State of Sao Paulo. CTMSP headquarters is placed at the Campus of the University of Sao Paulo. Most of CTMSP nuclear facilities are at the Centro Experimental Aramar (CEA), located 120 km northwest from the Capital city of Sao Paulo. CTMSP has two major nuclear programs. One is the development of a PWR reactor for naval propulsion, and the other is associated with the front end fuel cycle technology comprising enrichment, conversion and reconversion. These activities require an extensive area monitoring program. This paper presents the results of this program covering the years of 2003 to 2011. The results include surface monitoring, dose rates and uranium concentrations in the air. (author)

  17. Proposal of an Observatory of Trends for Nanotechnology in the Context of Technology Management in an Oil and Gas R&D Center – Case: Nanotechnology

    Directory of Open Access Journals (Sweden)

    Viviane Masseran Antunes Parreiras

    2013-12-01

    Full Text Available The paper presents basic concepts on nanotechnology and the use of this in an oil and gas research and development (R&D center, the Research and Development Center Leopoldo Américo Miguez de Mello of Petrobras (CENPES. The aim of this paper is to present a proposal of an observatory of trends in the area of nanotechnology at CENPES, to generate information, such as the state of the art technologies, technological trajectories, movements of competitors and partners, and aspects relating to regulations and incentives for decision making in the technology management process. The model consists of five steps that should occur in a continuous cycle: literature review, expert consultation, analysis of opportunities and threats, timelines or roadmaps, and monitoring. In conclusion, the proposed observatory includes a set of topics (variables, sources, techniques of competitive technical intelligence and technological foresight, systematized in order to support decision making in technology management.

  18. 2017 Technology Showcase Presentations | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Presentations from the 2017 Technology Showcase by NIH Intramural Research Program scientists held at Frederick National Laboratories for Cancer Research on June 7, 2017. | [google6f4cd5334ac394ab.html

  19. Use of qualitative methods and user-centered design to develop customized health information technology tools within federally qualified health centers to keep children insured.

    Science.gov (United States)

    DeVoe, Jennifer; Angier, Heather; Likumahuwa, Sonja; Hall, Jennifer; Nelson, Christine; Dickerson, Kay; Keller, Sara; Burdick, Tim; Cohen, Deborah

    2014-01-01

    Lack of health insurance negatively impacts children's health. Despite federal initiatives to expand children's coverage and accelerate state outreach efforts, millions of US children remain uninsured or experience frequent gaps in coverage. Most current efforts to enroll and retain eligible children in public insurance programs take place outside of the health care system. This study is a partnership between patients' families, medical informaticists, federally qualified health center (FQHC) staff, and researchers to build and test information technology tools to help FQHCs reach uninsured children and those at risk for losing coverage.

  20. Test results and commercialization plans for long life Stirling generators

    International Nuclear Information System (INIS)

    Erbeznik, R.M.; White, M.A.

    1996-01-01

    Many optimistic predictions regarding commercialization of Stirling engines have been announced over the years, but to date no real successes have emerged. STC is excited to announce the availability of beta prototypes for its RemoteGen trademark family of free-piston Stirling generators. STC is working with suppliers, manufacturers, and beta customers to commercialize the RemoteGen family of generators. STC is proving that these machines overcome previously inhibiting barriers by providing long life, high reliability, cost effective mass production, and market relevance. Stirling power generators are generally acknowledged to offer much higher conversion efficiencies than direct energy conversion systems. Life and reliability, on the other hand, are generally considered superior for direct conversion systems, as established by the exceptional endurance records (though with degradation) for thermoelectric (TE) and photovoltaic (PV) systems. STC's unique approaches combine dynamic system efficiency with static system reliability. The RemoteGen family presently includes a 10-watt RG-10, a 350-watt RG-350, and with 1-kW and 3-kW sizes planned for the future. They all use the same basic configuration with flexure bearings, clearance seals, and moving iron linear alternators. The third generation RG-10 has entered limited production with a radioisotope-fueled version, and a niche market for a propane-fueled version has been identified. Market analysis has led STC to focus on early commercial production of the RG-350. The linear alternator power module portion of the RG-350 is also used in its sister BeCool trademark family of coolers as the linear motor. By using a common power module, both programs will benefit by each other's commercialization efforts. The technology behind the RemoteGen generators, test results, and plans for commercialization are described in this paper

  1. Stanniocalcin 1 binds hemin through a partially conserved heme regulatory motif

    Energy Technology Data Exchange (ETDEWEB)

    Westberg, Johan A., E-mail: johan.westberg@helsinki.fi [Department of Pathology, Haartman Institute, University of Helsinki and HUSLAB, P.O. Box 21, Haartmaninkatu 3, FI-00014 Helsinki (Finland); Jiang, Ji, E-mail: ji.jiang@helsinki.fi [Department of Pathology, Haartman Institute, University of Helsinki and HUSLAB, P.O. Box 21, Haartmaninkatu 3, FI-00014 Helsinki (Finland); Andersson, Leif C., E-mail: leif.andersson@helsinki.fi [Department of Pathology, Haartman Institute, University of Helsinki and HUSLAB, P.O. Box 21, Haartmaninkatu 3, FI-00014 Helsinki (Finland)

    2011-06-03

    Highlights: {yields} Stanniocalcin 1 (STC1) binds heme through novel heme binding motif. {yields} Central iron atom of heme and cysteine-114 of STC1 are essential for binding. {yields} STC1 binds Fe{sup 2+} and Fe{sup 3+} heme. {yields} STC1 peptide prevents oxidative decay of heme. -- Abstract: Hemin (iron protoporphyrin IX) is a necessary component of many proteins, functioning either as a cofactor or an intracellular messenger. Hemoproteins have diverse functions, such as transportation of gases, gas detection, chemical catalysis and electron transfer. Stanniocalcin 1 (STC1) is a protein involved in respiratory responses of the cell but whose mechanism of action is still undetermined. We examined the ability of STC1 to bind hemin in both its reduced and oxidized states and located Cys{sup 114} as the axial ligand of the central iron atom of hemin. The amino acid sequence differs from the established (Cys-Pro) heme regulatory motif (HRM) and therefore presents a novel heme binding motif (Cys-Ser). A STC1 peptide containing the heme binding sequence was able to inhibit both spontaneous and H{sub 2}O{sub 2} induced decay of hemin. Binding of hemin does not affect the mitochondrial localization of STC1.

  2. Hypoxic preconditioning induces neuroprotective stanniocalcin-1 in brain via IL-6 signaling

    DEFF Research Database (Denmark)

    Westberg, Johan A; Serlachius, Martina; Lankila, Petri

    2007-01-01

    BACKGROUND AND PURPOSE: Exposure of animals for a few hours to moderate hypoxia confers relative protection against subsequent ischemic brain damage. This phenomenon, known as hypoxic preconditioning, depends on new RNA and protein synthesis, but its molecular mechanisms are poorly understood...... originally reported expression of mammalian STC-1 in brain neurons and showed that STC-1 guards neurons against hypercalcemic and hypoxic damage. METHODS: We treated neural Paju cells with IL-6 and measured the induction of STC-1 mRNA. In addition, we quantified the effect of hypoxic preconditioning on Stc-1...... mRNA levels in brains of wild-type and IL-6 deficient mice. Furthermore, we monitored the Stc-1 response in brains of wild-type and transgenic mice, overexpressing IL-6 in the astroglia, before and after induced brain injury. RESULTS: Hypoxic preconditioning induced an upregulated expression of Stc...

  3. An Analysis of Information Technology Adoption by IRBs of Large Academic Medical Centers in the United States.

    Science.gov (United States)

    He, Shan; Botkin, Jeffrey R; Hurdle, John F

    2015-02-01

    The clinical research landscape has changed dramatically in recent years in terms of both volume and complexity. This poses new challenges for Institutional Review Boards' (IRBs) review efficiency and quality, especially at large academic medical centers. This article discusses the technical facets of IRB modernization. We analyzed the information technology used by IRBs in large academic institutions across the United States. We found that large academic medical centers have a high electronic IRB adoption rate; however, the capabilities of electronic IRB systems vary greatly. We discuss potential use-cases of a fully exploited electronic IRB system that promise to streamline the clinical research work flow. The key to that approach utilizes a structured and standardized information model for the IRB application. © The Author(s) 2014.

  4. Partnering Events | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Our team of technology transfer specialists has specialized training in invention reporting, patenting, patent strategy, executing technology transfer agreements and marketing. TTC is comprised of professionals with diverse legal, scientific, and business/marketing expertise. Most of our staff hold doctorate-level technical and/or legal training.

  5. Ames Research Center Research and Technology 2000

    Science.gov (United States)

    2002-01-01

    This report highlights the challenging work accomplished during fiscal year 2000 by Ames research scientists,engineers, and technologists. It discusses research and technologies that enable the Information Age, that expand the frontiers of knowledge for aeronautics and space, and that help to maintain U.S. leadership in aeronautics and space research and technology development. The accomplishments are grouped into four categories based on four of NASA's Strategic Enterprises: Aerospace Technology, Space Science, Biological and Physical Research, and Earth Science. The primary purpose of this report is to communicate knowledge-to inform our stakeholders, customer, and partners, and the people of the United States about the scope and diversity of Ames' mission,the nature of Ames' research and technolog) activities,and the stimulating challenges ahead. The accomplishments cited illustrate the contributions that Ames is willing to improve the quality of life for our citizens and the economic position of the United States in the world marketplace.

  6. Sponsorship and exhibitions at Nordic science centres and museums

    DEFF Research Database (Denmark)

    Davidsson, Eva; Sørensen, Helene

    2010-01-01

    Science and technology centres (STC) and science museums tend increasingly to rely on external economic support in order to create new exhibitions. But in what ways may the economic situation affect what is presented in their exhibitions? This article aims to explore how staff members consider...

  7. Integration of Cloud Technologies for Data Stewardship at the NOAA National Centers for Environmental Information (NCEI)

    Science.gov (United States)

    Casey, K. S.; Hausman, S. A.

    2016-02-01

    In the last year, the NOAA National Oceanographic Data Center (NODC) and its siblings, the National Climatic Data Center and National Geophysical Data Center, were merged into one organization, the NOAA National Centers for Environmental Information (NCEI). Combining its expertise under one management has helped NCEI accelerate its efforts to embrace and integrate private, public, and hybrid cloud environments into its range of data stewardship services. These services span a range of tiers, from basic, long-term preservation and access, through enhanced access and scientific quality control, to authoritative product development and international-level services. Throughout these tiers of stewardship, partnerships and pilot projects have been launched to identify technological and policy-oriented challenges, to establish solutions to these problems, and to highlight success stories for emulation during operational integration of the cloud into NCEI's data stewardship activities. Some of these pilot activities including data storage, access, and reprocessing in Amazon Web Services, the OneStop data discovery and access framework project, and a set of Cooperative Research and Development Agreements under the Big Data Project with Amazon, Google, IBM, Microsoft, and the Open Cloud Consortium. Progress in these efforts will be highlighted along with a future vision of how NCEI could leverage hybrid cloud deployments and federated systems across NOAA to enable effective data stewardship for its oceanographic, atmospheric, climatic, and geophysical Big Data.

  8. Bolivia. The new nuclear research center in El Alto

    International Nuclear Information System (INIS)

    Nogarin, Mauro

    2016-01-01

    Research reactors in Latin America have become a priority in public policy in the last decade. Bolivia wants to become the 8th country to implement peaceful nuclear technology in this area with the new Center for Research and Development in the Nuclear Technology. The Center will be the most advanced in Latin America. It will provide for a wide use of radiation technologies in agriculture, medicine, and industry. After several negotiations Bolivia and the Russian Federation signed the Intergovernmental Agreement on cooperation in the peaceful use of atomic energy and the construction of the Nuclear Research and Technology Center.

  9. Bolivia. The new nuclear research center in El Alto

    Energy Technology Data Exchange (ETDEWEB)

    Nogarin, Mauro

    2016-05-15

    Research reactors in Latin America have become a priority in public policy in the last decade. Bolivia wants to become the 8th country to implement peaceful nuclear technology in this area with the new Center for Research and Development in the Nuclear Technology. The Center will be the most advanced in Latin America. It will provide for a wide use of radiation technologies in agriculture, medicine, and industry. After several negotiations Bolivia and the Russian Federation signed the Intergovernmental Agreement on cooperation in the peaceful use of atomic energy and the construction of the Nuclear Research and Technology Center.

  10. HEMISPHERIC CENTER FOR ENVIRONMENTAL TECHNOLOGY

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian

    1999-09-30

    The Princeton Plasma Physics Laboratory (PPPL) demonstration of the diamond wire cutting technology on the surrogate of the Tokamak Fusion Test Reactor (TFTR), Figure 1, was performed from August 23-September 3, 1999. The plated diamond wire, Figure 2, was successful in cutting through all components of the TFTR surrogate including stainless steel, inconel and graphite. The demonstration tested three different void fill materials (mortar with sand, Rheocell-15, and foam) and three cooling systems (water, air, and liquid nitrogen). The optimum combination was determined to be the use of the low-density concrete void fill, Rheocell-15 with an average density of 52 lbs/ft{sup 3}, using a water coolant. However, the liquid nitrogen performed better than expected with only minor problems and was considered to be a successful demonstration of the Bluegrass Concrete Cutting, Inc. proprietary liquid-nitrogen coolant system. Data from the demonstration is being calculated and a summary of the technology demonstration will be included in the October monthly report. An ITSR will be written comparing the diamond wire saw to the plasma arc (baseline) technology. The MTR Chemical Protective Suit, a proprietary new suit from Kimberly Clark, was evaluated from 8/9/99 to 8/12/99 at Beaver, WV. This particular suit was tested on subjects performing three different tasks: climbing through a horizontal confined space, vertical confined space (pit), and loading and unloading material using a wheel barrow. Multiple test subjects performed each task for 20 minutes each. Performance of the innovative suit was compared to two commonly used types of protective clothing. Vital statistics, including body temperature and heart rate, were continuously monitored and recorded by an authorized physician. A summary of the demonstration will be included in the October monthly report. Along with the MTR Chemical Protective Suit, the VitalSense{trademark} Telemetric Monitoring System from Mini Mitter

  11. About TTC | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    The TTC facilitates licensing and co-development partnerships between biomedical industry, academia, and government agencies and the research laboratories of the NCI and nine other institutes and centers of NIH.

  12. The Use of Assessment Center Technology for the Prevention and Reduction of Professional Burnout

    Directory of Open Access Journals (Sweden)

    Stalnova I.A.,

    2014-08-01

    Full Text Available Dynamism of professional activity, increasing workload and working time shortage, high social responsibility for results and other factors increase the probability of formation of burnout in government employees. This actualizes the search for new forms and methods of professional qualification of government employees based on an assessment of their psychological qualities. We discuss the problem of professional and personal burnout in Rosreestr employees, reveal the symptoms of this syndrome. As a tool for preventing and reducing the negative impact of professional deformation in Rosreestr workers, we propose the use of assessment center technology successfully tested in the international practice and requiring adaptation to Russian realities.

  13. Development of Technological Profiles for Transfer of Energy- and Resource Saving Technologies

    Directory of Open Access Journals (Sweden)

    Lysenko, V.S.

    2015-01-01

    Full Text Available The article deals with the methodological foundations for the development of technological profiles for «System of Transfer of Energy- and Resource Saving Technologies». It is determined that a compliance with the methodology and standards of the European network «Relay Centers» (Innovation Relay Centers — IRC network, since 2008 — EEN, the Russian Technology Transfer Network RTTN and Uk rainian Technology Transfer Network UTTN is the main pri nciple of the development process of technological requests and offers.

  14. Establishing the functional connectivity of the frontotemporal network in pre-attentive change detection with Transcranial Magnetic Stimulation and event-related optical signal.

    Science.gov (United States)

    Tse, Chun-Yu; Long-Yin, Yip; Lui, Troby Ka-Yan; Xiao, Xue-Zhen; Wang, Yang; Chu, Winnie Chiu Wing; Parks, Nathan Allen; Chan, Sandra Sau-Man; Neggers, Sebastiaan Franciscus Wijnandus

    2018-06-18

    Current theories of pre-attentive deviant detection postulate that before the Superior Temporal Cortex (STC) detects a change, the Inferior Frontal Cortex (IFC) engages in stimulus analysis, which is particularly critical for ambiguous deviations (e.g., deviant preceded by a short train of standards). These theories rest on the assumption that IFC and STC are functionally connected, which has only been supported by correlational brain imaging studies. We examined this functional connectivity assumption by applying Transcranial Magnetic Stimulation (TMS) to disrupt IFC function, while measuring the later STC mismatch response with the event-related optical signal (EROS). EROS can localize brain activity in both spatial and temporal dimensions via measurement of optical property changes associated with neuronal activity, and is inert to the electromagnetic interference produced by TMS. Specifically, the STC mismatch response at 120-180 ms elicited by a deviant preceded by a short standard train when IFC TMS was applied at 80 ms was compared with the STC mismatch responses in temporal control (TMS with 200 ms delay), spatial control (sham TMS at vertex), auditory control (TMS pulse noise only), and cognitive control (deviant preceded by a long standard train) conditions. The STC mismatch response to deviants preceded by the short train was abolished by TMS of the IFC at 80 ms, while the STC responses remained intact in all other control conditions. These results confirm the involvement of the IFC in the STC mismatch response and support a functional connection between IFC and STC. Copyright © 2018. Published by Elsevier Inc.

  15. Synergistic effect of p53 on TSA-induced stanniocalcin 1 expression in human nasopharyngeal carcinoma cells, CNE2.

    Science.gov (United States)

    Ching, L Y; Yeung, Bonnie H Y; Wong, Chris K C

    2012-06-01

    Human stanniocalcin 1 (STC1) has recently been identified as a putative protein factor involved in cellular apoptosis. The use of histone deacetylase inhibitor (i.e. trichostatin A (TSA)) and doxorubicin (Dox) is one of the common treatment methods to induce apoptosis in human cancer cells. A study on TSA and Dox-mediated apoptosis may shed light on the regulation and function of STC1 in cancer treatment. In this study, TSA and Dox cotreatment in human nasopharyngeal carcinoma cells (CNE2) elicited synergistic effects on STC1 gene expression and cellular apoptosis. An activation of p53 (TP53) transcriptional activity in Dox- or Dox+TSA-treated cells was revealed by the increased expression levels of p53 mRNA/protein as well as p53-driven luciferase activities. To elucidate the possible involvement of p53 in STC1 gene transcription, a vector expressing wild-type or dominant negative (DN) p53 was transiently transfected into the cells. Both STC1 promoter luciferase constructs and chromatin immunoprecipitation assays did not support the direct role of p53 in STC1 gene transactivation. However, the synergistic effects of p53 on the induction of NF-κB phosphorylation and the recruitment of acetylated histone H3 in STC1 promoter were observed in TSA-cotreated cells. The overexpression of exogenous STC1 sensitized apoptosis in Dox-treated cells. Taken together, this study provides data to show the cross talk of NF-κB, p53, and histone protein in the regulation of STC1 expression and function.

  16. Análise da função manual na síndrome do túnel do carpo

    OpenAIRE

    Mattos, Daniela Junckes da Silva

    2010-01-01

    Este estudo investigou efeito da Síndrome do Túnel do Carpo (STC) na função manual. Foram analisados os parâmetros da força de preensão e suas associações com as características da STC, bem como o controle da força de preensão de indivíduos com STC em tarefas funcionais e o efeito causado pela fadiga e peso do objeto. Foram avaliadas 13 mulheres com STC (GE) e 13 sem STC (GC) com idade de 43,54 ± 7,70 e 43,23 ± 7,89 anos, respectivamente. O GE foi classificado quando à gravidade dos sintomas ...

  17. Heart Information Center

    Science.gov (United States)

    ... Rounds Seminar Series & Daily Conferences Fellowships and Residencies School of Perfusion Technology Education Resources Library & Learning Resource Center CME Resources THI Journal THI Cardiac Society Register for the Cardiac Society ...

  18. Activities of the NEDO information center

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    Under the situation where items of information related to energy and industrial technologies (including environmental technologies) are diversified and internationalized, the NEDO Information Center opens its book and data rooms, performs database service and information exchange activities with other countries, and issues information journals. These activities are intended to respond accurately and quickly to users` information needs. This paper reports the result of operations during fiscal 1994. Retained and provided for public reading at the Center are 2,200 reports on results of research and development works having been carried out by NEDO, 3,800 books and data published inside and outside Japan mainly on new energies, and 190 kinds of periodical publications. The first nationwide geothermal result charts are also reproduced and sold. Technological literature and information prepared by IEA which have been obtained based on the energy technological data exchange treaty and the implementation treaty on establishment of IEA coal research have been recorded as the NEDO-EDBS and offered on line. This paper also introduces the optical databases. The agreement on the IEA Information Centers for the Analysis and Dissemination of Demonstrated Energy Technologies (CADDET) is also available. Descriptions are given also on activities of the Greenhouse Gas Technology Information Exchange (GREENTIE).

