WorldWideScience

Sample records for technology area ta

  1. Social shaping of technology in TA and HTA

    DEFF Research Database (Denmark)

    Clausen, Christian; Yoshinaka, Yutaka

    2004-01-01

    The paper discusses how the social shaping of technology (SST) approach may be useful in understanding the role played by technology assessment within the context of technological development and change. It is proposed that an SST perspective on TA (or HTA) yields particular insight, regardless...... of whether or not the TA activity bases itself on a social shaping understanding of technology. This is because SST addresses the socially negotiated character of technological development, where TA itself may be construed as an element influencing the process of such negotiation. At the same time, TA...... is a construction, that is, itself a product of negotiations involving social actors. Thus, an understanding that TA is socially shaped, and is involved in the shaping of technology, opens up for a perspective on TA as both entailing constraints and enablements within the context of the particular agenda...

  2. Technical Area V (TA-V) transformation project close-out report.

    Energy Technology Data Exchange (ETDEWEB)

    2010-07-01

    Sandia National Laboratories (SNL) Technical Area V (TA-V) has provided unique nuclear experimental environments for decades. The technologies tested in TA-V facilities have furthered the United States Nuclear Weapons program and has contributed to the national energy and homeland security mission. The importance of TA-V working efficiently to produce an attractive and effective platform for experiments should not be underestimated. Throughout its brief history, TA-V has evolved to address multiple and diverse sets of requirements. These requirements evolved over many years; however, the requirements had not been managed nor communicated comprehensively or effectively. A series of programmatic findings over several years of external audits was evidence of this downfall. Today, these same requirements flow down through a new TA-V management system that produces consistently applied and reproducible approaches to work practices. In 2008, the TA-V department managers assessed the state of TA-V services and work activities to understand how to improve customer interfaces, stakeholders perceptions, and workforce efficiencies. The TA-V management team initiated the TA-V Transformation Project after they deemed the pre-June 2008 operational model to be ineffective in managing work and in providing integrated, continuous improvement to TA-V processes. This report summarizes the TA-V Transformation Project goals, activities, and accomplishments.

  3. Paleoclimate from Tree Rings of Picea morrisonicola in Ta-Ta-Chia Area of Central Taiwan

    Science.gov (United States)

    Chen, T.; Wright, W. E.; Wei, K.; Cook, E. R.

    2009-12-01

    Almost no dendrochronology has been reported internationally from Taiwan, despite the existence of many dendrochronologically appropriate tree species. In this study, we reconstruct the regional paleoclimate using a multi-century tree ring-width chronology developed from Picea morrisonicola ( the endemic Taiwan Spruce), a subtropical species growing in the Ta-Ta-Chia subalpine mountain areas of central Taiwan. Picea morrisonicola in Taiwan is the only member of the Picea genus whose distribution crosses the Tropic of Cancer. Statistical analysis of the climate signal demonstrates that both the temperature and precipitation have significant effects on tree growth.

  4. Ta Keo Temple Reconstruction Based on Terrestrial Laser Scanning Technology

    Science.gov (United States)

    Xi, X.; Wang, C.; Wan, Y. P.; Khuon, K. N.

    2015-08-01

    Ta Keo temple is one of the very famous temple complex of Angkor Wat in northwestern Cambodia. It has been suffering massive collapse and other serious damages in recent years. Nowadays, Terrestrial Laser Scanning(TLS) technology is considered as a wellestablished resource for heritage documentation and protection (Lerma et al, 2008; Reshetyuk, 2009). This paper used TLS to reconstruct Ta Keo Temple. Firstly, we acquired 71 scanning stations of points cloud data with high density and high accuracy, and over one thousand images with high spatial resolution about the temple. Secondly, the raw points cloud data were denoised, reduced and managed efficiently, and registrated using an adjusted ICP algorithm. Thirdly, a triangulation method was used to model most objects. At last, we mapped the texture data into the digital model and a 3-D model of Ta Keo with high accuracy was achieved. The authors focus on large object reconstruction by TLS technology, and pay much attention to the scanning design, multi-station data and the whole project's data registration, and texture mapping and so on. The research result will be useful for Ta Keo restoration, reconstruction and protection. Also, it is a good reference source for large complex buildings reconstruction when using terrestrial laser scanning technology.

  5. Seismic assessment of Technical Area V (TA-V).

    Energy Technology Data Exchange (ETDEWEB)

    Medrano, Carlos S.

    2014-03-01

    The Technical Area V (TA-V) Seismic Assessment Report was commissioned as part of Sandia National Laboratories (SNL) Self Assessment Requirement per DOE O 414.1, Quality Assurance, for seismic impact on existing facilities at Technical Area-V (TA-V). SNL TA-V facilities are located on an existing Uniform Building Code (UBC) Seismic Zone IIB Site within the physical boundary of the Kirtland Air Force Base (KAFB). The document delineates a summary of the existing facilities with their safety-significant structure, system and components, identifies DOE Guidance, conceptual framework, past assessments and the present Geological and Seismic conditions. Building upon the past information and the evolution of the new seismic design criteria, the document discusses the potential impact of the new standards and provides recommendations based upon the current International Building Code (IBC) per DOE O 420.1B, Facility Safety and DOE G 420.1-2, Guide for the Mitigation of Natural Phenomena Hazards for DOE Nuclear Facilities and Non-Nuclear Facilities.

  6. TA-54 (Area G) Risk Assessment from Extreme Wildfire Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Linn, Rodman Ray [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Koo, Eunmo [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Honig, Kristen Ann [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); White, Judith [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Funk, David John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-10

    Los Alamos National Laboratory (LANL) and surrounding areas have been exposed to at least four significant wildfires since 1977 and there have been numerous others within 50 miles of LANL. Based on this history, wildfires are considered a risk to LANL facilities and their contents. While many LANL facilities are at risk to wildfire to some degree, they are found in a wide variety of conditions, thus they have varying sensitivities to wildfires. Additionally, LANL facilities have various functions and different assets, so they have a wide range of values or consequences if compromised. Therefore, determining the risks and precautions that are warranted to mitigate these risks must be done on a case-by-case basis. In an effort to assess possible wildfire risks to sensitive materials stored in a Perma-Con® in dome TA-54-0375, a conventional fire risk analysis was performed. This conventional risk analysis is documented in Engineering Evaluation Form AP-FIRE-001-FM1, which is dated 9/28/2015 and was titled ‘Wildland Fire Exposure Evaluation for Building TA-54-0375’ (Hall 2015). This analysis acknowledged that there was significant chance of wildfire in the vicinity of TA-54-0375, but the amount of combustible material surrounding the building was deemed low. The wildland fuels that were closest to the building were largely fine fuels and were not expected to have significant duration of heat release. The prevailing winds at this location are from the south and southwest and the nearest significant upwind fuels (tree crowns or unmown grasses) are at least 300 feet away. Based on these factors the conventional wildland fire risk to TA-54-0375 was deemed minimal, “Acceptable As Is, No Action Required.” This risk evaluation was based on a combined assessment of low probability of wildfires arriving at the site from other directions (where higher fuel loadings might be present) as well as the effective setback of fuels in the direction that fire is

  7. Stormwater Pollution Prevention Plan TA-60 Roads and Grounds Facility and Associated Sigma Mesa Staging Area

    Energy Technology Data Exchange (ETDEWEB)

    Sandoval, Leonard Frank [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-01

    This Stormwater Pollution Prevention Plan (SWPPP) is applicable to operations at the Technical Area -60 (TA-60) Roads and Grounds Facility and Associated Sigma Mesa Staging Area off Eniwetok Drive, in Los Alamos County, New Mexico.

  8. 78 FR 41954 - TA-W-82,634, Prudential Global Business Technology Solutions Central Security Services Dresher...

    Science.gov (United States)

    2013-07-12

    ... Employment and Training Administration TA-W-82,634, Prudential Global Business Technology Solutions Central Security Services Dresher, Pennsylvania; TA-W-82,634A, Prudential Global Business Technology Solutions Central Security Services Iselin, New Jersey; TA-W-82,634B, Prudential Global Business...

  9. [Inspection of gas cylinders in storage at TA-54, Area L]. Volume 1, Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-06-23

    ERC sampled, analyzed, and recontainerized when necessary gas cylinders containing various chemicals in storage at Los Alamos TA-54 Area L. A vapor containment structure was erected. A total of 179 cylinders was processed; 39 were repackaged; and 55 were decommissioned. This report summarizes the operation; this is Volume 1 of five volumes.

  10. Mechanisms of Low-Temperature Nitridation Technology on a TaN Thin Film Resistor for Temperature Sensor Applications.

    Science.gov (United States)

    Chen, Huey-Ru; Chen, Ying-Chung; Chang, Ting-Chang; Chang, Kuan-Chang; Tsai, Tsung-Ming; Chu, Tian-Jian; Shih, Chih-Cheng; Chuang, Nai-Chuan; Wang, Kao-Yuan

    2016-12-01

    In this letter, we propose a novel low-temperature nitridation technology on a tantalum nitride (TaN) thin film resistor (TFR) through supercritical carbon dioxide (SCCO2) treatment for temperature sensor applications. We also found that the sensitivity of temperature of the TaN TFR was improved about 10.2 %, which can be demonstrated from measurement of temperature coefficient of resistance (TCR). In order to understand the mechanism of SCCO2 nitridation on the TaN TFR, the carrier conduction mechanism of the device was analyzed through current fitting. The current conduction mechanism of the TaN TFR changes from hopping to a Schottky emission after the low-temperature SCCO2 nitridation treatment. A model of vacancy passivation in TaN grains with nitrogen and by SCCO2 nitridation treatment is eventually proposed to increase the isolation ability in TaN TFR, which causes the transfer of current conduction mechanisms.

  11. Hot spray technology of TA7 titanium alloy coated by molybdenum and its bonding strength

    Institute of Scientific and Technical Information of China (English)

    Li Xiaoquan; Du Zeyu; Yang Xuguang

    2006-01-01

    A kind of surface modification test was introduced, by which plasma spray in argon atmosphere with CNC4500 system was applied for TA7 titanium alloy to be coated with molybdenum, and technology to produce metallurgical bonding at interface of coating and base meal was tested by heating in vacuum condition for diffusion after hot spray.With the help of scan electron microscope analysis ( SEM) , the effect of argon inlet pressure and heating temperature on coating structure as well as product of diffusion layer were studied.The glued tensile test method was used to measure bonding strength of base metal to coating.The result has shown that both argon inlet pressure and heating temperature exert some effect on coating structure and the width of diffusion layer.A bonding strength of base metal to coating which is greater than molybdenum coating itself may be attained and can be controlled in more than 50 MPa level with tested hot spray technology.

  12. Innovation investment area: Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    1994-03-01

    The mission of Environmental Management`s (EM) Office of Technology Development (OTD) Innovation Investment Area is to identify and provide development support for two types of technologies that are developed to characterize, treat and dispose of DOE waste, and to remediate contaminated sites. They are: technologies that show promise to address specific EM needs, but require proof-of-principle experimentation; and (2) already proven technologies in other fields that require critical path experimentation to demonstrate feasibility for adaptation to specific EM needs. The underlying strategy is to ensure that private industry, other Federal Agencies, universities, and DOE National Laboratories are major participants in developing and deploying new and emerging technologies. To this end, about 125 different new and emerging technologies are being developed through Innovation Investment Area`s (IIA) two program elements: RDDT&E New Initiatives (RD01) and Interagency Agreements (RD02). Both of these activities are intended to foster research and development partnerships so as to introduce innovative technologies into other OTD program elements for expedited evaluation.

  13. Plutonium focus area: Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    To ensure research and development programs focus on the most pressing environmental restoration and waste management problems at the U.S. Department of Energy (DOE), the Assistant Secretary for the Office of Environmental Management (EM) established a working group in August 1993 to implement a new approach to research and technology development. As part of this approach, EM developed a management structure and principles that led to creation of specific focus areas. These organizations were designed to focus scientific and technical talent throughout DOE and the national scientific community on major environmental restoration and waste management problems facing DOE. The focus area approach provides the framework for inter-site cooperation and leveraging of resources on common problems. After the original establishment of five major focus areas within the Office of Technology Development (EM-50), the Nuclear Materials Stabilization Task Group (NMSTG, EM-66) followed EM-50`s structure and chartered the Plutonium Focus Area (PFA). NMSTG`s charter to the PFA, described in detail later in this book, plays a major role in meeting the EM-66 commitments to the Defense Nuclear Facilities Safety Board (DNFSB). The PFA is a new program for FY96 and as such, the primary focus of revision 0 of this Technology Summary is an introduction to the Focus Area; its history, development, and management structure, including summaries of selected technologies being developed. Revision 1 to the Plutonium Focus Area Technology Summary is slated to include details on all technologies being developed, and is currently planned for release in August 1996. The following report outlines the scope and mission of the Office of Environmental Management, EM-60, and EM-66 organizations as related to the PFA organizational structure.

  14. [Research and Application of the ICP-MS Detection Technology for the Content of Nb and Ta in Geochemical Sample].

    Science.gov (United States)

    Li, Zi-qiang; Li, Xiao-ying; Zhu, Kun; Xu, Xiao-xia; Yan, Zhi-yuan

    2015-08-01

    In order to provide the test analysis technology to support the exploration and development of niobium and tantalum resource, based on the special chemical properties of Nb and Ta in geochemical sample, we studied the detection methods for the content of Nb and Ta in geochemical sample by using inductively coupled plasma mass spectrometry (ICP-MS). The results show that the sample dissolution and instrumental parameter of ICP-MS, especially the former have significant influence? on detection results. Therefore, optimizing important parameters of sample dissolution is the key of the detection technology. The optimal parameters are that the weight of sample is 50 mg; the dosage of HF acid is 15 mL; the concentration of nitric acid and tartaric acid in the sample solution is 2% and 1.5%, respectively; the validity period of detection for sample solution ≤1 d. The detection method has been validated by the national geochemistry standard reference material. The precise and exaction of method meet the required of industry standards. The detection limits of method for Nb and Ta are 1.05 and 0.13 μg · g(-1), respectively. The experiment proved that the ICP-MS detection methods, which using certain preparation process of sample solutions, is suitable for accurate and rapid determination of Nb and Ta in geochemical sample, especially geochemical survey samples which with a large amount and low content of Nb and Ta.

  15. Plutonium focus area. Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-09-01

    The Assistant Secretary for the Office of Environmental Management (EM) at the U.S. Department of Energy (DOE) chartered the Plutonium Focus Area (PFA) in October 1995. The PFA {open_quotes}...provides for peer and technical reviews of research and development in plutonium stabilization activities...{close_quotes} In addition, the PFA identifies and develops relevant research and technology. The purpose of this document is to focus attention on the requirements used to develop research and technology for stabilization, storage, and preparation for disposition of nuclear materials. The PFA Technology Summary presents the approach the PFA uses to identify, recommend, and review research. It lists research requirements, research being conducted, and gaps where research is needed. It also summarizes research performed by the PFA in the traditional research summary format. This document encourages researchers and commercial enterprises to do business with PFA by submitting research proposals or {open_quotes}white papers.{close_quotes} In addition, it suggests ways to increase the likelihood that PFA will recommend proposed research to the Nuclear Materials Stabilization Task Group (NMSTG) of DOE.

  16. Suntown Technology will Finish the Construction of 200,000 T/A Aluminum Foil Production Base

    Institute of Scientific and Technical Information of China (English)

    2014-01-01

    <正>The"200,000 t/a world top ranking aluminum foil processing base"by the Suntown Technology Group is called"201 Project",it is also one of the Group’s key construction projects in 2014.This project formally kicked off in May 2013,and will be fully completed and launched into production at the end of October,2014.The 201 Project mainly

  17. Radiological survey and decontamination of the former main technical area (TA-1) at Los Alamos, New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Ahlquist, A.J.; Stoker, A.K.; Trocki, L.K. (comps.)

    1977-12-01

    A radiological survey was conducted on the undeveloped portions of the site of the former Main Technical Area (TA-1) of the Los Alamos Scientific Laboratory in north-central New Mexico. Between 1943 and 1965, research work on nuclear weapons was carried out in TA-1. The area was decontaminated and demolished in stages, and beginning in 1966 the land was given to Los Alamos County or sold to private interests. The survey disclosed traces of radioactive contamination undetected or considered insignificant during original demolition in the 1950s and 1960s. The remaining contamination was removed in 1975 and 1976 to levels considered to pose no health or safety hazards and, further, to the lowest levels considered practicable. Methods used in the survey included measurement techniques for detecting alpha emitters such as uranium and plutonium, extensive surface and subsurface soil sampling, and use of conventional health physics instrumentation to provide detailed information on approximately 16 hectares (40 acres) of land. As a result of the decontamination efforts, approximately 15,000 m/sup 3/ of contaminated or potentially contaminated material was removed to an approved radioactive waste disposal site on ERDA property. Full details of the methods, findings, decision criteria, and as-left conditions are documented.

  18. NASA Technology Area 07: Human Exploration Destination Systems Roadmap

    Science.gov (United States)

    Kennedy, Kriss J.; Alexander, Leslie; Landis, Rob; Linne, Diane; Mclemore, Carole; Santiago-Maldonado, Edgardo; Brown, David L.

    2011-01-01

    This paper gives an overview of the National Aeronautics and Space Administration (NASA) Office of Chief Technologist (OCT) led Space Technology Roadmap definition efforts. This paper will given an executive summary of the technology area 07 (TA07) Human Exploration Destination Systems (HEDS). These are draft roadmaps being reviewed and updated by the National Research Council. Deep-space human exploration missions will require many game changing technologies to enable safe missions, become more independent, and enable intelligent autonomous operations and take advantage of the local resources to become self-sufficient thereby meeting the goal of sustained human presence in space. Taking advantage of in-situ resources enhances and enables revolutionary robotic and human missions beyond the traditional mission architectures and launch vehicle capabilities. Mobility systems will include in-space flying, surface roving, and Extra-vehicular Activity/Extravehicular Robotics (EVA/EVR) mobility. These push missions will take advantage of sustainability and supportability technologies that will allow mission independence to conduct human mission operations either on or near the Earth, in deep space, in the vicinity of Mars, or on the Martian surface while opening up commercialization opportunities in low Earth orbit (LEO) for research, industrial development, academia, and entertainment space industries. The Human Exploration Destination Systems (HEDS) Technology Area (TA) 7 Team has been chartered by the Office of the Chief Technologist (OCT) to strategically roadmap technology investments that will enable sustained human exploration and support NASA s missions and goals for at least the next 25 years. HEDS technologies will enable a sustained human presence for exploring destinations such as remote sites on Earth and beyond including, but not limited to, LaGrange points, low Earth orbit (LEO), high Earth orbit (HEO), geosynchronous orbit (GEO), the Moon, near

  19. Radionuclide Concentrations in Honey Bees from Area G at TA-54 during 1998

    Energy Technology Data Exchange (ETDEWEB)

    Haarmann, T.K.; Fresquez, P.R.

    1999-06-01

    Honey bees were collected from two colonies located at Los Alamos National Laboratory's Area G, Technical Area 54, and from one control (background) colony located near Jemez Springs, NM. Samples were analyzed for various radionuclides. Area G sample results from both colonies were higher than the upper (95%) level background concentration for {sup 239,240}Pu, {sup 3}H, and total uranium. Sample results from one colony were higher than the upper (95%) level background concentration for {sup 238}Pu.

  20. Radionuclide Concentrations in Honey Bees from Area G at TA-54 during 1999

    Energy Technology Data Exchange (ETDEWEB)

    T. K. Haarmann; P. R. Fresquez

    2000-06-01

    Honey bees were collected from two colonies located at Los Alamos National Laboratory's Area G, Technical Area 54, and from one control (background) colony located near Jemez Springs, NM. Samples were analyzed for various radionuclides. Area G sample results from both colonies were higher than the upper (95%) level background concentration for {sup 3}H. Sample results from one colony were higher than the upper (95%) level background concentration for total uranium, while sample results from the other colony were higher than the upper (95%) level background concentration for {sup 90}Sr.

  1. Radionuclide concentrations in honey bees from Area G at TA-54 during 1997. Progress report

    Energy Technology Data Exchange (ETDEWEB)

    Haarmann, T.K.; Fresquez, P.R.

    1998-07-01

    Honey bees were collected from two colonies located at Los Alamos National Laboratory`s Area G, Technical Area 54, and from one control (background) colony located near Jamez Springs, NM. Samples were analyzed for the following: cesium ({sup 137}Cs), americium ({sup 241}Am), plutonium ({sup 238}Pu and {sup 239,240}Pu), tritium ({sup 3}H), total uranium, and gross gamma activity. Area G sample results from both colonies were higher than the upper (95%) level background concentration for {sup 238}Pu and {sup 3}H.

  2. TA-60-1 Heavy Equipment Shop Areas SWPPP Rev 2 Jan 2017-Final

    Energy Technology Data Exchange (ETDEWEB)

    Burgin, Jillian Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-07

    The primary activities and equipment areas at the facility that are potential stormwater pollution sources include; The storage of vehicles and heavy equipment awaiting repair; or repaired vehicles waiting to be picked up; The storage and handling of oils, anti-freeze, solvents, degreasers, batteries and other chemicals for the maintenance of vehicles and heavy equipment; and Equipment cleaning operations including exterior vehicle wash-down. Steam cleaning is only done on the steam cleaning pad area located at the north east end of Building 60-0001.

  3. Dental implants of TiTa30 produced by powder technology

    Energy Technology Data Exchange (ETDEWEB)

    Wack, T.; Biehl, V.; Breme, J. [Universitaet des Saarlandes, Saarbruecken (Germany). Lehrstuhl fuer Metallische Werkstoffe; Schwanke, C.; Schaeffer, L.