  19. Idaho Nuclear Technology and Engineering Center (INTEC) (formerly ICPP) ash reutilization study

    Energy Technology Data Exchange (ETDEWEB)

    Langenwalter, T.; Pettet, M.; Ochoa, R.; Jensen, S.

    1998-05-01

    Since 1984, the coal-fired plant at the Idaho Nuclear Technology and Engineering Center (INTEC, formerly Idaho Chemical Processing Plant) has been generating fly ash at a rate of approximately 1,000 tons per year. This ash is hydrated and placed in an ash bury pit near the coal-fired plant. The existing ash bury pit will be full in less than 1 year at its present rate of use. A conceptual design to build a new ash bury pit was completed, and the new pit is estimated to cost $1.7 million. This report evaluates ash reutilization alternatives that propose to eliminate this waste stream and save the $1.7 million required to build a new pit. The alternatives include using ash for landfill day cover, concrete admixture, flowable fill, soil stabilization, waste remediation, and carbon recovery technology. Both physical and chemical testing, under the guidance of the American Society for Testing and Materials, have been performed on ash from the existing pit and from different steps within the facility`s processes. The test results have been evaluated, compared to commercial ash, and are discussed as they relate to reutilization alternatives. This study recommends that the ash be used in flowable fill concrete for Deactivation and Demolition work at the Idaho National Engineering and Environmental Laboratory.

  20. Idaho Nuclear Technology and Engineering Center (INTEC) (formerly ICPP) ash reutilization study

    International Nuclear Information System (INIS)

    Langenwalter, T.; Pettet, M.; Ochoa, R.; Jensen, S.

    1998-05-01

    Since 1984, the coal-fired plant at the Idaho Nuclear Technology and Engineering Center (INTEC, formerly Idaho Chemical Processing Plant) has been generating fly ash at a rate of approximately 1,000 tons per year. This ash is hydrated and placed in an ash bury pit near the coal-fired plant. The existing ash bury pit will be full in less than 1 year at its present rate of use. A conceptual design to build a new ash bury pit was completed, and the new pit is estimated to cost $1.7 million. This report evaluates ash reutilization alternatives that propose to eliminate this waste stream and save the $1.7 million required to build a new pit. The alternatives include using ash for landfill day cover, concrete admixture, flowable fill, soil stabilization, waste remediation, and carbon recovery technology. Both physical and chemical testing, under the guidance of the American Society for Testing and Materials, have been performed on ash from the existing pit and from different steps within the facility's processes. The test results have been evaluated, compared to commercial ash, and are discussed as they relate to reutilization alternatives. This study recommends that the ash be used in flowable fill concrete for Deactivation and Demolition work at the Idaho National Engineering and Environmental Laboratory

  1. Remediation of cadmium-contaminated soil by extraction with para-sulphonato-thiacalix[4]arene, a novel supramolecular receptor.

    Science.gov (United States)

    Li, Yushuang; Hu, Xiaojun; Song, Xueying; Sun, Tieheng

    2012-08-01

    Batch extractions were conducted to evaluate the performance of para-sulphonato-thiacalix[4]arene (STC[4]A), a novel supramolecular receptor, for removing cadmium (Cd) from soil. The extraction mechanism was investigated by determination of the conditional stability constants (log K) of the STC[4]A-Cd complex. The influences of various variables were examined, including pH, contact time, and extractant concentration. The Cd extraction efficiency increased with increasing pH, reaching the maximum at pH 11 and then declining at higher pH values. This pH dependence was explained by the variation in the log K value of the STC[4]A-Cd complex along with pH change. When the STC[4]A dose was increased to an STC[4]A:Cd molar ratio of 2.5:1, Cd was exhaustively removed (up to 96.8%). The comparison experiment revealed that the Cd extraction performance of STC[4]A was almost equivalent to that of EDTA and significantly better than that of natural organic acids. STC[4]A extraction could efficiently prevent co-dissolution of soil minerals. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. Carolinas Energy Career Center

    Energy Technology Data Exchange (ETDEWEB)

    Classens, Anver; Hooper, Dick; Johnson, Bruce

    2013-03-31

    Central Piedmont Community College (CPCC), located in Charlotte, North Carolina, established the Carolinas Energy Career Center (Center) - a comprehensive training entity to meet the dynamic needs of the Charlotte region's energy workforce. The Center provides training for high-demand careers in both conventional energy (fossil) and renewable energy (nuclear and solar technologies/energy efficiency). CPCC completed four tasks that will position the Center as a leading resource for energy career training in the Southeast: • Development and Pilot of a New Advanced Welding Curriculum, • Program Enhancement of Non-Destructive Examination (NDE) Technology, • Student Support through implementation of a model targeted toward Energy and STEM Careers to support student learning, • Project Management and Reporting. As a result of DOE funding support, CPCC achieved the following outcomes: • Increased capacity to serve and train students in emerging energy industry careers; • Developed new courses and curricula to support emerging energy industry careers; • Established new training/laboratory resources; • Generated a pool of highly qualified, technically skilled workers to support the growing energy industry sector.

  3. External radiation levels in installations of nuclear technology center

    International Nuclear Information System (INIS)

    Maletta, Paulo Guilherme M.; Filipetto, Joao; Wakabayashi, Tetsuaki; Silva, Teogenes A. da

    2005-01-01

    The radiological protection is a basic activity of nuclear technology center so that can carry through its activities with security, having to be planned and executed with total effectiveness. One of the basic tools of the radiological protection is the adoption of monitoring programs, that have as objective generality to evaluate the radiological conditions of the workstation and to assure that these conditions are acceptable safe for the displayed individuals, either workers or members of the public, as established in the basic norms of radiological protection. The Centro de Desenvolvimento da Tecnologia Nuclear - CDTN, first institution in Brazil, created in 1952 to entirely dedicate the related works to the nuclear area, to own 39 building, of which they are kept the Triga Reactor, Irradiation Gamma Laboratory, Reject Laboratory, Calibration Dosemeters Laboratory and others. In such installations, radioactive materials are produced, handled, processed and stored, being necessary the levels of external radiation ambient monitoring. As part of the radioprotection plan, monitoring 63 points on strategically located in the external areas to the building of CDTN, using characterized and calibrated thermoluminescence dosemeters. This work describes the dose distribution of the points, the doses evaluation procedure and the 4 results carried through between 2001 and 2004. The data demonstrate the attendance to the level of security established in the basic norm, what it contributed for the operation licensing of to the IBAMA. (author)

  4. User-centered Technologies For Blind Children

    OpenAIRE

    Jaime Sánchez

    2008-01-01

    The purpose of this paper is to review, summarize, and illustrate research work involving four audio-based games created within a user-centered design methodology through successive usability tasks and evaluations. These games were designed by considering the mental model of blind children and their styles of interaction to perceive and process data and information. The goal of these games was to enhance the cognitive development of spatial structures, memory, haptic perception, mathe...

  5. Integrating heterogeneous healthcare call centers.

    Science.gov (United States)

    Peschel, K M; Reed, W C; Salter, K

    1998-01-01

    In a relatively short period, OHS has absorbed multiple call centers supporting different LOBs from various acquisitions, functioning with diverse standards, processes, and technologies. However, customer and employee satisfaction is predicated on OHS's ability to thoroughly integrate these heterogeneous call centers. The integration was initiated and has successfully progressed through a balanced program of focused leadership and a defined strategy which includes site consolidation, sound performance management philosophies, and enabling technology. Benefits have already been achieved with even more substantive ones to occur as the integration continues to evolve.

  6. Structural Integrity Program for the Calcined Solids Storage Facilities at the Idaho Nuclear Technology and Engineering Center

    International Nuclear Information System (INIS)

    Bryant, J.W.; Nenni, J.A.

    2003-01-01

    This report documents the activities of the structural integrity program at the Idaho Nuclear Technology and Engineering Center relevant to the high-level waste Calcined Solids Storage Facilities and associated equipment, as required by DOE M 435.1-1, ''Radioactive Waste Management Manual.'' Based on the evaluation documented in this report, the Calcined Solids Storage Facilities are not leaking and are structurally sound for continued service. Recommendations are provided for continued monitoring of the Calcined Solids Storage Facilities

  7. Structural Integrity Program for the Calcined Solids Storage Facilities at the Idaho Nuclear Technology and Engineering Center

    International Nuclear Information System (INIS)

    Jeffrey Bryant

    2008-01-01

    This report documents the activities of the structural integrity program at the Idaho Nuclear Technology and Engineering Center relevant to the high-level waste Calcined Solids Storage Facilities and associated equipment, as required by DOE M 435.1-1, 'Radioactive Waste Management Manual'. Based on the evaluation documented in this report, the Calcined Solids Storage Facilities are not leaking and are structurally sound for continued service. Recommendations are provided for continued monitoring of the Calcined Solids Storage Facilities

  8. Stanniocalcin-1 regulates re-epithelialization in human keratinocytes.

    Directory of Open Access Journals (Sweden)

    Bonnie H Y Yeung

    Full Text Available Stanniocalcin-1 (STC1, a glycoprotein hormone, is believed to be involved in various biological processes such as inflammation, oxidative responses and cell migration. Riding on these emerging evidences, we hypothesized that STC1 may participate in the re-epithelialization during wound healing. Re-epithelialization is a critical step that involves keratinocyte lamellipodia (e-lam formation, followed by cell migration. In this study, staurosporine (STS treatment induced human keratinocyte (HaCaT e-lam formation on fibronectin matrix and migration via the activation of focal adhesion kinase (FAK, the surge of intracellular calcium level [Ca²⁺]i and the inactivation of Akt. In accompanied with these migratory features, a time- and dose-dependent increase in STC1 expression was detected. STC1 gene expression was found not the downstream target of FAK-signaling as illustrated by FAK inhibition using PF573228. The reduction of [Ca²⁺]i by BAPTA/AM blocked the STS-mediated keratinocyte migration and STC1 gene expression. Alternatively the increase of [Ca²⁺]i by ionomycin exerted promotional effect on STS-induced STC1 gene expression. The inhibition of Akt by SH6 and GSK3β by lithium chloride (LiCl could respectively induce and inhibit the STS-mediated e-lam formation, cell migration and STC1 gene expression. The STS-mediated e-lam formation and cell migration were notably hindered or induced respectively by STC1 knockdown or overexpression. This notion was further supported by the scratched wound assay. Collectively the findings provide the first evidence that STC1 promotes re-epithelialization in wound healing.

  9. Stanniocalcin-1 regulates re-epithelialization in human keratinocytes.

    Science.gov (United States)

    Yeung, Bonnie H Y; Wong, Chris K C

    2011-01-01

    Stanniocalcin-1 (STC1), a glycoprotein hormone, is believed to be involved in various biological processes such as inflammation, oxidative responses and cell migration. Riding on these emerging evidences, we hypothesized that STC1 may participate in the re-epithelialization during wound healing. Re-epithelialization is a critical step that involves keratinocyte lamellipodia (e-lam) formation, followed by cell migration. In this study, staurosporine (STS) treatment induced human keratinocyte (HaCaT) e-lam formation on fibronectin matrix and migration via the activation of focal adhesion kinase (FAK), the surge of intracellular calcium level [Ca²⁺]i and the inactivation of Akt. In accompanied with these migratory features, a time- and dose-dependent increase in STC1 expression was detected. STC1 gene expression was found not the downstream target of FAK-signaling as illustrated by FAK inhibition using PF573228. The reduction of [Ca²⁺]i by BAPTA/AM blocked the STS-mediated keratinocyte migration and STC1 gene expression. Alternatively the increase of [Ca²⁺]i by ionomycin exerted promotional effect on STS-induced STC1 gene expression. The inhibition of Akt by SH6 and GSK3β by lithium chloride (LiCl) could respectively induce and inhibit the STS-mediated e-lam formation, cell migration and STC1 gene expression. The STS-mediated e-lam formation and cell migration were notably hindered or induced respectively by STC1 knockdown or overexpression. This notion was further supported by the scratched wound assay. Collectively the findings provide the first evidence that STC1 promotes re-epithelialization in wound healing.

  10. Technology Development for Hydrogen Propellant Storage and Transfer at the Kennedy Space Center (KSC)

    Science.gov (United States)

    Youngquist, Robert; Starr, Stanley; Krenn, Angela; Captain, Janine; Williams, Martha

    2016-01-01

    The National Aeronautics and Space Administration (NASA) is a major user of liquid hydrogen. In particular, NASA's John F. Kennedy (KSC) Space Center has operated facilities for handling and storing very large quantities of liquid hydrogen (LH2) since the early 1960s. Safe operations pose unique challenges and as a result NASA has invested in technology development to improve operational efficiency and safety. This paper reviews recent innovations including methods of leak and fire detection and aspects of large storage tank health and integrity. We also discuss the use of liquid hydrogen in space and issues we are addressing to ensure safe and efficient operations should hydrogen be used as a propellant derived from in-situ volatiles.

  11. 78 FR 21702 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-04-11

    ... documents or comments received, go to http://www.regulations.gov at any time or to the Docket Management... airplanes operated as private use, not for hire, not for common carriage. Side-facing seats are to be installed by Greenpoint Technologies for the original supplemental type certificate (STC). The limitation is...

  12. Stanniocalcin-1 Protects a Mouse Model from Renal Ischemia-Reperfusion Injury by Affecting ROS-Mediated Multiple Signaling Pathways.

    Science.gov (United States)

    Liu, Dajun; Shang, Huiping; Liu, Ying

    2016-07-12

    Stanniocalcin-1 (STC-1) protects against renal ischemia-reperfusion injury (RIRI). However, the molecular mechanisms remain widely unknown. STC-1 inhibits reactive oxygen species (ROS), whereas most ROS-mediated pathways are associated with ischemic injury. Therefore, to explore the mechanism, the effects of STC-1 on ROS-medicated pathways were studied. Non-traumatic vascular clamps were used to establish RIRI mouse models. The serum levels of STC-1, interleukin-6 (IL-6), interferon (IFN) γ, P53, and capase-3 were measured by ELISA kits. Superoxide dismutase (SOD) and malondialdehyde (MDA) were measured by fluorescence spectrofluorometer. All these molecules changed significantly in a RIRI model mouse when compared with those in a sham control. Kidney cells were isolated from sham and model mice. STC-1 was overexpressed or knockout in these kidney cells. The molecules in ROS-medicated pathways were measured by real-time quantitative PCR and Western blot. The results showed that STC-1 is an effective ROS scavenger. The serum levels of STC-1, MDA and SOD activity were increased while the serum levels of IL-6, iIFN-γ, P53, and capase-3 were decreased in a model group when compared with a sham control (p ROS-mediated molecules. Therefore, STC-1 maybe improve anti-inflammation, anti-oxidant and anti-apoptosis activities by affecting ROS-mediated pathways, especially the phospho-modifications of the respective proteins, resulting in the increase of SOD and reduce of capase-3, p53, IL-6 and IFN-γ.

  13. Electrolysis activities at FCH Test Center

    DEFF Research Database (Denmark)

    Ravn Nielsen, Eva; Nygaard, Frederik Berg

    FCH Test Center for fuel cell and hydrogen technologies was established in 2010 at Risø DTU in Denmark. Today, the test center is part of DTU Energy Conversion. The center gives industry access to advanced testing and demonstration of components and systems. A number of national projects and EU...... projects regarding water electrolysis involve FCH Test Center as a partner. This presentation gives an overview of the activities....

  14. Illinois Accelerator Research Center

    Science.gov (United States)

    Kroc, Thomas K.; Cooper, Charlie A.

    The Illinois Accelerator Research Center (IARC) hosts a new accelerator development program at Fermi National Accelerator Laboratory. IARC provides access to Fermi's state-of-the-art facilities and technologies for research, development and industrialization of particle accelerator technology. In addition to facilitating access to available existing Fermi infrastructure, the IARC Campus has a dedicated 36,000 ft2 Heavy Assembly Building (HAB) with all the infrastructure needed to develop, commission and operate new accelerators. Connected to the HAB is a 47,000 ft2 Office, Technology and Engineering (OTE) building, paid for by the state, that has office, meeting, and light technical space. The OTE building, which contains the Accelerator Physics Center, and nearby Accelerator and Technical divisions provide IARC collaborators with unique access to world class expertise in a wide array of accelerator technologies. At IARC scientists and engineers from Fermilab and academia work side by side with industrial partners to develop breakthroughs in accelerator science and translate them into applications for the nation's health, wealth and security.

  15. Informing Science (IS and Science and Technology Studies (STS: The University as Decision Center (DC for Teaching Interdisciplinary Research

    Directory of Open Access Journals (Sweden)

    Teresa Castelao-Lawless

    2001-01-01

    Full Text Available Students of history and philosophy of science courses at my University are either naïve robust realists or naïve relativists in relation to science and technology. The first group absorbs from culture stereotypical conceptions, such as the value-free character of the scientific method, that science and technology are impervious to history or ideology, and that science and religion are always at odds. The second believes science and technology were selected arbitrarily by ideologues to have privileged world views of reality to the detriment of other interpretations. These deterministic outlooks must be challenged to make students aware of the social importance of their future roles, be they as scientists and engineers or as science and technology policy decision makers. The University as Decision Center (DC not only reproduces the social by teaching standard solutions to well-defined problems but also provides information regarding conflict resolution and the epistemological, individual, historical, social, and political mechanisms that help create new science and technology. Interdisciplinary research prepares students for roles that require science and technology literacy, but raises methodological issues in the context of the classroom as it increases uncertainty with respect to apparently self-evident beliefs about scientific and technological practices.

  16. Clean Energy Solutions Center Services (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2014-04-01

    The Clean Energy Solutions Center (Solutions Center) helps governments, advisors and analysts create policies and programs that advance the deployment of clean energy technologies. The Solutions Center partners with international organizations to provide online training, expert assistance, and technical resources on clean energy policy.

  17. The proteolytic activity of pregnancy-associated plasma protein-A is potentially regulated by stanniocalcin-1 and -2 during human ovarian follicle development

    DEFF Research Database (Denmark)

    Jepsen, Malene R.; Kløverpris, Søren; Bøtkjær, Jane A.

    2016-01-01

    STUDY QUESTION: Is the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) regulated by the stanniocalcins (STC1 and STC2) during human follicle maturation? SUMMARY ANSWER: The STCs and PAPP-A show similar expression by immunohistochemistry in developing follicles, and regulation...... of PAPP-A proteolytic activity is suggested by the identification of inhibited protein complexes between PAPP-A and STC1 or STC2 in human follicular fluid (FF). WHAT IS KNOWN ALREADY: The insulin-like growth factor (IGF)-regulating proteinase PAPP-A is secreted by the granulosa cells of estrogen...

  18. Research on auto-calibration technology of the image plane's center of 360-degree and all round looking camera

    Science.gov (United States)

    Zhang, Shaojun; Xu, Xiping

    2015-10-01

    The 360-degree and all round looking camera, as its characteristics of suitable for automatic analysis and judgment on the ambient environment of the carrier by image recognition algorithm, is usually applied to opto-electronic radar of robots and smart cars. In order to ensure the stability and consistency of image processing results of mass production, it is necessary to make sure the centers of image planes of different cameras are coincident, which requires to calibrate the position of the image plane's center. The traditional mechanical calibration method and electronic adjusting mode of inputting the offsets manually, both exist the problem of relying on human eyes, inefficiency and large range of error distribution. In this paper, an approach of auto- calibration of the image plane of this camera is presented. The imaging of the 360-degree and all round looking camera is a ring-shaped image consisting of two concentric circles, the center of the image is a smaller circle and the outside is a bigger circle. The realization of the technology is just to exploit the above characteristics. Recognizing the two circles through HOUGH TRANSFORM algorithm and calculating the center position, we can get the accurate center of image, that the deviation of the central location of the optic axis and image sensor. The program will set up the image sensor chip through I2C bus automatically, we can adjusting the center of the image plane automatically and accurately. The technique has been applied to practice, promotes productivity and guarantees the consistent quality of products.

  19. An Analysis of Programmatic Variables Relating to the Pass Rates on the Licensure Examination by Practical Nurses in Tennessee Technology Centers

    Science.gov (United States)

    Simpson, Janis Lee

    2013-01-01

    The purpose of this quantitative research study was to determine the degree to which Licensed Practical Nursing programmatic variables positively correlate with select Tennessee Technology Center institution pass rates on the licensure examination--NCLEX-PNRTM. This study investigated the relationship between the dependent variable of NCLEX-PNRTM…

  20. User-centered design

    International Nuclear Information System (INIS)

    Baik, Joo Hyun; Kim, Hyeong Heon

    2008-01-01

    The simplification philosophy, as an example, that both of EPRI-URD and EUR emphasize is treated mostly for the cost reduction of the nuclear power plants, but not for the simplification of the structure of user's tasks, which is one of the principles of user-centered design. A user-centered design is a philosophy based on the needs and interests of the user, with an emphasis on making products usable and understandable. However, the nuclear power plants offered these days by which the predominant reactor vendors are hardly user-centered but still designer-centered or technology-centered in viewpoint of fulfilling user requirements. The main goal of user-centered design is that user requirements are elicited correctly, reflected properly into the system requirements, and verified thoroughly by the tests. Starting from the user requirements throughout to the final test, each requirement should be traceable. That's why requirement traceability is a key to the user-centered design, and main theme of a requirement management program, which is suggested to be added into EPRI-URD and EUR in the section of Design Process. (author)

  1. 77 FR 16074 - Notice of Listening Sessions on Implementation of Unemployment Insurance Provisions of the Middle...

    Science.gov (United States)

    2012-03-19

    ... Department of Labor (Department) is interested in hearing from stakeholders on the following issues: Model... percent reimbursement of the amount of STC paid under a program meeting the new definition for an STC...' allowances, payable to the individual under State law. However, no payments may be made to a State for STC...

  2. Bessines: Rebirth of a technological excellence center

    International Nuclear Information System (INIS)

    2014-06-01

    Areva's mining activity is rooted in the Limousin region of central France. For over 65 years, Bessines-sur-Gartempe has been closely involved with global energy and industrial issues. Geologists came here first as explorers, followed by miners and chemical engineers. This is the heritage on which Areva is drawing to help satisfy the steadily growing demand for energy. The SEPA's (Service d'etudes, de Procedes et Analyses) role is to develop new ways to process and use mineral ores. A world renowned R and D center, modernizing its research facilities is a key part of the program to revitalize the Bessines site. Between 1947 and 2001, close to 250 mining sites were exploited in France producing 76,000 tons of uranium. The Areva group (through the CEA and COGEMA) operated 55 % of these sites, all of which have been reclaimed today. UREKA is an educational center created by Areva to inform the public about uranium mining and French know-how in this field. This museum is unique in the world of mining. Depleted uranium is a byproduct of the uranium enrichment process. It harbors real energy potential that Areva intends to tap in the future. The effectiveness of lead-212 in targeting and destroying cancer cells was demonstrated several years ago. The Geosciences Center in made of four entities spread over 4,000 m 2 , regrouping the whole of Areva's mining knowledge and history. The wealth of mineralogical, petrographic and documentary data found there has been accumulated over more than 60 years of exploration and mining

  3. Lower Savannah aging, disability & transportation resource center : regional travel management and coordination center (TMCC) model and demonstration project.

    Science.gov (United States)

    2014-10-01

    This report details the deployed technology and implementation experiences of the Lower Savannah Aging, Disability & Transportation : Resource Center in Aiken, South Carolina, which served as the regional Travel Management and Coordination Center (TM...

  4. A Qualitative Study of the Treatment Improvement Protocols (TIPs): An Assessment of the Use of TIPs by Individuals Affiliated with the Addiction Technology Transfer Centers (ATTCs).

    Science.gov (United States)

    Hayashi, Susan W.; Suzuki, Marcia; Hubbard, Susan M.; Huang, Judy Y.; Cobb, Anita M.

    2003-01-01

    Evaluated the Addiction Technology Transfer Centers (ATTCs) of the Center for Substance Abuse Treatment (CSAT) as a means of diffusion of innovations, focusing on use of the Treatment Improvement Protocols (TIPs). Qualitative studies at 6 ATTCs that included 57 interviews show that the CSAT is at the forefront of providing resources to the…

  5. Computational fluid dynamics research at the United Technologies Research Center requiring supercomputers

    Science.gov (United States)

    Landgrebe, Anton J.

    1987-01-01

    An overview of research activities at the United Technologies Research Center (UTRC) in the area of Computational Fluid Dynamics (CFD) is presented. The requirement and use of various levels of computers, including supercomputers, for the CFD activities is described. Examples of CFD directed toward applications to helicopters, turbomachinery, heat exchangers, and the National Aerospace Plane are included. Helicopter rotor codes for the prediction of rotor and fuselage flow fields and airloads were developed with emphasis on rotor wake modeling. Airflow and airload predictions and comparisons with experimental data are presented. Examples are presented of recent parabolized Navier-Stokes and full Navier-Stokes solutions for hypersonic shock-wave/boundary layer interaction, and hydrogen/air supersonic combustion. In addition, other examples of CFD efforts in turbomachinery Navier-Stokes methodology and separated flow modeling are presented. A brief discussion of the 3-tier scientific computing environment is also presented, in which the researcher has access to workstations, mid-size computers, and supercomputers.

  6. Recent Efforts in Communications Research and Technology at the Glenn Research Center in Support of NASA's Mission

    Science.gov (United States)

    Miranda, Felix A.

    2015-01-01

    As it has done in the past, NASA is currently engaged in furthering the frontiers of space and planetary exploration. The effectiveness in gathering the desired science data in the amount and quality required to perform this pioneering work relies heavily on the communications capabilities of the spacecraft and space platforms being considered to enable future missions. Accordingly, the continuous improvement and development of radiofrequency and optical communications systems are fundamental to prevent communications to become the limiting factor for space explorations. This presentation will discuss some of the research and technology development efforts currently underway at the NASA Glenn Research Center in the radio frequency (RF) and Optical Communications. Examples of work conducted in-house and also in collaboration with academia, industry, and other government agencies (OGA) in areas such as antenna technology, power amplifiers, radio frequency (RF) wave propagation through Earths atmosphere, ultra-sensitive receivers, thin films ferroelectric-based tunable components, among others, will be presented. In addition, the role of these and other related RF technologies in enabling the NASA next generation space communications architecture will be also discussed.

  7. The development and technology transfer of software engineering technology at NASA. Johnson Space Center

    Science.gov (United States)

    Pitman, C. L.; Erb, D. M.; Izygon, M. E.; Fridge, E. M., III; Roush, G. B.; Braley, D. M.; Savely, R. T.

    1992-01-01

    The United State's big space projects of the next decades, such as Space Station and the Human Exploration Initiative, will need the development of many millions of lines of mission critical software. NASA-Johnson (JSC) is identifying and developing some of the Computer Aided Software Engineering (CASE) technology that NASA will need to build these future software systems. The goal is to improve the quality and the productivity of large software development projects. New trends are outlined in CASE technology and how the Software Technology Branch (STB) at JSC is endeavoring to provide some of these CASE solutions for NASA is described. Key software technology components include knowledge-based systems, software reusability, user interface technology, reengineering environments, management systems for the software development process, software cost models, repository technology, and open, integrated CASE environment frameworks. The paper presents the status and long-term expectations for CASE products. The STB's Reengineering Application Project (REAP), Advanced Software Development Workstation (ASDW) project, and software development cost model (COSTMODL) project are then discussed. Some of the general difficulties of technology transfer are introduced, and a process developed by STB for CASE technology insertion is described.

  8. Environmental Survey preliminary report, Pittsburgh Energy Technology Center, Pittsburgh, Pennsylvania

    Energy Technology Data Exchange (ETDEWEB)

    1988-09-01

    This report presents the preliminary findings from the first phase of the Environmental Survey of the US Department of Energy (DOE) Pittsburgh Energy Technology Center (PETC) conducted December 7--11, 1987. The Survey is being conducted by an interdisciplinary team of environmental specialists, led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team specialists are outside experts being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with PETC. The Survey covers all environmental media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations carried on at PETC, and interviews with site personnel. The Survey team developed a Sampling and Analysis (S A) Plan to assist in further assessing certain environmental problems identified during its on-site Survey activities at PETC. The S A Plan will be executed by the Oak Ridge National Laboratory (ORNL). When completed, the Plan's results will be incorporated into the PETC Survey findings for inclusion into the Environmental Survey Summary Report. 64 refs., 23 figs., 29 tabs.

  9. Annual Report (No. 1) of Center for Advanced Research of Energy Technology, Hokkaido University; Hokkaido Daigaku energy sentan kogaku kenkyu center nenpo dai 1 go

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    The activities of the Center cover basic researches into chemistry, physics, and materials necessary for the development of technologies relating to high-efficiency conversion of coal-centered fossil fuel resources and to the security of new energy sources. Studies under way in the field of carbonaceous resources conversion reaction involve the process of transfer of heat and substance in the coal conversion reaction, behavior of short-life intermediate products, and the structure and physical properties of coal as a molecular solid or macromolecule. Studies being conducted in the field of carbonaceous resources assessment include the search for and development of high-efficiency catalysts for coal conversion reaction systems, elucidation of physical and chemical structures of coal and coal-derived oils, energy conversion of the low-entropy type, creation of carbon-based functional materials, etc. Furthermore, research and development is under way for enhanced-efficiency conversion of high-temperature thermal energy acquired by fossil fuel combustion into electrical energy and for materials that will constitute nuclear fusion reactors and atomic reactors and will withstand combustion plasma. (NEDO)

  10. The EPRI NDE center after five years

    International Nuclear Information System (INIS)

    Dau, G.J.; Nemzek, T.A.

    1985-01-01

    In 1979, the Electric Power Research Institute (EPRI) established a Nondestructive Evaluation (NDE) Center. The purpose of the Center is to provide the electric utility industry with a dedicated NDE development and field-use-qualification capability. Later, the scope of activities at the NDE Center was expanded. Beginning in 1980, the BWR Owners Group (IGSCC) provided funding necessary to operate the BWR Pipe Remedy Demonstration and Training Facility. In 1984, the Maintenance Equipment Applications Center was established by EPRI. Both functions are co-located within the NDE Center. All three functions share common objectives of providing the electric utility industry with a capability dedicated to assuring reduction to practice of new or improved technology, proof testing, qualification for field use, and obtaining code and regulatory acceptance of qualified methods and training. The purpose of this paper is to describe typical activities of the Center and some of the benefits that have accrued. The next section describes the Center organization, operation, and facility, while the remaining sections discuss the technology transfer thrust and benefits

  11. Center for Contaminated Sediments

    Data.gov (United States)

    Federal Laboratory Consortium — The U.S. Army Corps of Engineers Center for Contaminated Sediments serves as a clearinghouse for technology and expertise concerned with contaminated sediments. The...

  12. Cab technology integration laboratory demonstration with moving map technology

    Science.gov (United States)

    2013-03-31

    A human performance study was conducted at the John A. Volpe National Transportation Systems Center (Volpe Center) using a locomotive research simulatorthe Cab Technology Integration Laboratory (CTIL)that was acquired by the Federal Railroad Ad...

  13. HEMISPHERIC CENTER FOR ENVIRONMENTAL TECHNOLOGY

    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian

    2000-01-31

    The Online Measurement of Decontamination project team received a commitment for a demonstration in May from the Sacramento (California) Municipal Utility District (SMUD) Rancho Seco site. Since this site is a member of the DOE Commercial Utilities Consortium, the demonstration will fulfill the DOE and commercial technology demonstration requirements. Discussion on deployment of the Integrated Vertical and Overhead Decontamination (IVOD) System at Rancho Seco was conducted; date for deployment tentatively scheduled for early spring. Based upon fictional requirements from SRS for a shiny monitor in a high-level waste tank, FIU-HCET developed and delivered a draft slurry monitor design and draft test plan. Experiments measuring slurry settling time for SRS slurry simulant at 10 wt% have been completed on FIU-HCET'S flow loop with SRS dip. The completed design package of the test mockup for evaluating Non-Intrusive Location of Buried Items Technologies was sent to Fluor Fernald and the Operating Engineers National Hazmat Program for review. Comments are due at the end of January. Preliminary experiments to determine size distribution of aerosols generated during metal cutting were performed. A 1/4-inch-thick iron plate was cut using a plasma arc torch, and the size distribution of airborne particles was measured using a multistage impactor. Per request of DOE-Ohio, FIU-HCET participated in a weeklong value engineering study for the characterization, decontamination, and dismantlement of their critical path facility.

  14. Center for Beam Physics, 1993

    International Nuclear Information System (INIS)

    1994-05-01

    The Center for Beam Physics is a multi-disciplinary research and development unit in the Accelerator and Fusion Research Division at Lawrence Berkeley Laboratory. At the heart of the Center's mission is the fundamental quest for mechanisms of acceleration, radiation and focusing of energy. Dedicated to exploring the frontiers of the physics of (and with) particle and photon beams, its primary mission is to promote the science and technology of the production, manipulation, storage and control systems of charged particles and photons. The Center serves this mission via conceptual studies, theoretical and experimental research, design and development, institutional project involvement, external collaborations, association with industry and technology transfer. This roster provides a glimpse at the scientists, engineers, technical support, students, and administrative staff that make up this team and a flavor of their multifaceted activities during 1993

  15. Stanniocalcin 2 Regulates Non-capacitative Ca2+ Entry and Aggregation in Mouse Platelets

    Directory of Open Access Journals (Sweden)

    Esther López

    2018-03-01

    Full Text Available Stanniocalcin 2 (STC2 is a fish protein that controls body Ca2+ and phosphate metabolism. STC2 has also been described in mammals, and as platelet function highly depends on both extracellular and intracellular Ca2+, we have explored its expression and function in these cells. STC2−/− mice exhibit shorter tail bleeding time than WT mice. Platelets from STC2-deficient mice showed enhanced aggregation, as well as enhanced Ca2+ mobilization in response to the physiological agonist thrombin (Thr and the diacylglycerol analog, OAG, a selective activator of the non-capacitative Ca2+ entry channels. Interestingly, platelets from STC2−/− mice exhibit attenuated interaction between STIM1 and Orai1 in response to Thr, thus suggesting that STC2 is required for Thr-evoked STIM1-Orai1 interaction and the subsequent store-operated Ca2+ entry (SOCE. We have further assessed possible changes in the expression of the most relevant channels involved in non-capacitative Ca2+ entry in platelets. Then, protein expression of Orai3, TRPC3 and TRPC6 were evaluated by Western blotting, and the results revealed that while the expression of Orai3 was enhanced in the STC2-deficient mice, others like TRPC3 and TRPC6 remains almost unaltered. Summarizing, our results provide for the first time evidence for a role of STC2 in platelet physiology through the regulation of agonist-induced Ca2+ entry, which might be mediated by the regulation of Orai3 channel expression.

  16. Une maison de culture (A Culture Center).

    Science.gov (United States)

    Mourlevat, Alain

    1980-01-01

    Describes the "Culture Center" designed by Le Corbusier and located in Firminy, France. The role of the center in arousing intellectual curiosity in people living in a technological age is discussed. The audience of this culture center, young people, and the types of activities directed toward them are described. (AMH)

  17. The ConocoPhillips Center for a Sustainable WE2ST (Water-Energy Education, Science, and Technology): Lessons Learned from an Innovative Research-Education-Outreach Center at Colorado School of Mines

    Science.gov (United States)

    Hogue, T. S.; Blaine, A. C.; Martin, A. C.

    2016-12-01

    The ConocoPhillips Center for a Sustainable WE2ST (Water-Energy Education, Science, and Technology) is a testament to the power of collaboration and innovation. WE2ST began as a partnership between ConocoPhillips (foundation gift) and the Colorado School of Mines (CSM) with the goal of fostering solutions to water-energy challenges via education, research and outreach. The WE2ST center is a training ground for the next generation of water-energy-social scientists and engineers and is a natural fit for CSM, which is known for its expertise in water resources, water treatment technologies, petroleum engineering, geosciences, and hydrology. WE2ST has nine contributing faculty researchers that combine to create a web of expertise on sustainable energy and water resources. This research benefits unconventional energy producers, water-reliant stakeholders and the general public. Areas of focus for research include water sources (quality and quantity), integrated water-energy solution viability and risk, and social-corporate responsibility. The WE2ST Center currently provides annual support for 8-9 Graduate Fellows and 13 Undergraduate Scholars. Top-tier graduate students are recruited nationally and funded similar to an NSF Graduate Research Fellowship (GRF). Undergraduate Scholars are also recruited from across the CSM campus to gain experience in faculty laboratories and on research teams. All WE2ST students receive extensive professional skills training, leadership development, communication skills training, networking opportunities in the water-energy industries, and outreach opportunities in the community. The corner stone of the WE2ST Center is a focus on communication with the public. Both in social science research teams and in general interactions with the public, WE2ST seeks to be "an honest broker" amidst a very passionate and complex topic. WE2ST research is communicated by presentations at technical conferences, talking with people at public gatherings

  18. Evaluating cartographic design principles applied to space-time cube content

    DEFF Research Database (Denmark)

    Kveladze, Irma; Kraak, Menno-Jan

    2013-01-01

    the different uses of the graphic variables and depth cues to represent the paths and stations. Both quantitative and qualitative evaluation methods were applied during the testing. The results gave an indication on how design influence the 'performance' of the STC, and resulted in guidelines for the design...... to the neglectance of a proper cartographic design. To judge the influence of this design on the effectiveness and efficiency of the STC as a graphic representation of movement data a user-centered design evaluation has been set up. The experiment included two applications each with its own characteristic data...... complexity and content. It involved a historic and an urban problem case. The first is a relatively simple dataset of historical movements and the second is a complex dataset of pedestrians movement. Based on questions formulated by domain experts different design scenarios were tested. These included...

  19. Database created with the operation of environmental monitoring program from the Nuclear Technology Development Center (CDTN) - Brazilian CNEN

    International Nuclear Information System (INIS)

    Peixoto, C.M.

    1995-01-01

    The environmental control from the Nuclear Technology Development Center (CDTN - Brazilian CNEN) is done through a Program of Environmental Monitoring-PMA, which has been in operation since 1985. To register all the analytic results of the several samples, samples, a database was created. In this work, this database structure as well as the information used in the evaluation of the results obtained from the operation of the above-mentioned PMA are presented. (author). 5 refs, 1 fig, 3 tabs

  20. Patient-centered applications: use of information technology to promote disease management and wellness. A white paper by the AMIA knowledge in motion working group.

    Science.gov (United States)

    Demiris, George; Afrin, Lawrence B; Speedie, Stuart; Courtney, Karen L; Sondhi, Manu; Vimarlund, Vivian; Lovis, Christian; Goossen, William; Lynch, Cecil

    2008-01-01

    Advances in information technology (IT) enable a fundamental redesign of health care processes based on the use and integration of electronic communication at all levels. New communication technologies can support a transition from institution centric to patient-centric applications. This white paper defines key principles and challenges for designers, policy makers, and evaluators of patient-centered technologies for disease management and prevention. It reviews current and emerging trends; highlights challenges related to design, evaluation, reimbursement and usability; and reaches conclusions for next steps that will advance the domain.

  1. ExMC Technology Watch

    Science.gov (United States)

    Krihak, M.; Barr, Y.; Watkins, S.; Fung, P.; McGrath, T.; Baumann, D.

    2012-01-01

    The Technology Watch (Tech Watch) project is a NASA endeavor conducted under the Human Research Program's (HRP) Exploration Medical Capability (ExMC) element, and focusing on ExMC technology gaps. The project involves several NASA centers, including the Johnson Space Center (JSC), Glenn Research Center (GRC), Ames Research Center (ARC), and the Langley Research Center (LaRC). The objective of Tech Watch is to identify emerging, high-impact technologies that augment current NASA HRP technology development efforts. Identifying such technologies accelerates the development of medical care and research capabilities for the mitigation of potential health issues encountered during human space exploration missions. The aim of this process is to leverage technologies developed by academia, industry and other government agencies and to identify the effective utilization of NASA resources to maximize the HRP return on investment. The establishment of collaborations with these entities is beneficial to technology development, assessment and/or insertion and further NASA's goal to provide a safe and healthy environment for human exploration. In 2011, the major focus areas for Tech Watch included information dissemination, education outreach and public accessibility to technology gaps and gap reports. The dissemination of information was accomplished through site visits to research laboratories and/or companies, and participation at select conferences where Tech Watch objectives and technology gaps were presented. Presentation of such material provided researchers with insights on NASA ExMC needs for space exploration and an opportunity to discuss potential areas of common interest. The second focus area, education outreach, was accomplished via two mechanisms. First, several senior student projects, each related to an ExMC technology gap, were sponsored by the various NASA centers. These projects presented ExMC related technology problems firsthand to collegiate laboratories

  2. Activities of JAEA in the International Science and Technology Center (ISTC)

    International Nuclear Information System (INIS)

    Hamada, Shozo

    2013-05-01

    Since the Headquarter of the International Science and Technology Center (ISTC) was established in Moscow, Russian Federation in 1994, Japan Atomic Energy Agency (JAEA), which includes both Japan Atomic Energy Research Institute and Japan has been made various, considerable contributions as well as participation in partner projects in ISTC activities. By the way, the Russian Federation Party, which is a Government Board Member of ISTC, made the statement that the Russian Federation would withdraw from ISTC until the end of 2015 in the 52th Government Board in held Moscow, 9 December 2010. This is based on the possible consequences of the Executive Order of the President of the Russian Federation dated 11 August 2010 with respect to the withdraw of the Russian Federation from ISTC. So that the Government Board has been discussing about the continuation and/or the establishment of a new organization for ISTC. In any case, the Headquarter of ISTC could stay at Moscow until the end of 2015 at latest. This time is considered as a transition period of ISTC and it is summarized that the collaborations, contributions of JAEA and outcomes from them for ISTC activities in this report. (author)

  3. Handbook on data centers

    CERN Document Server

    Khan, Samee Ullah

    2015-01-01

    This handbook offers a comprehensive review of the state-of-the-art research achievements in the field of data centers. Contributions from international, leading researchers and scholars offer topics in cloud computing, virtualization in data centers, energy efficient data centers, and next generation data center architecture.  It also comprises current research trends in emerging areas, such as data security, data protection management, and network resource management in data centers. Specific attention is devoted to industry needs associated with the challenges faced by data centers, such as various power, cooling, floor space, and associated environmental health and safety issues, while still working to support growth without disrupting quality of service. The contributions cut across various IT data technology domains as a single source to discuss the interdependencies that need to be supported to enable a virtualized, next-generation, energy efficient, economical, and environmentally friendly data cente...