    1999-07-01

    The production and the mechanical properties of porous parts of the biocompatible titanium alloy TiTa30 produced via powder metallurgy are described. The aim of the study was to create endosseous dental implants with a low Young`s modulus and a porous surface, which will result in a good load transfer from the implant to the bone thus stimulating the formation of new bone and ultimately by the ingrowth of bone into the surface of the implant lead to a good anchorage in the bone. Other applications of such porous parts might be bearings or filters. The new alloy TiTa30 was melted in an electric-arc furnace in a water-cooled mould in an argon atmosphere and then powdered by the hydrogenation - dehydrogenation (HDH)-process. Samples were produced by unidirectional pressing and then sintering of the green bodies under vacuum. The influence of the sintering parameters (particle size, compacting pressure, sintering time and temperature) on the mechanical properties was investigated. While the Young`s modulus and the yield strength varied only with the resulting porosity, the fatigue strength of the samples also depended on the particle size and the sintering temperature and time. It was possible to produce samples with a Young`s modulus comparable to that of bone and a fatigue strength high enough for use as a dental implant. In addition to the mechanical testing the functionality of the implants (bone ingrowth and implant anchorage) was tested in-vivo in animal experiments. (orig.) 5 refs.

  4. Review of the geological and structural setting near the site of the proposed Transuranic Waste Facility (TRUWF) Technical Area 52 (TA-52), Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Schultz-Fellenz, Emily S.; Gardner, Jamie N.

    2007-10-01

    Because of Los Alamos National Laboratory’s proximal location to active geologic structures, assessment of seismic hazards, including the potential for seismic surface rupture, must occur before construction of any facilities housing nuclear or other hazardous materials. A transuranic waste facility (TRUWF) planned for construction at Technical Area 52 (TA-52) provides the impetus for this report. Although no single seismic hazards field investigation has focused specifically on TA-52, numerous studies at technical areas surrounding TA-52 have shown no significant, laterally continuous faults exhibiting activity in the last 10 ka within 3,000 ft of the proposed facility. A site-specific field study at the footprint of the proposed TRUWF would not yield further high-precision data on possible Holocene faulting at the site because post-Bandelier Tuff sediments are lacking and the shallowest subunit contacts of the Bandelier Tuff are gradational. Given the distal location of the proposed TRUWF to any mapped structures with demonstrable Holocene displacement, surface rupture potential appears minimal at TA-52.

  5. NASA's Spaceliner Investment Area Technology Activities

    Science.gov (United States)

    Hueter, Uwe; Lyles, Garry M. (Technical Monitor)

    2001-01-01

    NASA's has established long term goals for access-to-space. The third generation launch systems are to be fully reusable and operational around 2025. The goals for the third generation launch system are to significantly reduce cost and improve safety over current conditions. The Advanced Space Transportation Program Office (ASTP) at the NASA's Marshall Space Flight Center in Huntsville, AL has the agency lead to develop space transportation technologies. Within ASTP, under the Spaceliner Investment Area, third generation technologies are being pursued in the areas of propulsion, airframes, integrated vehicle health management (IVHM), avionics, power, operations, and range. The ASTP program will mature these technologies through both ground and flight system testing. The Spaceliner Investment Area plans to mature vehicle technologies to reduce the implementation risks for future commercially developed reusable launch vehicles (RLV). The plan is to substantially increase the design and operating margins of the third generation RLV (the Space Shuttle is the first generation) by incorporating advanced technologies in propulsion, materials, structures, thermal protection systems, avionics, and power. Advancements in design tools and better characterization of the operational environment will allow improvements in design margins. Improvements in operational efficiencies will be provided through use of advanced integrated health management, operations, and range technologies. The increase in margins will allow components to operate well below their design points resulting in improved component operating life, reliability, and safety which in turn reduces both maintenance and refurbishment costs. These technologies have the potential of enabling horizontal takeoff by reducing the takeoff weight and achieving the goal of airline-like operation. These factors in conjunction with increased flight rates from an expanding market will result in significant improvements in safety

  6. NASA's Spaceliner 100 Investment Area Technology Activities

    Science.gov (United States)

    Hueter, Uwe; Lyles, Garry M. (Technical Monitor)

    2001-01-01

    NASA's has established long term goals for access-to-space. The third generation launch systems are to be fully reusable and operational around 2025. The goals for the third generation launch system are to reduce cost by a factor of 100 and improve safety by a factor of 10,000 over current conditions. The Advanced Space Transportation Program Office (ASTP) at the NASA's Marshall Space Flight Center in Huntsville, AL has the agency lead to develop space transportation technologies. Within ASTP, under the Spaceliner100 Investment Area, third generation technologies are being pursued in the areas of propulsion, airframes, integrated vehicle health management (IVHM), launch systems, and operations and range. The ASTP program will mature these technologies through ground system testing. Flight testing where required, will be advocated on a case by case basis.

  7. GoTa-the future-oriented digital trunking technology%GoTa--面向未来的数字集群通信技术

    Institute of Scientific and Technical Information of China (English)

    薛育红; 刘守文; 刘金龙

    2004-01-01

    GoTa是基于CDMA技术,面向未来技术演进的新一代CDMA数字集群通信系统.对于传统的CDMA网络运营商,可以在已建的CDMA系统上通过系统升级,方便地叠加集群业务子系统,提供集群业务.GoTa也可以作为单独的专业集群通信系统,供专业集群网络运营商建网运营,提供集群通信服务.GoTa数字集群通信系统,可以提供共网集群和专业调度统一的业务模式,提高网络综合竞争能力.GoTa作为专业集群通信系统,可供共网集群网络运营商建网运营,提供集群通信服务,也可应用于专业集群调度系统,例如地方的应急联动指挥调度系统.文中在分析集群通信技术发展、市场需求的基础上,介绍了新一代数字集群通信技术GoTa,以及相关的系统、终端和业务产品.

  8. Landfill stabilization focus area: Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    Landfills within the DOE Complex as of 1990 are estimated to contain 3 million cubic meters of buried waste. The DOE facilities where the waste is predominantly located are at Hanford, the Savannah River Site (SRS), the Idaho National Engineering Laboratory (INEL), the Los Alamos National Laboratory (LANL), the Oak Ridge Reservation (ORR), the Nevada Test Site (NTS), and the Rocky Flats Plant (RFP). Landfills include buried waste, whether on pads or in trenches, sumps, ponds, pits, cribs, heaps and piles, auger holes, caissons, and sanitary landfills. Approximately half of all DOE buried waste was disposed of before 1970. Disposal regulations at that time permitted the commingling of various types of waste (i.e., transuranic, low-level radioactive, hazardous). As a result, much of the buried waste throughout the DOE Complex is presently believed to be contaminated with both hazardous and radioactive materials. DOE buried waste typically includes transuranic-contaminated radioactive waste (TRU), low-level radioactive waste (LLW), hazardous waste per 40 CFR 26 1, greater-than-class-C waste per CFR 61 55 (GTCC), mixed TRU waste, and mixed LLW. The mission of the Landfill Stabilization Focus Area is to develop, demonstrate, and deliver safer,more cost-effective and efficient technologies which satisfy DOE site needs for the remediation and management of landfills. The LSFA is structured into five technology areas to meet the landfill remediation and management needs across the DOE complex. These technology areas are: assessment, retrieval, treatment, containment, and stabilization. Technical tasks in each of these areas are reviewed.

  9. A novel technology for quick acclimation of an anaerobic microbial consortia used for biodegrading teraphthalic acid(TA)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The seed sludge originated from a methane fermentation reactor was enriched and acclimated with TA as sole carbon source under nitrate respiration mode first for 6 week, and then can be turned to methane fermentation conditions. After 6 weeks processing, the specific rate acclimation. Aftera total of 90 days for the enrichment and acclimation, the fermentative bacteria which originally existed in the seed sludge nearly disappeared, and instead of them, the TA reductive and cleaving bacteria group was formed in the new consortia, which was confirmed by the MPN counts and roll tube counts. Compared with the control experiment, the acclimation period can be shortened by about 50%.

  10. Technology strategy for gas technologies; Technology Target Areas; TTA8 Gas Technology

    Energy Technology Data Exchange (ETDEWEB)

    2008-07-01

    TTA8 - Gas technologies points out the various routes Norway can follow to capitalise on the vast resources of natural gas that will be produced in the years to come by developing a strong technology and competence platform. A broad view is taken for the value creation having as basis the continued gas export from NCS to Europe, but also a strong focus on development of gas resources in other parts of the world. The latter can also be seen as part of international positioning for upstream resources and does also include involvements in projects, and export of technology and products. The TTA has structured the analysis into 3 main areas: Gas transport and processing (pipeline, LNG, other); Gas conversion to fuels, chemicals and materials; CO{sub 2} management. In this report, for each of these areas, scenarios based on a gap analysis are presented. One of the key goals has been to identify pacing and emerging technologies for the next 20 years. Based on this, technologies have been mapped according to importance for future competitiveness and technology ambitions. This also includes primary funding responsibilities (public and/or industry). The road map below reflects the key issues in the proposed strategy. The base level of the figure explains areas that will have to be pursued to maintain Norway's role as a key gas and gas technology provider. The second layer represents near term options and possibilities with a reasonable risk profile that could further enhance the Norwegian position given the resources and drive to further develop this industry. As the top layer we have selected some of our 'dreams', what we may achieve if a progressive approach is followed with a strongly innovation based policy. It is acknowledged by the TTA that Norway cannot be a leading technology player in all aspects of the gas value chain. For some technologies we should be an active player and developer, whilst for other technologies we should become a competent buyer

  11. Arsenic, cadmium, and manganese levels in shellfish from Map Ta Phut, an industrial area in Thailand, and the potential toxic effects on human cells.

    Science.gov (United States)

    Rangkadilok, Nuchanart; Siripriwon, Pantaree; Nookabkaew, Sumontha; Suriyo, Tawit; Satayavivad, Jutamaad

    2015-01-01

    Map Ta Phut Industrial Estate is a major industrial area in Thailand for both petrochemical and heavy industries. The release of hazardous wastes and other pollutants from these industries increases the potential for contamination in foods in the surrounding area, especially farmed shellfish. This study determined the arsenic (As), cadmium (Cd), and manganese (Mn) concentrations in the edible flesh of farmed shellfish, including Perna viridis, Meretrix meretrix, and Scapharca inaequivalvis, around the Map Ta Phut area using inductively coupled plasma mass spectrometry. The results showed that shellfish samples contained high levels of total As [1.84-6.42 mg kg(-1) wet weight (ww)]. High Mn concentrations were found in P. viridis and M. meretrix, whereas S. inaequivalis contained the highest Cd. Arsenobetaine (AsB) was found to be the major As species in shellfish (>45% of total As). The in vitro cytotoxicity of these elements was evaluated using human cancer cells (T47D, A549, and Jurkat cells). An observed decrease in cell viability in T47D and Jurkat cells was mainly caused by exposure to inorganic As (iAs) or Mn but not to AsB or Cd. The combined elements (AsB+Mn+Cd) at concentrations predicted to result from the estimated daily intake of shellfish flesh by the local people showed significant cytotoxicity in T47D and Jurkat cells.

  12. Decontamination and decommissioning focus area. Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    This report presents details of the facility deactivation, decommissioning, and material disposition research for development of new technologies sponsored by the Department of Energy. Topics discussed include; occupational safety, radiation protection, decontamination, remote operated equipment, mixed waste processing, recycling contaminated metals, and business opportunities.

  13. Structural and magnetic characterization of large area, free-standing thin films of magnetic ion intercalated dichalcogenides Mn0.25TaS2 and Fe0.25TaS2

    Science.gov (United States)

    Danz, Th; Liu, Q.; Zhu, X. D.; Wang, L. H.; Cheong, S. W.; Radu, I.; Ropers, C.; Tobey, R. I.

    2016-09-01

    Free-standing thin films of magnetic ion intercalated transition metal dichalcogenides are produced using ultramicrotoming techniques. Films of thicknesses ranging from 30 nm to 250 nm were achieved and characterized using transmission electron diffraction and x-ray magnetic circular dichroism. Diffraction measurements visualize the long range crystallographic ordering of the intercalated ions, while the dichroism measurements directly assess the orbital contributions to the total magnetic moment. We thus verify the unquenched orbital moment in Fe0.25TaS2 and measure the fully quenched orbital contribution in Mn0.25TaS2. Such films can be used in a wide variety of ultrafast x-ray and electron techniques that benefit from transmission geometries, and allow measurements of ultrafast structural, electronic, and magnetization dynamics in space and time.

  14. The Technology of Wireless Local Area Network

    Institute of Scientific and Technical Information of China (English)

    林楠; 李翠霞

    2007-01-01

    This article provides an overview of the Wireless LAN. Firstly, the article introduces the history ofdevelopment of IEEE 802.11.Then, the article will discuss the basic technology of the IEEE 802.11 including IEEE 802.11b, a, and g. The finally, IEEE 802.11 a / b / gComparison and the trend of WLANs will be prospected by this article.

  15. Potentiometric RuO2-Ta2O5 pH sensors fabricated using thick film and LTCC technologies.

    Science.gov (United States)

    Manjakkal, Libu; Zaraska, Krzysztof; Cvejin, Katarina; Kulawik, Jan; Szwagierczak, Dorota

    2016-01-15

    The paper reports on the preparation, properties and application of potentiometric pH sensors with thick film RuO2-Ta2O5 sensing electrode and Ag/AgCl/KCl reference electrode screen printed on an alumina substrate. Furthermore, it presents fabrication procedure and characterization of a new miniaturized pH sensor on LTCC (low temperature cofired ceramics) substrate, destined for wireless monitoring. The crystal structure, phase and elemental composition, and microstructure of the films were investigated by X-ray diffractometry, Raman spectroscopy, scanning electron microscopy and energy dispersive spectroscopy. Potentiometric characterization was performed in a wide pH range of 2-12 for different storage conditions and pH loops. The advantages of the proposed thick film pH sensors are: (a) low cost and easy fabrication, (b) excellent sensitivity close to the Nernstian response (56mV/pH) in the wide pH range, (c) fast response, (d) long lifetime, (e) good reproducibility, (f) low hysteresis and drift effects, and (g) low cross-sensitivity towards Li(+), Na(+) and K(+) as interfering ions. The applicability of the sensors for pH measurement of river, tap and distilled water, and some drinks was also tested.

  16. Technology Area Roadmap for In-Space Propulsion Technologies

    Science.gov (United States)

    Johnson, Les; Meyer, Michael; Palaszewski, Bryan; Coote, David; Goebel, Dan; White, Harold

    2012-01-01

    The exponential increase of launch system size.and cost.with delta-V makes missions that require large total impulse cost prohibitive. Led by NASA fs Marshall Space Flight Center, a team from government, industry, and academia has developed a flight demonstration mission concept of an integrated electrodynamic (ED) tethered satellite system called PROPEL: \\Propulsion using Electrodynamics.. The PROPEL Mission is focused on demonstrating a versatile configuration of an ED tether to overcome the limitations of the rocket equation, enable new classes of missions currently unaffordable or infeasible, and significantly advance the Technology Readiness Level (TRL) to an operational level. We are also focused on establishing a far deeper understanding of critical processes and technologies to be able to scale and improve tether systems in the future. Here, we provide an overview of the proposed PROPEL mission. One of the critical processes for efficient ED tether operation is the ability to inject current to and collect current from the ionosphere. Because the PROPEL mission is planned to have both boost and deboost capability using a single tether, the tether current must be capable of flowing in both directions and at levels well over 1 A. Given the greater mobility of electrons over that of ions, this generally requires that both ends of the ED tether system can both collect and emit electrons. For example, hollow cathode plasma contactors (HCPCs) generally are viewed as state-of-the-art and high TRL devices; however, for ED tether applications important questions remain of how efficiently they can operate as both electron collectors and emitters. Other technologies will be highlighted that are being investigated as possible alternatives to the HCPC such as Solex that generates a plasma cloud from a solid material (Teflon) and electron emission (only) technologies such as cold-cathode electron field emission or photo-electron beam generation (PEBG) techniques

  17. MSFC institutional area network and ATM technology

    Science.gov (United States)

    Amin, Ashok T.

    1994-10-01

    The New Institutional Area Network (NEWIAN) at Marshall supports over 5000 end users with access to 26 file servers providing work presentation services. It is comprised of some 150 Ethernet LAN's interconnected by bridges/routers which are in turn connected to servers over two dual FDDI rings. The network supports various higher level protocols such as IP, IPX, AppleTalk (AT), and DECNet. At present IPX and AT protocols packets are routed, and IP protocol packets are bridged; however, work is in progress to route all IP packets. The impact of routing IP packets on network operation is examined. Broadband Integrated Services Data Network (BISDN), presently at various stages of development, is intended to provide voice, video, and data transfer services over a single network. BISDN will use asynchronous transfer mode (ATM) as a data transfer technique which provides for transmission, multiplexing, switching, and relaying of small size data units called cells. Limited ATM Wide Area Network (WAN) services are offered by Wiltel, AT&T, Sprint, and others. NASA is testing a pilot ATM WAN with a view to provide Program Support Communication Network services using ATM. ATM supports wide range of data rates and quality of service requirements. It is expected that ATM switches will penetrate campus networks as well. However, presently products in these areas are at various stages of development and standards are not yet complete. We examine development of ATM to help assess its role in the evolution of NEWIAN.

  18. Baseline Radionuclide and Nonradionuclide Concentrations in Soils, Vegetation, and Small Mammals at the Proposed Expansion Area at TA-54 Area G

    Energy Technology Data Exchange (ETDEWEB)

    D. D. Romero, P. R. Fresquez

    2007-11-30

    Area G is a 25.5-hectare (63-acre), fenced, low-level radioactive solid waste processing and disposal area located on the east end of Mesa del Buey at Technical Area 54 at Los Alamos National Laboratory. This disposal area has been in existence since 1957 and is expected to be filled by the year 2015. Thus, a new area, located adjacent to Area G on the west side, has been proposed for the expansion of disposal activities. Since 1994 to the present, baseline levels of several radionuclides and nonradionuclides have been collected in soils, vegetation, and small mammals (field mice and rock squirrels). These data will be used to assess potential impacts, if any, at the expanded site once operations begin. Baseline statistical reference levels (BSRLs) (mean plus three standard deviations = 99% confidence level) of radionuclides and nonradionuclides in these media were calculated and compared with regional statistical reference levels (RSRLs). RSRLs are calculated from regional areas away from the influence of the Laboratory and represent natural and worldwide fallout sources. BSRLs in most media, with the exception of field mice (mostly Peromyscus spp.), compare very well with RSRLs. Field mice, probably because they are mobile and may have spent time within the active disposal area, appeared to be impacted by Area G operations as they contained higher concentrations of {sup 3}H, {sup 238}Pu, {sup 239,240}Pu, and {sup 241}Am as compared to RSRLs. Overall, however, the preoperational data from the other media show that the proposed expansion area has been impacted very little by Area G operations.

  19. Engineering Research, Development and Technology, FY95: Thrust area report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-01

    The mission of the Engineering Research, Development, and Technology Program at Lawrence Livermore National Laboratory (LLNL) is to develop the knowledge base, process technologies, specialized equipment, tools and facilities to support current and future LLNL programs. Engineering`s efforts are guided by a strategy that results in dual benefit: first, in support of Department of Energy missions, such as national security through nuclear deterrence; and second, in enhancing the nation`s economic competitiveness through their collaboration with US industry in pursuit of the most cost-effective engineering solutions to LLNL programs. To accomplish this mission, the Engineering Research, Development, and Technology Program has two important goals: (1) identify key technologies relevant to LLNL programs where they can establish unique competencies, and (2) conduct high-quality research and development to enhance their capabilities and establish themselves as the world leaders in these technologies. To focus Engineering`s efforts, technology thrust areas are identified and technical leaders are selected for each area. The thrust areas are comprised of integrated engineering activities, staffed by personnel from the nine electronics and mechanical engineering divisions, and from other LLNL organizations. This annual report, organized by thrust area, describes Engineering`s activities for fiscal year 1995. The report provides timely summaries of objectives methods, and key results from eight thrust areas: computational electronics and electromagnetics; computational mechanics; microtechnology; manufacturing technology; materials science and engineering; power conversion technologies; nondestructive evaluation; and information engineering.

  20. Web TA Production (WebTA)

    Data.gov (United States)

    US Agency for International Development — WebTA is a web-based time and attendance system that supports USAID payroll administration functions, and is designed to capture hours worked, leave used and...

  1. Information Literacy Education on College of Technology at Kyushu Area

    Science.gov (United States)

    Kozono, Kazutake; Ikeda, Naomitsu; Irie, Hiroki; Fujimoto, Yoichi; Oshima, Shunsuke; Murayama, Koichi; Taguchi, Hirotsugu

    Recently, the importance of an engineering education increases by the development of the information technology (IT) . Development of the information literacy education is important to deal with new IT in the education on college of technology. Our group investigated the current state of information literacy education on college of technology at Kyushu area and the secondary education. In addition, we investigated about the talent whom the industrial world requested. From these investigation results, this paper proposed cooperation with the elementary and secondary education, enhancement of intellectual property education, introduction of information ethics education, introduction of career education and enhancement of PBL to information literacy education on college of technology.

  2. Thrust Area Report, Engineering Research, Development and Technology

    Energy Technology Data Exchange (ETDEWEB)

    Langland, R. T.

    1997-02-01

    The mission of the Engineering Research, Development, and Technology Program at Lawrence Livermore National Laboratory (LLNL) is to develop the knowledge base, process technologies, specialized equipment, tools and facilities to support current and future LLNL programs. Engineering`s efforts are guided by a strategy that results in dual benefit: first, in support of Department of Energy missions, such as national security through nuclear deterrence; and second, in enhancing the nation`s economic competitiveness through our collaboration with U.S. industry in pursuit of the most cost- effective engineering solutions to LLNL programs. To accomplish this mission, the Engineering Research, Development, and Technology Program has two important goals: (1) identify key technologies relevant to LLNL programs where we can establish unique competencies, and (2) conduct high-quality research and development to enhance our capabilities and establish ourselves as the world leaders in these technologies. To focus Engineering`s efforts technology {ital thrust areas} are identified and technical leaders are selected for each area. The thrust areas are comprised of integrated engineering activities, staffed by personnel from the nine electronics and mechanical engineering divisions, and from other LLNL organizations. This annual report, organized by thrust area, describes Engineering`s activities for fiscal year 1996. The report provides timely summaries of objectives, methods, and key results from eight thrust areas: Computational Electronics and Electromagnetics; Computational Mechanics; Microtechnology; Manufacturing Technology; Materials Science and Engineering; Power Conversion Technologies; Nondestructive Evaluation; and Information Engineering. Readers desiring more information are encouraged to contact the individual thrust area leaders or authors. 198 refs., 206 figs., 16 tabs.