  4. KCC1: First Nanoparticle developed by KAUST Catalysis Center

    KAUST Repository

    Basset, Jean-Marie

    2010-08-01

    KCC1 is the first Nanoparticle developed by KAUST Catalysis Center. Director of KAUST Catalysis Center, Dr. Jean-Marie Basset, Senior Research Scientist at KCC, Dr. Vivek Polshettiwar, and Dr. Dongkyu Cha of the Advanced Nanofabrication Imaging & Characterization Core Laboratory discuss the details of this recent discovery. This video was produced by KAUST Visualization Laboratory and KAUST Technology Transfer and Innovation - Terence McElwee, Director, Technology Transfer and Innovation - IP@kaust.edu.sa This technology is part of KAUST\\'s technology commercialization program that seeks to stimulate development and commercial use of KAUST-developed technologies. For more information email us at ip@kaust.edu.sa.

  5. JSC research and technology

    Science.gov (United States)

    1993-01-01

    The primary roles and missions of JSC incorporate all aspects of human presence in space. Therefore, the Center is involved in the development of technology that will allow humans to stay longer in Earth orbit, allow safe flight in space, and provide capabilities to explore the Moon and Mars. The Center's technology emphasis areas include human spacecraft development, human support systems and infrastructure, and human spacecraft operations. Safety and reliability are critical requirements for the technologies that JSC pursues for long-duration use in space. One of the objectives of technology development at the Center is to give employees the opportunity to enhance their technological expertise and project management skills by defining, designing, and developing projects that are vital to the Center's strategy for the future. This report is intended to communicate within and outside the Agency our research and technology (R&T) accomplishments, as well as inform Headquarters program managers and their constituents of the significant accomplishments that have promise for future Agency programs. While not inclusive of all R&T efforts, the report presents a comprehensive summary of JSC projects in which substantial progress was made in the 1992 fiscal year. At the beginning of each project description, names of the Principal Investigator (PI) and the Technical Monitor (TM) are given, followed by their JSC mail codes or their company or university affiliations. The funding sources and technology focal points are identified in the index.

  6. NASA Earth Science Mission Control Center Enterprise Emerging Technology Study Study (MCC Technology Study)

    Science.gov (United States)

    Smith, Dan; Horan, Stephen; Royer, Don; Sullivan, Don; Moe, Karen

    2015-01-01

    This paper reports on the results of the study to identify technologies that could have a significant impact on Earth Science mission operations when looking out at the 5-15 year horizon (through 2025). The potential benefits of the new technologies will be discussed, as well as recommendations for early research and development, prototyping, or analysis for these technologies.

  7. Service Delivery and Related Issues at the Trace Research and Development Center.

    Science.gov (United States)

    Smith, R. O.

    The environmental context of the Trace Center is first briefly described as background for a more detailed description of the center's service delivery activities in the field of rehabilitation/education technology. Trace serves four major functions in rehabilitation/education technology. As a nationally funded rehabilitation engineering center,…

  8. A study on organizational culture, structure and information technology as three KM enablers: A case study in five Iranian medical and healthcare research centers

    Directory of Open Access Journals (Sweden)

    Mahdi Iran-nejad-parizi

    2013-01-01

    Full Text Available This study investigates organizational structure, culture, and information technology as knowledge management (KM infrastructural capabilities, and compares their significance and status quo in five medical research centers in Tehran, Iran. Objectives of this research were pursued by employing two statistical methods, regression analysis and Friedman test. Included in the study were 135 people (researchers and support staff from five medical and healthcare research centers of Tehran. A survey questionnaire including 23 questions was utilized to examine organizational structure, culture and information technology indicators. And another 12 questions examined KM effectiveness. The Friedman test indicated that in terms of their status quo, the three studied KM enablers are at different conditions, with organizational culture having the best (mean rank=1.79 and IT the worst (mean rank=2.14 status. Moreover, it was revealed by regression analysis that organizational structure is believed to have the most significant impact (Beta= 0.397 on the effectiveness of knowledge management initiatives, while information technology gained the least perceived impact (Beta= 0.176.

  9. CRADA Payment Options | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    NCI TTC CRADA PAYMENT OPTIONS: Electronic Payments by Wire Transfer via Fedwire, Mail a check to the Institute or Center, or Automated Clearing House (ACH)/Electronic Funds Transfer (ETF) payments via Pay.gov (NCI ONLY).

  10. Fuel transfer system ALARA design review - Project A.15

    International Nuclear Information System (INIS)

    KUEBERTH, L.R.

    2001-01-01

    One mission of the Spent Nuclear Fuel (SNF) Project is to move the SNF from the K Basins in the Hanford 100K Area to an interim dry storage at the Canister Storage Building (CSB) in the Hanford 200 East Area. The Fuel Transfer System (FTS) is a subproject that will move the SNF from the 105K East (KE) Facility to the 105K West (KW) Facility. The SNF will be treated for shipment to the Cold Vacuum Drying (CVD) facility at the KW Basin. The SNF canisters will be loaded underwater into a Shielded Transfer Cask (STC) in the KE Basin. The fully loaded STC will be brought out of the water and placed into a Cask Transfer Overpack (CTO) by the STC Straddle Carrier. As the STC is removed from the water, it will be washed down with demineralized water by an manual rinse system. The CTO with the STC inside will be placed on a transport trailer and transferred to the KW Basin as an intra-facility transfer. The CTO will be unloaded from the shipping trailer at the KW Basin and the STC will be removed from the CTO. The STC will then be lowered into the KW Basin water and the fuel will be removed. The SNF will then be processed for shipment to the CVD. As soon as all of the fuel has been removed from the STC, the cask will be removed from the KW Basin water and placed into the CTO. The CTO will again be placed on the trailer for transport back to the KE Basin where the entire cycle will be repeated approximately 400 times. This document records the As Low As Reasonably Achievable (ALARA) findings and design recommendations/requirements by the SNF Project noted during the Final Design Review of the STC, CTO, STC Transfer System, Annexes and Roadways for support of FTS. This document is structured so that all statements that include the word ''shall'' represent design features that have been or will be implemented within the project scope. Statements that include the words ''should'' or ''recommend'' represent ALARA design features to be evaluated for future implementation

  11. El Tribunal Constitucional como “supremo intérprete” de la Ley de Aguas

    Directory of Open Access Journals (Sweden)

    Francisco Balaguer Callejón

    2011-10-01

    based on the logic,the technology and the experience to which the STC 227/1988 appealed, witha teleological inspiration and taking into account the change in the block ofconstitutionality effected by the lawmaker of the statute of autonomy, whichis also State lawmaker. These criteria may have allowed for a different opinionbased on the assessment of the Constitutional Court itself and the analysisof all the elements constitutionally liable and because of that, due toproper consideration.

  12. Comparative numerical and experimental study of two combined wind and wave energy concepts

    Directory of Open Access Journals (Sweden)

    Zhen Gao

    2016-01-01

    Full Text Available With a successful and rapid development of offshore wind industry and increased research activities on wave energy conversion in recent years, there is an interest in investigating the technological and economic feasibility of combining offshore wind turbines (WTs with wave energy converters (WECs. In the EU FP7 MARINA Platform project, three floating combined concepts, namely the spar torus combination (STC, the semi-submersible flap combination (SFC and the oscillating water column (OWC array with a wind turbine, were selected and studied in detail by numerical and experimental methods. This paper summarizes the numerical modeling and analysis of the two concepts: STC and SFC, the model tests at a 1:50 scale under simultaneous wave and wind excitation, as well as the comparison between the numerical and experimental results. Both operational and survival wind and wave conditions were considered. The numerical analysis was based on a time-domain global model using potential flow theory for hydrodynamics and blade element momentum theory (for SFC or simplified thrust force model (for STC for aerodynamics. Different techniques for model testing of combined wind and wave concepts were discussed with focus on modeling of wind turbines by disk or redesigned small-scale rotor and modeling of power take-off (PTO system for wave energy conversion by pneumatic damper or hydraulic rotary damper. In order to reduce the uncertainty due to scaling, the numerical analysis was performed at model scale and both the numerical and experimental results were then up-scaled to full scale for comparison. The comparison shows that the current numerical model can well predict the responses (motions, PTO forces, power production of the combined concepts for most of the cases. However, the linear hydrodynamic model is not adequate for the STC concept in extreme wave conditions with the torus fixed to the spar at the mean water level for which the wave slamming on the

  13. Laser Spot Center Detection and Comparison Test

    Science.gov (United States)

    Zhu, Jun; Xu, Zhengjie; Fu, Deli; Hu, Cong

    2018-04-01

    High efficiency and precision of the pot center detection are the foundations of avionics instrument navigation and optics measurement basis for many applications. It has noticeable impact on overall system performance. Among them, laser spot detection is very important in the optical measurement technology. In order to improve the low accuracy of the spot center position, the algorithm is improved on the basis of the circle fitting. The pretreatment is used by circle fitting, and the improved adaptive denoising filter for TV repair technology can effectively improves the accuracy of the spot center position. At the same time, the pretreatment and de-noising can effectively reduce the influence of Gaussian white noise, which enhances the anti-jamming capability.

  14. A randomized study of internet parent training accessed from community technology centers.

    Science.gov (United States)

    Irvine, A Blair; Gelatt, Vicky A; Hammond, Michael; Seeley, John R

    2015-05-01

    Behavioral parent training (BPT) has been shown to be efficacious to improve parenting skills for problematic interactions with adolescents displaying oppositional and antisocial behaviors. Some research suggests that support group curricula might be transferred to the Internet, and some studies suggest that other curriculum designs might also be effective. In this research, a BPT program for parents of at-risk adolescents was tested on the Internet in a randomized trial (N = 307) from computer labs at six community technology centers in or near large metropolitan areas. The instructional design was based on asynchronous scenario-based e-learning, rather than a traditional parent training model where presentation of course material builds content sequentially over multiple class sessions. Pretest to 30-day follow-up analyses indicated significant treatment effects on parent-reported discipline style (Parenting Scale, Adolescent version), child behavior (Eyberg Child Behavior Inventory), and on social cognitive theory constructs of intentions and self-efficacy. The effect sizes were small to medium. These findings suggest the potential to provide effective parent training programs on the Internet.

  15. Long-Term Demonstration of Hydrogen Production from Coal at Elevated Temperatures Year 6 - Activity 1.12 - Development of a National Center for Hydrogen Technology

    Energy Technology Data Exchange (ETDEWEB)

    Stanislowski, Joshua; Tolbert, Scott; Curran, Tyler; Swanson, Michael

    2012-04-30

    The Energy & Environmental Research Center (EERC) has continued the work of the National Center for Hydrogen Technology® (NCHT®) Program Year 6 Task 1.12 project to expose hydrogen separation membranes to coal-derived syngas. In this follow-on project, the EERC has exposed two membranes to coal-derived syngas produced in the pilot-scale transport reactor development unit (TRDU). Western Research Institute (WRI), with funding from the State of Wyoming Clean Coal Technology Program and the North Dakota Industrial Commission, contracted with the EERC to conduct testing of WRI’s coal-upgrading/gasification technology for subbituminous and lignite coals in the EERC’s TRDU. This gasifier fires nominally 200–500 lb/hour of fuel and is the pilot-scale version of the full-scale gasifier currently being constructed in Kemper County, Mississippi. A slipstream of the syngas was used to demonstrate warm-gas cleanup and hydrogen separation using membrane technology. Two membranes were exposed to coal-derived syngas, and the impact of coal-derived impurities was evaluated. This report summarizes the performance of WRI’s patent-pending coalupgrading/ gasification technology in the EERC’s TRDU and presents the results of the warm-gas cleanup and hydrogen separation tests. Overall, the WRI coal-upgrading/gasification technology was shown to produce a syngas significantly lower in CO2 content and significantly higher in CO content than syngas produced from the raw fuels. Warm-gas cleanup technologies were shown to be capable of reducing sulfur in the syngas to 1 ppm. Each of the membranes tested was able to produce at least 2 lb/day of hydrogen from coal-derived syngas.

  16. 7. Annual seminar of the scientific initiation of the Center for Development of Nuclear Technology. Abstracts; 7. Seminario anual de iniciacao cientifica do Centro de Desenvolvimento da Tecnologia Nuclear. Resumos

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    This seminar presents the Scientific Initiation Program developed at the CDTN - Brazilian Center for the Development of Nuclear Technology and focuses on activities of the sectors of: radiopharmaceutical production; radiation applied to health; waste management; structural integrity; environment; nanotechnology and nuclear materials; reactor technology; mineral technology; reactor and analytical techniques.

  17. Technology Applications Team: Applications of aerospace technology

    Science.gov (United States)

    1993-01-01

    Highlights of the Research Triangle Institute (RTI) Applications Team activities over the past quarter are presented in Section 1.0. The Team's progress in fulfilling the requirements of the contract is summarized in Section 2.0. In addition to our market-driven approach to applications project development, RTI has placed increased effort on activities to commercialize technologies developed at NASA Centers. These Technology Commercialization efforts are summarized in Section 3.0. New problem statements prepared by the Team in the reporting period are presented in Section 4.0. The Team's transfer activities for ongoing projects with the NASA Centers are presented in Section 5.0. Section 6.0 summarizes the status of four add-on tasks. Travel for the reporting period is described in Section 7.0. The RTI Team staff and consultants and their project responsibilities are listed in Appendix A. The authors gratefully acknowledge the contributions of many individuals to the RTI Technology Applications Team program. The time and effort contributed by managers, engineers, and scientists throughout NASA were essential to program success. Most important to the program has been a productive working relationship with the NASA Field Center Technology Utilization (TU) Offices. The RTI Team continues to strive for improved effectiveness as a resource to these offices. Industry managers, technical staff, medical researchers, and clinicians have been cooperative and open in their participation. The RTI Team looks forward to continuing expansion of its interaction with U.S. industry to facilitate the transfer of aerospace technology to the private sector.

  18. Generation of actinide colloids and their sorption on rocks. A study on colloids in an ISTC (International Science and Technology Center) project

    International Nuclear Information System (INIS)

    Fujiwara, Ai

    2005-01-01

    Results of experimental studies on generation of colloids and their sorption on rocks conducted in the ISTC (International Science and Technology Center) project No.1326 are presented, as well as a brief introduction of the project and a planned new project on colloidal migration near the Karachai Lake, Russia. (author)

  19. Building Technologies Program Multi-Year Program Plan Technology Validation and Market Introduction 2008

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2008-01-01

    Building Technologies Program Multi-Year Program Plan 2008 for technology validation and market introduction, including ENERGY STAR, building energy codes, technology transfer application centers, commercial lighting initiative, EnergySmart Schools, EnergySmar

  20. The working out of architectural concept for a new type public building — multi-information and education center by using information technologies and mathematical models

    Directory of Open Access Journals (Sweden)

    Михаил Владимирович Боровиков

    2012-12-01

    Full Text Available Architectural concept of multifunctional information and educational center and its implementation is given in the author's project. Advanced information technology and mathematical models used in the development of the author project.

  1. The Manned Spacecraft Center and medical technology

    Science.gov (United States)

    Johnston, R. S.; Pool, S. L.

    1974-01-01

    A number of medically oriented research and hardware development programs in support of manned space flights have been sponsored by NASA. Blood pressure measuring systems for use in spacecraft are considered. In some cases, complete new bioinstrumentation systems were necessary to accomplish a specific physiological study. Plans for medical research during the Skylab program are discussed along with general questions regarding space-borne health service systems and details concerning the Health Services Support Control Center.

  2. Research and development of grid computing technology in center for computational science and e-systems of Japan Atomic Energy Agency

    International Nuclear Information System (INIS)

    Suzuki, Yoshio

    2007-01-01

    Center for Computational Science and E-systems of the Japan Atomic Energy Agency (CCSE/JAEA) has carried out R and D of grid computing technology. Since 1995, R and D to realize computational assistance for researchers called Seamless Thinking Aid (STA) and then to share intellectual resources called Information Technology Based Laboratory (ITBL) have been conducted, leading to construct an intelligent infrastructure for the atomic energy research called Atomic Energy Grid InfraStructure (AEGIS) under the Japanese national project 'Development and Applications of Advanced High-Performance Supercomputer'. It aims to enable synchronization of three themes: 1) Computer-Aided Research and Development (CARD) to realize and environment for STA, 2) Computer-Aided Engineering (CAEN) to establish Multi Experimental Tools (MEXT), and 3) Computer Aided Science (CASC) to promote the Atomic Energy Research and Investigation (AERI). This article reviewed achievements in R and D of grid computing technology so far obtained. (T. Tanaka)

  3. Planning nuclear energy centers under technological and demand uncertainty

    International Nuclear Information System (INIS)

    Meier, P.M.; Palmedo, P.F.

    1976-01-01

    The question considered is whether new nuclear power plants should be located in nuclear energy centers, or ''power parks'' with co-located fabrication and reprocessing facilities. That issue has been addressed in a recent study by the Nuclear Regulatory Commission and remains under investigation at Brookhaven and elsewhere. So far, however, the advisability of this policy has been analyzed primarily within the framework of a single view of the future. Suggestions of the types of questions that should be asked regarding this policy if it is properly to be viewed as an example of decision making under uncertainty are made. It is concluded that ''A consideration of the various uncertainties involved in the question of dispersed vs. remote siting of energy facilities introduces a number of new elements into the analysis. On balance those considerations provide somewhat greater support for the clustered concept. The NEC approach seems to provide somewhat greater flexibility in accomodating possible future electricity generating technologies. Increased regulatory and construction efficiencies possible in an NEC reduces the impact of demand uncertainty as does the lower costs associated with construction acceleration or deceleration.'' It is also noted that, in the final analysis, ''it is the public's perception of the relative costs and benefits of a measure that determine the acceptability or unacceptability of a particular innovation,'' not the engineer's cost/benefit analysis. It is further noted that if the analysis can identify limits on analytical methods and models, it will not make the job of energy decision-making any easier, but it may make the process more responsive to its impact on society

  4. AcEST: BP913929 [AcEST

    Lifescience Database Archive (English)

    Full Text Available g OS=... 54 2e-15 sp|P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 64 3e-10 sp|P53971|FAP...: 509 CREKCHEGPCPPCN 522 >sp|P40798|STC_DROME Protein shuttle craft OS=Drosophila melanogaster GN=stc PE=1 S...e-20 tr|B6K130|B6K130_SCHJP Shuttle craft like transcriptional regula... 69 4e-20

  5. Characterization of a Murine Model of Bioequivalent Bladder Wound Healing and Repair Following Subtotal Cystectomy

    Directory of Open Access Journals (Sweden)

    Mona Zarifpour

    2017-05-01

    Full Text Available Previous work demonstrated restoration of a bioequivalent bladder within 8 weeks of removing the majority of the bladder (subtotal cystectomy or STC in rats. The goal of the present study was to extend our investigations of bladder repair to the murine model, to harness the power of mouse genetics to delineate the cellular and molecular mechanisms responsible for the observed robust bladder regrowth. Female C57 black mice underwent STC, and at 4, 8, and 12 weeks post-STC, bladder repair and function were assessed via cystometry, ex vivo pharmacologic organ bath studies, and T2-weighted magnetic resonance imaging (MRI. Histology was also performed to measure bladder wall thickness. We observed a time-dependent increase in bladder capacity (BC following STC, such that 8 and 12 weeks post-STC, BC and micturition volumes were indistinguishable from those of age-matched non-STC controls and significantly higher than observed at 4 weeks. MRI studies confirmed that bladder volume was indistinguishable within 3 months (11 weeks post-STC. Additionally, bladders emptied completely at all time points studied (i.e., no increases in residual volume, consistent with functional bladder repair. At 8 and 12 weeks post-STC, there were no significant differences in bladder wall thickness or in the different components (urothelium, lamina propria, or smooth muscle layers of the bladder wall compared with age-matched control animals. The maximal contractile response to pharmacological activation and electrical field stimulation increased over time in isolated tissue strips from repaired bladders but remained lower at all time points compared with controls. We have established and validated a murine model for the study of de novo organ repair that will allow for further mechanistic studies of this phenomenon after, for example, genetic manipulation.

  6. Involving Minority High School Students in Cutting Edge Research through C-DEBI, an NSF-National Science and Technology Center

    Science.gov (United States)

    Singer, E.; Edwards, K. J.