  3. Application of a fast and efficient algorithm to detect areas with prerequisites for landslide in sensitive clays, Göta Älv, Sweden

    Science.gov (United States)

    Melchiorre, Caterina; Tryggvason, Ari

    2014-05-01

    In Sweden, landslide stability maps are based on the recognition of topographical and soil conditions. The topographical criterion is based on the ratio between height of the slope and its length. The calculation of this cross-sectional angle is straight forward in one dimension, but slightly more complicated in two dimensions and very computationally expensive in a GIS environment. We present an application of a fast and efficient computer algorithm based on slope and soil criteria in Göta Älv, southwest Sweden. The algorithm, compared to other software implementations of the cross-sectional angle criterion, guarantees a fast execution, the possibility to insert several threshold values of the cross-sectional angle and the use of information on bedrock elevation. As input maps we used a 1:50000 Quaternary soil map, a DEM at 2x2 m pixel resolution, and a bedrock elevation map. We used two sets of cross-sectional angle thresholds, the first one derived from stability calculation and the second one assessed through the relationship between QCSI (i.e., estimated value of the sensitivity) and the cross-sectional angle calculated from the landslide scar database. A comparison between the results of the algorithm using or not using the bedrock information was also performed. The produced maps were validated by using the landslide scar database and a hazard map. The results show that the use of bedrock information decreases the calculated areas with prerequisites for landslides, whereas not decreasing the performance of the algorithm. The maps produced by using the two different sets of cross-angle thresholds are very similar and show similar results in the validation. This means that it would be possible to extent this methodology in areas without geotechnical information by using less expensive data such as the QCSI. Moreover, the use of several cross-sectional angle thresholds is not possible in other software implementations available at the moment. This means that

  4. Engineering research, development and technology. Thrust area report, FY93

    Energy Technology Data Exchange (ETDEWEB)

    1994-05-01

    The mission of the Engineering Research, Development, and Technology Program at Lawrence Livermore National Laboratory (LLNL) is to develop the technical staff, tools, and facilities needed to support current and future LLNL programs. The efforts are guided by a dual-benefit research and development strategy that supports Department of Energy missions, such as national security through nuclear deterrence and economic competitiveness through partnerships with U.S. industry. This annual report, organized by thrust area, describes the activities for the fiscal year 1993. The report provides timely summaries of objectives, methods, and results from nine thrust areas for this fiscal year: Computational Electronics and Electromagnetics; Computational Mechanics; Diagnostics and Microelectronics; Fabrication Technology; Materials Science and Engineering; Power Conversion Technologies; Nondestructive Evaluation; Remote Sensing, Imaging, and Signal Engineering; and Emerging Technologies. Separate abstracts were prepared for 47 papers in this report.

  5. Mixed waste characterization, treatment, and disposal focus area. Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    This paper presents details about the technology development programs of the Department of Energy. In this document, waste characterization, thermal treatment processes, non-thermal treatment processes, effluent monitors and controls, development of on-site innovative technologies, and DOE business opportunities are applied to environmental restoration. The focus areas for research are: contaminant plume containment and remediation; mixed waste characterization, treatment, and disposal; high-level waste tank remediation; landfill stabilization; and decontamination and decommissioning.

  6. Contaminant plumes containment and remediation focus area. Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    EM has established a new approach to managing environmental technology research and development in critical areas of interest to DOE. The Contaminant Plumes Containment and Remediation (Plumes) Focus Area is one of five areas targeted to implement the new approach, actively involving representatives from basic research, technology implementation, and regulatory communities in setting objectives and evaluating results. This document presents an overview of current EM activities within the Plumes Focus Area to describe to the appropriate organizations the current thrust of the program and developing input for its future direction. The Plumes Focus Area is developing remediation technologies that address environmental problems associated with certain priority contaminants found at DOE sites, including radionuclides, heavy metals, and dense non-aqueous phase liquids (DNAPLs). Technologies for cleaning up contaminants of concern to both DOE and other federal agencies, such as volatile organic compounds (VOCs), polychlorinated biphenyls (PCBs), and other organics and inorganic compounds, will be developed by leveraging resources in cooperation with industry and interagency programs.

  7. Roles of TaON and Ta(3)N(5) in the visible-Fenton-like degradation of atrazine.

    Science.gov (United States)

    Du, Yingxun; Zhao, Lu; Zhang, Yuanyuan

    2014-02-28

    In this study, the roles of TaON and Ta3N5 in the degradation of atrazine by the visible-Fenton-like system were examined in detail. The TaON and Ta3N5 samples prepared by the nitridation of Ta2O5 and characterized by XRD, DRS, BET and PL analyses. The results showed that the TaON sample had weaker absorption in the visible region but higher specific surface area than the Ta3N5 sample. The degradation rate of atrazine in visible-TaON-Fenton-like system was 2.64 times than that in visible-Ta3N5-Fenton-like system. Both Fe(2+) and H2O2 could be reduced by eCB (electrons in the conduction band) in TaON or Ta3N5, while atrazine could not be oxidized by hVB (holes in the valance band). OH is the active species for the degradation of atrazine in visible-TaON/Ta3N5-Fenton-like systems. Majority of OH originated from Fenton reaction. After Fe(3+) was reduced by eCB to Fe(2+), Fe(2+) reacted quickly with H2O2 to generate OH. In addition, by capturing eCB, a little of H2O2 was reduced to yield OH, which contributed a small fraction of atrazine degradation. Based on the experimental results, the roles of TaON and Ta3N5 in the visible-Fenton-like system were proposed. And the higher photocatalytic activity of TaON than Ta3N5 was suggested to be due to the higher separation efficiency of electrons and holes, which may be related to the larger specific surface area.

  8. Chongqing Economic and Technological Development Area:Community Overview

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ Chongqing Economic and Technological Development Area, for 13 years of development, has made detailed work in building the investment environment, bold job in the management system innovation, full strengths in business recruitment and investment attacting,hard job in cultivating new point of economic growth.

  9. Wireless body area networks technology, implementation, and applications

    CERN Document Server

    Yuce, Mehmet R

    2011-01-01

    The book provides a comprehensive overview for the latest WBAN systems, technologies, and applications. The chapters of the book have been written by various specialists who are experts in their areas of research and practice. The book starts with the basic techniques involved in designing and building WBAN systems. It explains the deployment issues and then moves into the application areas of WBAN. The remaining chapters focus on the development of hardware, signal processing algorithms, and wireless communication and network design for wearable and implantable body sensors used in WBAN appli

  10. Benefit Estimates of Terminal Area Productivity Program Technologies

    Science.gov (United States)

    Hemm, Robert; Shapiro, Gerald; Lee, David; Gribko, Joana; Glaser, Bonnie

    1999-01-01

    This report documents benefit analyses for the NASA Terminal Area Technology (TAP) technology programs. Benefits are based on reductions in arrival delays at ten major airports over the 10 years from 2006 through 2015. Detailed analytic airport capacity and delay models were constructed to produce the estimates. The goal of TAP is enable good weather operations tempos in all weather conditions. The TAP program includes technologies to measure and predict runway occupancy times, reduce runway occupancy times in bad weather, accurately predict wake vortex hazards, and couple controller automation with aircraft flight management systems. The report presents and discusses the estimate results and describes the models. Three appendixes document the model algorithms and discuss the input parameters selected for the TAP technologies. The fourth appendix is the user's guide for the models. The results indicate that the combined benefits for all TAP technologies at all 10 airports range from $550 to $650 million per year (in constant 1997 dollars). Additional benefits will accrue from reductions in departure delays. Departure delay benefits are calculated by the current models.

  11. Diabetes and Technology for Increased Activity (DaTA Study: The effects of exercise and technology on heart rate variability and metabolic syndrome risk factors.

    Directory of Open Access Journals (Sweden)

    Melanie I Stuckey

    2013-09-01

    Full Text Available This study tested the hypothesis that an eight-week exercise intervention supported by mobile health (mHealth technology would improve metabolic syndrome (MetS risk factors and heart rate variability (HRV in a population with MetS risk factors. Participants (n=12; 3 male; aged 56.9±7.0y reported to the laboratory for assessment of MetS risk factors and fitness (VO2max at baseline (V0 and after eight-weeks (V2 of intervention. Participants received an individualized exercise prescription and a mHealth technology kit for remote monitoring of blood pressure (BP, blood glucose, physical activity and body weight via smartphone. Participants underwent 24-h ambulatory monitoring of R-R intervals following V0 and V2. Low and high frequency powers of HRV were assessed from the recording and the ratio of low-to-high frequency powers and low and high frequency power in normalized units were calculated. One-way repeated measures analysis of variance showed that waist circumference (V0: 113.1±11.0cm, V2: 108.1±14.7cm; p=0.004 and diastolic BP (V0: 81±6mmHg, V2: 76±11mmHg; p=0.04 were reduced and VO2max increased (V0: 31.3ml/kg/min, V2: 34.8ml/kg/min; p=0.02 with no changes in other MetS risk factors. Low and high frequency powers in normalized units were reduced (V0: 75.5±12.0, V2: 72.0±12.1; p=0.03 and increased (V0: 24.5±12.0, V2: 28.0±12.1; p=0.03, respectively, with no other changes in HRV. Over the intervention period, changes in systolic BP were correlated negatively with the changes in R-R interval (r=-0.600; p=0.04 and positively with the changes in heart rate (r=0.611; p=0.03, with no other associations between MetS risk factors and HRV parameters. Thus, this eight-week mHealth supported exercise intervention improved MetS risk factors and HRV parameters, but only changes in systolic BP were associated with improved autonomic function.

  12. Radioactive Tank Waste Remediation Focus Area. Technology summary

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    In February 1991, DOE`s Office of Technology Development created the Underground Storage Tank Integrated Demonstration (UST-ID), to develop technologies for tank remediation. Tank remediation across the DOE Complex has been driven by Federal Facility Compliance Agreements with individual sites. In 1994, the DOE Office of Environmental Management created the High Level Waste Tank Remediation Focus Area (TFA; of which UST-ID is now a part) to better integrate and coordinate tank waste remediation technology development efforts. The mission of both organizations is the same: to focus the development, testing, and evaluation of remediation technologies within a system architecture to characterize, retrieve, treat, concentrate, and dispose of radioactive waste stored in USTs at DOE facilities. The ultimate goal is to provide safe and cost-effective solutions that are acceptable to both the public and regulators. The TFA has focused on four DOE locations: the Hanford Site in Richland, Washington, the Idaho National Engineering Laboratory (INEL) near Idaho Falls, Idaho, the Oak Ridge Reservation in Oak Ridge, Tennessee, and the Savannah River Site (SRS) in Aiken, South Carolina.

  13. New Products and Technologies, Based on Calculations Developed Areas

    Directory of Open Access Journals (Sweden)

    Gheorghe Vertan

    2013-09-01

    Full Text Available Following statistics, currently prosperous and have high GDP / capita, only countries that have and fructify intensively large natural resources and/or produce and export products massive based on patented inventions accordingly. Without great natural wealth and the lowest GDP / capita in the EU, Romania will prosper only with such products. Starting from the top experience in the country, some patented, can develop new and competitive technologies and patentable and exportable products, based on exact calculations of developed areas, such as that double shells welded assemblies and plating of ships' propellers and blade pump and hydraulic turbines.

  14. LIDAR Mapping Technology to Populate Green Areas GIS

    Science.gov (United States)

    Cattaneo, N.; Di Maria, F.; Guzzetti, F.; Privitera, A.; Righetti, G.

    2011-08-01

    In the last eight years the structure of Topographical Database of green areas has been implemented and consolidated: originally born to manage green areas in Milan, it is now used in other cities. Beside the optimizations achieved in data management (i.e. relationship between data and working process, updating procedures, exhaustive Index of Items) it is now becoming important an optimization in data acquisition: this is the reason why a test was started involving the use of LiDAR technology for surveying those green areas classified as equipped parks (over 50.000 sqmt), as an alternative to the traditional topographycal survey. LiDAR technology is commonly applied to forestry surveying and green mass computation, even in urban contexts, achieving good results also in automation of data processing. Nevertheless this testing activity has a specific aim, that is to derive (also using the contextual orthophoto) as many layers as possible among the ones described by the Specifications on Green areas TDb, preserving the high level of thematical detail and accuracy suggested by the Specifications. To do this, using the application Laserwebfor visualization and interaction with the point cloud, new and specific functions and layouts have been designed and implemented. For each item of the index has been made an effort to encode the optimal strategy for exploring the cloud and exporting the datum. The variety of the elements included in the Specification Index of Items is very differentiated, therefore also the procedures in point cloud analysis are various, as the main purpose of this work is to exploit all the potential information contained in a point cloud.

  15. Elasticity and melodic reformulations in music by oral transmission in Western Mediterranean area: music for flaüta and drum in Eivissa and Formentera Islands

    Directory of Open Access Journals (Sweden)

    Escandell i Guasch, Jaume

    2010-12-01

    Full Text Available The article focuses on instrumental music of oral transmission in the islands of Eivissa and Formentera. In particular, are explained two aspects of the structural behaviour detected in liturgical repertoire for the set of flaüta and drum. The first one of these aspects consists of the development of a musical discourse from the constant reformulation of two melodic models clearly delimited by the used degrees –in relation to all the gamma of sounds that the instrument produces– and for the ending notes. The second one refers to the elasticity that characterizes the studied pieces, which do not have a prefixed extension, but have mechanisms based on a variable times repetition of determinate segments. This fact enables more widespread or more reduced versions of the same pieces[es] El presente artículo aborda la música instrumental de transmisión oral de las islas de Eivissa y Formentera. Concretamente, se explican dos aspectos del comportamiento estructural detectados en el repertorio litúrgico para flaüta y tambor. El primero de ellos consiste en el desarrollo de un discurso musical a partir de la reformulación constante de dos modelos melódicos delimitados claramente por los grados utilizados –en relación con toda la gama de sonidos que produce la flaüta– y por las notas de terminación. El segundo se refiere a la elasticidad que caracteriza las piezas estudiadas. Éstas no tienen una extensión prefijada, sino que cuentan con mecanismos basados en la repetición –un número variable de veces- de segmentos determinados, lo que permite desarrollar versiones más extensas o más reducidas de una misma pieza. [ct] L’article se centra en la música instrumental de transmissió oral a les les illes d’Eivissa i Formentera. En concret, s’expliquen dos aspectes del comportament estructural detectats en el repertori litúrgic per al conjunt de flaüta i tambor. El primer de dits aspectes consisteix en el desenvolupament d

  16. Defense Technology Objectives of the Joint Warfighting Science and Technology and Defense Technology Area Plan.

    Science.gov (United States)

    1996-05-01

    occlusion , multipath etc.) through the use of inertial measurement systems (Interferometric Fiber Optic Gyro, Dynamically Tuned Gyro) and will...management systems provide mobile and semi- mobile assets (e.g., Abrams, Theater Missile Defense - TMD ) with low cost, low burden survivability...technology for development of an operational high energy Airborne Laser (ABL) for Theater Missile Defense ( TMD ). Address risk reduction issues for develop

  17. Assessment of Gari Processing Technologies in Oja-Iya Area of ...

    African Journals Online (AJOL)

    Assessment of Gari Processing Technologies in Oja-Iya Area of Ilorin Metropolis. ... Journal of Agricultural Research and Development ... Large scale gari processing was largely unsuccessful in the area because of lack of modern technology, ...

  18. Chemical surety material decontamination and decommissioning of Los Alamos National Laboratory Chemical Surety Material Laboratory area TA-3, building SM-29, room 4009

    Energy Technology Data Exchange (ETDEWEB)

    Moore, T.E.; Smith, J.M.

    1994-04-01

    From 1982 through 1987, Los Alamos National Laboratory (LANL) performed surety laboratory operations for the U.S. Army Medical Research and Development Command (MRDC). Room 4009 in building SM-29, TA-3, was used as the laboratory for work with the following chemical surety material (CSM) agents: sarin (GB), soman (GD), lewisite (L), and distilled mustard (HD) radio-labelled with H{sup 3} or C{sup 14}. The work was confined to three CSM-certified fume hoods, located in room 4009 (see diagram in Appendix C). The laboratory ceased all active operations during the late 1986 and early 1987 period. From 1987 until 1993 the laboratory was secured and the ventilation system continued to operate. During late 1992, the decision was made to utilize this laboratory space for other operations, thus a decision was made to dismantle and reconfigure this room. LANL sub-contracted Battelle Memorial Institute (BMI) to draw upon the CSM experience of the technical staff from the Hazardous Materials Research Facility (HMRF) to assist in developing a decontamination and decommissioning plan. BMI was subcontracted to devise a CSM safety training course, and a sampling and air monitoring plan for CSM material to ensure personnel safety during all disassembly operations. LANL subcontracted Johnson Controls personnel to perform all disassembly operations. Beginning in early 1993 BMI personnel from the HMRF visited the laboratory to develop both the safety plan and the sample and air monitoring plan. Execution of that plan began in September 1993 and was completed in January 1994.

  19. A novel wireless personal area network technology: ultra wide band technology

    Institute of Scientific and Technical Information of China (English)

    GAO Wei-hua; GUO Li-li; LIANG Zhi-guo

    2006-01-01

    Ultra Wideband (UWB) technology is promising for wireless personal area network (WPAN) applications due to its high data rate, low power requirement and short-range characteristics. Instead of exploring new unused frequency band, the UWB communication follows the overlay principle, i.e.,sharing the spectrum with existing systems and devices. This novel radio technology has been recently approved by the regulatory authorities in the United States and Canada, and is being considered for approval in Europe and Asia. In this paper, an overview of the UWB radio technology from the technical,economical, and regulatory perspectives is provided. Firstly, the definition of UWB by the Federal Communications Commission (FCC) is introduced, followed by a brief introduction to the history. The current status of the standardization process resulting from the FCC's recent decision to permit unlicensed operation in the [3.1-10.6] GHz band is discussed. Then, the reasons of considering UWB as a future solution for WLAN/WPAN applications are studied. In particular, the unique properties of UWB and its difference from other wireless technology alternatives are studied. Then, the benefits and challenges related to the commercial deployment of UWB for future applications are discussed. Finally,the research problems and challenges posed by the UWB technology are focused.

  20. Technology Estimating 2: A Process to Determine the Cost and Schedule of Space Technology Research and Development

    Science.gov (United States)

    Cole, Stuart K.; Wallace, Jon; Schaffer, Mark; May, M. Scott; Greenberg, Marc W.

    2014-01-01

    As a leader in space technology research and development, NASA is continuing in the development of the Technology Estimating process, initiated in 2012, for estimating the cost and schedule of low maturity technology research and development, where the Technology Readiness Level is less than TRL 6. NASA' s Technology Roadmap areas consist of 14 technology areas. The focus of this continuing Technology Estimating effort included four Technology Areas (TA): TA3 Space Power and Energy Storage, TA4 Robotics, TA8 Instruments, and TA12 Materials, to confine the research to the most abundant data pool. This research report continues the development of technology estimating efforts completed during 2013-2014, and addresses the refinement of parameters selected and recommended for use in the estimating process, where the parameters developed are applicable to Cost Estimating Relationships (CERs) used in the parametric cost estimating analysis. This research addresses the architecture for administration of the Technology Cost and Scheduling Estimating tool, the parameters suggested for computer software adjunct to any technology area, and the identification of gaps in the Technology Estimating process.

  1. Engineering Mathematics Assessment Using "MapleTA"

    Science.gov (United States)

    Jones, Ian S.

    2008-01-01

    The assessment of degree level engineering mathematics students using the computer-aided assessment package MapleTA is discussed. Experience of academic and practical issues for both online coursework and examination assessments is presented, hopefully benefiting other academics in this novel area of activity. (Contains 6 figures and 1 table.)

  2. Technology strategy for subsea processing and transport; Technology Target Areas; TTA6 - Subsea processing and transportation

    Energy Technology Data Exchange (ETDEWEB)

    2008-07-01

    OG21 (www.OG21.org) Norway's official technology strategy for the petroleum sector issued a revised strategy document in November 2005 (new strategy planned in 2009). In this document 'Subsea processing and transport' was identified as one of the eight new technology target areas (TTAs). The overall OG21 strategy document is on an aggregated level, and therefore the Board of OG21 decided that a sub-strategy for each TTA was needed. This document proposes the sub-strategy for the technology target area 'Subsea processing and transport' which covers the technology and competence necessary to effectively transport well stream to a platform or to onshore facilities. This includes multiphase flow modelling, flow assurance challenges to avoid problems with hydrates, asphaltenes and wax, subsea or downhole fluid conditioning including bulk water removal, and optionally complete water removal, and sand handling. It also covers technologies to increase recovery by pressure boosting from subsea pumping and/or subsea compression. Finally it covers technologies to facilitate subsea processing such as control systems and power supply. The vision of the Subsea processing and transport TTA is: Norway is to be the leading international knowledge- and technology cluster in subsea processing and transport: Sustain increased recovery and accelerated production on the NCS by applying subsea processing and efficient transport solutions; Enable >500 km gas/condensate multiphase well stream transport; Enable >200 km oil-dominated multiphase well stream transport; Enable well stream transport of complex fluids; Enable subsea separation, boosting compression, and water injection; Enable deepwater developments; Enable environmentally friendly and energy efficient field development. Increase the export of subsea processing and transport technology: Optimize technology from the NCS for application worldwide; Develop new technology that can meet the challenges found in

  3. A comparative study of the sensitivities of Salmonella typhimurium strains TA 98, TA 100 and TA 102 to hospital waste waters.

    Science.gov (United States)

    Gupta, Preeti; Mathur, P; Mathur, N; Aarya, B

    2014-07-01

    Hospitals are a release source of many chemical compounds in their wastewaters. In the present study Salmonella typhimurium strains TA 98, TA 100 and TA 102 were analyzed for their sensitivity to hospital waste waters. The results of the study showed that hospital waste waters consists of mutagens causing frame shift mutations and base pair substitutions and amongst the three strains used in this study, TA 102 was most effective which along with TA 98 can be used for quick assessment of genotoxicity of hospital waste waters prior to its discharge. Genotoxic potential of hospital waste waters from five major hospitals located in Jaipur and Delhi was studied. Such waste waters should be treated prior to their discharge. The results of this study call for further detailed study in this area of research.

  4. Enabling Technologies for Fabrication of Large Area Flexible Antennas Project

    Data.gov (United States)

    National Aeronautics and Space Administration — MesoScribe Technologies, a high tech start-up from SUNY-Stony Brook, proposes to apply a breakthrough new direct writing technology to meet the objectives set-forth...

  5. Investigation of TaC–TaB2 ceramic composites

    Indian Academy of Sciences (India)

    Behzad Mehdikhani; Gholam Hossein Borhani; Saeed Reza Bakhshi; Hamid Reza Baharvandi

    2016-02-01

    The TaC–TaB2 composition was sintered by spark plasma (SPS) at 1900–2100°C and applied pressure of 30 MPa. TaC and 2–3 wt% B4C were used as starting powders. Densification process, phase evolution, microstructure and the mechanical properties of the composites were investigated. The results indicated that the TaC–TaB2 composition could be SPS to 97% of theoretical density in 10 min at 2100°C. Addition of B4C leads to an increase in the density sample from 76 to 97%. B4C nano-powder resists grain growth even at high temperature 2100°C. The formation of TaB2/carbon at TaC grain boundaries helps in pinning the grain boundary and inhibiting grain growth. The phase formation was associated with carbon and boron diffusion from the starting particles B4C to form TaB2 phases. TaC grain sizes decreased with increase in B4C concentration. Samples with 2.0 wt% B4C composition had highest flexure strength up to 520 MPa. The effect of B4C addition on hardness measured by microhardness has been studied. Hardness of samples containing 3.0 wt% B4C was 16.99 GPa.

  6. Characterization of a TaJ Gene from Wheat

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    A novel J-domain protein gene was cloned from wheat (Triticum aestivum L.) using RT-PCR technology and named as TaJ. The J-domain protein is defined by the presence of a J-domain. The cDNA of T. aestivum gene, TaJ (GenBank accession number: DQ789026), was 1 263 bp and contained a complete open reading frame (ORF) encoding a J-domain protein of 420 amino acid residues. The predicted amino acid sequence of TaJ possesses three functionally essential domains: the N-terminal J-domain which includes the highly conserved HPD tripeptide, an adjacent domain that is rich in glycine and phenylalanine residues (G/F) and a Cysteine-rich zinc-finger domain with four repeats of CxxCxGxG that is important for protein interactions. The C-terminal of TaJ was -CAQQ, a farnesylation motif. The full-length deduced amino acid sequence of TaJ is highly homologous to J-domain proteins from various plant species. Southern blot analysis indicated that a single copy of TaJ existed in wheat genome. The expression pattern of TaJ performed by real-time PCR demonstrated that heat shock (HS) at 37℃ induced the expression of TaJ rapidly and strongly, but the response of the TaJ gene to cold stress was much slower than that to HS. Tissue-specific expression analysis showed that the expression level of TaJ gene was much higher in leaves than that in roots.

  7. Technology selection for MSW treatment in Altiplano areas using FMDM.

    Science.gov (United States)

    Jiang, Jianguo; Lou, Zhiying; Hg, Siio; Duo, Ji; Li, Zhong

    2009-10-01

    There are special requirements for municipal solid waste (MSW) treatment caused by lower oxygen content and atmospheric pressure on the Altiplano. The intention of this paper was to analyse the applicability of various technologies to MSW treatment in the Altiplano and select the best one based on the current MSW collection modes and technical levels, using the Fuzzy Mathematical Decision Method (FMDM). Technologies including landfill, incineration, composting, and anaerobic digestion (AD) were compared. The results of the studies showed that AD technology is a new technology which is attractive in economic terms and helpful for environmental harmony. AD can solve the difficulties caused by a high content of organic matter in the MSW, lower atmospheric pressure and oxygen content on the Altiplano. Moreover, it can achieve reduction and recycling of the waste, thereby saving space for treatment and disposal. Using this technology, renewable energy can be recovered to save conventional fuel consumption and the emission of greenhouse gases can be reduced to improve the conservation of the local ecosystem. Putting AD into practice in the Altiplano may be the preferred method of MSW treatment.

  8. The technological management in the PETROBRAS gas and energy area; A gestao tecnologica da area de gas e energia da PETROBRAS

    Energy Technology Data Exchange (ETDEWEB)

    Baratelli Junior, Fernando [PETROBRAS, Rio de Janeiro, RJ (Brazil). Centro de Pesquisas]. E-mail: fbj@cenpes.petrobras.com.br

    2002-07-01

    This paper present detailed results obtained at the COMEG (Strategic Technologic Committee for Energy and Gas) identifying the the technological factors, and the associated critical technologies, pointing out the technological positioning of the PETROBRAS related to the each factor , the company strategic behaviour on each technological factor and the management directives for managing the technological development of the area.

  9. Small Wind Technology Diffusion in Suburban Areas of Sicily

    Directory of Open Access Journals (Sweden)

    Simona Culotta

    2015-09-01

    Full Text Available Among renewable energy resources, wind energy became more attractive in the last decade. Wind farm installations dramatically increased in areas where climatic conditions, topography, and environment have allowed their development. The installation of wind turbines, usually carried out in remote areas, recently began to cover areas identified by a complex terrain such as urban and suburban zones. Although these new plant choices are characterized by lower productivity, there is increasing interest in wind energy production in both urban and suburban areas. In this work the authors have carried out an energy analysis developed from a sample of small wind turbines available on the market. This study shows how variable the energy production of a small wind turbine can be according to many design and context parameters: wind profiles, installation height, land use, and characteristics of the turbine.

  10. Novel Surveillance Technologies for Airport Ramp Area Operations Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective of the current research is to develop the concept, algorithms and software necessary for enabling a novel surveillance system for airports ramp areas....

  11. SCIENCE AND TECHNOLOGY ACTIVITIES FOR CHROMIUM IN THE 100 AREAS

    Energy Technology Data Exchange (ETDEWEB)

    PETERSEN SW

    2009-07-02

    {sm_bullet} Primary Objective: Protect the Columbia River - Focus is control and treatment of contamination at or near the shoreline, which is influenced by bank storage {sm_bullet} Secondary Objective: Reduce hexavalent chromium to <48 parts per billion (ppb) in aquifer (drinking water standard) - Large plumes with isolated areas of high chromium concentrations (> 40,000 ppb), - Unknown source location(s); probably originating in reactor operation areas

  12. GIS-technologies for integrated assessment of the productive mining areas

    Energy Technology Data Exchange (ETDEWEB)

    Zamaraev, R.Y.; Oparin, V.N.; Popov, S.E.; Potapov, V.P.; Pyastunovich,O.L. [Russian Academy of Sciences, Kemerovo (Russian Federation)

    2008-05-15

    The paper describes the bases of a new application of GIS-technologies for integrated assessment and comparison of the productive mining areas, involving a wide range of mining and technological factors, considering mineral properties, mineral occurrence conditions and geographical advantages of a mineral deposit location. The model capabilities are exemplified by a comparison of technological characteristics of coals, transportation and power supply infrastructure of the productive mining areas at the Kuznetsk Coal Basin.

  13. Enhancing technology acceptance: The role of the subsurface contaminants focus area external integration team

    Energy Technology Data Exchange (ETDEWEB)

    Kirwan-Taylor, H.; McCabe, G.H. [Battelle Seattle Research Center, WA (United States); Lesperance, A. [Pacific Northwest National Lab., Richland, WA (United States); Kauffman, J.; Serie, P.; Dressen, L. [EnvironIssues (United States)

    1996-09-01

    The US DOE is developing and deploying innovative technologies for cleaning up its contaminated facilities using a market-oriented approach. This report describes the activities of the Subsurface Contaminant Focus Area`s (SCFA) External Integration Team (EIT) in supporting DOE`s technology development program. The SCFA program for technology development is market-oriented, driven by the needs of end users. The purpose of EIT is to understand the technology needs of the DOE sites and identify technology acceptance criteria from users and other stakeholders to enhance deployment of innovative technologies. Stakeholders include regulators, technology users, Native Americans, and environmental and other interest groups. The success of this national program requires close coordination and communication among technology developers and stakeholders to work through all of the various phases of planning and implementation. Staff involved must be willing to commit significant amounts of time to extended discussions with the various stakeholders.

  14. Area Array Technology Evaluations for Space and Military Applications

    Science.gov (United States)

    Ghaffarian, Reza

    1996-01-01

    The Jet Propulsion Laboratory (JPL) is currently assessing the use of Area Array Packaging (AAP) for National Aeronautics and Space Administration (NASA) spaceflight applications. this work is being funded through NASA Headquarters, Code Q. The paper discusses background of AAP, objectives, and uses of AAP.

  15. Inkjet technology for large-area OPV applications

    NARCIS (Netherlands)

    Ren, M.; Sweelssen, J.; Andriessen, H.A.J.M.

    2011-01-01

    The roll-to-roll manufacturing process is believed to significantly reduce the cost-price of large area organic photovoltaic systems. Therefore, we build up knowledge base concerning the influence of process conditions on the performance of polymer solar cells. Inkjet printing has been a major resea

  16. FLOOD STUDY IN THE DEJ AREA, USING MODERN COMPUTING TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    F. ST. STOICA

    2013-03-01

    Full Text Available Floods have the potential to cause fatalities, displacement of people and damage to the environment, to severely compromise economic development and to undermine the economic activities of the Community. In developing policies referring to water and land uses Member States and the Community should consider the potential impacts that such policies might have on flood risks and the management of flood risks. In order to implement the EU directives, Romania is developing at a national level “Prevention, Protection and Minimizing Flood Effects Plan”; in Someş-Tisa hydrographic basin, the plan is implemented by Someş Tisa Water Board. This study is a brief presentation of the pilot study which is part of this program, undertaken in Dej area, at the confluence of two important rivers, Someşul Mare and Someşul Mic, where the flood of 1970 had a catastrophic impact; Dej area is a priority in the above mentioned plan.

  17. Local area networks an introduction to the technology

    CERN Document Server

    McNamara, John E

    1985-01-01

    This concise book provides an objective introduction to local area networks - how they work, what they do, and how you can benefit from them. It outlines the pros and cons of the most common configurations so you can evaluate them in light of your own needs. You'll also learn about network software, with special emphasis on the ISO layered model of communications protocols.

  18. Energy technology monitoring - New areas and in-depth investigations; Technologie-Monitoring - Weitere Bereiche - Vertiefungen

    Energy Technology Data Exchange (ETDEWEB)

    Rigassi, R.; Eicher, H. [Dr. Eicher und Pauli AG, Liestal (Switzerland); Steiner, P.; Ott, W. [Econcept AG, Zuerich (Switzerland)

    2005-07-01

    This comprehensive report for the Swiss Federal Office of Energy (SFOE) presents the results of a project that examined long-term trends in the energy technology area in order to provide information that is to form the basis for political action and the distribution of energy research funding in Switzerland. Energy-technology areas examined include variable-speed electrical drives, ventilation systems for low-energy-consumption buildings, membrane technology and the use of plastics in lightweight automobiles. Examples are quoted and the current state of the appropriate technologies and market aspects are examined. Also, the potential and future developments in the areas listed are looked at. The consequences for energy policy and future developments in the technology-monitoring area are considered.

  19. Engineering Research and Development and Technology thrust area report FY92

    Energy Technology Data Exchange (ETDEWEB)

    Langland, R.T.; Minichino, C. [eds.

    1993-03-01

    The mission of the Engineering Research, Development, and Technology Program at Lawrence Livermore National Laboratory (LLNL) is to develop the technical staff and the technology needed to support current and future LLNL programs. To accomplish this mission, the Engineering Research, Development, and Technology Program has two important goals: (1) to identify key technologies and (2) to conduct high-quality work to enhance our capabilities in these key technologies. To help focus our efforts, we identify technology thrust areas and select technical leaders for each area. The thrust areas are integrated engineering activities and, rather than being based on individual disciplines, they are staffed by personnel from Electronics Engineering, Mechanical Engineering, and other LLNL organizations, as appropriate. The thrust area leaders are expected to establish strong links to LLNL program leaders and to industry; to use outside and inside experts to review the quality and direction of the work; to use university contacts to supplement and complement their efforts; and to be certain that we are not duplicating the work of others. This annual report, organized by thrust area, describes activities conducted within the Program for the fiscal year 1992. Its intent is to provide timely summaries of objectives, theories, methods, and results. The nine thrust areas for this fiscal year are: Computational Electronics and Electromagnetics; Computational Mechanics; Diagnostics and Microelectronics; Emerging Technologies; Fabrication Technology; Materials Science and Engineering; Microwave and Pulsed Power; Nondestructive Evaluation; and Remote Sensing and Imaging, and Signal Engineering.

  20. Structure of metal-oxide Ti-Ta-(Ti,Ta)xOy coatings during spark alloying and induction-thermal oxidation

    Science.gov (United States)

    Koshuro, V.; Fomin, A.; Fomina, M.; Rodionov, I.; Brzhozovskii, B.; Martynov, V.; Zakharevich, A.; Aman, A.; Oseev, A.; Majcherek, S.; Hirsch, S.

    2016-08-01

    The study focuses on combined spark alloying of titanium and titanium alloy surface and porous matrix structure oxidation. The metal-oxide coatings morphology is the result of melt drop transfer, heat treatment, and oxidation. The study establishes the influence of technological regimes of alloying and oxidation on morphological heterogeneity of metal- oxide system Ti-Ta-(Ti,Ta)xOy.

  1. Wireless Local Area Network Adaptive Modulation and Coding Technology Research

    Institute of Scientific and Technical Information of China (English)

    SUN Zeng-you; SUN Xiao-fan

    2012-01-01

      Expound the existing modulation mode of the present wireless local area network. Directing at the problem that when single modulation method conveys data with high speed in the frequency selective fading channel, the system throughput will be declined and the efficiency of the spectrum will be lowered . Put forward the scheme that the OFDM sub-carrier will use differ⁃ent modulation modes after dynamic groups by amplitude frequency response. Simulation results show that the scheme will lower the complexity of the system achievement, and can get a higher spectrum efficiency.

  2. Minimal Technologies Application Project, Hohenfels Training Area, Germany: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Zellmer, S.D.; Hinchman, R.R.; Johnson, D.O. [Argonne National Lab., IL (United States). Energy Systems Div.; Severinghaus, W.D. [Corps of Engineers, Champaign, IL (United States); Brent, J.J. [Army Construction Engineering Research Lab., Champaign, IL (United States)

    1991-12-01

    At the US Army Hohenfels Training Area in Germany, more than 30 years of continuous and intensive tactical training has caused extensive environmental damage because of the loss of vegetative cover and accelerated soil erosion. A project was conducted to evaluate the cost-effectiveness and relative benefits of various revegetation procedures. These procedures involved amendment and seedbed preparation options that were combined with three different durations of site closure. The point-intercept method was used to measure the types and amounts of vegetation established and changes in the vegetative community. Over three growing seasons, applications of fertilizer and seed increased the percent grass, legume, and total vegetative cover. The duration of site closure had no influence on the types or amounts of ground cover established. Materials made up only 10% of the total cost of the fertilization and seeding operations. The results of the research indicate that less expensive methods of amendment application should be evaluated. The data also show that site closure is not practical, economical, or necessary. The results of this project suggest that a regular maintenance program consisting of seeding and fertilization is required to maintain adequate vegetative cover and control erosion on tactical training areas.

  3. Technology Used for Realization of the Reform in Informal Areas.

    Science.gov (United States)

    Qirko, K.

    2008-12-01

    ORGANIZATION OF STRUCTURE AND ADMINISTRATION OF ALUIZNI Law no. 9482, date 03.03.2006 " On legalization, urban planning and integration of unauthorized buildings", entered into force on May 15, 2006. The Council of Ministers, with its decision no.289, date 17.05.2006, established the Agency for the Legalization, Urbanization, and Integration of the Informal Zones/Buildings (ALUIZNI), with its twelve local bodies. ALUIZNI began its activity in reliance to Law no. 9482, date 03.03.2006 " On legalization, urban planning and integration of unauthorized buildings", in July 2006. The administration of this agency was completed during this period and it is composed of; General Directory and twelve regional directories. As of today, this institution has 300 employees. The administrative structure of ALUIZNI is organized to achieve the objectives of the reform and to solve the problems arising during its completion. The following sectors have been established to achieve the objectives: Sector of compensation of owners; sector of cartography, sector of geographic system data elaboration (GIS) and Information Technology; sector of urban planning; sector of registration of legalized properties and Human resource sector. Following this vision, digital air photography of the Republic of Albania is in process of realization, from which we will receive, for the first time, orthophoto and digital map, unique for the entire territory of our country. This cartographic product, will serve to all government institutions and private ones. All other systems, such as; system of territory management; system of property registration ; system of population registration; system of addresses; urban planning studies and systems; definition of boundaries of administrative and touristic zones will be established based on this cartographic system. The cartographic product will be of parameters mentioned below, divided in lots:(2.3 MEuro) 1.Lot I: It includes the urban zone, 1200 km2. It will have

  4. Technology of gas drainage and utilization in Huaibei mining area

    Institute of Scientific and Technical Information of China (English)

    LI Wei; XU Rui

    2009-01-01

    With the characteristics of coal seam geology and gas occurrence, a "ground-underground" integrated gas drainage method was formed, which can relieve gas pressure and increase permeability by mining the protection seams in conditional regions. After coal seam gas drainage, high gas outburst seam was converted to low gas safety seam. In the coal face mining process, safety and high efficient coal mining were realized by the measure of gas-suction over mining. In addition to the drainage gas for civil gas and gas power generation, the Huaibei Mining Group has actively carried out research on the utilization technology of methane drainage by ventilation. On the one hand, it can save precious energy; on the other hand, it can protect the environment for people's survival. In 2007, the amount of coal mine gas drainage was 120 hm3; the rate of coal mine gas drainage was 44%. Compared with the year 2002, the amount of coal mine gas drainage increased by two times. Meanwhile, the utilization rate of gas increased rapidly.

  5. Scenarios to explore the futures of the emerging technology of organic and large area electronics

    OpenAIRE

    Parandian, Alireza; Rip, Arie

    2013-01-01

    Emerging technologies pose challenges for futures research because of their uncertainties combined with promises. Actors are anticipating and acting strategically. Sociotechnical scenarios building on endogenous futures support and enlighten actors. Such scenarios contribute to “strategic intelligence” about the technologies and their embedding in society. Organic and large area electronics promise to substitute silicon-based technologies, but firms and potential users are reluctant to invest...

  6. Space Design for the Acitc Educational technology Office Area Using a Workplace neighborhood Concept

    OpenAIRE

    Zhu, Ping

    1997-01-01

    Today, the workplace is undergoing dramatic changes, featuring increased team activities and informal interactions. The work place neighborhood is a design concept derived from a city planning theory that may solve the workplace design problems arising from these changes, and provided a focus for this project. The Educational Technology office area of the Advanced Communication and Information Technology Center...

  7. Atomically engineering Cu/Ta interfaces.

    Energy Technology Data Exchange (ETDEWEB)

    Webb, Edmund Blackburn, III (, Sandia National Laboratories, Albuquerque, NM); Zhou, Xiao Wang

    2007-09-01

    This report summarizes the major research and development accomplishments for the late start LDRD project (investment area: Enable Predictive Simulation) entitled 'Atomically Engineering Cu/Ta Interfaces'. Two ultimate goals of the project are: (a) use atomistic simulation to explore important atomistic assembly mechanisms during growth of Cu/Ta multilayers; and (b) develop a non-continuum model that has sufficient fidelity and computational efficiency for use as a design tool. Chapters 2 and 3 are essentially two papers that address respectively these two goals. In chapter 2, molecular dynamics simulations were used to study the growth of Cu films on (010) bcc Ta and Cu{sub x}Ta{sub 1-x} alloy films on (111) fcc Cu. The results indicated that fcc crystalline Cu films with a (111) texture are always formed when Cu is grown on Ta. The Cu films are always polycrystalline even when the Ta substrate is single crystalline. These polycrystalline films are composed of grains with only two different orientations, which are separated by either orientational grain boundaries or misfit dislocations. Periodic misfit dislocations and stacking fault bands are observed. The Cu film surface roughness was found to decrease with increasing adatom energy. Due to a Cu surface segregation effect, the Cu{sub x}Ta{sub 1-x} films deposited on Cu always have a higher Cu composition than that used in the vapor mixture. When Cu and Ta compositions in the films are comparable, amorphous structures may form. The fundamental origins for all these phenomena have been studied in terms of crystallography and interatomic interactions. In chapter 3, a simplified computational method, diffusional Monte Carlo (dMC) method, was developed to address long time kinetic processes of materials. Long time kinetic processes usually involve material transport by diffusion. The corresponding microstructural evolution of materials can be analyzed by kinetic Monte Carlo simulation methods, which

  8. [Brazilian technological output in the area of nursing: advances and challenges].

    Science.gov (United States)

    Koerich, Micheline Henrique Araujo da Luz; Vieira, Raquel Heloisa Guedes; Silva, Daniela Eda; Erdmann, Alacoque Lorenzini; Meirelles, Betina Horner Shlindwein

    2011-12-01

    This article aims to analyze the patents registered in the nursing area, since these patents may be used as an indicator of the technological development in the area. It presents and discusses national technological productions, tracked through the "nursing" keyword, patented in the period from 1990-2009. This is a retrospective documental research, using, as a source, data from the National Industrial Property Institute (INPI). The information gathered is discussed in relation to the appropriation of the technologies, the incentive to develop them and register them as a source of knowledge in the nursing field, aiming the practice of care. Light and light hard technology productions are increasing in the nursing field. However, these are not registered and patented. The technological advance in the nursing field is emergent and needs policies for its development.

  9. Dead Layer in a Ta/Ni81Fe19/Ta Structure

    Institute of Scientific and Technical Information of China (English)

    于广华; 任婷婷; 李明华; 朱逢吾; 姜宏伟; 赖武彦

    2002-01-01

    The effect of Ta seed layers and Ta cap layers on the effective magnetic thickness of ultrathin permalloy (Ni81 Fe19)was experimentally investigated for magnetic random access memory applications. The films were deposited by magnetron sputtering. For a Ta/Ni81Fe19/Ta fundamental structure, the Ta seed and Ta cap layers resulted in a loss of moment equivalent to a magnetically dead layer of thickness 1.6 ± 0.2 nm. In order to find the mechanism, the composition and chemical states at the interface regions of Ta/Ni81 Fe19 and Ni81 Fe19/Ta were studied using x-ray photoelectron spectroscopy and the peak decomposition technique. The results show that there are thermodynamically favourable reactions at the Ta/Ni81 Fe19 and Ni81Fe19/Ta interfaces: 2Ta + Ni = NiTa2.