    2012-12-01

    The Center for Dark Energy Biosphere Investigations (C-DEBI) was established as a National Science and Technology Center (NTC) funded by NSF in 2009. Its mission is to explore life beneath the seafloor and make transformative discoveries that advance science, benefit society, and inspire people of all ages and origins. Thanks to the multi-institutional character of C-DEBI, the Center has not only started a collaborative framework for experimental and exploratory research, but also targets education programs at the K-12, undergraduate, graduate and postdoctoral levels involving biogeochemists, microbiologists, geochemists and geologists. An example for this is the introduction of deep biosphere research into the K-12 classroom. In this context, C-DEBI has collaborated with teachers from the Animo Leadership High School in Inglewood, which is ranked 27th within California and has a total minority enrollment of 99%, to adapt Marine Biology classes and introduce latest Deep Biosphere Science discoveries. Three high school students participated in a pilot project over 6 months to gain hands-on experience in an ongoing study in a Marine Microbiology laboratory at University of Southern California. Graduate and postdoctoral students from the Departments of Biological and Earth Sciences supervised theory, praxis and project design, which was aimed at culturing strains of Marinobacter, one of the most ubiquitous marine microbial genera, and preparing extracted DNA for sequencing using the latest Ion Torrent Technology. Students learned about the interdisciplinary global context of the study and gained experience in laboratory procedures, including basic aseptical techniques, molecular biology methods, and cutting-edge sequencing Technology, as well as problem-solving and creative thinking in project preparation and conduction. This hands-on training included discussions about the 'Whys' and 'Hows' in today's research with respect to their specific project, but also from a

  7. Clean Energy Solutions Center Services (Vietnamese Translation) (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2014-11-01

    This is the Vietnamese language translation of the Clean Energy Solutions Center (Solutions Center) fact sheet. The Solutions Center helps governments, advisors and analysts create policies and programs that advance the deployment of clean energy technologies. The Solutions Center partners with international organizations to provide online training, expert assistance, and technical resources on clean energy policy.

  8. Clean Energy Solutions Center Services (Arabic Translation) (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2014-06-01

    This is the Arabic translation of the Clean Energy Solutions Center Services fact sheet. The Clean Energy Solutions Center (Solutions Center) helps governments, advisors and analysts create policies and programs that advance the deployment of clean energy technologies. The Solutions Center partners with international organizations to provide online training, expert assistance, and technical resources on clean energy policy.

  9. Louisiana Transportation Research Center : Annual report, 2016-2017

    Science.gov (United States)

    2017-10-11

    This publication is a report of the transportation research, technology transfer, education, and training activities of the Louisiana Transportation Research Center for July 1, 2016 - June 30, 2017. The center is sponsored jointly by the Louisiana De...

  10. Electric Power Research Institute Environmental Control Technology Center: Report to the Steering Committee, June 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-06-01

    Operations and maintenance continued this month at the Electric Power Research Institute`s (EPRI`s) Environmental Control Technology Center (ECTC). Testing for the Hazardous Air Pollutant (HAP) test block was conducted using the 4.0 MW Spray Dryer Absorber System (SDA) and Pulse Jet Fabric Filter (PJFF) - Carbon Injection System. Investigations also continued across the B&W/CHX Heat Exchanger unit, while the 1.0 MW Selective Catalytic Reduction (SCR) unit remained idle this month in a cold-standby mode as monthly inspections were conducted. Pilot Testing Highlights Testing efforts in June were focused on the HAP test block and the Trace Elements Removal (TER) test block. Both programs were conducted on the 4.0 MW wet FGD pilot unit and PJFF unit. The HAP test block was temporarily concluded in June to further review the test data. This program began in March as part of the DOE Advanced Power Systems Program; the mission of this program is to accelerate the commercialization of affordable, high-efficiency, low-emission, coal-fueled electric generating technologies. The 1996 HAP test block focuses on three research areas, including: Catalytic oxidation of vapor-phase elemental mercury; Enhanced particulate-phase HAPs removal by electrostatic charging of liquid droplets; and Enhanced mercury removal by addition of additives to FGD process liquor. The TER test block is part of EPRI`s overall program to develop control technology options for reduction of trace element emissions. This experimental program investigates mercury removal and mercury speciation under different operating conditions.

  11. The USC Epigenome Center.

    Science.gov (United States)

    Laird, Peter W

    2009-10-01

    The University of Southern California (USC, CA, USA) has a long tradition of excellence in epigenetics. With the recent explosive growth and technological maturation of the field of epigenetics, it became clear that a dedicated high-throughput epigenomic data production facility would be needed to remain at the forefront of epigenetic research. To address this need, USC launched the USC Epigenome Center as the first large-scale center in academics dedicated to epigenomic research. The Center is providing high-throughput data production for large-scale genomic and epigenomic studies, and developing novel analysis tools for epigenomic research. This unique facility promises to be a valuable resource for multidisciplinary research, education and training in genomics, epigenomics, bioinformatics, and translational medicine.

  12. Human Spaceflight Technology Needs - A Foundation for JSC's Technology Strategy

    Science.gov (United States)

    Stecklein, Jonette M.

    2013-01-01

    Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which adds risks as well as provides a major driver for costs and cost uncertainty. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cis-lunar space, near earth asteroid visits, lunar exploration, Mars moons, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA's Johnson Space Center (JSC), as the nation s primary center for human exploration, is addressing this challenge through an innovative approach in allocating Internal Research and Development funding to projects. The HAT Technology Needs (TechNeeds) Database has been developed to correlate across critical technologies and the NASA Office of Chief Technologist Technology Area Breakdown Structure (TABS). The TechNeeds Database illuminates that many critical technologies may support a single technical capability gap, that many HAT technology needs may map to a single TABS technology discipline, and that a single HAT technology need may map to multiple TABS technology

  13. Human-Centered Design Bill of Rights for Educators.

    Science.gov (United States)

    Sugar, William A.

    This paper presents a potential solution to encourage technology adoption and integration within schools by proposing a human-centered technology "bill of rights" for educators. The intention of this bill of rights it to influence educators' beliefs towards technology and to enable educators to confront with confidence the seemingly…

  14. Learning System Center App Controller

    CERN Document Server

    Naeem, Nasir

    2015-01-01

    This book is intended for IT professionals working with Hyper-V, Azure cloud, VMM, and private cloud technologies who are looking for a quick way to get up and running with System Center 2012 R2 App Controller. To get the most out of this book, you should be familiar with Microsoft Hyper-V technology. Knowledge of Virtual Machine Manager is helpful but not mandatory.

  15. Acceptable short-term outcome of laparoscopic subtotal colectomy for inflammatory bowel disease.

    Science.gov (United States)

    Frid, Natalie Lassen; Bulut, Orhan; Pachler, Jørn

    2013-06-01

    Laparoscopic colectomy for both benign and malignant disease, including inflammatory bowel disease (IBD), has recently been shown to have many advantages compared with open surgery. This study aimed to compare the effect of laparoscopic versus open subtotal colectomy (STC) for IBD on overall morbidity. A total of 99 patients undergoing STC for IBD at our institution from 2007 through 2011 were identified. Patients undergoing open STC were compared with patients undergoing laparoscopic STC. Outcomes included 30-day morbidity, conversion to laparotomy, intraoperative blood loss, operative time, admission time, late onset complications and 30-day mortality. Results are presented as median values. A total of 57 patients underwent open STC (Group 1) and 42 patients laparoscopic STC (Group 2). Group 1 comprised 26 males and 31 females, with a median age of 35 years and a body mass index (BMI) of 23.2 kg/m2. Group 2 comprised 18 males and 24 females, with a median age of 34 years and a BMI of 23.5 kg/m2. Group 2 had less morbidity (42.9% versus 75.4%, p < 0.002), reduced blood loss (100 ml versus 200 ml, p < 0.001), longer operative time (193.5 min. versus 128 min., p < 0.001), shorter length of hospital stay (six days versus 16 days, p < 0.001) than Group 1. One patient died (Group 1). There was no difference in late onset complications and no conversions to laparotomy in the laparoscopic group. Laparoscopic STC has a longer operative time, but improves short-term outcomes compared with open surgery. not relevant. not relevant.

  16. Expression of stanniocalcin 1 in thyroid side population cells and thyroid cancer cells.

    Science.gov (United States)

    Hayase, Suguru; Sasaki, Yoshihito; Matsubara, Tsutomu; Seo, Daekwan; Miyakoshi, Masaaki; Murata, Tsubasa; Ozaki, Takashi; Kakudo, Kennichi; Kumamoto, Kensuke; Ylaya, Kris; Cheng, Sheue-yann; Thorgeirsson, Snorri S; Hewitt, Stephen M; Ward, Jerrold M; Kimura, Shioko

    2015-04-01

    Mouse thyroid side population (SP) cells consist of a minor population of mouse thyroid cells that may have multipotent thyroid stem cell characteristics. However the nature of thyroid SP cells remains elusive, particularly in relation to thyroid cancer. Stanniocalcin (STC) 1 and 2 are secreted glycoproteins known to regulate serum calcium and phosphate homeostasis. In recent years, the relationship of STC1/2 expression to cancer has been described in various tissues. Microarray analysis was carried out to determine genes up- and down-regulated in thyroid SP cells as compared with non-SP cells. Among genes up-regulated, stanniocalcin 1 (STC1) was chosen for study because of its expression in various thyroid cells by Western blotting and immunohistochemistry. Gene expression analysis revealed that genes known to be highly expressed in cancer cells and/or involved in cancer invasion/metastasis were markedly up-regulated in SP cells from both intact as well as partial thyroidectomized thyroids. Among these genes, expression of STC1 was found in five human thyroid carcinoma-derived cell lines as revealed by analysis of mRNA and protein, and its expression was inversely correlated with the differentiation status of the cells. Immunohistochemical analysis demonstrated higher expression of STC1 in the thyroid tumor cell line and thyroid tumor tissues from humans and mice. These results suggest that SP cells contain a population of cells that express genes also highly expressed in cancer cells including Stc1, which warrants further study on the role of SP cells and/or STC1 expression in thyroid cancer.

  17. NASA's Corrosion Technology Laboratory at the Kennedy Space Center: Anticipating, Managing, and Preventing Corrosion

    Science.gov (United States)

    Calle, Luz Marina

    2014-01-01

    Corrosion is the degradation of a material that results from its interaction with the environment. The marine environment at NASAs Kennedy Space Center (KSC) has been documented by ASM International (formerly American Society for Metals) as the most corrosive in the United States. With the introduction of the Space Shuttle in 1981, the already highly corrosive conditions at the launch pads were rendered even more severe by the 70 tons of highly corrosive hydrochloric acid that were generated by the solid rocket boosters. Numerous failures at the launch pads are caused by corrosion.The structural integrity of ground infrastructure and flight hardware is critical to the success, safety, cost, and sustainability of space missions. As a result of fifty years of experience with launch and ground operations in a natural marine environment that is highly corrosive, NASAs Corrosion Technology Laboratory at KSC is a major source of corrosion control expertise in the launch and other environments. Throughout its history, the Laboratory has evolved from what started as an atmospheric exposure facility near NASAs launch pads into a world-wide recognized capability that provides technical innovations and engineering services in all areas of corrosion for NASA and external customers.This presentation will provide a historical overview of the role of NASAs Corrosion Technology in anticipating, managing, and preventing corrosion. One important challenge in managing and preventing corrosion involves the detrimental impact on humans and the environment of what have been very effective corrosion control strategies. This challenge has motivated the development of new corrosion control technologies that are more effective and environmentally friendly. Strategies for improved corrosion protection and durability can have a huge impact on the economic sustainability of human spaceflight operations.

  18. UC Davis Fuel Cell, Hydrogen, and Hybrid Vehicle (FCH2V) GATE Center of Excellence

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, Paul

    2012-05-31

    This is the final report of the UC Davis Fuel Cell, Hydrogen, and Hybrid Vehicle (FCH2V) GATE Center of Excellence which spanned from 2005-2012. The U.S. Department of Energy (DOE) established the Graduate Automotive Technology Education (GATE) Program, to provide a new generation of engineers and scientists with knowledge and skills to create advanced automotive technologies. The UC Davis Fuel Cell, Hydrogen, and Hybrid Vehicle (FCH2V) GATE Center of Excellence established in 2005 is focused on research, education, industrial collaboration and outreach within automotive technology. UC Davis has had two independent GATE centers with separate well-defined objectives and research programs from 1998. The Fuel Cell Center, administered by ITS-Davis, has focused on fuel cell technology. The Hybrid-Electric Vehicle Design Center (HEV Center), administered by the Department of Mechanical and Aeronautical Engineering, has focused on the development of plug-in hybrid technology using internal combustion engines. The merger of these two centers in 2005 has broadened the scope of research and lead to higher visibility of the activity. UC Davis's existing GATE centers have become the campus's research focal points on fuel cells and hybrid-electric vehicles, and the home for graduate students who are studying advanced automotive technologies. The centers have been highly successful in attracting, training, and placing top-notch students into fuel cell and hybrid programs in both industry and government.

  19. Person-centered care and engagement via technology of residents with dementia in aged care facilities.

    Science.gov (United States)

    Goh, Anita M Y; Loi, Samantha M; Westphal, Alissa; Lautenschlager, Nicola T

    2017-12-01

    Touchscreen technology (TT) is a resource that can improve the quality of life of residents with dementia, and care staff, in residential aged care facilities (RACF) through a person-centered care approach. To enable the use of TTs to engage and benefit people with dementia in RACFs, education is needed to explore how these devices may be used, what facilitates use, and how to address barriers. We sought to provide education and explore RACF staff views and barriers on using TT to engage their residents with dementia. An educational session on using TT with residents with dementia was given to staff from three long-term RACFs in Melbourne, Australia. A cross-sectional convenience sample of 17 staff members (personal care attendants, registered nurses, enrolled nurses, allied health clinicians, and domestic staff) who attended were administered questionnaires pre- and post-sessions. As a result of the education seminar, they were significantly more confident in their ability to use TT devices with residents. TT, and education to staff about its use with residents with dementia, is a useful strategy to enhance RACF staff knowledge and confidence, thereby enhancing the use of technology in RACFs in order to improve care standards in people with dementia.

  20. Manufacturing technologies

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    The Manufacturing Technologies Center is an integral part of Sandia National Laboratories, a multiprogram engineering and science laboratory, operated for the Department of Energy (DOE) with major facilities at Albuquerque, New Mexico, and Livermore, California. Our Center is at the core of Sandia`s Advanced Manufacturing effort which spans the entire product realization process.

  1. The Soviet center of astronomical data

    International Nuclear Information System (INIS)

    Dluzhnevskaya, O.B.

    1982-01-01

    On the basis of the current French-Soviet cooperation in science and technology, the Astronomical Council of the U.S.S.R. Academy of Sciences and the Strasbourg Center signed in 1977 an agreement on setting up the Soviet Center of Astronomical Data as its filial branch. The Soviet Center was created on the basis of a computation center at the Zvenigorod station of the Astronomical Council of the U.S.S.R. Academy of Sciences, which had already had considerable experience of working with stellar catalogues. In 1979 the Center was equipped with a EC-1033 computer. In 1978-1979 the Soviet Center of Astronomical Data (C.A.D.) received from Strasbourg 96 of the most important catalogues. By September 1981 the list of catalogues available at the Soviet Center has reached 140 catalogues some of which are described. (Auth.)

  2. The space - time - cube and the display of large movement data sets: the link between visualization strategies and cartographic design guidelines

    DEFF Research Database (Denmark)

    Kveladze, Irma; Kraak, Menno-Jan

    2011-01-01

    one should not only consider the nature of the data, but also the purpose of the particular phase of the workflow. To verify the above approach the visualization strategies and design guidelines are applied in a different use cases. The cases include: • The annotated space-time path A travel log...... is the Space-Time-cube (STC). The last decades the interest in this representation has increased considerable because of the technological opportunities. Despite the many domains where the STC is used, it is still unclear what the full possibilities and limitations of this graphic representation are. Its three...... consisting of a trajectory based on different modes of transport, with linked annotations. The challenge is to deal different scales and annotations. • The historical movement data The event ‘Napoleons march to Moscow’ contains fifteen space-time paths (STP) with attribute information. Challenge is to answer...

  3. 1991 research and technology

    Science.gov (United States)

    1992-01-01

    Selected research and technology activities at Ames Research Center, including the Moffett Field site and the Dryden Flight Research Facility, are summarized. These activities exemplify the Center's varied and productive research efforts for 1991.

  4. Optical Multidimensional Switching for Data Center Networks

    OpenAIRE

    Kamchevska, Valerija; Galili, Michael; Oxenløwe, Leif Katsuo; Berger, Michael Stübert

    2017-01-01

    Optical switches are known for the ability to provide high bandwidth connectivity at a relatively low power consumption and low latency. Several recent demonstrations on optical data center architectures confirm the potential for introducing all-optical switching within the data center, thus avoiding power hungry optical-electrical-optical conversions at each node. This Ph.D. thesis focuses precisely on the application of optical technologies in data center networks where optics is not only u...

  5. Technology Transfer: Marketing Tomorrow's Technology

    Science.gov (United States)

    Tcheng, Erene

    1995-01-01

    The globalization of the economy and the end of the Cold War have triggered many changes in the traditional practices of U.S. industry. To effectively apply the resources available to the United States, the federal government has firmly advocated a policy of technology transfer between private industry and government labs, in this case the National Aeronautics and Space Administration (NASA). NASA Administrator Daniel Goldin is a strong proponent of this policy and has organized technology transfer or commercialization programs at each of the NASA field centers. Here at Langley Research Center, the Technology Applications Group (TAG) is responsible for facilitating the transfer of Langley developed research and technology to U.S. industry. Entering the program, I had many objectives for my summer research with TAG. Certainly, I wanted to gain a more thorough understanding of the concept of technology transfer and Langley's implementation of a system to promote it to both the Langley community and the community at large. Also, I hoped to become more familiar with Langley's research capabilities and technology inventory available to the public. More specifically, I wanted to learn about the technology transfer process at Langley. Because my mentor is a member of Materials and Manufacturing marketing sector of the Technology Transfer Team, another overriding objective for my research was to take advantage of his work and experience in materials research to learn about the Advanced Materials Research agency wide and help market these developments to private industry. Through the various projects I have been assigned to work on in TAG, I have successfully satisfied the majority of these objectives. Work on the Problem Statement Process for TAG as well as the development of the Advanced Materials Research Brochure have provided me with the opportunity to learn about the technology transfer process from the outside looking in and the inside looking out. Because TAG covers

  6. Advanced Training Technologies and Learning Environments

    Science.gov (United States)

    Noor, Ahmed K. (Compiler); Malone, John B. (Compiler)

    1999-01-01

    This document contains the proceedings of the Workshop on Advanced Training Technologies and Learning Environments held at NASA Langley Research Center, Hampton, Virginia, March 9-10, 1999. The workshop was jointly sponsored by the University of Virginia's Center for Advanced Computational Technology and NASA. Workshop attendees were from NASA, other government agencies, industry, and universities. The objective of the workshop was to assess the status and effectiveness of different advanced training technologies and learning environments.

  7. La juridificación del derecho a decidir en España. La STC 42/2014 y el derecho a aspirar a un proceso de cambio político del orden constitucional. // The juridification of the right to decide in Spain.

    Directory of Open Access Journals (Sweden)

    Joan Ridao i Martín

    2014-12-01

    Full Text Available SUMMARY: 1. The Sentence 42/2014, of the Constitutional Court of Spain, about the «Declaration of sovereignty and the right to decide of the people in Catalonia». 2. The right to self-determination and the juridification of the right to decide in the international context. 3 The fitting of the right to decide in the Spanish domestic constitutional order. Background. 3.1. The so-called «Ibarretxe Plan». 3.2. The Catalan case: the so-called «National Transition». 4. Query tools that do not involve the exercise of the right to self-determination. 4.1. Consequences of the weak standardization of referendums in Spain. 4.2. The potential territorialisation of referendums of Article 92 Spanish Constitution (CE. The eventual delegation of state power to authorize referendums of Article 150.2 CE. 5. Referendums and consultations at the regional level. 5.1. The Catalan legislation regarding referendums. 5.2. The non-referendum consultation: a hybrid not-called referendum. Conclusions. Bibliography. RESUMEN La STC 42/2014, de 25 de marzo, estimó parcialmente, por unanimidad, el recurso del Gobierno contra la «Resolución 5/X del Parlamento de Cataluña, por la que se aprueba la Declaración soberanista y del derecho a decidir del pueblo de Cataluña», declarando «inconstitucional y nulo» el principio primero, según el cual, «el pueblo de Cataluña tiene, por razones de legitimidad democrática, el carácter de sujeto político y jurídico soberano». No obstante, el alto Tribunal declaró constitucionales las referencias al «derecho a decidir de los ciudadanos de Cataluña» al no consagrar, a su juicio, un derecho de autodeterminación no reconocido constitucionalmente sino una aspiración política a concretar mediante un proceso ajustado a la legalidad constitucional, con respeto a los principios de «legitimidad democrática», «pluralismo» y «legalidad». La argumentación del Tribunal no sólo desestimó el argumento de que el

  8. Technological advances for studying human behavior

    Science.gov (United States)

    Roske-Hofstrand, Renate J.

    1990-01-01

    Technological advances for studying human behavior are noted in viewgraph form. It is asserted that performance-aiding systems are proliferating without a fundamental understanding of how they would interact with the humans who must control them. Two views of automation research, the hardware view and the human-centered view, are listed. Other viewgraphs give information on vital elements for human-centered research, a continuum of the research process, available technologies, new technologies for persistent problems, a sample research infrastructure, the need for metrics, and examples of data-link technology.