  10. Technology strategy for cost-effective drilling and intervention; Technology Target Areas; TTA4 - Cost effective drilling and intervention

    Energy Technology Data Exchange (ETDEWEB)

    2007-07-01

    The main goals of the OG21 initiative are to (1) develop new technology and knowledge to increase the value creation of Norwegian oil and gas resources and (2) enhance the export of Norwegian oil and gas technology. The OG21 Cost-effective Drilling and Intervention (CEDI) Technology Target Area (TTA) has identified some key strategic drilling and well intervention needs to help meet the goals of OG21. These key strategic drilling and well intervention needs are based on a review of present and anticipated future offshore-Norway drilling and well intervention conditions and the Norwegian drilling and well intervention industry. A gap analysis has been performed to assess the extent to which current drilling and well intervention research and development and other activities will meet the key strategic needs. Based on the identified strategic drilling and well intervention needs and the current industry res each and development and other activities, the most important technology areas for meeting the OG21 goals are: environment-friendly and low-cost exploration wells; low-cost methods for well intervention/sidetracks; faster and extended-reach drilling; deep water drilling, completion and intervention; offshore automated drilling; subsea and sub-ice drilling; drilling through basalt and tight carbonates; drilling and completion in salt formation. More specific goals for each area: reduce cost of exploration wells by 50%; reduce cost for well intervention/sidetracks by 50%; increase drilling efficiency by 40%; reduce drilling cost in deep water by 40 %; enable offshore automated drilling before 2012; enable automated drilling from seabed in 2020. Particular focus should be placed on developing new technology for low-cost exploration wells to stem the downward trends in the number of exploration wells drilled and the volume of discovered resources. The CEDI TTA has the following additional recommendations: The perceived gaps in addressing the key strategic drilling and

  11. XPS analyses of Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films

    Energy Technology Data Exchange (ETDEWEB)

    Li Minghua, E-mail: mhli@ustb.edu.cn [Department of Material Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Han Gang; Liu Yang; Feng Chun; Wang Haicheng; Teng Jiao; Yu Guanghua [Department of Material Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China)

    2012-10-01

    Highlights: Black-Right-Pointing-Pointer Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films were prepared by magnetron sputtering. The anisotropic magnetoresistance (AMR) increases dramatically after annealing. Black-Right-Pointing-Pointer The chemical states of Ta and MgO{sub x} at the interface of the NiFe/MgO{sub x}/Ta films, which were prepared at the different technological conditions, were analyzed by X-ray photoelectron spectroscopy (XPS). Black-Right-Pointing-Pointer The AMR of Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films is related to the chemical states of MgO{sub x}. These states were produced under different technical conditions and influence the film properties. - Abstract: Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films were prepared by magnetron sputtering. The anisotropic magnetoresistance (AMR) increases dramatically after annealing. The chemical states of Ta and MgO{sub x} at the interface of the NiFe/MgO{sub x}/Ta films, which were prepared at the different technological conditions, were analyzed by X-ray photoelectron spectroscopy (XPS). The results show that the AMR of the films is related to the chemical states of MgO{sub x}. The chemical states of Mg are different when MgO{sub x} is prepared at different technological conditions. Therefore, increasing the AMR is beneficial when more Mg{sup 2+} ions are present in the MgO{sub x} films.

  12. Observation of 186mTa

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Unreported tantalum isomer 18mTa has been produced through the reaction 186W(n,p) by irradiation of natW with 14 MeV neutrons. The activity of 186Ta and 186Ta was measured using HPGe detectors and several X-γ as well as γ-γ coincidence arrangements. The 186mTa has been identified by means of measuring known γ rays from 186Ta p-decay. The half-life of 186mTa has been determined to be (1.5±0.1) min.

  13. Science and Technology of Food Storage and Preservation. Teaching of Science and Technology in Rural Areas.

    Science.gov (United States)

    Anand, V. V.; And Others

    Most science curriculum innovations seem to have their origins and emphases in urban intellectual concerns and their content generally caters to university bound students. The reason for the failure of rural students in science subjects may be the lack of relevancy of the program to the needs of individuals living in rural areas. This module deals…

  14. Solar Lighting Technologies for Highway Green Rest Areas in China: Energy Saving Economic and Environmental Evaluation

    Directory of Open Access Journals (Sweden)

    Xiaochun Qin

    2015-01-01

    Full Text Available In this paper, taking Lushan West Sea highway green rest area in Jiangxi Province of China as the case study, the suitable types, applicability, advantages, and effective methods of solar lighting technologies for highway rest area were determined based on the analysis of characteristics of highway green rest area. It was proved that solar lighting technologies including the natural light guidance system, solar LED lighting, and maximizing natural light penetration were quite suitable for highway rest area in terms of lighting effects and energy and economic efficiency. The illuminance comparison of light guidance system with electrical lighting was made based on the on-site experiment. Also, the feasibility of natural light guidance system was well verified in terms of the lighting demand of the visitor centre in the rest area by the illuminance simulation analysis. The evaluation of the energy saving, economic benefits, and environmental effects of solar lighting technologies for highway rest area was, respectively, made in detail. It was proved that the application of solar technology for green lighting of highway rest facilities not only could have considerable energy saving capacity and achieve high economic benefits, but also make great contributions to the reduction of environment pollution.

  15. Differences and similarities of energy innovation systems – comparison of five technology areas in Denmark

    DEFF Research Database (Denmark)

    Borup, Mads

    2016-01-01

    This paper presents a study of the energy innovation systems concerning five technology areas in Denmark: biomass energy, wind power, solar cells, fuel cells & hydrogen and energy efficiency technology. The study shows that the characteristics of the innovation systems differ significantly between...... the areas amongst other things concerning actor landscapes, market formations, and patterns of learning and interaction. This is despite the common context of Danish society and Danish energy systems, policy and institutions. An increase in maturity has appeared in some of the areas over the latest decades....... Along with the increase in maturity, a number of new challenges have appeared. Despite internationalization and open economies, the national, domestic level is of significant importance. The paper contributes to current research discussions on the context relations of technological innovation systems...

  16. INEEL Subsurface Disposal Area CERCLA-based Decision Analysis for Technology Screening and Remedial Alternative Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Parnell, G. S.; Kloeber, Jr. J.; Westphal, D; Fung, V.; Richardson, John Grant

    2000-03-01

    A CERCLA-based decision analysis methodology for alternative evaluation and technology screening has been developed for application at the Idaho National Engineering and Environmental Laboratory WAG 7 OU13/14 Subsurface Disposal Area (SDA). Quantitative value functions derived from CERCLA balancing criteria in cooperation with State and Federal regulators are presented. A weighted criteria hierarchy is also summarized that relates individual value function numerical values to an overall score for a specific technology alternative.

  17. Emerging Technologies and Techniques for Wide Area Radiological Survey and Remediation

    Energy Technology Data Exchange (ETDEWEB)

    Sutton, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Zhao, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-03-24

    Technologies to survey and decontaminate wide-area contamination and process the subsequent radioactive waste have been developed and implemented following the Chernobyl nuclear power plant release and the breach of a radiological source resulting in contamination in Goiania, Brazil. These civilian examples of radioactive material releases provided some of the first examples of urban radiological remediation. Many emerging technologies have recently been developed and demonstrated in Japan following the release of radioactive cesium isotopes (Cs-134 and Cs-137) from the Fukushima Dai-ichi nuclear power plant in 2011. Information on technologies reported by several Japanese government agencies, such as the Japan Atomic Energy Agency (JAEA), the Ministry of the Environment (MOE) and the National Institute for Environmental Science (NIES), together with academic institutions and industry are summarized and compared to recently developed, deployed and available technologies in the United States. The technologies and techniques presented in this report may be deployed in response to a wide area contamination event in the United States. In some cases, additional research and testing is needed to adequately validate the technology effectiveness over wide areas. Survey techniques can be deployed on the ground or from the air, allowing a range of coverage rates and sensitivities. Survey technologies also include those useful in measuring decontamination progress and mapping contamination. Decontamination technologies and techniques range from non-destructive (e.g., high pressure washing) and minimally destructive (plowing), to fully destructive (surface removal or demolition). Waste minimization techniques can greatly impact the long-term environmental consequences and cost following remediation efforts. Recommendations on technical improvements to address technology gaps are presented together with observations on remediation in Japan.

  18. Evaluation of Excitation Function for 182Ta

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>Present work concerns the evaluated neutron induced excitation function data for 182Ta, and mainly on (n, γ) reaction channel. The related experimental data were collected, analyzed and corrected for 182Ta

  19. Main: 1TA3 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1TA3 小麦 Bread Wheat Triticum aestivum Xylanase Inhibitor Protein I Precursor. Name=...479.1; -.|PDB; 1OM0; X-ray; A=31-304.|PDB; 1TA3; X-ray; A=-.|PDB; 1TE1; X-ray; A=...CGYPPAAHVGRALATGIFERAHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA wheat_1TA3.jpg ...

  20. Technology strategy for enhanced recovery; Technology Target Areas; TTA3 - enhanced recovery

    Energy Technology Data Exchange (ETDEWEB)

    2007-07-01

    The Norwegian Continental Shelf (NCS) is facing new challenges in reserve replacement and improved recovery in order to maintain the overall oil production rate from the area. A new target for an increase in oil reserves of 800 million Sm3 of oil (5 billion barrels) by year 2015 has been set by NPD. This is an ambitious goal considering several of the large fields are on a steep decline, and most of the recent discoveries are relatively small. A significant part of these increased reserves will have to come from fields currently on production, from reservoir areas that have been partly or fully swept, and it is therefore evident that Enhanced Oil Recovery (EOR) methods have to play a key role in achieving this target. EOR methods can be divided into gas based EOR methods and water based EOR methods. Thermal methods are not considered applicable on the NCS due to the relatively light oils present, and the depth of the reservoirs. Gas Based EOR; Water Based EOR; CO{sub 2} injection; Surfactants; Air injection; Polymer; Nitrogen injection; Alkaline; Flue gas injection; Polymer gels; WAG; MEOR; FAWAG. The former OG21 strategy document gave high priority to Water Alternating Gas (WAG) methods and CO{sub 2} injection for enhanced recovery. A lot of research and development and evaluation projects on CO{sub 2} injection were launched and are on-going, most of these are being CO{sub 2} WAG studies. The main challenge now in order to realize CO{sub 2} injection on the NCS is on CO{sub 2} availability and transport. It is also believed that increasing gas prices will limit the availability of hydrocarbon gas for injection purposes in the future. There is, however, a clear need for developing alternative cost efficient EOR methods that can improve the sweep efficiency significantly. Since a majority of the fields on the NCS are being produced under water flooding (or WAG), methods that can improve the water flooding efficiency by chemical additives are of special interest and

  1. Evaluation of Discrimination Technologies and Classification Results Live Site Demonstration: Former Waikoloa Maneuver Area

    Science.gov (United States)

    2015-06-01

    investigated to ensure that all TOI were recovered. 15. SUBJECT TERMS MetalMapper, UX -Analyze, UXO, Former Waikoloa Maneuver Area, discrimination...26 5.7 Munitions Debris Management ................................................................................. 27 6.0...conditions. • Investigate in cooperation with regulators and program managers how classification technologies can be implemented in munitions and

  2. Brokerage and SME Innovation: An Analysis of the Technology Transfer Service at Area Science Park, Italy

    Science.gov (United States)

    Cattapan, Paolo; Passarelli, Mariacarmela; Petrone, Michele

    2012-01-01

    This paper contributes to the literature on innovation brokerage by analysing the effects of brokerage activities on the innovation and growth of small and medium-sized enterprises (SMEs). The authors provide a detailed description of the Technology Transfer Service (TTS), credited as a European best-practice innovation broker, at Area Science…

  3. Brokerage and SME Innovation: An Analysis of the Technology Transfer Service at Area Science Park, Italy

    Science.gov (United States)

    Cattapan, Paolo; Passarelli, Mariacarmela; Petrone, Michele

    2012-01-01

    This paper contributes to the literature on innovation brokerage by analysing the effects of brokerage activities on the innovation and growth of small and medium-sized enterprises (SMEs). The authors provide a detailed description of the Technology Transfer Service (TTS), credited as a European best-practice innovation broker, at Area Science…

  4. The Identification of Technology Platforms and Innovation Areas with High Regional Impact

    Directory of Open Access Journals (Sweden)

    Nataša Urbančíková

    2011-10-01

    Full Text Available The paper is focused on the process of identification of the technological platforms and innovation areas with high regional impact. The aim is to discover future fields of technological innovation which are having a high qualitative and quantitative demand of high potentials. The research has been undertaken within project Innovative Development of European Areas by fostering transnational Knowledge Development – IDEA/ 2CE1175P1 funded by Central Europe Programme. The aim of IDEA project is the development of an adequate strategy which enables the small and medium sized enterprises in the regions of Central Europe to face the increasing demand of high potentials with tested methods and instruments. The target group of IDEA project are so called “high potentials” in the engineering and scientific sector where future-oriented technologies are one of the main sources of innovation.

  5. Potential Offshore Wind Energy Areas in California: An Assessment of Locations, Technology, and Costs

    Energy Technology Data Exchange (ETDEWEB)

    Musial, Walter [National Renewable Energy Lab. (NREL), Golden, CO (United States); Beiter, Philipp [National Renewable Energy Lab. (NREL), Golden, CO (United States); Tegen, Suzanne [National Renewable Energy Lab. (NREL), Golden, CO (United States); Smith, Aaron [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-12-01

    This report summarizes a study of possible offshore wind energy locations, technologies, and levelized cost of energy in the state of California between 2015 and 2030. The study was funded by the U.S. Department of the Interior's Bureau of Ocean Energy Management (BOEM), the federal agency responsible for regulating renewable energy development on the Outer Continental Shelf. It is based on reference wind energy areas where representative technology and performance characteristics were evaluated. These reference areas were identified as sites that were suitable to represent offshore wind cost and technology based on physical site conditions, wind resource quality, known existing site use, and proximity to necessary infrastructure. The purpose of this study is to assist energy policy decision-making by state utilities, independent system operators, state government officials and policymakers, BOEM, and its key stakeholders. The report is not intended to serve as a prescreening exercise for possible future offshore wind development.

  6. Mediating states in 180Ta

    OpenAIRE

    Alexa, Petr

    2002-01-01

    Possible theoretical electromagnetic paths between the ground state and the isomeric state at 75.3 keV in 180Ta are discussed in the framework of the two-quasiparticle-plus-phonon model and the standard axially-symmetric rotor model including Coriolis mixing. Experimental transition rates from the isomeric state to the ground state via observed mediating states are compared to the theoretical ones.

  7. Roles of TaON and Ta{sub 3}N{sub 5} in the visible-Fenton-like degradation of atrazine

    Energy Technology Data Exchange (ETDEWEB)

    Du, Yingxun, E-mail: yxdu@niglas.ac.cn; Zhao, Lu; Zhang, Yuanyuan

    2014-02-01

    Graphical abstract: - Highlights: • TaON exhibited higher photocatalytic activity than Ta{sub 3}N{sub 5}. • e{sub CB} is captured by either Fe{sup 3+} or H{sub 2}O{sub 2} and h{sub VB} could not oxidize atrazine. • ·OH, from the reduction of H{sub 2}O{sub 2} by Fe{sup 2+} or by e{sub CB}, is the active species. • By capturing e{sub CB}, H{sub 2}O{sub 2} was preferred to be reduced to H{sub 2}O than to ·OH. • TaON showed the higher separation efficiency of electrons and holes than Ta{sub 3}N{sub 5}. - Abstract: In this study, the roles of TaON and Ta{sub 3}N{sub 5} in the degradation of atrazine by the visible-Fenton-like system were examined in detail. The TaON and Ta{sub 3}N{sub 5} samples prepared by the nitridation of Ta{sub 2}O{sub 5} and characterized by XRD, DRS, BET and PL analyses. The results showed that the TaON sample had weaker absorption in the visible region but higher specific surface area than the Ta{sub 3}N{sub 5} sample. The degradation rate of atrazine in visible-TaON-Fenton-like system was 2.64 times than that in visible-Ta{sub 3}N{sub 5}-Fenton-like system. Both Fe{sup 2+} and H{sub 2}O{sub 2} could be reduced by e{sub CB} (electrons in the conduction band) in TaON or Ta{sub 3}N{sub 5}, while atrazine could not be oxidized by h{sub VB} (holes in the valance band). ·OH is the active species for the degradation of atrazine in visible-TaON/Ta{sub 3}N{sub 5}-Fenton-like systems. Majority of ·OH originated from Fenton reaction. After Fe{sup 3+} was reduced by e{sub CB} to Fe{sup 2+}, Fe{sup 2+} reacted quickly with H{sub 2}O{sub 2} to generate ·OH. In addition, by capturing e{sub CB}, a little of H{sub 2}O{sub 2} was reduced to yield ·OH, which contributed a small fraction of atrazine degradation. Based on the experimental results, the roles of TaON and Ta{sub 3}N{sub 5} in the visible-Fenton-like system were proposed. And the higher photocatalytic activity of TaON than Ta{sub 3}N{sub 5} was suggested to be due to the higher

  8. Study of monitoring mining subsidence in coal mining area by D-InSAR technology

    Institute of Scientific and Technical Information of China (English)

    PEI Liang; LI Wen-jie; TAN Yang

    2008-01-01

    Along with the increasing demand for coal and the great importance attached to mine safety, gaining the information of mine surface distortion timely has already become an urgent need to guarantee the safety of mine production. D-InSAR technology is a new measure which can provide the information of surface distortion in mining areas at centi-meter level through the processing of SAR image gained from radar satellite. In addition, this technology has the advantage of monitoring large areas with no weather limit. Intro-duced the basic principle and data processing steps of D-InSAR systematically and ac-quired the differential interferometry based on case study data. The advantages of D-InSAR and it's usability in monitoring mining subsidence in coal mining areas were proved.

  9. Study of monitoring mining subsidence in coal mining area by D-InSAR technology

    Institute of Scientific and Technical Information of China (English)

    PEI Liang; LI Wen-jie; TAN Yang

    2008-01-01

    Along with the increasing demand for coal and the great importance attached to mine safety,gaining the information of mine surface distortion timely has already become an urgent need to guarantee the safety of mine production.D-InSAR technology is a new measure which can provide the information of surface distortion in mining areas at centimeter level through the processing of SAR image gained from radar satellite.In addition,this technology has the advantage of monitoring large areas with no weather limit.Introduced the basic principle and data processing steps of D-InSAR systematically and acquired the differential interferometry based on case study data.The advantages of D-InSAR and it's usability in monitoring mining subsidence in coal mining areas were proved.

  10. An Interim Report on NASA's Draft Space Technology Roadmaps

    Science.gov (United States)

    2011-01-01

    NASA has developed a set of 14 draft roadmaps to guide the development of space technologies under the leadership of the NASA Office of the Chief Technologist (OCT). Each of these roadmaps focuses on a particular technology area (TA). The roadmaps are intended to foster the development of advanced technologies and concepts that address NASA's needs and contribute to other aerospace and national needs. OCT requested that the National Research Council conduct a study to review the draft roadmaps, gather and assess relevant community input, and make recommendations and suggest priorities to inform NASA's decisions as it finalizes its roadmaps. The statement of task states that "based on the results of the community input and its own deliberations, the steering committee will prepare a brief interim report that addresses high-level issues associated with the roadmaps, such as the advisability of modifying the number or technical focus of the draft NASA roadmaps." This interim report, which does not include formal recommendations, addresses that one element of the study charge. NASA requested this interim report so that it would have the opportunity to make an early start in modifying the draft roadmaps based on feedback from the panels and steering committee. The final report will address all other tasks in the statement of task. In particular, the final report will include a prioritization of technologies, will describe in detail the prioritization process and criteria, and will include specific recommendations on a variety of topics, including many of the topics mentioned in this interim report. In developing both this interim report and the final report to come, the steering committee draws on the work of six study panels organized by technical area, loosely following the organization of the 14 roadmaps, as follows: A Panel 1: Propulsion and Power TA01 Launch Propulsion Systems TA02 In-Space Propulsion Technologies TA03 Space Power and Energy Storage Systems TA13

  11. Defense Technology Objectives of the Joint Warfighting Science and Technology Plan and the Defense Technology Area Plan.

    Science.gov (United States)

    1997-01-01

    captive flight tests (CFTs); in FY98, demonstrating an integrated man- portable fire control system; and in FY99, conducting all-up-round demonstrations...program will con- duct captive -carry and live-fire IR missile tests verses a full-up IRCM suite, demonstrating (1) end-to-end IR countermeasure...area of data coverage. Orca , NAVOCEANO’s ROV, is used to gather bathymetric data. In cost effectiveness, Orca costs about $1.6 million, versus a T-AGS

  12. TA/TA list planning principles of TD-LTE system%TD-LTE系统TA及TA list规划原则

    Institute of Scientific and Technical Information of China (English)

    吕邦国; 于涛

    2013-01-01

      Firstly the TD-LTE system location area management mechanism is introduced in this paper. Secondly this paper analyzes the network paging mechanism, paging capacity according to the TD-LTE system capabilities and the current TD-LTE device performance. Lastly, by predicting the number of users as well as LTE cell single-user paging model, the TA/TA list planning principles and recommendations are given in this paper.%  本文首先介绍了TD-LTE系统位置区的管理机制,其次从TD-LTE系统能力以及目前TD-LTE设备性能等角度,分析了TD-LTE网络的寻呼机制和寻呼容量,最后通过预测LTE小区的用户数目以及单用户寻呼模型,给出了TA/TA list的规划原则和建议。

  13. Magnetic property and interface structure of Ta/NiO/NiFe/Ta

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Ta/NiO/NiFe/Ta multilayers, utilizing Ta as buffer layer, were prepared by rf reactive and dc magnetron sputtering. The exchange coupling field between NiO and NiFe reached a maximum value of 9.6×103 A/m at a NiO film thickness of 50 nm. The composition and chemical states at interface region of Ta/NiO/Ta were studied by using the X-ray photoelectron spectroscopy (XPS) and peak decomp- osition technique. The results show that there is an "inter- mixing layer" at the Ta/NiO (and NiO/Ta) interface due to a thermodynamically favorable reaction 2Ta + 5NiO = 5Ni + Ta2O5. This interface reaction has a great effect on exchange coupling. The thickness of Ni+NiO estimated by XPS depth- profiles is about 8-10 nm.

  14. NASA Space Technology Draft Roadmap Area 13: Ground and Launch Systems Processing

    Science.gov (United States)

    Clements, Greg

    2011-01-01

    This slide presentation reviews the technology development roadmap for the area of ground and launch systems processing. The scope of this technology area includes: (1) Assembly, integration, and processing of the launch vehicle, spacecraft, and payload hardware (2) Supply chain management (3) Transportation of hardware to the launch site (4) Transportation to and operations at the launch pad (5) Launch processing infrastructure and its ability to support future operations (6) Range, personnel, and facility safety capabilities (7) Launch and landing weather (8) Environmental impact mitigations for ground and launch operations (9) Launch control center operations and infrastructure (10) Mission integration and planning (11) Mission training for both ground and flight crew personnel (12) Mission control center operations and infrastructure (13) Telemetry and command processing and archiving (14) Recovery operations for flight crews, flight hardware, and returned samples. This technology roadmap also identifies ground, launch and mission technologies that will: (1) Dramatically transform future space operations, with significant improvement in life-cycle costs (2) Improve the quality of life on earth, while exploring in co-existence with the environment (3) Increase reliability and mission availability using low/zero maintenance materials and systems, comprehensive capabilities to ascertain and forecast system health/configuration, data integration, and the use of advanced/expert software systems (4) Enhance methods to assess safety and mission risk posture, which would allow for timely and better decision making. Several key technologies are identified, with a couple of slides devoted to one of these technologies (i.e., corrosion detection and prevention). Development of these technologies can enhance life on earth and have a major impact on how we can access space, eventually making routine commercial space access and improve building and manufacturing, and weather

  15. Area- and energy-efficient CORDIC accelerators in deep sub-micron CMOS technologies

    Science.gov (United States)

    Vishnoi, U.; Noll, T. G.

    2012-09-01

    The COordinate Rotate DIgital Computer (CORDIC) algorithm is a well known versatile approach and is widely applied in today's SoCs for especially but not restricted to digital communications. Dedicated CORDIC blocks can be implemented in deep sub-micron CMOS technologies at very low area and energy costs and are attractive to be used as hardware accelerators for Application Specific Instruction Processors (ASIPs). Thereby, overcoming the well known energy vs. flexibility conflict. Optimizing Global Navigation Satellite System (GNSS) receivers to reduce the hardware complexity is an important research topic at present. In such receivers CORDIC accelerators can be used for digital baseband processing (fixed-point) and in Position-Velocity-Time estimation (floating-point). A micro architecture well suited to such applications is presented. This architecture is parameterized according to the wordlengths as well as the number of iterations and can be easily extended for floating point data format. Moreover, area can be traded for throughput by partially or even fully unrolling the iterations, whereby the degree of pipelining is organized with one CORDIC iteration per cycle. From the architectural description, the macro layout can be generated fully automatically using an in-house datapath generator tool. Since the adders and shifters play an important role in optimizing the CORDIC block, they must be carefully optimized for high area and energy efficiency in the underlying technology. So, for this purpose carry-select adders and logarithmic shifters have been chosen. Device dimensioning was automatically optimized with respect to dynamic and static power, area and performance using the in-house tool. The fully sequential CORDIC block for fixed-point digital baseband processing features a wordlength of 16 bits, requires 5232 transistors, which is implemented in a 40-nm CMOS technology and occupies a silicon area of 1560 μm2 only. Maximum clock frequency from circuit

  16. Design and Implementation of Area Optimized, Low Complexity CMOS 32nm Technology Based NCO

    Directory of Open Access Journals (Sweden)

    Miss. Amruta Upase

    2017-05-01

    Full Text Available A numerically controlled oscillator (NCO is a digital signal generator which is a very important block in many Digital Communication Systems such as Software Defined Radios, Digital Radio set and Modems, Down/Up converters for Cellular and PCS base stations etc. NCO creates a synchronous, discrete-time, discrete-valued representation of a sinusoidal waveform. This paper implements the development and design of CMOS look up Table based numerically controlled oscillator which improves the performance, reduces the power & area requirement. The design is implemented with CMOS 32 nm Technology with Microwind 3.8 software tool. In addition, it can be used for analog circuit also enables the integration of complete system on chip. This paper also describes the design of a NCO which is of contemporary nature with reasonable speed, resolution and linearity with lower power, low area. For all about Pre Layout simulation has been realized using 32nm CMOS process Technology.

  17. Polymer and Concentrator Photovoltaic Technologies - Energy Return Factors and Area Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Loefgren, Birger; Gustaf Zettergren

    2006-12-20

    Market diffusion of flat plate crystalline silicon photovoltaic (PV) technology has been induced by economical support schemes and has lead to reduced cost per produced kWh electricity. For further market penetration of the PV technology, a continued reduction of production cost is required. Two alternative approaches to achieve this are using less expensive materials or changing the active materials. The technologies of concentrator PV (CPV) systems and polymer PV (PPV) devices represent these two strategies. The potential energy performance of these technologies is studied in terms of the process primary energy requirements for manufacturing, how many times this energy is paid back during its lifetime and as the required land area for electricity generation. The study is an energy analysis incorporating the inherent uncertainties in technology development. Uncertainties are identified in data acquisition, in design choices, as induced by development and improvement, in performance and by different application scenarios. The future technology alternatives are defined in different ways for CPV and PPV. CPV parameters are derived from existing products and ideas for improvements and PPV parameters from the directions of research. This study shows that the invested energy in future CPV and PPV is potentially paid back up to about 90 and 170 times, respectively, under Arizona (CPV) and average European (PPV) solar irradiation conditions. However the result is highly dependent on configuration, inventory data and device performance. Thus, for certain design alternatives, data and performance, PPV production energy is far from paid back during its lifetime. For CPV the energy return factor is decreased to about 13 in the least beneficial case. Area efficiency is studied as the land area requirements for producing a net output electricity of 1 MWh during 25 years. With device efficiencies from 1 to 5 per cent and lifetimes from 1 to 5 years a PPV device requires from 2

  18. [Nonpoint pollution control for rural areas of China with ecological engineering technologies].

    Science.gov (United States)

    Yin, Chengqing; Mao, Zhanpo

    2002-02-01

    Nonpoint pollution from rural areas is the results of the ecosystem degradation, and ecological engineering technologies are good ways for the restoration of watershed and enhancing material cycling. There are two types of treatment strategies: to control the polluted runoff and to reduce the pollutants from the sources. Six control technologies are introduced and they are multipond systems, grassed filter trips, wetland systems, eco-agriculture, slope ecological engineering, ecological treatment of wastewater and solid waste. These technologies need to be combined systematically in order to form a watershed ecological engineering. In the control program, it is important to use countermeasure suitable to the local conditions. In addition, the input of sufficient investment, management and education is necessary.

  19. Tanks Focus Area retrieval process development and enhancements FY96 technology development summary report

    Energy Technology Data Exchange (ETDEWEB)

    Rinker, M.W.; Bamberger, J.A.; Hatchell, B.K. [and others

    1996-09-01

    The Retrieval Process Development and Enhancements (RPD&E) activities are part of the Retrieval and Closure Program of the U.S. Department of Energy (DOE) EM-50 Tanks Focus Area. The purposes of RPD&E are to understand retrieval processes, including emerging and existing technologies, and to gather data on those processes, so that end users have the requisite technical basis to make retrieval decisions. Work has been initiated to support the need for multiple retrieval technologies across the DOE complex. Technologies addressed during FY96 focused on enhancements to sluicing, borehole mining, confined sluicing retrieval end effectors, the lightweight scarifier, and pulsed air mixing. Furthermore, a decision tool and database have been initiated to link retrieval processes with tank closure to assist end users in making retrieval decisions.

  20. Technology of fiber-optic temperature sensing and its application in temperature measuring of gob area

    Institute of Scientific and Technical Information of China (English)

    LIU Jing-wen; HUANG Li-ming

    2011-01-01

    Based on advantages of technology of distributive fiber-optic temperature sensing and specific to its applications in monitoring mine conflagration, the corresponding Processes such as connection arrangement, signal transmission and monitoring were illustrated. As applied in Sitai Coal Mine of Datong Coal Mine Group Co., this method is effective and accurate and could provide reliable gist for monitoring spontaneous combustion in gob area of mines.

  1. Stormwater Pollution Prevention Plan TA-60 Asphalt Batch Plant Revision 2: January 2017

    Energy Technology Data Exchange (ETDEWEB)

    Sandoval, Leonard Frank [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-01

    The Stormwater Pollution Prevention Team (PPT) is applicable to operations at the Technical Area (TA)- 60 Asphalt Batch Plant (ABP) located on Eniwetok Drive/Sigma Mesa, in Los Alamos County, New Mexico at Los Alamos National Laboratory (LANL).

  2. The Application Study in Solar Energy Technology for Highway Service Area: A Case Study of West Lushan Highway Low-Carbon Service Area in China

    Directory of Open Access Journals (Sweden)

    Xiaochun Qin

    2015-01-01

    Full Text Available A lot of research works have been made concerning highway service area or solar technology and acquired great achievements. However, unfortunately, few works have been made combining the two topics together of highway service areas and solar energy saving to make a systemic research on solar technology application for highway service area. In this paper, taking West Lushan highway low-carbon service area in Jiangxi Province of China as the case study, the advantages, technical principles, and application methods of solar energy technology for highway service area including solar photoelectric technology and solar water heating technology were discussed based on the analysis of characteristics of highway low-carbon service area; the system types, operation mode, and installing tilt angle of the two kinds of solar systems suitable for highway service areas were confirmed. It was proved that the reduction of the cost by electricity savings of solar system was huge. Taking the investment of the solar systems into account, the payback period of solar photoelectric systems and solar water heating systems was calculated. The economic effect of the solar systems in West Lushan highway service area during the effective operation periods was also calculated and proved very considerable.

  3. Technology and entrepreneurial orientation at the organisational level in the Johannesburg area

    Directory of Open Access Journals (Sweden)

    Boris Urban

    2010-03-01

    Full Text Available Orientation: The 21st century is tilting towards an economy that is primarily driven by technology and knowledge, where entrepreneurs have to recognise and anticipate high-technology opportunities so as to join the ranks of future entrepreneurial leaders.Research purpose: This study examines entrepreneurship and its relation with technology, which is often conceptualised as entrepreneurial orientation (EO and technology orientation (TO. The study is further contextualised by measuring environmental dynamism and hostility.Motivation for the study: Despite the weight of positive empirical findings and observations that EO and TO are strategic imperatives, there is a danger that firms in Africa are lagging behind and subsequently a study of this nature aids in understanding these imperatives.Research design, approach and method: A survey is used to collect data from a population of diverse businesses in the Johannesburg area (n = 1600, yielding a sample of 236 firms. Instruments were subjected to principal component factor analysis and descriptive statistics were calculated. The hypotheses were tested using correlational analysis, with their significance reported in terms of Pearson correlation coefficients.Main finding: Findings reveal significant correlations between EO and environment hostility and dynamism, but not between EO and TO.Practical and managerial implications: The study offers some solutions towards understanding how TO and EO may promote firm innovation, which encourages the diffusion, adoption and application of the very latest technologies. This is particularly relevant in cases where a lot of potential exists in developing countries to ‘import and adapt’ technologies developed in industrialised countries.Contribution of study: Research on firm innovation in the African context may be considered valuable, as very few empirical studies that have been conducted previously focus on innovation and technology in the context of an

  4. 78 FR 28627 - TA-W-80,340; TA-W-80,340A; TA-W-80,340B

    Science.gov (United States)

    2013-05-15

    ... Employment and Training Administration TA-W-80,340; TA-W-80,340A; TA-W-80,340B] Bush Industries, Inc., Mason... (TA-W-80,340) and Bush Industries, Inc., Allen Street Facility, Jamestown, New York (TA-W- 80,340A... the subject firm's Erie, Pennsylvania facility. The amended notice applicable to TA-W-80,340 is...

  5. Feasibility of water purification technology in rural areas of developing countries.

    Science.gov (United States)

    Johnson, Dana M; Hokanson, David R; Zhang, Qiong; Czupinski, Kevin D; Tang, Jinxian

    2008-08-01

    Water scarcity is threatening social and economic growth in rural areas of developing countries. There are potential markets for water purification technologies in these regions. The main focus of this article is to evaluate the social, economic and political feasibilities of providing water purification technologies to rural areas of developing countries. The findings of this research can serve as the basis for private investors interested in entering this market. Four representative regions were selected for the study. Economic, demographic, and environmental variables of each region were collected and analyzed along with domestic markets and political information. Rural areas of the developing world are populated with poor people unable to fulfill the basic needs for clean water and sanitation. These people represent an important group of potential users. Due to economic, social, and political risks in these areas, it is difficult to build a strong case for any business or organization focusing on immediate returns on capital investment. A plausible business strategy would be to approach the water purification market as a corporate responsibility and social investing in the short term. This would allow an organization to be well positioned once the economic ability of individuals, governments, and donor agencies are better aligned.

  6. Problems of teaching students to use the featured technologies in the area of semantic web

    Science.gov (United States)

    Klimov, V. V.; Chernyshov, A. A.; Balandina, A. I.; Kostkina, A. D.

    2017-01-01

    The following paper contains the description of up-to-date technologies in the area of web-services development, service-oriented architecture and the Semantic Web. The paper contains the analysis of the most popular and widespread technologies and methods in the semantic web area which are used in the developed educational course. In the paper, we also describe the problem of teaching students to use these technologies and specify conditions for the creation of the learning and development course. We also describe the main exercise for personal work and skills, which all the students learning this course have to gain. Moreover, in the paper we specify the problem with software which students are going to use while learning this course. In order to solve this problem, we introduce the developing system which will be used to support the laboratory works. For this moment this system supports only the fourth work execution, but our following plans contain the expansion of the system in order to support the leftover works.

  7. Areas Of Priority Development And Technological Changes In The Russian Economy

    Directory of Open Access Journals (Sweden)

    Andrey Prigulnyy

    2012-12-01

    Full Text Available To confirm the status of the post-industrial power, Russia must ensure faster growth of the economy based on razvivitiya scientific and technological capacity. The author of the opinion, according to which Russia should pursue a strategy that takes into account the possibility of commercialization of scientific and technological achievements of world level. Own results in the field of research and development activities are open, according to the author, the term technological cooperation with foreign companies, including in the area of commercialization of belonging to different parties, but complementary discoveries. To solve the problem of advanced development proposed strategies: leadership, catch-up, ahead of commercialization. According to the author, the greatest realism is different anticipatory strategy for commercialization of scientific and technical developments. This strategy can be implemented on the basis of public-private partnerships with innovative companies, mastering the "breakthrough" technology with state support. This will reduce the risk of private investment in the new production, increase the participation of private capital in the development of research and development, strengthen the links between science and industry, state action to shift towards support for projects involving the leadership of the domestic manufacturer of innovative products.

  8. Technology strategy for integrated operations and real time reservoir management; Technology Target Areas; TTA5 - Integrated operations and RTRM

    Energy Technology Data Exchange (ETDEWEB)

    2007-07-01

    In Norway Integrated Operations (IO) is a concept which in the first phase (G1) has been used to describe how to integrate processes and people onshore and offshore using ICT solutions and facilities that improve onshore's ability to support offshore operationally. The second generation (G2) Integrated Operations aims to help operators utilize vendors' core competencies and services more efficiently. Utilizing digital services and vendor products, operators will be able to update reservoir models, drilling targets and well trajectories as wells are drilled, manage well completions remotely, optimize production from reservoir to export lines, and implement condition-based maintenance concepts. The total impact on production, recovery rates, costs and safety will be profound. When the international petroleum business moves to the Arctic region the setting is very different from what is the case on the Norwegian Continental Shelf (NCS) and new challenges will arise. The Norwegian Ministry of Environment has recently issued an Integrated Management Plan for the Barents Sea where one focus is on 'Monitoring of the Marine Environment in the North'. The Government aims to establish a new and more coordinated system for monitoring the marine ecosystems in the north. A representative group consisting of the major Operators, the Service Industry, Academia and the Authorities have developed the enclosed strategy for the OG21 Integrated Operations and Real Time Reservoir Management (IO and RTRM) Technology Target Area (TTA). Major technology and work process research and development gaps have been identified in several areas: Bandwidth down-hole to surface; Sensor development including Nano-technology; Cross discipline use of Visualisation, Simulation and model development particularly in Drilling and Reservoir management areas; Software development in terms of data handling, model updating and calculation speed; Enabling reliable and robust communications

  9. Wastewater collection and treatment technologies for semi-urban areas of India: a case study.

    Science.gov (United States)

    Sundaravadivel, M; Vigneswaran, S

    2001-01-01

    Sanitation and wastewater management problems in small and medium towns in India (referred to as "semi-urban areas"--SUAs) are distinctly different from those of large cities or rural villages. There is an apparent lack of choices of appropriate sanitation options for these semi-urban areas, leading them to adopt on-site sanitation technologies. A field study of four such small towns in India was conducted to evaluate the suitability of available low-cost wastewater collection and treatment technologies, in light of their current practice. Based on the field study, this paper suggests a system comprising "combined surface sewers" and "reed-bed channel" for collection and treatment of wastewater for semi-urban areas, that can utilize all the existing infrastructure to effect better sanitation at lower costs. The suggested system involves converting the existing open wastewater collection drains on the road sides, as "decentralized" networks of covered drains with simple structural modifications to collect both wastewater and stormwater; and, converting the large open drains on the outskirts of SUAs that carry wastewater to agricultural fields, as gravel media filled beds planted with local reeds. Cost estimates for the towns studied indicate this system to be over 70% cheaper compared to conventional collection and treatment systems.

  10. TA-55 and Sigma Overview

    Energy Technology Data Exchange (ETDEWEB)

    Spearing, Dane Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Safeguards Science and Technology Group (NEN-1)

    2016-11-29

    These are slides from a facility overview presentation for visiting agencies to Los Alamos National Laboratory (LANL). The TA-55 Plutonium Facility (PF-4) is discussed in detail. PF-4 is a unique resource for US plutonium programs. The basic design is flexible and has adapted to changing national needs. It is a robust facility with strong safety and security implementation. It supports a variety of national programs. It will continue for many years into the future. Sigma is then discussed in detail, which handles everything from hydrogen to uranium. It has been in long term service to the Nation (nearly 60 years). It has a flexible authorization basis to handle almost the entire periodic table. It has a wide breadth of prototyping and characterization capabilities. It has integrated program and line management.

  11. Large area SiC coating technology of RBSC for semiconductor processing component

    Energy Technology Data Exchange (ETDEWEB)

    Park, Ji Yeon; Kim, Weon Ju

    2001-06-01

    As the semiconductor process is developed for the larger area wafer and the larger-scale integration, the processing fixtures are required to have excellent mechanical and high temperature properties. This highlights the importance of silicon carbide-based materials as a substitute for quartz-based susceptors. In this study, SiC coating technology on reaction sintered (RS) SiC with thickness variation of +/- 10% within a diameter of 8 inch by low pressure chemical vapor deposition has been developed for making a plate type SiC fixture such as heater, baffle, etc., with a diameter of 12 inch. Additionally, a state of art on fabrication technology and products of the current commercial SiC fixtures has been described.

  12. TaSYP71, a Qc-SNARE, Contributes to Wheat Resistance against Puccinia striiformis f. sp. tritici

    Directory of Open Access Journals (Sweden)

    Minjie eLiu

    2016-04-01

    Full Text Available N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs are involved in plant resistance; however, the role of SYP71 in the regulation of plant–pathogen interactions is not well known. In this study, we characterized a plant-specific SNARE in wheat, TaSYP71, which contains a Qc-SNARE domain. Three homologues are localized on chromosome 1AL, 1BL and 1DL. Using Agrobacterium-mediated transient expression, TaSYP71 was localized to the plasma membrane in Nicotiana benthamiana. Quantitative real-time PCR assays revealed that TaSYP71 homologues was induced by NaCl, H2O2 stress and infection by virulent and avirulent Puccinia striiformis f. sp. tritici (Pst isolates. Heterologous expression of TaSYP71 in Schizosaccharomyces pombe elevated tolerance to H2O2. Meanwhile, H2O2 scavenging gene (TaCAT was downregulated in TaSYP71 silenced plants treated by H2O2 compared to that in control, which indicated that TaSYP71 enhanced tolerance to H2O2 stress possibly by influencing the expression of TaCAT to remove the excessive H2O2 accumulation. When TaSYP71 homologues were all silenced in wheat by the virus-induced gene silencing system, wheat plants were more susceptible to Pst, with larger infection area and more haustoria number, but the necrotic area of wheat mesophyll cells were larger, one possible explanation that minor contribution of resistance to Pst was insufficient to hinder pathogen extension when TaSYP71were silenced, and the necrotic area was enlarged accompanied with the pathogen growth. Of course, later cell death could not be excluded. In addition, the expression of pathogenesis-related genes were down-regulated in TaSYP71 silenced wheat plants. These results together suggest that TaSYP71 play a positive role in wheat defence against Pst.

  13. [Visions and strategies in the European research area. "Technology for the Information Society"].

    Science.gov (United States)

    Gillessen, F

    2002-01-01

    A new generation of EU research is expected to take life at the end of 2002. One of the new elements of the Sixth Framework Programme (FP6), which is essential for the realisation of the European Research Area (ERA), will be the use of new instruments for funding research, such as Integrated Projects (IP) and Networks of Excellence (NoE). Integrated Projects will contribute to strengthening European competitiveness and solve major societal problems, by mobilising a critical mass of research and development resources and skills existing in Europe. Networks of Excellence will contribute to strengthening European scientific and technological excellence though a better integration of research capacities across Europe.

  14. Issues for reuse of gloveboxes at LANL TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Cadwallader, L.C.; Pinson, P.A.; Miller, C.F.