  9. Secondary Waste Considerations for Vitrification of Sodium-Bearing Waste at the Idaho Nuclear Technology and Engineering Center FY-2001 Status Report

    International Nuclear Information System (INIS)

    Herbst, A.K.; Kirkham, R.J.; Losinski, S.J.

    2002-01-01

    The Idaho Nuclear Technology and Engineering Center (INTEC) is considering vitrification to process liquid sodium-bearing waste. Preliminary studies were completed to evaluate the potential secondary wastes from the melter off-gas clean up systems. Projected secondary wastes comprise acidic and caustic scrubber solutions, HEPA filters, activated carbon, and ion exchange media. Possible treatment methods, waste forms, and disposal sites are evaluated from radiological and mercury contamination estimates

  10. Secondary Waste Considerations for Vitrification of Sodium-Bearing Waste at the Idaho Nuclear Technology and Engineering Center FY-2001 Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Herbst, A.K.; Kirkham, R.J.; Losinski, S.J.

    2002-09-26

    The Idaho Nuclear Technology and Engineering Center (INTEC) is considering vitrification to process liquid sodium-bearing waste. Preliminary studies were completed to evaluate the potential secondary wastes from the melter off-gas clean up systems. Projected secondary wastes comprise acidic and caustic scrubber solutions, HEPA filters, activated carbon, and ion exchange media. Possible treatment methods, waste forms, and disposal sites are evaluated from radiological and mercury contamination estimates.

  11. Laparoscopic and open subtotal colectomies have similar short-term results.

    Science.gov (United States)

    Hoogenboom, Froukje J; Bosker, Robbert J I; Groen, Henk; Meijerink, Wilhelmus J H J; Lamme, Bas; Pierie, Jean Pierre E N

    2013-01-01

    Laparoscopic subtotal colectomy (STC) is a complex procedure. It is possible that short-term benefits for segmental resections cannot be attributed to this complex procedure. This study aims to assess differences in short-term results for laparoscopic versus open STC during a 15-year single-institute experience. We reviewed consecutive patients undergoing laparoscopic or open elective or subacute STC from January 1997 to December 2012. Fifty-six laparoscopic and 50 open STCs were performed. The operation time was significantly longer in the laparoscopic group, median 266 min (range 121-420 min), compared to 153 min (range 90-408 min) in the open group (p < 0.001). Median hospital stay showed no statistical difference, 14 days (range 1-129 days) in the laparoscopic and 13 days (range 1-85 days) in the open group. Between-group postoperative complications were not statistically different. Laparoscopic STC has short-term results similar to the open procedure, except for a longer operation time. The laparoscopic approach for STC is therefore only advisable in selected patients combined with extensive preoperative counseling. Copyright © 2013 S. Karger AG, Basel.

  12. Bioleaching of two different genetic types of chalcopyrite and their comparative mineralogical assessment.

    Science.gov (United States)

    Deng, Sha; Gu, Guohua; Ji, Jing; Xu, Baoke

    2018-02-01

    The bioleaching of two different genetic types of chalcopyrite by the moderate thermophile Sulfobacillus thermosulfidooxidans was investigated by leaching behaviors elucidation and their comparative mineralogical assessment. The leaching experiment showed that the skarn-type chalcopyrite (STC) revealed a much faster leaching rate with 33.34% copper extracted finally, while only 23.53% copper was bioleached for the porphyry-type chalcopyrite (PTC). The mineralogical properties were analyzed by XRD, SEM, XPS, and Fermi energy calculation. XRD indicated that the unit cell volume of STC was a little larger than that of PTC. SEM indicated that the surface of STC had more steps and ridges. XPS spectra showed that Cu(I) was the dominant species of copper on the surfaces of the two chalcopyrite samples, and STC had much more copper with lower Cu 2p 3/2 binding energy. Additionally, the Fermi energy of STC was much higher than that of PTC. These mineralogical differences were in good agreement with the bioleaching behaviors of chalcopyrite. This study will provide some new information for evaluating the oxidation kinetics of chalcopyrite.

  13. Voice Over Internet Protocol (VoIP) in a Control Center Environment

    Science.gov (United States)

    Pirani, Joseph; Calvelage, Steven

    2010-01-01

    The technology of transmitting voice over data networks has been available for over 10 years. Mass market VoIP services for consumers to make and receive standard telephone calls over broadband Internet networks have grown in the last 5 years. While operational costs are less with VoIP implementations as opposed to time division multiplexing (TDM) based voice switches, is it still advantageous to convert a mission control center s voice system to this newer technology? Marshall Space Flight Center (MSFC) Huntsville Operations Support Center (HOSC) has converted its mission voice services to a commercial product that utilizes VoIP technology. Results from this testing, design, and installation have shown unique considerations that must be addressed before user operations. There are many factors to consider for a control center voice design. Technology advantages and disadvantages were investigated as they refer to cost. There were integration concerns which could lead to complex failure scenarios but simpler integration for the mission infrastructure. MSFC HOSC will benefit from this voice conversion with less product replacement cost, less operations cost and a more integrated mission services environment.

  14. DATA CENTER REMODELING FOR THE INTERNET OF THINGS

    Directory of Open Access Journals (Sweden)

    Cristian IVĂNUŞ

    2015-05-01

    Full Text Available Designing efficient data center is more than ever a challenge for many companies when it comes to meet the requirements of having a greater and extensible computing capacity. It should be stored increasing volumes of data. Applications became increasingly complex. The requirements for running business operations should be very flexible. If we want that ICT infrastructure (Information Technology & Communication to be able to offer, continuosly, high level of services, it is essential to rethink the "robustness" and the need for innovation in data centers. This is true for both servers and storage as well as for the processing power. Companies operating in this field help customers to optimize their data center availability and security by evaluating the energy consumption, cooling capacity and other factors involved in data centers upgrading. The objective is to obtain an optimum in terms of occupied space, most efficient power consumption and most effective cooling in order to achieve a sustainable long term data center operation. The development and modernization explosive data centers as a result to the three major trends existent in the IT (Information Technology now: cloud computing, Internet of Things and Big Data [1, 9].

  15. Center for Technology for Advanced Scientific Component Software (TASCS) Consolidated Progress Report July 2006 - March 2009

    Energy Technology Data Exchange (ETDEWEB)

    Bernholdt, D E; McInnes, L C; Govindaraju, M; Bramley, R; Epperly, T; Kohl, J A; Nieplocha, J; Armstrong, R; Shasharina, S; Sussman, A L; Sottile, M; Damevski, K

    2009-04-14

    A resounding success of the Scientific Discovery through Advanced Computing (SciDAC) program is that high-performance computational science is now universally recognized as a critical aspect of scientific discovery [71], complementing both theoretical and experimental research. As scientific communities prepare to exploit unprecedented computing capabilities of emerging leadership-class machines for multi-model simulations at the extreme scale [72], it is more important than ever to address the technical and social challenges of geographically distributed teams that combine expertise in domain science, applied mathematics, and computer science to build robust and flexible codes that can incorporate changes over time. The Center for Technology for Advanced Scientific Component Software (TASCS) tackles these issues by exploiting component-based software development to facilitate collaborative high-performance scientific computing.

  16. NASA's Corrosion Technology Laboratory at the Kennedy Space Center: Anticipating, Managing, and Preventing Corrosion

    Science.gov (United States)

    Calle, Luz Marina

    2015-01-01

    The marine environment at NASAs Kennedy Space Center (KSC) has been documented by ASM International (formerly American Society for Metals) as the most corrosive in North America. With the introduction of the Space Shuttle in 1981, the already highly corrosive conditions at the launch pads were rendered even more severe by the highly corrosive hydrochloric acid (HCl) generated by the solid rocket boosters (SRBs). Numerous failures at the launch pads are caused by corrosion. The structural integrity of ground infrastructure and flight hardware is critical to the success, safety, cost, and sustainability of space missions. NASA has over fifty years of experience dealing with unexpected failures caused by corrosion and has developed expertise in corrosion control in the launch and other environments. The Corrosion Technology Laboratory at KSC evolved, from what started as an atmospheric exposure test site near NASAs launch pads, into a capability that provides technical innovations and engineering services in all areas of corrosion for NASA, external partners, and customers.This paper provides a chronological overview of NASAs role in anticipating, managing, and preventing corrosion in highly corrosive environments. One important challenge in managing and preventing corrosion involves the detrimental impact on humans and the environment of what have been very effective corrosion control strategies. This challenge has motivated the development of new corrosion control technologies that are more effective and environmentally friendly. Strategies for improved corrosion protection and durability can have a huge impact on the economic sustainability of human spaceflight operations.

  17. Shortest triplet clustering: reconstructing large phylogenies using representative sets

    Directory of Open Access Journals (Sweden)

    Sy Vinh Le

    2005-04-01

    Full Text Available Abstract Background Understanding the evolutionary relationships among species based on their genetic information is one of the primary objectives in phylogenetic analysis. Reconstructing phylogenies for large data sets is still a challenging task in Bioinformatics. Results We propose a new distance-based clustering method, the shortest triplet clustering algorithm (STC, to reconstruct phylogenies. The main idea is the introduction of a natural definition of so-called k-representative sets. Based on k-representative sets, shortest triplets are reconstructed and serve as building blocks for the STC algorithm to agglomerate sequences for tree reconstruction in O(n2 time for n sequences. Simulations show that STC gives better topological accuracy than other tested methods that also build a first starting tree. STC appears as a very good method to start the tree reconstruction. However, all tested methods give similar results if balanced nearest neighbor interchange (BNNI is applied as a post-processing step. BNNI leads to an improvement in all instances. The program is available at http://www.bi.uni-duesseldorf.de/software/stc/. Conclusion The results demonstrate that the new approach efficiently reconstructs phylogenies for large data sets. We found that BNNI boosts the topological accuracy of all methods including STC, therefore, one should use BNNI as a post-processing step to get better topological accuracy.

  18. The design of neonatal incubators: a systems-oriented, human-centered approach.

    Science.gov (United States)

    Ferris, T K; Shepley, M M

    2013-04-01

    This report describes a multidisciplinary design project conducted in an academic setting reflecting a systems-oriented, human-centered philosophy in the design of neonatal incubator technologies. Graduate students in Architectural Design and Human Factors Engineering courses collaborated in a design effort that focused on supporting the needs of three user groups of incubator technologies: infant patients, family members and medical personnel. Design teams followed established human-centered design methods that included interacting with representatives from the user groups, analyzing sets of critical tasks and conducting usability studies with existing technologies. An iterative design and evaluation process produced four conceptual designs of incubators and supporting equipment that better address specific needs of the user groups. This report introduces the human-centered design approach, highlights some of the analysis findings and design solutions, and offers a set of design recommendations for future incubation technologies.

  19. Microsoft System Center 2012 Orchestrator cookbook

    CERN Document Server

    Erskine, Samuel

    2013-01-01

    This book is written in a practical, Cookbook style with numerous chapters and recipes focusing on creating runbooks to automate mission critical and everyday administration tasks.System Center 2012 Orchestrator is for administrators who wish to simplify the process of automating systems administration tasks. This book assumes that you have a basic knowledge of Windows Server 2008 Administration, Active Directory, Network Systems, and Microsoft System Center technologies.

  20. Center for X-ray Optics (CXRO)

    Data.gov (United States)

    Federal Laboratory Consortium — The Center for X-Ray Optics at Lawrence Berkeley National Laboratory works to further science and technology using short wavelength optical systems and techniques....

  1. Funding and Strategic Alignment Guidance for Infusing Small Business Innovation Research Technology Into Aeronautics Research Mission Directorate Projects at NASA Glenn Research Center for 2015

    Science.gov (United States)

    Nguyen, Hung D.; Steele, Gynelle C.; Morris, Jessica R.

    2015-01-01

    This document is intended to enable the more effective transition of NASA Glenn Research Center (GRC) SBIR technologies funded by the Small Business Innovation Research (SBIR) program as well as its companion, the Small Business Technology Transfer (STTR) program into NASA Aeronautics Research Mission Directorate (ARMD) projects. Primarily, it is intended to help NASA program and project managers find useful technologies that have undergone extensive research and development (RRD), through Phase II of the SBIR program; however, it can also assist non-NASA agencies and commercial companies in this process. aviation safety, unmanned aircraft, ground and flight test technique, low emissions, quiet performance, rotorcraft

  2. Annual report of Nuclear Technology and Education Center (April 1, 2005 - March 31, 2006)

    International Nuclear Information System (INIS)

    2006-12-01

    This report summarizes the activities of the Nuclear Technology and Education Center (NuTEC) of the Japan Atomic Energy Agency (JAEA) in the fiscal year 2005. On unification of JAERI and JNC on October, 2005, the former NuTEC of JAERI and the Human Resources Development Section of JNC were reorganized as the new NuTEC. Concomitantly, the training courses on nuclear emergency preparedness, held at the former NuTEC, was transferred to NEAT, JAEA, and the management related to university cooperation was assigned as one of the tasks of the new NuTEC. In total, the number of trainees for the general domestic training courses was 652, while that for the staff technical training courses was 616. The international training courses have also been carried out as planned. In addition, supportive activities for the Nuclear Professional School of Tokyo University, commenced in April, 2005, have been made mainly concerning the experimental exercises for the students. (author)

  3. The Chicago Center for Green Technology: life-cycle assessment of a brownfield redevelopment project

    International Nuclear Information System (INIS)

    Brecheisen, Thomas; Theis, Thomas

    2013-01-01

    The sustainable development of brownfields reflects a fundamental, yet logical, shift in thinking and policymaking regarding pollution prevention. Life-cycle assessment (LCA) is a tool that can be used to assist in determining the conformity of brownfield development projects to the sustainability paradigm. LCA was applied to the process of a real brownfield redevelopment project, now known as the Chicago Center for Green Technology, to determine the cumulative energy required to complete the following redevelopment stages: (1) brownfield assessment and remediation, (2) building rehabilitation and site development and (3) ten years of operation. The results of the LCA have shown that operational energy is the dominant life-cycle stage after ten years of operation. The preservation and rehabilitation of the existing building, the installation of renewable energy systems (geothermal and photovoltaic) on-site and the use of more sustainable building products resulted in 72 terajoules (TJ) of avoided energy impacts, which would provide 14 years of operational energy for the site. (letter)

  4. Environmental management technology demonstration and commercialization

    International Nuclear Information System (INIS)

    Daly, D.J.; Erickson, T.A.; Groenewold, G.H.

    1995-01-01

    The Energy ampersand Environmental Research Center (EERC), a contract-supported organization focused on technology research, development, demonstration, and commercialization (RDD ampersand C), is entering its second year of a Cooperative Agreement with the U.S. Department of Energy (DOE) Morgantown Energy Technology Center (METC) to facilitate the development, demonstration, and commercialization of innovative environmental management (EM) technologies in support of the activities of DOE's Office of Environmental Science and Technology (EM-50) under DOE's EM Program. This paper reviews the concept and approach of the program under the METC-EERC EM Cooperative Agreement and profiles the role the program is playing in the commercialization of five EM technologies

  5. Environmental management technology demonstration and commercialization

    Energy Technology Data Exchange (ETDEWEB)

    Daly, D.J.; Erickson, T.A.; Groenewold, G.H. [Energy & Environmental Research Center, Grand Forks, ND (United States)] [and others

    1995-10-01

    The Energy & Environmental Research Center (EERC), a contract-supported organization focused on technology research, development, demonstration, and commercialization (RDD&C), is entering its second year of a Cooperative Agreement with the U.S. Department of Energy (DOE) Morgantown Energy Technology Center (METC) to facilitate the development, demonstration, and commercialization of innovative environmental management (EM) technologies in support of the activities of DOE`s Office of Environmental Science and Technology (EM-50) under DOE`s EM Program. This paper reviews the concept and approach of the program under the METC-EERC EM Cooperative Agreement and profiles the role the program is playing in the commercialization of five EM technologies.

  6. Idaho Nuclear Technology and Engineering Center (INTEC) Sodium Bearing Waste - Waste Incidental to Reprocessing Determination

    International Nuclear Information System (INIS)

    Jacobson, Victor Levon

    2002-01-01

    U.S. Department of Energy Manual 435.1-1, Radioactive Waste Management, Section I.1.C, requires that all radioactive waste subject to Department of Energy Order 435.1 be managed as high-level radioactive waste, transuranic waste, or low-level radioactive waste. Determining the radiological classification of the sodium-bearing waste currently in the Idaho Nuclear Technology and Engineering Center Tank Farm Facility inventory is important to its proper treatment and disposition. This report presents the technical basis for making the determination that the sodium-bearing waste is waste incidental to spent fuel reprocessing and should be managed as mixed transuranic waste. This report focuses on the radiological characteristics of the sodium-bearing waste. The report does not address characterization of the nonradiological, hazardous constituents of the waste in accordance with Resource Conservation and Recovery Act requirements

  7. Research and Technology 1997

    Science.gov (United States)

    1998-01-01

    This report highlights the challenging work accomplished during fiscal year 1997 by Ames research scientists and engineers. The work is divided into accomplishments that support the goals of NASA s four Strategic Enterprises: Aeronautics and Space Transportation Technology, Space Science, Human Exploration and Development of Space (HEDS), and Earth Science. NASA Ames Research Center s research effort in the Space, Earth, and HEDS Enterprises is focused i n large part to support Ames lead role for Astrobiology, which broadly defined is the scientific study of the origin, distribution, and future of life in the universe. This NASA initiative in Astrobiology is a broad science effort embracing basic research, technology development, and flight missions. Ames contributions to the Space Science Enterprise are focused in the areas of exobiology, planetary systems, astrophysics, and space technology. Ames supports the Earth Science Enterprise by conducting research and by developing technology with the objective of expanding our knowledge of the Earth s atmosphere and ecosystems. Finallv, Ames supports the HEDS Enterprise by conducting research, managing spaceflight projects, and developing technologies. A key objective is to understand the phenomena surrounding the effects of gravity on living things. Ames has also heen designated the Agency s Center of Evcellence for Information Technnlogv. The three cornerstones of Information Technology research at Ames are automated reasoning, human-centered computing, and high performance computing and networking.

  8. The Stanford University US-Japan Technology Management Center

    National Research Council Canada - National Science Library

    Dasher, Richard

    2002-01-01

    ..., nanotechnologies, MEMS, system-level chip integration, and advanced manufacturing. Our technology management focus embraced industry standards and standardization, intellectual property management, U.S...

  9. PREFACE: Fourth International Symposium on Atomic Technology

    Science.gov (United States)

    Okada, Shigefumi

    2010-04-01

    The International Symposium on Atomic Technology (ISAT) is held every year. The 4th Symposium (ISAT-4) was held on November 18-19, 2009 at the Seaside Hotel MAIKO VILLA KOBE, Kobe City, Japan presided by the "Atomic Technology Project". The ISAT-4 symposium was intended to offer a forum for the discussion on the latest progress in the atomic technologies. The symposium was attended by 107 delegates. There were 10 invited and 6 oral presentations. The number of poster presentations was 69. From all the contributions, 22 papers selected through review process are contained in this volume. The "Atomic Technology Project" was started in 2006 as a joint project of three institutions; (1) the Center for Atomic and Molecular Technologies, Graduate School of Engineering, Osaka University (CAMT), (2) the Tsukuba Research Center for Interdisciplinary Materials Science, Graduate School of Pure and Applied Sciences, University of Tsukuba (TIMS) and (3) the Polyscale Technology Research Center, Research Institute for Science and Technology, Tokyo University of Science (PTRC), each of which were independently pursuing nano-technologies and was developing atomic scale operation and diagnostics, functional materials, micro processing and device. The project is funded by the Ministry of Education, Culture, Sports, Science and Technology of Japan. The goal of the project is to contribute to the development of atomic-scale science and technologies such as functional molecules, biomaterials, and quantum functions of atomic-scale structures. Shigefumi Okada Conference Chair Center for Atomic and Molecular Technologies, Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita-city, Osaka 565-0871, Japan. Conference photograph Kobe photograph

  10. Practical issues for testing thin film PV modules at standard test conditions.

    OpenAIRE

    Marín González, Omar; Raga Arroyo, Manuela Pilar; Alonso Garcia, M. Carmen; Muñoz-García, Miguel Angel

    2013-01-01

    Thin film photovoltaic (TF) modules have gained importance in the photovoltaic (PV) market. New PV plants increasingly use TF technologies. In order to have a reliable sample of a PV module population, a huge number of modules must be measured. There is a big variety of materials used in TF technology. Some of these modules are made of amorphous or microcrystalline silicon. Other are made of CIS or CdTe. Not all these materials respond the same under standard test conditions (STC) of power...

  11. Kazakhstan innovation projects in nuclear technologies field

    International Nuclear Information System (INIS)

    Shkol'nik, V.S.; Tukhvatulin, Sh.T.

    2005-01-01

    At present in the Republic of Kazakhstan in preparation and realization stage there are several innovation projects related with use of advanced nuclear technologies. Projects are as follows: 'Implementation of Kazakhstan thermonuclear reactor tokamak (KTM)'; 'Implementation at the L.N. Gumilev Eurasian National University the inter-disciplinary research complex on the heavy ions accelerator base'; 'Development of the Technological Park 'Nuclear Technologies Center in Kurchatov city'; 'Development the first in the Central-Asian region Center of Nuclear Medicine and Biophysics'. The initiator and principal operator of these projects is the National Nuclear Center of the Republic of Kazakhstan

  12. Patient- and Provider-Centered Design of an Outpatient Diabetes Technology Clinic

    OpenAIRE

    Cramer, Angela M.; Scalzo, Patricia; Bach, Sarah M.; Kudva, Yogish C.

    2016-01-01

    The number of US patients using diabetes technology is increasing, and sophisticated technologies continue to emerge. Patients using diabetes technology require access to providers prepared to offer care in this rapidly changing field. The authors sought to identify factors important to both patients using diabetes technology and providers caring for such patients. They redesigned the Diabetes Technology Clinic at an academic group practice in response to the needs of patients and providers. ...

  13. JRCAT - A Nanotechnology Center in Tsukuba

    International Nuclear Information System (INIS)

    Tanaka, Kazunobu

    2000-01-01

    Joint Research Center for Atom Technology (JRCAT) and its Atom Technology Project are described. The project covers a wide range of research subjects; manipulation of atoms and molecules, formation of nanostructures of semiconductors, spin electronics and first-principles calculation of dynamic processes of atoms and molecules on solid-state surfaces. Several recent achievements on nanotechnology and nanoscience are roughly sketched

  14. NASA technology applications team: Applications of aerospace technology

    Science.gov (United States)

    1993-01-01

    This report covers the activities of the Research Triangle Institute (RTI) Technology Applications Team for the period 1 October 1992 through 30 September 1993. The work reported herein was supported by the National Aeronautics and Space Administration (NASA), Contract No. NASW-4367. Highlights of the RTI Applications Team activities over the past year are presented in Section 1.0. The Team's progress in fulfilling the requirements of the contract is summarized in Section 2.0. In addition to our market-driven approach to applications project development, RTI has placed increased effort on activities to commercialize technologies developed at NASA Centers. These Technology Commercialization efforts are summarized in Section 3.0. New problem statements prepared by the Team in the reporting period are presented in Section 4.0. The Team's transfer activities for ongoing projects with the NASA Centers are presented in Section 5.0. Section 6.0 summarizes the status of four add-on tasks. Travel for the reporting period is described in Section 7.0. The RTI Team staff and consultants and their project responsibilities are listed in Appendix A. Appendix B includes Technology Opportunity Announcements and Spinoff! Sheets prepared by the Team while Appendix C contains a series of technology transfer articles prepared by the Team.

  15. Staff roster for 1979: National Center for Analysis of Energy Systems

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    This publication is a compilation of resumes from the current staff of the National Center for Analysis of Energy Systems. The Center, founded in January 1976, is one of four areas within the Department of Energy and Environment at Brookhaven National Laboratory. The emphasis of programs at the Center is on energy policy and planning studies at the regional, national, and international levels, involving quantitative, interdisciplinary studies of the technological, economic, social, and environmental aspects of energy systems. To perform these studies the Center has assembled a staff of experts in the areas of science, technology, economics planning, health and safety, information systems, and quantitative analysis.

  16. Classification of Security Operation Centers

    CSIR Research Space (South Africa)

    Jacobs, P

    2013-08-01

    Full Text Available Security Operation Centers (SOCs) are a necessary service for organisations that want to address compliance and threat management. While there are frameworks in existence that addresses the technology aspects of these services, a holistic framework...

  17. MSU-Northern Bio-Energy Center of Excellence

    Energy Technology Data Exchange (ETDEWEB)

    Kegel, Greg [Montana State Univ., Bozeman, MT (United States); Alcorn-Windy Boy, Jessica [Montana State Univ., Bozeman, MT (United States); Abedin, Md. Joynal [Montana State Univ., Bozeman, MT (United States); Maglinao, Randy [Montana State Univ., Bozeman, MT (United States)

    2014-09-30

    MSU-Northern established the Bio-Energy Center (the Center) into a Regional Research Center of Excellence to address the obstacles concerning biofuels, feedstock, quality, conversion process, economic viability and public awareness. The Center built its laboratories and expertise in order to research and support product development and commercialization for the bio-energy industry in our region. The Center wanted to support the regional agricultural based economy by researching biofuels based on feedstock’s that can be grown in our region in an environmentally responsible manner. We were also interested in any technology that will improve the emissions and fuel economy performance of heavy duty diesel engines. The Center had a three step approach to accomplish these goals: 1. Enhance the Center’s research and testing capabilities 2. Develop advanced biofuels from locally grown agricultural crops. 3. Educate and outreach for public understanding and acceptance of new technology. The Center was very successful in completing the tasks as outlined in the project plan. Key successes include discovering and patenting a new chemical conversion process for converting camelina oil to jet fuel, as well as promise in developing a heterogeneous Grubs catalyst to support the new chemical conversion process. The Center also successfully fragmented and deoxygenated naturally occurring lignin with a Ni-NHC catalyst, showing promise for further exploration of using lignin for fuels and fuel additives. This would create another value-added product for lignin that can be sourced from beetle kill trees or waste products from cellulose ethanol fuel facilities.

  18. Environmental Technology Verification Report: Taconic Energy, Inc. TEA Fuel Additive

    Science.gov (United States)

    The Greenhouse Gas Technology Center (GHG Center) is one of six verification organizations operating under EPA’s ETV program. One sector of significant interest to GHG Center stakeholders is transportation - particularly technologies that result in fuel economy improvements. Taco...

  19. Spatiotemporal correlation of optical coherence tomography in-vivo images of rabbit airway for the diagnosis of edema

    Science.gov (United States)

    Kang, DongYel; Wang, Alex; Volgger, Veronika; Chen, Zhongping; Wong, Brian J. F.

    2015-07-01

    Detection of an early stage of subglottic edema is vital for airway management and prevention of stenosis, a life-threatening condition in critically ill neonates. As an observer for the task of diagnosing edema in vivo, we investigated spatiotemporal correlation (STC) of full-range optical coherence tomography (OCT) images acquired in the rabbit airway with experimentally simulated edema. Operating the STC observer on OCT images generates STC coefficients as test statistics for the statistical decision task. Resulting from this, the receiver operating characteristic (ROC) curves for the diagnosis of airway edema with full-range OCT in-vivo images were extracted and areas under ROC curves were calculated. These statistically quantified results demonstrated the potential clinical feasibility of the STC method as a means to identify early airway edema.

  20. Evaluación económica de una engorda de toretes en dos sistemas de alimentación

    Directory of Open Access Journals (Sweden)

    José Manuel González Pérez

    2016-01-01

    Full Text Available Se evaluó económicamente la en - gorda de toretes en dos sistemas de alimenta - ción: uno bajo el sistema silvopastoril intensivo ( ssp i y otro bajo un sistema tradicional de confinamiento ( stc . Se usaron 78 toretes, divi - didos equitativamente en los ssp i y stc , en Apa - tzingán, Michoacán, México. Para la evaluación se utilizaron los indicadores del van , la tir , el prc , y la r = b / c . Los indicadores económicos obtenidos para el ssp i fueron positivos y para el stc resultaron negativos. Se observó que no fue rentable la engorda de toretes en el trópico Michoacano bajo el stc ; sin embargo, fue viable económicamente bajo un ssp i.

  1. Study on the operational guides of the off-site emergency management center

    International Nuclear Information System (INIS)

    Park, Won Jong; Han, S. J.; Oh, K. H.

    2005-01-01

    The emergency response organizational groups and roles of Off-site Emergency Management Center was proposed to respond in case of radiological emergency. Development of implementing procedures of Off-site Emergency Management Center in case of radiological emergency to improve effective co-operation and rapid response in radiological emergency. Establishment of 'The Ordinance of Operation of residence radiological emergency office of the Minister of Science and Technology' and announced by the Minister of Science and Technology. The Implementing procedures of Off-site Emergency Management Center and 'The Ordinance of Operation of residence radiological emergency office of the Minister of Science and Technology' can be provide guidelines in case of emergency

  2. Effective technology transfer through regional information teams

    International Nuclear Information System (INIS)

    Wicks, D.E.; Gahan, B.; Hoyle, G.

    1997-01-01

    Communication and the transfer of technical information is critical to the international gas industry. The technical research results developed through Gas Research Institute's natural gas supply program have been disseminated through a number of vehicles. Two primary vehicles are GRI's Information Centers and Regional Technology Transfer Agents (RTTA). The Information Centers serve as repositories for GRI information as well as provide no-cost literature searching expertise. The RTTAs actively communicate and interface with area producers, introducing potential technology adopters with GRI technology managers and/or the appropriate licensed product or service distributors. The combination of Information Centers and RTTAs continues to help independent producers break through the barriers of technology and accelerate the benefits of lower cost natural gas recovery. (au)

  3. What do we mean by Human-Centered Design of Life-Critical Systems?

    Science.gov (United States)

    Boy, Guy A

    2012-01-01

    Human-centered design is not a new approach to design. Aerospace is a good example of a life-critical systems domain where participatory design was fully integrated, involving experimental test pilots and design engineers as well as many other actors of the aerospace engineering community. This paper provides six topics that are currently part of the requirements of the Ph.D. Program in Human-Centered Design of the Florida Institute of Technology (FIT.) This Human-Centered Design program offers principles, methods and tools that support human-centered sustainable products such as mission or process control environments, cockpits and hospital operating rooms. It supports education and training of design thinkers who are natural leaders, and understand complex relationships among technology, organizations and people. We all need to understand what we want to do with technology, how we should organize ourselves to a better life and finally find out whom we are and have become. Human-centered design is being developed for all these reasons and issues.

  4. Activities of the Center for Space Construction

    Science.gov (United States)

    1993-01-01

    The Center for Space Construction (CSC) at the University of Colorado at Boulder is one of eight University Space Engineering Research Centers established by NASA in 1988. The mission of the center is to conduct research into space technology and to directly contribute to space engineering education. The center reports to the Department of Aerospace Engineering Sciences and resides in the College of Engineering and Applied Science. The college has a long and successful track record of cultivating multi-disciplinary research and education programs. The Center for Space Construction is prominent evidence of this record. At the inception of CSC, the center was primarily founded on the need for research on in-space construction of large space systems like space stations and interplanetary space vehicles. The scope of CSC's research has now evolved to include the design and construction of all spacecraft, large and small. Within this broadened scope, our research projects seek to impact the underlying technological basis for such spacecraft as remote sensing satellites, communication satellites, and other special purpose spacecraft, as well as the technological basis for large space platforms. The center's research focuses on three areas: spacecraft structures, spacecraft operations and control, and regolith and surface systems. In the area of spacecraft structures, our current emphasis is on concepts and modeling of deployable structures, analysis of inflatable structures, structural damage detection algorithms, and composite materials for lightweight structures. In the area of spacecraft operations and control, we are continuing our previous efforts in process control of in-orbit structural assembly. In addition, we have begun two new efforts in formal approach to spacecraft flight software systems design and adaptive attitude control systems. In the area of regolith and surface systems, we are continuing the work of characterizing the physical properties of lunar

  5. The Center for Aerospace Research: A NASA Center of Excellence at North Carolina Agricultural and Technical State University

    Science.gov (United States)

    Lai, Steven H.-Y.

    1992-01-01

    This report documents the efforts and outcomes of our research and educational programs at NASA-CORE in NCA&TSU. The goal of the center was to establish a quality aerospace research base and to develop an educational program to increase the participation of minority faculty and students in the areas of aerospace engineering. The major accomplishments of this center in the first year are summarized in terms of three different areas, namely, the center's research programs area, the center's educational programs area, and the center's management area. In the center's research programs area, we focus on developing capabilities needed to support the development of the aerospace plane and high speed civil transportation system technologies. In the educational programs area, we developed an aerospace engineering option program ready for university approval.

  6. Impelementation of Information Technology Service Management at Data And Information System Center of XYZ University

    Directory of Open Access Journals (Sweden)

    Kornelius Irfandhi

    2016-03-01

    Full Text Available Information Technology (IT is increasingly progressing. Nowadays, the success of a business of the organization/company is highly dependent on the IT infrastructure used. Therefore, organizations/companies have to manage their IT service to be optimal to their customers. Looking at this matter and the increasing dynamics of XYZ University, then Data and Information System Center (Pusdatin - an IT provider of XYZ University began implementing IT Service Management (ITSM from 2013 using the latest version of Information Technology Infrastructure Library (ITIL, namely ITIL v3 as a framework for implementing ITSM in its business processes. However, along the way, there are still some problems happen in Pusdatin in order that ITSM can actually support and align with the objectives of XYZ University. Through this paper, the authors want to explain how the implementation of ITSM at Pusdatin, identify the problems related to the implementation of ITSM, and provide the solutions for each problem. The methods used are direct observation to Pusdatin, conductan interview with the Head of Pusdatin and Staff of Pusdatin, and also perform a literature review of books and papers that discuss about ITIL. The result of this research is that ITSM process of Pusdatin generally works quite well but there are still some shortcomings because ITSM is not 100% implemented in all areas.

  7. NASA Technology Applications Team: Commercial applications of aerospace technology

    Science.gov (United States)

    1994-01-01

    The Research Triangle Institute (RTI) Team has maintained its focus on helping NASA establish partnerships with U.S. industry for dual use development and technology commercialization. Our emphasis has been on outcomes, such as licenses, industry partnerships and commercialization of technologies, that are important to NASA in its mission of contributing to the improved competitive position of U.S. industry. The RTI Team has been successful in the development of NASA/industry partnerships and commercialization of NASA technologies. RTI ongoing commitment to quality and customer responsiveness has driven our staff to continuously improve our technology transfer methodologies to meet NASA's requirements. For example, RTI has emphasized the following areas: (1) Methodology For Technology Assessment and Marketing: RTI has developed and implemented effective processes for assessing the commercial potential of NASA technologies. These processes resulted from an RTI study of best practices, hands-on experience, and extensive interaction with the NASA Field Centers to adapt to their specific needs. (2) Effective Marketing Strategies: RTI surveyed industry technology managers to determine effective marketing tools and strategies. The Technology Opportunity Announcement format and content were developed as a result of this industry input. For technologies with a dynamic visual impact, RTI has developed a stand-alone demonstration diskette that was successful in developing industry interest in licensing the technology. And (3) Responsiveness to NASA Requirements: RTI listened to our customer (NASA) and designed our processes to conform with the internal procedures and resources at each NASA Field Center and the direction provided by NASA's Agenda for Change. This report covers the activities of the Research Triangle Institute Technology Applications Team for the period 1 October 1993 through 31 December 1994.

  8. NASA Technology Transfer System

    Science.gov (United States)

    Tran, Peter B.; Okimura, Takeshi

    2017-01-01

    NTTS is the IT infrastructure for the Agency's Technology Transfer (T2) program containing 60,000+ technology portfolio supporting all ten NASA field centers and HQ. It is the enterprise IT system for facilitating the Agency's technology transfer process, which includes reporting of new technologies (e.g., technology invention disclosures NF1679), protecting intellectual properties (e.g., patents), and commercializing technologies through various technology licenses, software releases, spinoffs, and success stories using custom built workflow, reporting, data consolidation, integration, and search engines.

  9. Green Propellant Infusion Mission Program Development and Technology Maturation

    Science.gov (United States)

    McLean, Christopher H.; Deininger, William D.; Joniatis, John; Aggarwal, Pravin K.; Spores, Ronald A.; Deans, Matthew; Yim, John T.; Bury, Kristen; Martinez, Jonathan; Cardiff, Eric H.; hide

    2014-01-01

    The NASA Space Technology Mission Directorate's (STMD) Green Propellant Infusion Mission (GPIM) Technology Demonstration Mission (TDM) is comprised of a cross-cutting team of domestic spacecraft propulsion and storable green propellant technology experts. This TDM is led by Ball Aerospace & Technologies Corp. (BATC), who will use their BCP- 100 spacecraft to carry a propulsion system payload consisting of one 22 N thruster for primary divert (DeltaV) maneuvers and four 1 N thrusters for attitude control, in a flight demonstration of the AF-M315E technology. The GPIM project has technology infusion team members from all three major market sectors: Industry, NASA, and the Department of Defense (DoD). The GPIM project team includes BATC, includes Aerojet Rocketdyne (AR), Air Force Research Laboratory, Aerospace Systems Directorate, Edwards AFB (AFRL), NASA Glenn Research Center (GRC), NASA Kennedy Space Center (KSC), and NASA Goddard Space Flight Center (GSFC). STMD programmatic and technology oversight is provided by NASA Marshall Space Flight Center. The GPIM project shall fly an operational AF-M315E green propulsion subsystem on a Ball-built BCP-100 spacecraft.

  10. Technologies for life

    International Nuclear Information System (INIS)

    Kerner, J.

    2006-01-01

    In this video-film technologies applied in the BIONT, a. s. are presented. Production of radionuclides and radiopharmaceuticals as well as principles of positron emission tomography and diagnostic using is explained. Other technologies implemented and planned in the Cyclotron Center of the Slovak Republic are presented.

  11. Preliminary designs for 25 kWe advanced Stirling conversion systems for dish electric applications

    Science.gov (United States)

    Shaltens, Richard K.; Schreiber, Jeffrey G.

    Under the Department of Energy's (DOE) Solar Thermal Technology Program, Sandia National Laboratories is evaluating heat engines for terrestrial Solar Distributed Heat Receivers. The Stirling engine has been identified by Sandia as one of the most promising engines for terrestrial applications. The Stirling engine also has the potential to meet DOE's performance and cost goals. The NASA Lewis Research Center is conducting Stirling engine technology development activities directed toward a dynamic power source for space applications. Space power systems requirements include high reliability, very long life, low vibration and high efficiency. The free-piston Stirling engine has the potential for future high power space conversion systems, either nuclear or solar powered. Although both applications appear to be quite different, their requirements complement each other. Preliminary designs feature a free-piston Stirling engine, a liquid metal heat transport system, and a means to provide nominally 25 kW electric power to a utility grid while meeting DOE's performance and long term cost goals. The Cummins design incorporates a linear alternator to provide the electrical output, while the STC design generates electrical power indirectly through a hydraulic pump/motor coupled to an induction generator. Both designs for the ASCS's will use technology which can reasonably be expected to be available in the early 1990's.

  12. Best Practices Guide for Energy-Efficient Data Center Design

    Energy Technology Data Exchange (ETDEWEB)

    O. VanGeet: NREL

    2010-02-24

    This guide provides an overview of best practices for energy-efficient data center design which spans the categories of Information Technology (IT) systems and their environmental conditions, data center air management, cooling and electrical systems, on-site generation, and heat recovery.

  13. NASA's National Center for Advanced Manufacturing

    Science.gov (United States)

    Vickers, John

    2003-01-01

    NASA has designated the Principal Center Assignment to the Marshall Space Flight Center (MSFC) for implementation of the National Center for Advanced Manufacturing (NCAM). NCAM is NASA s leading resource for the aerospace manufacturing research, development, and innovation needs that are critical to the goals of the Agency. Through this initiative NCAM s people work together with government, industry, and academia to ensure the technology base and national infrastructure are available to develop innovative manufacturing technologies with broad application to NASA Enterprise programs, and U.S. industry. Educational enhancements are ever-present within the NCAM focus to promote research, to inspire participation and to support education and training in manufacturing. Many important accomplishments took place during 2002. Through NCAM, NASA was among five federal agencies involved in manufacturing research and development (R&D) to launch a major effort to exchange information and cooperate directly to enhance the payoffs from federal investments. The Government Agencies Technology Exchange in Manufacturing (GATE-M) is the only active effort to specifically and comprehensively address manufacturing R&D across the federal government. Participating agencies include the departments of Commerce (represented by the National Institute of Standards and Technology), Defense, and Energy, as well as the National Science Foundation and NASA. MSFC s ongoing partnership with the State of Louisiana, the University of New Orleans, and Lockheed Martin Corporation at the Michoud Assembly Facility (MAF) progressed significantly. Major capital investments were initiated for world-class equipment additions including a universal friction stir welding system, composite fiber placement machine, five-axis machining center, and ten-axis laser ultrasonic nondestructive test system. The NCAM consortium of five universities led by University of New Orleans with Mississippi State University

  14. Factors That Explain the Attitude towards Statistics in High-School Students: Empirical Evidence at Technological Study Center of the Sea in Veracruz, Mexico

    Science.gov (United States)

    Rojas-Kramer, Carlos; Limón-Suárez, Enrique; Moreno-García, Elena; García-Santillán, Arturo

    2018-01-01

    The aim of this paper was to analyze attitude towards statistics in high-school students using the SATS scale designed by Auzmendi (1992). The sample was 200 students from the sixth semester of the afternoon shift, who were enrolled in technical careers from the Technological Study Center of the Sea (Centro de Estudios Tecnológicos del Mar 07…

  15. International Water Center

    Science.gov (United States)

    The urban district of Nancy and the Town of Nancy, France, have taken the initiative of creating an International Center of Water (Centre International de l'Eau à Nancy—NAN.C.I.E.) in association with two universities, six engineering colleges, the Research Centers of Nancy, the Rhine-Meuse Basin Agency, and the Chamber of Commerce and Industry. The aim of this center is to promote research and technology transfer in the areas of water and sanitation. In 1985 it will initiate a research program drawing on the experience of 350 researchers and engineers of various disciplines who have already been assigned to research in these fields. The research themes, the majority of which will be multidisciplinary, concern aspects of hygiene and health, the engineering of industrial processes, water resources, and the environment and agriculture. A specialist training program offering five types of training aimed at university graduates, graduates of engineering colleges, or experts, will start in October 1984.