    1998-08-01

    This report is a summary of issues that face plutonium glovebox designers and users at the Los Alamos National Laboratory (LANL) Technical Area 55 (TA-55). Characterizing the issues is a step in the task of enhancing the next generation glovebox design to minimize waste streams while providing the other design functions. This report gives an initial assessment of eight important design and operation issues that can benefit from waste minimization.

  15. Issues for reuse of gloveboxes at LANL TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Cadwallader, L.C.; Pinson, P.A.; Miller, C.F.

    1998-08-01

    This report is a summary of issues that face plutonium glovebox designers and users at the Los Alamos National Laboratory (LANL) Technical Area 55 (TA-55). Characterizing the issues is a step in the task of enhancing the next generation glovebox design to minimize waste streams while providing the other design functions. This report gives an initial assessment of eight important design and operation issues that can benefit from waste minimization.

  16. Model of areas for identifying risks influencing the compliance of technological processes and products

    Science.gov (United States)

    Misztal, A.; Belu, N.

    2016-08-01

    Operation of every company is associated with the risk of interfering with proper performance of its fundamental processes. This risk is associated with various internal areas of the company, as well as the environment in which it operates. From the point of view of ensuring compliance of the course of specific technological processes and, consequently, product conformity with requirements, it is important to identify these threats and eliminate or reduce the risk of their occurrence. The purpose of this article is to present a model of areas of identifying risk affecting the compliance of processes and products, which is based on multiregional targeted monitoring of typical places of interference and risk management methods. The model is based on the verification of risk analyses carried out in small and medium-sized manufacturing companies in various industries..

  17. Characterizing gas shaly sandstone reservoirs using the magnetic resonance technology in the Anaco area, East Venezuela

    Energy Technology Data Exchange (ETDEWEB)

    Fam, Maged; August, Howard [Halliburton, Houston, TX (United States); Zambrano, Carlos; Rivero, Fidel [PDVSA Gas (Venezuela)

    2008-07-01

    With demand for natural gas on the rise every day, accounting for and booking every cubic foot of gas is becoming very important to operators exploiting natural gas reservoirs. The initial estimates of gas reserves are usually established through the use of petrophysical parameters normally based on wireline and/or LWD logs. Conventional logs, such as gamma ray, density, neutron, resistivity and sonic, are traditionally used to calculate these parameters. Sometimes, however, the use of such conventional logs may not be enough to provide a high degree of accuracy in determining these petrophysical parameters, which are critical to reserve estimates. Insufficient accuracy can be due to high complexities in the rock properties and/or a formation fluid distribution within the reservoir layers that is very difficult to characterize with conventional logs alone. The high degree of heterogeneity in the shaly sandstone rock properties of the Anaco area, East Venezuela, can be characterized by clean, high porosity, high permeability sands to very shaly, highly laminated, and low porosity rock. This wide variation in the reservoir properties may pose difficulties in identifying gas bearing zones which may affect the final gas reserves estimates in the area. The application of the magnetic resonance imaging (MRI) logging technology in the area, combined with the application of its latest acquisition and interpretation methods, has proven to be very adequate in detecting and quantifying gas zones as well as providing more realistic petrophysical parameters for better reserve estimates. This article demonstrates the effectiveness of applying the MRI logging technology to obtain improved petrophysical parameters that will help better characterize the shaly-sands of Anaco area gas reservoirs. This article also demonstrates the value of MRI in determining fluid types, including distinguishing between bound water and free water, as well as differentiating between gas and liquid

  18. Stoichiometry behavior of TaN, TaCN and TaC thin films produced by magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Vargas, M. [Centro de Nanociencia y Nanotecnología, Universidad Nacional Autónoma de México, A.P. 2681, C.P. 22860, Ensenada, B.C. (Mexico); Castillo, H.A. [Centro de Enseñanza Técnica y Superior, CETYS Universidad, Campus Tijuana, Tijuana, B.C. (Mexico); Restrepo-Parra, E., E-mail: erestrepopa@unal.edu.co [Universidad Nacional de Colombia Sede Medellín Colombia, Facultad de Minas, Manizales (Colombia); De La Cruz, W. [Centro de Nanociencia y Nanotecnología, Universidad Nacional Autónoma de México, A.P. 2681, C.P. 22860, Ensenada, B.C. (Mexico)

    2013-08-15

    Thin films were synthesized in a magnetron sputtering system using a target of Ta with 99.99% purity and silicon substrates (1 1 1). The gases used for the film growth were (Ar + N{sub 2}), (Ar + CH{sub 4} + N{sub 2}) and (Ar + CH{sub 4}) mixtures for TaN, TaCN and TaC, respectively. The substrate temperature increased from room temperature to 500 °C. The chemical composition and bonding configuration were examined using X-ray photoelectron spectroscopy (XPS), revealing Ta-N, Ta-C-N, Ta-C and C-C bonds. Moreover, the crystallographic structure was analyzed using X-ray diffraction (XRD), indicating the presence of (1 1 1) and (2 0 0) planes belonging to a face-centered cubic structure. The stoichiometry variation dependence on the CH{sub 4} and N{sub 2} flow was analyzed, and the influence of the substrate temperature on the coatings was investigated. Finally, scanning electron microscopy (SEM) was used to determine the evolution on the grain formation in the coatings as the substrate temperature increased.

  19. Technology strategy for deepwater and subsea production systems 2008 update; Technology Target Areas; TTA7 - Deep water and subsea prodution technology

    Energy Technology Data Exchange (ETDEWEB)

    2008-07-01

    Executive summary 'Deepwater and Subsea Production Systems' has been identified as one of the eight new Technology Target Areas (TTAs) in Norway's technology strategy for the Oil and Gas sector. This TTA covers deepwater floating production systems, subsea systems (except subsea processing technologies which are addressed by TTA6) and arctic development systems (in both shallow and deepwater). The total hydrocarbon reserves worldwide, which are enabled by the technologies under this TTA exceed 400 billion boe which, itself exceeds the proven reserves of Saudi Arabia. For deepwater developments the long term technical challenge is to develop flexible and adaptive systems which are better able to cope with subsurface uncertainties e.g. compartmentalisation and provide required access to the reservoir to enable successful recovery. More specific medium term challenges relate to developing solutions for harsh environmental conditions such as those offshore Norway and to develop cost effective methods of installing subsea hardware in deep and ultra deep water without requiring expensive crane vessels. For subsea systems the challenge is to develop solutions for ultra deepwater without increasing costs, so that Norway's leading export position in this area can be maintained and strengthened. Considering developments in the arctic, Norwegian industry is already well placed through its familiarity with arctic climate, close relationship with Russia and involvement in Sakhalin II. As we move to water depth beyond about 150m use of Gravity Base Structures (GBS) becomes very expensive or non-feasible and we need to consider other solutions. Subsea-to-beach could be an attractive solution but we need to resolve challenges related to long distance tie backs, flow assurance, uneven terrain, etc. There is also a specific need to develop floating systems capable of drilling and production in an arctic environment. To address the above technical challenges the

  20. Effects of thickness and annealing condition on magnetic properties and thermal stabilities of Ta/Nd/NdFeB/Nd/Ta sandwiched films

    Science.gov (United States)

    Liu, Wen-Feng; Zhang, Min-Gang; Zhang, Ke-Wei; Zhang, Hai-Jie; Xu, Xiao-Hong; Chai, Yue-Sheng

    2016-11-01

    Ta/Nd/NdFeB/Nd/Ta sandwiched films are deposited by magnetron sputtering on Si (100) substrates, and subsequently annealed in vacuum at different temperatures for different time. It is found that both the thickness of NdFeB and Nd layer and the annealing condition can affect the magnetic properties of Ta/Nd/NdFeB/Nd/Ta films. Interestingly, the thickness and annealing temperature show the relevant behaviors that can affect the magnetic properties of the film. The high coercivity of 24.1 kOe (1 Oe = 79.5775 A/m) and remanence ratio (remanent magnetization/saturation magnetization) of 0.94 can be obtained in a Ta/Nd(250 nm)/NdFeB(600 nm)/Nd(250 nm)/Ta film annealed for 3 min at 1023 K. In addition, the thermal stability of the film is also linked to the thickness of NdFeB and Nd layer and the annealing temperature as well. The excellent thermal stability can be achieved in a Ta/Nd(250 nm)/NdFeB(600 nm)/Nd(250 nm)/Ta film annealed at 1023 K. Program supported by the National Natural Science Foundation of China (Grant No. 51305290), the Higher Education Technical Innovation Project of Shanxi Province, China (Grant No. 2013133), the Fund Program for the Scientific Activities of Selected Returned Overseas Professionals of Shanxi Province, China (Grant No. 2015003), and the Program for the Key Team of Scientific and Technological Innovation of Shanxi Province, China (Grant No. 2013131009).

  1. A large-area strain sensing technology for monitoring fatigue cracks in steel bridges

    Science.gov (United States)

    Kong, Xiangxiong; Li, Jian; Collins, William; Bennett, Caroline; Laflamme, Simon; Jo, Hongki

    2017-08-01

    This paper presents a novel large-area strain sensing technology for monitoring fatigue cracks in steel bridges. The technology is based on a soft elastomeric capacitor (SEC), which serves as a flexible and large-area strain gauge. Previous experiments have verified the SEC’s capability to monitor low-cycle fatigue cracks experiencing large plastic deformation and large crack opening. Here an investigation into further extending the SEC’s capability for long-term monitoring of fatigue cracks in steel bridges subject to traffic loading, which experience smaller crack openings. It is proposed that the peak-to-peak amplitude (pk-pk amplitude) of the sensor’s capacitance measurement as the indicator of crack growth to achieve robustness against capacitance drift during long-term monitoring. Then a robust crack monitoring algorithm is developed to reliably identify the level of pk-pk amplitudes through frequency analysis, from which a crack growth index (CGI) is obtained for monitoring fatigue crack growth under various loading conditions. To generate representative fatigue cracks in a laboratory, loading protocols were designed based on constant ranges of stress intensity to limit plastic deformations at the crack tip. A series of small-scale fatigue tests were performed under the designed loading protocols with various stress intensity ratios. Test results under the realistic fatigue crack conditions demonstrated the proposed crack monitoring algorithm can generate robust CGIs which are positively correlated with crack lengths and independent from loading conditions.

  2. Innovative technologies for decentralised water-, wastewater and biowaste management in urban and peri-urban areas.

    Science.gov (United States)

    Otterpohl, R; Braun, U; Oldenburg, M

    2003-01-01

    Avoiding the comingling of water flows coming from different sources and thus obtaining flows with a very low dilution factor is the first and major step key to technical solutions for adequate treatment of household wastewaters. Through their decentral structure and effective recovery of water, energy and fertiliser these systems can be highly cost efficient. Fresh water consumption can be reduced by up to 80% while nutrients can be recovered to a large extent. Source control is also advantageous for hygienic reasons: low volumes are far easier to sanitise. Source separation technology in municipal waste water treatment does often lead decentralised or semicentral systems. The first essential step is the separate collection and treatment of toilet waste in households, which contains almost all pathogens and nutrients. New toilet systems with very low dilution factors, ranging from vacuum- through urine sorting to dry toilets, have been introduced in several projects and proven feasible. New ideas such as the black- and greywater cycle systems are presently under research at the Technical University Hamburg Harburg. Such modular, integrated and small scale systems are only possible through recent advances in membrane technology and, due to their small scale, do have the potential to be installed in densely populated regions. These technologies are options for following the principles of ecological sanitation, to contain, to sanitise and to reuse also in urban areas (EcoSanRes, 2003).

  3. Ship Compliance in Emission Control Areas: Technology Costs and Policy Instruments.

    Science.gov (United States)

    Carr, Edward W; Corbett, James J

    2015-08-18

    This paper explores whether a Panama Canal Authority pollution tax could be an effective economic instrument to achieve Emission Control Area (ECA)-like reductions in emissions from ships transiting the Panama Canal. This tariff-based policy action, whereby vessels in compliance with International Maritime Organisation (IMO) ECA standards pay a lower transit tariff than noncompliant vessels, could be a feasible alternative to petitioning for a Panamanian ECA through the IMO. A $4.06/container fuel tax could incentivize ECA-compliant emissions reductions for nearly two-thirds of Panama Canal container vessels, mainly through fuel switching; if the vessel(s) also operate in IMO-defined ECAs, exhaust-gas treatment technologies may be cost-effective. The RATES model presented here compares current abatement technologies based on hours of operation within an ECA, computing costs for a container vessel to comply with ECA standards in addition to computing the Canal tax that would reduce emissions in Panama. Retrofitted open-loop scrubbers are cost-effective only for vessels operating within an ECA for more than 4500 h annually. Fuel switching is the least-cost option to industry for vessels that operate mostly outside of ECA regions, whereas vessels operating entirely within an ECA region could reduce compliance cost with exhaust-gas treatment technology (scrubbers).

  4. Securing Canada’s Information-Technology Infrastructure: Context, Principles, and Focus Areas of Cybersecurity Research

    Directory of Open Access Journals (Sweden)

    Dan Craigen

    2013-07-01

    Full Text Available This article addresses the challenges of cybersecurity and ultimately the provision of a stable and resilient information-technology infrastructure for Canada and, more broadly, the world. We describe the context of current cybersecurity challenges by synthesizing key source material whose importance was informed by our own real-world experiences. Furthermore, we present a checklist of guiding principles to a unified response, complete with a set of action-oriented research topics that are linked to known operational limitations. The focus areas are used to drive the formulation of a unified and relevant research and experimental development program, thereby moving us towards a stable and resilient cyberinfrastructure. When cybersecurity is viewed as an inherently interdisciplinary problem of societal concern, we expect that fundamentally new research perspectives will emerge in direct response to domain-specific protection requirements for information-technology infrastructure. Purely technical responses to cybersecurity challenges will be inadequate because human factors are an inherent aspect of the problem. This article will interest managers and entrepreneurs. Senior management teams can assess new technical developments and product releases to fortify their current security solutions, while entrepreneurs can harness new opportunities to commercialize novel technology to solve a high-impact cybersecurity problem..

  5. Performance of Coral Reef Management within Marine Protected Areas: Integrating Ecological, Socioeconomic, Technological, and Institutional Dimensions

    Directory of Open Access Journals (Sweden)

    Roni Bawole

    2013-04-01

    Full Text Available This research studied the characteristics and approaches that contributed to the successful of coral reef management (CRM efforts.  One such characteristic occurred in most case  studies was the importance of integrating ecological, socio-economic, technological use, and  institutional dimensions during all processes. Based on a multi-dimensional analysis,  the sustainability of CRM was 56.34% cumulatively, indicating a moderate level of management. This study  further suggested the importance to improve  technology and institution to achieve an effective CRM since both dimensions have  contributed only 38.80% and 49.26% respectively.  Stakeholder involvement was also central to the success of networking development within the management of Cenderawasih Bay National Park, specifically in facilitating the integration of ecological, socioeconomic, political will, and local cultural objectives in achieving an optimum planning objectives. Compilations of baselin information (both scientific and local knowledge were important to evaluate the effectiveness of all processes and for adaptive management to increase its potential in the management strategies. Balancing the integration of all management dimensions (ecology, socio-economic, technology, and institution in the whole processes with specific attributes in each case, would lead to an adaptive management for the implementation of conservation and management process.Keywords: coral  reef, management performance,  integrated dimensions, marine protected areas.

  6. FY96 materials and processes technology area plan (TAP). Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    The Materials and Processes Technology Area Plan (MP TAP) describes the research and development activities performed by the Wright-Laboratory`s Materials Directorate (WL/XL) at WPAFB, OH. WL/ML is responsible for developing MP technologies for all Air Force aircraft, spacecraft, and missiles systems. MP for Structures, Propulsion, and Subsystems thrust of the MP TAP describes the development of technologies utilizing advanced composite materials, lightweight - aluminum and titanium alloys, high temperature intermetallics, and improved fluids, lubricants, and coatings. Applications include airframe and engine retrofits, high speed aircraft, spacelift, missiles and satellites. The MP for Electronics, Optics, and Survivability thrust of the MP TAP describes the development of materials for high temperature semiconductors and superconductors, advanced infrared detectors, non-linear optical devices, and laser hardening. Applications include high power radar and avionic systems, infrared countermeasures, and sensor and aircrew laser protection. The MP for Systems and Operational Support thrust of the MP TAP describes the development of nondestructive inspection (NDI) techniques and repair of composite and LO materials. It also describes ML`s interface with all Air Force fielded systems through logistic centers and system project offices (SPOs) and by conducting electronic and structural failure analysis.

  7. Problems of method of technology assessment. A methodological analysis; Methodenprobleme des Technology Assessment; Eine methodologische Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, V.

    1993-03-01

    The study undertakes to analyse the theoretical and methodological structure of Technology Assessment (TA). It is based on a survey of TA studies which provided an important condition for theoreticall sound statements on methodological aspects of TA. It was established that the main basic theoretical problems of TA are in the field of dealing with complexity. This is also apparent in the constitution of problems, the most elementary and central approach of TA. Scientifically founded constitution of problems and the corresponding construction of models call for interdisciplinary scientific work. Interdisciplinarity in the TA research process is achieved at the level of virtual networks, these networks being composed of individuals suited to teamwork. The emerging network structures have an objective-organizational and an ideational basis. The objective-organizational basis is mainly the result of team composition and the external affiliations of the team members. The ideational basis of the virtual network is represented by the team members` mode of thinking, which is individually located at a multidisciplinary level. The theoretical `skeleton` of the TA knowledge system, which is represented by process knowledge based linkage structures, can be generated and also processed in connection with the knowledge on types of problems, areas of analysis and procedures to deal with complexity. Within this process, disciplinary knowledge is a necessary but not a sufficient condition. Metatheoretical and metadisciplinary knowledge and the correspondingly processes complexity of models are the basis for the necessary methodological awareness, that allows TA to become designable as a research procedure. (orig./HP) [Deutsch] Die Studie stellt sich die Aufgabe, die theoretische und methodische Struktur des Technology Assessment (TA) zu analysieren. Sie fusst auf Erhebungen, die bei Technology-Assessment-Studien vorgenommen wurden und die wesentliche Voraussetzungen fuer

  8. [A preliminary clinical study on endoscopic measurement of lesion area with the method of digital image processing technology].

    Science.gov (United States)

    Zhang, Lei; Wang, Zhihua; Fu, Zhongqian; Fang, Pengcheng; Ling, Kai; Xu, Jianming; Kong, Derun; Xu, Zhangwei

    2013-10-01

    It is of great importance to measure the lesion area in scientific research and clinical practice. The present study aims to solve barrel distortion and measure lesion area with the technology of computer visualization. With the ultimate purpose to obtain the precise lesion area, the study, based on the original endoscopy system and digital image processing technology, dealt with the correction of barrel distortion by lens adjustment, calculated the gastric ulcer area with the aid of Qt database and finally developed an image processing software--Endoscope Assistant (EAS). The results showed that the EAS was accurate in vitro. It was employed to measure the gastric ulcer area of 45 patients and the results were compared with the traditional formula method. It could be well concluded that this technology is safe, accurate and economical for measuring gastric ulcer area.

  9. Technology.

    Science.gov (United States)

    Online-Offline, 1998

    1998-01-01

    Focuses on technology, on advances in such areas as aeronautics, electronics, physics, the space sciences, as well as computers and the attendant progress in medicine, robotics, and artificial intelligence. Describes educational resources for elementary and middle school students, including Web sites, CD-ROMs and software, videotapes, books,…

  10. Water Environment Pollution in Three—Gorge Reservoir Area and Treatment Technology

    Institute of Scientific and Technical Information of China (English)

    LUOGuyuan; XUXiaoyi; 等

    2002-01-01

    After the erecgtion of Three-Gorge Reservoir,The Water Environment in the reservoir area will be turned into water dobies like laker,and the self-clarification ability of water will also be moch slower than ever,Now,the quality of water in most segments in upper reaches of Yangtze River cannot meet the requiremets of I-II class Environment Quality Standard (GHZB1-1999),In Yangtze River,Jialing River and Wujiang River,the mian indexes such as colon bacillus,nonionic ammonia,chemical oxygen demand(COD),petroleum,phenol,total phosphorus(TP),heavy metal,etc.,have exceeded the standard limits.The water bodies of the reservoir area are facing serious risk of eutrophicatioinm.To solve that problem.A countermeasure of multi-spot diverted treatment and separate discharge is recommended,for doing this,lots of smallscale wastemwate treatment facilities employing updated activated sludge treatment technologies are to be set up.Up to now,a number of sewage treatment technologies to control eutrophication of water have been developed,which include processes of sequencing batch activated sludge(SBR),absorbing bio-degradation (AB),oxidation channel,package intermittent aeration system(PIAS),intermittent cylce extended aeration system(ICEAS),UNITANK and so on ,The Efective one to be applied in the reservoir area should convey the requirements of ecological agriculture,forestry and urban planning ,and be accompanied by legal support for appropriate exploitation of natural resources.

  11. Field investigations of soils at TA-19, TA-26, TA-73 and TA-0, SWMU aggregate 0-D and 016

    Energy Technology Data Exchange (ETDEWEB)

    McFadden, L.D. [Geoprofile, Inc., Albuquerque, NM (United States)

    1995-03-01

    Field based investigations of the general soil-geomorphic characteristics were carried out at TA-19, -26, -73, -0, Aggregate 0-D and -016 in order to provide information for utilization in ongoing and anticipated LANL ERP (Environmental Restoration Project) activities at these sites. These investigations show that soils exhibiting diverse morphologic character, varying ages, and relations to landforms characterize these sites. A review of recent and ongoing soils studies also shows that soil textural, chemical, and mineralogical characteristics may profoundly influence the migration and/or retardation of a variety of potential contaminants initially placed in direct contact with soils, or that encounter soils during subsurface percolation or discharge. Soil-geomorphic relations also provide important insights into recent site erosion, deposition or other surficial processes that must, be considered as part of environmental assessment of a given site and remediation; and, the planned geomorphic mapping activities at each site, as well as other associated activities (e.g, geophysical survey, site sampling) are accordingly appropriate and necessary with respect to identification of significant soil relations at each site. Specific and general recommendations in consideration of important findings regarding the possible impacts of soil development of the nature of contaminant behavior at various sites are provided to help guide sampling and analysis activities during ERP investigations outlined in the RFI Work Plan for Operational Unit-1071.