  16. AcEST: DK960831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P40798|STC_DROME Protein shuttle craft OS=Drosophila melanoga... 33 1.0 sp|O68988|CSMI_CHLTE Chlorosome pro...++ M LE Sbjct: 101 EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLE 155 >sp|P40798|STC_DROME Protein shuttle craft

  17. Calcined Waste Storage at the Idaho Nuclear Technology and Engineering Center

    Energy Technology Data Exchange (ETDEWEB)

    Staiger, M. Daniel, Swenson, Michael C.

    2011-09-01

    This comprehensive report provides definitive volume, mass, and composition (chemical and radioactivity) of calcined waste stored at the Idaho Nuclear Technology and Engineering Center. Calcine composition data are required for regulatory compliance (such as permitting and waste disposal), future treatment of the caline, and shipping the calcine to an off-Site-facility (such as a geologic repository). This report also contains a description of the calcine storage bins. The Calcined Solids Storage Facilities (CSSFs) were designed by different architectural engineering firms and built at different times. Each CSSF has a unique design, reflecting varying design criteria and lessons learned from historical CSSF operation. The varying CSSF design will affect future calcine retrieval processes and equipment. Revision 4 of this report presents refinements and enhancements of calculations concerning the composition, volume, mass, chemical content, and radioactivity of calcined waste produced and stored within the CSSFs. The historical calcine samples are insufficient in number and scope of analysis to fully characterize the entire inventory of calcine in the CSSFs. Sample data exist for all the liquid wastes that were calcined. This report provides calcine composition data based on liquid waste sample analyses, volume of liquid waste calcined, calciner operating data, and CSSF operating data using several large Microsoft Excel (Microsoft 2003) databases and spreadsheets that are collectively called the Historical Processing Model. The calcine composition determined by this method compares favorably with historical calcine sample data.

  18. Calcined Waste Storage at the Idaho Nuclear Technology and Engineering Center

    International Nuclear Information System (INIS)

    Staiger, M. Daniel; Swenson, Michael C.

    2011-01-01

    This comprehensive report provides definitive volume, mass, and composition (chemical and radioactivity) of calcined waste stored at the Idaho Nuclear Technology and Engineering Center. Calcine composition data are required for regulatory compliance (such as permitting and waste disposal), future treatment of the caline, and shipping the calcine to an off-Site-facility (such as a geologic repository). This report also contains a description of the calcine storage bins. The Calcined Solids Storage Facilities (CSSFs) were designed by different architectural engineering firms and built at different times. Each CSSF has a unique design, reflecting varying design criteria and lessons learned from historical CSSF operation. The varying CSSF design will affect future calcine retrieval processes and equipment. Revision 4 of this report presents refinements and enhancements of calculations concerning the composition, volume, mass, chemical content, and radioactivity of calcined waste produced and stored within the CSSFs. The historical calcine samples are insufficient in number and scope of analysis to fully characterize the entire inventory of calcine in the CSSFs. Sample data exist for all the liquid wastes that were calcined. This report provides calcine composition data based on liquid waste sample analyses, volume of liquid waste calcined, calciner operating data, and CSSF operating data using several large Microsoft Excel (Microsoft 2003) databases and spreadsheets that are collectively called the Historical Processing Model. The calcine composition determined by this method compares favorably with historical calcine sample data.

  19. Co-Development Agreements | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    The National Cancer Institute's TTC uses three different co-development agreements to help industry and academia interact and partner with National Institutes of Health laboratories and scientists to support technology development activities.

  20. Tennessee Valley Authority National Fertilizer and Environmental Research Center

    International Nuclear Information System (INIS)

    Gautney, J.

    1991-01-01

    The National Fertilizer and Environmental Research Center (NFERC) is a unique part of the Tennessee Valley Authority (TVA), a government agency created by an Act of Congress in 1933. The Center, located in Muscle Shoals, Alabama, is a national laboratory for research, development, education and commercialization for fertilizers and related agricultural chemicals including their economic and environmentally safe use, renewable fuel and chemical technologies, alternatives for solving environmental/waste problems, and technologies which support national defense- NFERC projects in the pesticide waste minimization/treatment/disposal areas include ''Model Site Demonstrations and Site Assessments,'' ''Development of Waste Treatment and Site Remediation Technologies for Fertilizer/Agrichemical Dealers,'' ''Development of a Dealer Information/Education Program,'' and ''Constructed Wetlands.''

  1. A spacetime cloak, or a history editor

    Science.gov (United States)

    McCall, Martin W.; Favaro, Alberto; Kinsler, Paul; Boardman, Allan

    2011-02-01

    We introduce a new type of electromagnetic cloak, the spacetime cloak (STC), which conceals events rather than objects. Non-emitting events occurring during a restricted period are never suspected by a distant observer. The cloak works by locally manipulating the speed of light of an initially uniform light distribution, whilst the light rays themselves always follow straight paths. Any 'perfect' spacetime cloak would necessarily rely upon the technology of electromagnetic metamaterials, which has already been shown to be capable of deforming light in ways hitherto unforeseen—to produce, for example, an electromagnetic object cloak. Nevertheless, we show how it is possible to use intensity-dependent refractive indices to construct an approximate STC, an implementation that would enable the distinct signature of successful event cloaking to be observed. Potential demonstrations include systems that apparently violate quantum statistics, 'interrupt-without-interrupt' computation on convergent data channels and the illusion of a Star Trek transporter.

  2. A spacetime cloak, or a history editor

    International Nuclear Information System (INIS)

    McCall, Martin W; Favaro, Alberto; Kinsler, Paul; Boardman, Allan

    2011-01-01

    We introduce a new type of electromagnetic cloak, the spacetime cloak (STC), which conceals events rather than objects. Non-emitting events occurring during a restricted period are never suspected by a distant observer. The cloak works by locally manipulating the speed of light of an initially uniform light distribution, whilst the light rays themselves always follow straight paths. Any 'perfect' spacetime cloak would necessarily rely upon the technology of electromagnetic metamaterials, which has already been shown to be capable of deforming light in ways hitherto unforeseen—to produce, for example, an electromagnetic object cloak. Nevertheless, we show how it is possible to use intensity-dependent refractive indices to construct an approximate STC, an implementation that would enable the distinct signature of successful event cloaking to be observed. Potential demonstrations include systems that apparently violate quantum statistics, 'interrupt-without-interrupt' computation on convergent data channels and the illusion of a Star Trek transporter

  3. National Wind Technology Center Site Environmental Assessment: Bird and Bat Use and Fatalities -- Final Report; Period of Performance: April 23, 2001 -- December 31, 2002

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, E.; Piaggio, A. J.; Bock, C. E.; Armstrong, D. M.

    2003-01-01

    This study was conducted to ascertain actual and potential impacts of wind turbines on populations of birds and bats at the National Wind Technology Center (NWTC) in northern Jefferson County, Colorado. The NWTC, which is part of the U.S. Department of Energy's National Renewable Energy Laboratory (NREL), is located on a mesa dominated by ungrazed grassland with isolated patches of ponderosa pine. Similar lands to the north and west are part of the city of Boulders open space system. Areas to the east and south are part of the Rocky Flats Environmental Technology Site.

  4. Dual-Use Space Technology Transfer Conference and Exhibition. Volume 2

    Science.gov (United States)

    Krishen, Kumar (Compiler)

    1994-01-01

    This is the second volume of papers presented at the Dual-Use Space Technology Transfer Conference and Exhibition held at the Johnson Space Center February 1-3, 1994. Possible technology transfers covered during the conference were in the areas of information access; innovative microwave and optical applications; materials and structures; marketing and barriers; intelligent systems; human factors and habitation; communications and data systems; business process and technology transfer; software engineering; biotechnology and advanced bioinstrumentation; communications signal processing and analysis; medical care; applications derived from control center data systems; human performance evaluation; technology transfer methods; mathematics, modeling, and simulation; propulsion; software analysis and decision tools; systems/processes in human support technology; networks, control centers, and distributed systems; power; rapid development; perception and vision technologies; integrated vehicle health management; automation technologies; advanced avionics; and robotics technologies.

  5. Human-centered incubator: beyond a design concept

    OpenAIRE

    Goossens, R H M; Willemsen, H

    2013-01-01

    We read with interest the paper by Ferris and Shepley1 on a human-centered design project with university students on neonatal incubators. It is interesting to see that in the design solutions and concepts as presented by Ferris and Shepley,1 human-centered design played an important role. In 2005, a master thesis project was carried out in the Delft University of Technology, following a similar human-centered design approach.2, 3 In that design project we also addressed the noise level insid...

  6. Technology Transfer and Technology Transfer Intermediaries

    Science.gov (United States)

    Bauer, Stephen M.; Flagg, Jennifer L.

    2010-01-01

    A standard and comprehensive model is needed to evaluate and compare technology transfer systems and the stakeholders within these systems. The principle systems considered include federal laboratories, U.S. universities, the rehabilitation engineering research centers (RERCs), and large small business innovation research programs. An earlier…

  7. Investigation of the mechanism of soft tissue conduction explains several perplexing auditory phenomena.

    Science.gov (United States)

    Adelman, Cahtia; Chordekar, Shai; Perez, Ronen; Sohmer, Haim

    2014-09-01

    Soft tissue conduction (STC) is a recently expounded mode of auditory stimulation in which the clinical bone vibrator delivers auditory frequency vibratory stimuli to skin sites on the head, neck, and thorax. Investigation of the mechanism of STC stimulation has served as a platform for the elucidation of the mechanics of cochlear activation, in general, and to a better understanding of several perplexing auditory phenomena. This review demonstrates that it is likely that the cochlear hair cells can be directly activated at low sound intensities by the fluid pressures initiated in the cochlea; that the fetus in utero, completely enveloped in amniotic fluid, hears by STC; that a speaker hears his/her own voice by air conduction and by STC; and that pulsatile tinnitus is likely due to pulsatile turbulent blood flow producing fluid pressures that reach the cochlea through the soft tissues.

  8. Digitalization influence on shopping centers strategic management

    Directory of Open Access Journals (Sweden)

    Ioniţă Irene Mihaela

    2017-07-01

    Full Text Available Shopping centers are an important aspect of the extremely dynamic life of the 21st century consumer. Nowadays, worldwide, shopping centers represent significant multimillion euro investments, remarking themselves with bold architectures and structures and an individual brand image. Retail markets are currently under transformation by a confluence of new retailing technologies, dramatic shifts in the demographic profile and preferences of more affluent and educated shoppers. Part of the market share in modern retail moved to new forms of selling, which weakened the offer of some traditional retailers, while also creating opportunities for retailers to move and integrate their offerings with new digital tools (via electronic commerce, social commerce and mobile commerce. Meeting customer needs and increasing sales are the primary drivers behind retailers use of information systems and technology (IS/IT. New developments in IS/IT offer new opportunities and challenges for organizations and society. The current paper proposes to analyze the way digital media and information technology (computers and mobile devices influences the virtual and physical shopping experiences, and shopping centers management consequently. The need for communication & sales channels integration, the impact of new information technologies (IT’s, the growing role of social / digital media, the balance between personalization and privacy – all represent challenges retail industry needs to currently adapt to face digitalization. E-commerce is transforming both consumer behavior and retailing business models, by greatly expanding shopping convenience, selection and affordability.

  9. A case history of technology transfer

    Science.gov (United States)

    1981-01-01

    A sequence of events, occurring over the last 25 years, are described that chronicle the evolution of ion-bombardment electric propulsion technology. Emphasis is placed on the latter phases of this evolution, where special efforts were made to pave the way toward the use of this technology in operational space flight systems. These efforts consisted of a planned program to focus the technology toward its end applications and an organized process that was followed to transfer the technology from the research-technology NASA Center to the user-development NASA Center and its industry team. Major milestones in this evolution, which are described, include the development of thruster technology across a large size range, the successful completion of two space electric rocket tests, SERT I and SERT II, development of power-processing technology for electric propulsion, completion of a program to make the technology ready for flight system development, and finally the technology transfer events.

  10. The Knowledge-Based Technology Applications Center (KBTAC) seminar series

    International Nuclear Information System (INIS)

    Isik, C.; Wood, R.M.

    1993-12-01

    Neural Networks are adaptive systems that allow users to model complex systems, classify patterns, filter data or control processes with little or no a-priori knowledge. Neural networks represent a branch of artificial intelligence technology. Fuzzy logic is a generalization of formalized mathematical logic that allows representation of uncertainty by providing a smooth transition from true to false, instead of a step change. It allows for a proposition to be both true and false, to different degrees at the same time. This allows representation of approximate reasoning concepts that occur frequently in everyday experience, such as ''somewhat true,'' or ''not very hot.'' To utilize these technologies, utility personnel need to acquire knowledge and skills in a number of areas: 1. basic principles of neural networks and fuzzy logic; 2. types of neural networks and fuzzy logic systems, their applications, and requirements for use; 3. considerations for designing neural networks and fuzzy logic systems; 4. software tools available for these technologies. Off-the-shelf software is available for a variety of hardware platforms to rapidly develop, tune and test neural networks and fuzzy logic systems. Familiarity with the problem to which a neural network or fuzzy logic system is applied allows the designer to develop an appropriate design. Therefore, it is desirable to teach neural network and fuzzy logic technology to utility experts in the domain of application

  11. 77 FR 26511 - Announcing a National Cybersecurity Center of Excellence (NCCoE) Workshop

    Science.gov (United States)

    2012-05-04

    ... Cybersecurity Center of Excellence (NCCoE) Workshop AGENCY: National Institute of Standards and Technology (NIST... Cybersecurity Center of Excellence (NCCoE) Workshop to be held on Tuesday, June 26, 2012. This is an initial... accelerating the widespread adoption of integrated cybersecurity tools and technologies. The NCCoE will bring...

  12. Aflatoxin B1 and sterigmatocystin survey in beer sold in China.

    Science.gov (United States)

    Zhao, Yarong; Huang, Jianxiang; Ma, Liyan; Liu, Shuai; Wang, Fuhua

    2017-03-01

    A total of 101 samples of beer from the Chinese market were analysed for the presence of aflatoxin B 1 (AFB 1 ) and sterigmatocystin (STC), using methods based on liquid chromatography-tandem mass spectrometry. The limit of quantification and the limit of detection in beer were 0.1 and 0.03 µg/kg, respectively. Recoveries of AFB 1 and STC from spiked beer samples were 97.8-103.6% and 92.7-102.1%, respectively. None of the beer purchased samples were contaminated with AFB 1 or STC.

  13. Analog design of wireless control for home equipment

    Science.gov (United States)

    Zheng, Shiyong; Li, Zhao; Li, Biqing; Jiang, Suping

    2018-04-01

    This design consists of a STC89C52 microcontroller, a serial Bluetooth module and the Android system. Production of STC89C52 controlled by single-chip computer telephone systems. The system is composed of mobile phone Android system as a master in the family centre,via serial Bluetooth module pass instructions and information to implement wireless transceiver using STC89C52 MCU wireless Bluetooth transmission to control homedevices. System high reliability, low cost easy to use, stong applicability and other characerristics, can be used in single-user family, has great significance.

  14. Comprehensive characterisation and analysis of PV module performance under real operating conditions

    NARCIS (Netherlands)

    Louwen, Atse; de Waal, Arjen C.; Schropp, Ruud E.I.; Faaij, André P.C.; van Sark, Wilfried G.J.H.M.

    2017-01-01

    The specifications of photovoltaic modules show performance under standard testing conditions (STC), but only limited information relating to performance at non-STC conditions. While performance is affected by irradiance, temperature, spectral composition of irradiance, angle-of-incidence of the

  15. Comprehensive characterisation and analysis of PV module performance under real operating conditions

    NARCIS (Netherlands)

    Louwen, Atse; de Waal, Arjen C.; Schropp, Ruud E I; Faaij, André P C; van Sark, Wilfried G J H M

    The specifications of photovoltaic modules show performance under standard testing conditions (STC), but only limited information relating to performance at non-STC conditions. While performance is affected by irradiance, temperature, spectral composition of irradiance, angle-of-incidence of the

  16. NASA's engineering research centers and interdisciplinary education

    Science.gov (United States)

    Johnston, Gordon I.

    1990-01-01

    A new program of interactive education between NASA and the academic community aims to improve research and education, provide long-term, stable funding, and support cross-disciplinary and multi-disciplinary research. The mission of NASA's Office of Aeronautics, Exploration and Technology (OAET) is discussed and it is pointed out that the OAET conducts about 10 percent of its total R&D program at U.S. universities. Other NASA university-based programs are listed including the Office of Commercial Programs Centers for the Commercial Development of Space (CCDS) and the National Space Grant program. The importance of university space engineering centers and the selection of the nine current centers are discussed. A detailed composite description is provided of the University Space Engineering Research Centers. Other specialized centers are described such as the Center for Space Construction, the Mars Mission Research Center, and the Center for Intelligent Robotic Systems for Space Exploration. Approaches to educational outreach are discussed.

  17. JPRS Report, Science & Technology, USSR: Science & Technology Policy

    Science.gov (United States)

    1990-09-18

    urgent and vital problems that faced the United States of America at that time. This discussion was of a completely free nature, and, although at...imeni M.O. Auezov, and the Sociology Center attached to the Institute of Eco- nomics, which took part in sociolinguistic studies of the language...development of advanced technologies. In the United States of America , for example, a special fund of these technologies was estab- lished. An

  18. Sustainable Biofuels Development Center

    Energy Technology Data Exchange (ETDEWEB)

    Reardon, Kenneth F. [Colorado State Univ., Fort Collins, CO (United States)

    2015-03-01

    The mission of the Sustainable Bioenergy Development Center (SBDC) is to enhance the capability of America’s bioenergy industry to produce transportation fuels and chemical feedstocks on a large scale, with significant energy yields, at competitive cost, through sustainable production techniques. Research within the SBDC is organized in five areas: (1) Development of Sustainable Crops and Agricultural Strategies, (2) Improvement of Biomass Processing Technologies, (3) Biofuel Characterization and Engine Adaptation, (4) Production of Byproducts for Sustainable Biorefining, and (5) Sustainability Assessment, including evaluation of the ecosystem/climate change implication of center research and evaluation of the policy implications of widespread production and utilization of bioenergy. The overall goal of this project is to develop new sustainable bioenergy-related technologies. To achieve that goal, three specific activities were supported with DOE funds: bioenergy-related research initiation projects, bioenergy research and education via support of undergraduate and graduate students, and Research Support Activities (equipment purchases, travel to attend bioenergy conferences, and seminars). Numerous research findings in diverse fields related to bioenergy were produced from these activities and are summarized in this report.

  19. CD-ROM technology at the EROS data center

    Science.gov (United States)

    Madigan, Michael E.; Weinheimer, Mary C.

    1993-01-01

    The vast amount of digital spatial data often required by a single user has created a demand for media alternatives to 1/2" magnetic tape. One such medium that has been recently adopted at the U.S. Geological Survey's EROS Data Center is the compact disc (CD). CD's are a versatile, dynamic, and low-cost method for providing a variety of data on a single media device and are compatible with various computer platforms. CD drives are available for personal computers, UNIX workstations, and mainframe systems, either directly connected, or through a network. This medium furnishes a quick method of reproducing and distributing large amounts of data on a single CD. Several data sets are already available on CD's, including collections of historical Landsat multispectral scanner data and biweekly composites of Advanced Very High Resolution Radiometer data for the conterminous United States. The EROS Data Center intends to provide even more data sets on CD's. Plans include specific data sets on a customized disc to fulfill individual requests, and mass production of unique data sets for large-scale distribution. Requests for a single compact disc-read only memory (CD-ROM) containing a large volume of data either for archiving or for one-time distribution can be addressed with a CD-write once (CD-WO) unit. Mass production and large-scale distribution will require CD-ROM replication and mastering.

  20. Research and Technology 1996: Innovation in Time and Space

    Science.gov (United States)

    1996-01-01

    As the NASA Center responsible for assembly, checkout, servicing, launch, recovery, and operational support of Space Transportation System elements and payloads, the John F. Kennedy Space Center is placing increasing emphasis on its advanced technology development program. This program encompasses the efforts of the Engineering Development Directorate laboratories, most of the KSC operations contractors, academia, and selected commercial industries - all working in a team effort within their own areas of expertise. This edition of the Kennedy Space Center Research and Technology 1996 Annual Report covers efforts of all these contributors to the KSC advanced technology development program, as well as our technology transfer activities.