  12. Technology strategy for integrated operations and real time reservoir management; Technology Target Areas; TTA5 - Integrated operations and RTRM

    Energy Technology Data Exchange (ETDEWEB)

    2007-07-01

    In Norway Integrated Operations (IO) is a concept which in the first phase (G1) has been used to describe how to integrate processes and people onshore and offshore using ICT solutions and facilities that improve onshore's ability to support offshore operationally. The second generation (G2) Integrated Operations aims to help operators utilize vendors' core competencies and services more efficiently. Utilizing digital services and vendor products, operators will be able to update reservoir models, drilling targets and well trajectories as wells are drilled, manage well completions remotely, optimize production from reservoir to export lines, and implement condition-based maintenance concepts. The total impact on production, recovery rates, costs and safety will be profound. When the international petroleum business moves to the Arctic region the setting is very different from what is the case on the Norwegian Continental Shelf (NCS) and new challenges will arise. The Norwegian Ministry of Environment has recently issued an Integrated Management Plan for the Barents Sea where one focus is on 'Monitoring of the Marine Environment in the North'. The Government aims to establish a new and more coordinated system for monitoring the marine ecosystems in the north. A representative group consisting of the major Operators, the Service Industry, Academia and the Authorities have developed the enclosed strategy for the OG21 Integrated Operations and Real Time Reservoir Management (IO and RTRM) Technology Target Area (TTA). Major technology and work process research and development gaps have been identified in several areas: Bandwidth down-hole to surface; Sensor development including Nano-technology; Cross discipline use of Visualisation, Simulation and model development particularly in Drilling and Reservoir management areas; Software development in terms of data handling, model updating and calculation speed; Enabling reliable and robust communications

  13. Discussion on Sustainable Water Technologies for Peri-Urban Areas of Mexico City: Balancing Urbanization and Environmental Conservation

    OpenAIRE

    Tiemen A. Nanninga; Iemke Bisschops; Eduardo López; José Luis Martínez-Ruiz; Daniel Murillo; Laura Essl; Markus Starkl

    2012-01-01

    Often centralized water supply, sanitation and solid waste services struggle to keep up with the rapid expansion of urban areas. The peri-urban areas are at the forefront of this expansion and it is here where decentralized technologies are increasingly being implemented. The introduction of decentralized technologies allows for the development of new opportunities that enable the recovery and reuse of resources in the form of water, nutrients and energy. This resource-oriented management of ...

  14. Identifying Areas of Tension in the Field of Technology-Enhanced Learning: Results of an International Delphi Study

    Science.gov (United States)

    Plesch, Christine; Kaendler, Celia; Rummel, Nikol; Wiedmann, Michael; Spada, Hans

    2013-01-01

    Despite steady progress in research in technology-enhanced learning (TEL), the translation of research findings and technology into educational practices falls short of expectations. We present five Areas of Tension which were identified and evaluated in an international Delphi study on TEL. These tensions might impede a more comprehensive…

  15. Analysis of an Interactive Technology Supported Problem-Based Learning STEM Project Using Selected Learning Sciences Interest Areas (SLSIA)

    Science.gov (United States)

    Kumar, David Devraj

    2017-01-01

    This paper reports an analysis of an interactive technology-supported, problem-based learning (PBL) project in science, technology, engineering and mathematics (STEM) from a Learning Sciences perspective using the Selected Learning Sciences Interest Areas (SLSIA). The SLSIA was adapted from the "What kinds of topics do ISLS [International…

  16. Final technology report for D-Area oil seepage basin bioventing optimization test, environmental restoration support

    Energy Technology Data Exchange (ETDEWEB)

    Radway, J.C.; Lombard, K.H.; Hazen, T.C.

    1997-01-24

    One method proposed for the cleanup of the D-Area Oil Seepage Basin was in situ bioremediation (bioventing), involving the introduction of air and gaseous nutrients to stimulate contaminant degradation by naturally occurring microorganisms. To test the feasibility of this approach, a bioventing system was installed at the site for use in optimization testing by the Environmental Biotechnology Section of the Savannah River Technology Center. During the interim action, two horizontal wells for a bioventing remediation system were installed eight feet below average basin grade. Nine piezometers were also installed. In September of 1996, a generator, regenerative blower, gas cylinder station, and associated piping and nutrient injection equipment were installed at the site and testing was begun. After baseline characterization of microbial activity and contaminant degradation at the site was completed, four injection campaigns were carried out. These consisted of (1) air alone, (2) air plus triethylphosphate (TEP), (3) air plus nitrous oxide, and (4) air plus methane. This report describes results of these tests, together with conclusions and recommendations for further remediation of the site. Natural biodegradation rates are high. Oxygen, carbon dioxide, and methane levels in soil gas indicate substantial levels of baseline microbial activity. Oxygen is used by indigenous microbes for biodegradation of organics via respiration and hence is depleted in the soil gas and water from areas with high contamination. Carbon dioxide is elevated in contaminated areas. High concentrations of methane, which is produced by microbes via fermentation once the oxygen has been depleted, are found at the most contaminated areas of this site. Groundwater measurements also indicated that substantial levels of natural contaminant biodegradation occurred prior to air injection.

  17. Polyimide microfluidic devices with integrated nanoporous filtration areas manufactured by micromachining and ion track technology

    Science.gov (United States)

    Metz, S.; Trautmann, C.; Bertsch, A.; Renaud, Ph

    2004-03-01

    This paper reports on polyimide microfluidic devices fabricated by photolithography and a layer transfer lamination technology. The microchannels are sealed by laminating an uncured polyimide film on a partially cured layer and subsequent imidization. Selected areas of the microchannels were irradiated with heavy ions of several hundred MeV and the generated ion tracks are chemically etched to submicron pores of high aspect ratio. The ion beam parameters and the track etching conditions define density, length, diameter and shape of the pores. Membrane permeability and separation performance is demonstrated in cross-flow filtration experiments. The devices can be used for selective delivery or probing of fluids to biological tissue, e.g. drug delivery or microdialysis. For chip-based devices the filters can be used as a sample pre-treatment unit for filtration or concentration of particles or molecules.

  18. Regulatory framework and examples of ground-source heating/cooling technology in the Winnipeg area

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, R. [Manitoba Conservation, Winnipeg, MB (Canada)

    2003-07-01

    Winnipeg, Manitoba lies over a highly transmissive Carbonate Aquifer of Ordovician age, which provides a suitable environment for groundwater supply and return wells. Many licensed ground-source heating cooling (GSHC) systems have been installed in and around the Winnipeg urban area over the last several decades. A water rights licence, issued by the Provincial Department of Conservation, is required for all groundwater supply and return wells. This licence comes with certain rights and responsibilities. This paper describes the regulatory framework which governs the licensing process. The author emphasized that the future use and success of the technology depends, in large part, on the development of a critical mass of experienced contractors, hydrogeologists and consulting engineers. 2 refs.

  19. Solar efficient technologies for valorising an archaeological site in the rural area Romania

    Science.gov (United States)

    Tǎmǎşan, Maria; Mǎrǎcineanu, Cristian; Bica, Smaranda Maria

    2015-12-01

    The purpose of the study is finding viable methods of rehabilitation and re-use of the cultural heritage in rural areas by efficient contemporary technological and architectural solutions. In this respect, this paper describes the phases of an environmental-friendly intervention on an archaeological site near the village Şiria, Arad County, as case study, the expected results and the steps which must be taken in order to implement the proposal. The final aim is to create a complex and sustainable tourist attraction through musealisation, integrated in the already known, but poorly promoted tourist itinerary, known as The Wine Path - Şiria is in a wine-growing region first documented in the 9th century. The proposed design reflects our sustainable approach by combining local materials with non-invasive structural solutions and efficient solar technologies. The purpose of this approach is to reduce the building's maintenance costs nearly to 0 and to extend the visiting time of the archaeological site during the entire year, whatever the weather or season. The proposals are to be submitted to the County Council, having issued the Strategy for Tourist Development for Arad County, elaborated in 2011 by The Analysis for Institutional Development Centre - Bucharest.

  20. Aviation System Capacity Program Terminal Area Productivity Project: Ground and Airborne Technologies

    Science.gov (United States)

    Giulianetti, Demo J.

    2001-01-01

    Ground and airborne technologies were developed in the Terminal Area Productivity (TAP) project for increasing throughput at major airports by safely maintaining good-weather operating capacity during bad weather. Methods were demonstrated for accurately predicting vortices to prevent wake-turbulence encounters and to reduce in-trail separation requirements for aircraft approaching the same runway for landing. Technology was demonstrated that safely enabled independent simultaneous approaches in poor weather conditions to parallel runways spaced less than 3,400 ft apart. Guidance, control, and situation-awareness systems were developed to reduce congestion in airport surface operations resulting from the increased throughput, particularly during night and instrument meteorological conditions (IMC). These systems decreased runway occupancy time by safely and smoothly decelerating the aircraft, increasing taxi speed, and safely steering the aircraft off the runway. Simulations were performed in which optimal trajectories were determined by air traffic control (ATC) and communicated to flight crews by means of Center TRACON Automation System/Flight Management System (CTASFMS) automation to reduce flight delays, increase throughput, and ensure flight safety.

  1. EM-50 Tanks Focus Area retrieval process development and enhancements. FY97 technology development summary report

    Energy Technology Data Exchange (ETDEWEB)

    Rinker, M.W.; Bamberger, J.A. [Pacific Northwest National Lab., Richland, WA (United States); Alberts, D.G. [Waterjet Technology, Inc., Kent, WA (United States)] [and others

    1997-09-01

    The Retrieval Process Development and Enhancements (RPD and E) activities are part of the US Department of Energy (DOE) EM-50 Tanks Focus Area, Retrieval and Closure program. The purpose of RPD and E is to understand retrieval processes, including emerging and existing technologies, and to gather data on these processes, so that end users have requisite technical bases to make retrieval decisions. Technologies addressed during FY97 include enhancements to sluicing, the use of pulsed air to assist mixing, mixer pumps, innovative mixing techniques, confined sluicing retrieval end effectors, borehole mining, light weight scarification, and testing of Russian-developed retrieval equipment. Furthermore, the Retrieval Analysis Tool was initiated to link retrieval processes with tank waste farms and tank geometric to assist end users by providing a consolidation of data and technical information that can be easily assessed. The main technical accomplishments are summarized under the following headings: Oak Ridge site-gunite and associated tanks treatability study; pulsed air mixing; Oak Ridge site-Old Hydrofracture Facility; hydraulic testbed relocation; cooling coil cleaning end effector; light weight scarifier; innovative tank mixing; advanced design mixer pump; enhanced sluicing; Russian retrieval equipment testing; retrieval data analysis and correlation; simulant development; and retrieval analysis tool (RAT).

  2. Near-Field Coupling Communication Technology For Human-Area Networking

    Directory of Open Access Journals (Sweden)

    Ryoji Nagai

    2012-12-01

    Full Text Available We propose a human-area networking technology that uses the surface of the human body as a data transmission path and uses near-field coupling TRXs. This technology aims to achieve a "touch and connect" form of communication and a new concept of "touch the world" by using a quasi-electrostatic field signal that propagates along the surface of the human body. This paper explains the principles underlying near-field coupling communication. Special attention has been paid to common-mode noise since our communication system is strongly susceptible to this. We designed and made a common-mode choke coil and a transformer to act as common-mode noise filters to suppress common-mode noise. Moreover, we describe how we evaluated the quality of communication using a phantom model with the same electrical properties as the human body and present the experimental results for the packet error rate (PER as a function of the signal to noise ratio (SNR both with the common-mode choke coil or the transformer and without them. Finally, we found that our system achieved a PER of less than 10-2 in general office rooms using raised floors, which corresponded to the quality of communication demanded by communication services in ordinary office spaces.

  3. Secondary content area teachers speak about literacy and technology: Tensions, complexities, conceptualizations, and practices

    Science.gov (United States)

    Stolle, Elizabeth Joy Petroelje

    2007-12-01

    The purpose of this study was to share the details, complexities, contradictions, parallels, conceptualizations, and practices of secondary content area teachers' use of information and communication technologies (ICTs) to enhance literacy practices and learning. Specifically, the research questions were: How do English, Science, and Social Studies teachers conceptualize the impacts ICTs have on literacy practices and learning? What is the relationship between English, Science, and Social Studies teachers' conceptualizations and their use of ICTs in their everyday pedagogical practices to enhance literacy practices and learning? I used the notions of literacy as a social practice to frame the study and writing as a method of inquiry to analyze the teachers' conceptualizations and practices. Through observations and interviews, I learned the teachers' stories. Within these stories, four tensions emerged in regard to how the teachers negotiate between their conceptualizations and classroom practices: (1) access to ICTs adequate for the task; (2) sufficient levels of ICT knowledge for the task; (3) fear of the unknown; and (4) identification of who benefits form the ICTs and how these benefits can be determined. The conclusions, or major themes highlighted in the teachers' stories, are that: (a) technology seems to be an add-on to support well-established practices, (b) teachers cling to traditional literacy practices, (c) teachers take up and use ICTs and literacy for unique purposes based on their individual classroom contexts, and (d) teachers' tensions limit their ability to envision beyond what they currently see and do in regards to ICTs and literacy.

  4. Near-Field Coupling Communication Technology For Human-Area Networking

    Directory of Open Access Journals (Sweden)

    Ryoji Nagai

    2012-12-01

    Full Text Available We propose a human-area networking technology that uses the surface of the human body as a data transmission path and uses near-field coupling TRXs. This technology aims to achieve a "touch and connect" form of communication and a new concept of "touch the world" by using a quasi-electrostatic field signal that propagates along the surface of the human body. This paper explains the principles underlying near-field coupling communication. Special attention has been paid to common-mode noise since our communication system is strongly susceptible to this. We designed and made a common-mode choke coil and a transformer to act as common-mode noise filters to suppress common-mode noise. Moreover, we describe how we evaluated the quality of communication using a phantom model with the same electrical properties as the human body and present the experimental results for the packet error rate (PER as a function of the signal to noise ratio (SNR both with the common-mode choke coil or the transformer and without them. Finally, we found that our system achieved a PER of less than 10-2 in general office rooms using raised floors, which corresponded to the quality of communication demanded by communication services in ordinary office spaces.

  5. Nanostructured Ti-Ta thin films synthesized by combinatorial glancing angle sputter deposition.

    Science.gov (United States)

    Motemani, Yahya; Khare, Chinmay; Savan, Alan; Hans, Michael; Paulsen, Alexander; Frenzel, Jan; Somsen, Christoph; Mücklich, Frank; Eggeler, Gunther; Ludwig, Alfred

    2016-12-09

    -patterning and a combinatorial materials library fabrication strategy offer a promising technological approach for investigating Ti-Ta thin films for a range of applications. The proposed approaches can be similarly implemented for other materials systems which can benefit from the formation of a nanocolumnar morphology.

  6. Nanostructured Ti-Ta thin films synthesized by combinatorial glancing angle sputter deposition

    Science.gov (United States)

    Motemani, Yahya; Khare, Chinmay; Savan, Alan; Hans, Michael; Paulsen, Alexander; Frenzel, Jan; Somsen, Christoph; Mücklich, Frank; Eggeler, Gunther; Ludwig, Alfred

    2016-12-01

    combinatorial materials library fabrication strategy offer a promising technological approach for investigating Ti-Ta thin films for a range of applications. The proposed approaches can be similarly implemented for other materials systems which can benefit from the formation of a nanocolumnar morphology.

  7. Symposium in Honour of T.A. Springer

    CERN Document Server

    Hesselink, Wim; Kallen, Wilberd; Strooker, Jan

    1987-01-01

    From 1-4 April 1986 a Symposium on Algebraic Groups was held at the University of Utrecht, The Netherlands, in celebration of the 350th birthday of the University and the 60th of T.A. Springer. Recognized leaders in the field of algebraic groups and related areas gave lectures which covered wide and central areas of mathematics. Though the fourteen papers in this volume are mostly original research contributions, some survey articles are included. Centering on the Symposium subject, such diverse topics are covered as Discrete Subgroups of Lie Groups, Invariant Theory, D-modules, Lie Algebras, Special Functions, Group Actions on Varieties.

  8. Anisotropic properties of TaS2

    Institute of Scientific and Technical Information of China (English)

    Qiao Yan-Bin; Li Yan-Ling; Zhong Guo-Hua; Zeng Zhi; Qin Xiao-Ying

    2007-01-01

    The anisotropic properties of 1T- and 2H-TaS2 are investigated by the density functional theory within the framework of full-potential linearized augmented plane wave method. The band structures of 1T- and 2H-TaS2 exhibit anisotropic properties and the calculated electronic specific-heat coefficient γ of 2H-TaS2 accords well with the existing experimental value. The anisotropic frequency-dependent dielectric functions including the effect of the Drude term are analysed, where the εxx(ω) spectra corresponding to the electric field E perpendicular to the z axis show excellent agreement with the measured results except for the ε1xx(ω) of 1T-TaS2 below the energy level of 2.6 eV which is due to the lack of the enough CDW information for reference in our calculation. Furthermore, based on the values of optical effective mass ratio P of 1T and 2H phases it is found that the anisotropy in 2H-TaS2 is stronger than that in 1T-TaS2.

  9. Landscape monitoring of post-industrial areas using LiDAR and GIS technology

    Directory of Open Access Journals (Sweden)

    Wężyk Piotr

    2015-06-01

    Full Text Available The quarrying industry is changing the local landscape, forming deep open pits and spoil heaps in close proximity to them, especially lignite mines. The impact can include toxic soil material (low pH, heavy metals, oxidations etc. which is the basis for further reclamation and afforestation. Forests that stand on spoil heaps have very different growth conditions because of the relief (slope, aspect, wind and rainfall shadows, supply of solar energy, etc. and type of soil that is deposited. Airborne laser scanning (ALS technology deliver point clouds (XYZ and derivatives as raster height models (DTM, DSM, nDSM=CHM which allow the reception of selected 2D and 3D forest parameters (e.g. height, base of the crown, cover, density, volume, biomass, etc. The automation of ALS point cloud processing and integrating the results into GIS helps forest managers to take appropriate decisions on silvicultural treatments in areas with failed plantations (toxic soil, droughts on south-facing slopes; landslides, etc. or as regular maintenance. The ISOK country-wide project ongoing in Poland will soon deliver ALS point cloud data which can be successfully used for the monitoring and management of many thousands of hectares of destroyed post-industrial areas which according to the law, have to be afforested and transferred back to the State Forest.

  10. Research of Ancient Architectures in Jin-Fen Area Based on GIS&BIM Technology

    Science.gov (United States)

    Jia, Jing; Zheng, Qiuhong; Gao, Huiying; Sun, Hai

    2017-05-01

    The number of well-preserved ancient buildings located in Shanxi Province, enjoying the absolute maximum proportion of ancient architectures in China, is about 18418, among which, 9053 buildings have the structural style of wood frame. The value of the application of BIM (Building Information Modeling) and GIS (Geographic Information System) is gradually probed and testified in the corresponding fields of ancient architecture’s spatial distribution information management, routine maintenance and special conservation & restoration, the evaluation and simulation of related disasters, such as earthquake. The research objects are ancient architectures in JIN-FEN area, which were first investigated by Sicheng LIANG and recorded in his work of “Chinese ancient architectures survey report”. The research objects, i.e. the ancient architectures in Jin-Fen area include those in Sicheng LIANG’s investigation, and further adjustments were made through authors’ on-site investigation and literature searching & collection. During this research process, the spatial distributing Geodatabase of research objects is established utilizing GIS. The BIM components library for ancient buildings is formed combining on-site investigation data and precedent classic works, such as “Yingzao Fashi”, a treatise on architectural methods in Song Dynasty, “Yongle Encyclopedia” and “Gongcheng Zuofa Zeli”, case collections of engineering practice, by the Ministry of Construction of Qing Dynasty. A building of Guangsheng temple in Hongtong county is selected as an example to elaborate the BIM model construction process based on the BIM components library for ancient buildings. Based on the foregoing work results of spatial distribution data, attribute data of features, 3D graphic information and parametric building information model, the information management system for ancient architectures in Jin-Fen Area, utilizing GIS&BIM technology, could be constructed to support the

  11. Using GIS technology to identify areas of tuberculosis transmission and incidence

    Directory of Open Access Journals (Sweden)

    Jost Kenneth C

    2004-10-01

    Full Text Available Abstract Background Currently in the U.S. it is recommended that tuberculosis screening and treatment programs be targeted at high-risk populations. While a strategy of targeted testing and treatment of persons most likely to develop tuberculosis is attractive, it is uncertain how best to accomplish this goal. In this study we seek to identify geographical areas where on-going tuberculosis transmission is occurring by linking Geographic Information Systems (GIS technology with molecular surveillance. Methods This cross-sectional analysis was performed on data collected on persons newly diagnosed with culture positive tuberculosis at the Tarrant County Health Department (TCHD between January 1, 1993 and December 31, 2000. Clinical isolates were molecularly characterized using IS6110-based RFLP analysis and spoligotyping methods to identify patients infected with the same strain. Residential addresses at the time of diagnosis of tuberculosis were geocoded and mapped according to strain characterization. Generalized estimating equations (GEE analysis models were used to identify risk factors involved in clustering. Results Evaluation of the spatial distribution of cases within zip-code boundaries identified distinct areas of geographical distribution of same strain disease. We identified these geographical areas as having increased likelihood of on-going transmission. Based on this evidence we plan to perform geographically based screening and treatment programs. Conclusion Using GIS analysis combined with molecular epidemiological surveillance may be an effective method for identifying instances of local transmission. These methods can be used to enhance targeted screening and control efforts, with the goal of interruption of disease transmission and ultimately incidence reduction.

  12. Geology of the Western Part of Los Alamos National Laboratory (TA-3 to TA-16), Rio Grande Rift, New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    C.J.Lewis; A.Lavine; S.L.Reneau; J.N.Gardner; R.Channell; C.W.Criswell

    2002-12-01

    We present data that elucidate the stratigraphy, geomorphology, and structure in the western part of Los Alamos National Laboratory between Technical Areas 3 and 16 (TA-3 and TA-16). Data include those gathered by geologic mapping of surficial, post-Bandelier Tuff strata, conventional and high-precision geologic mapping and geochemical analysis of cooling units within the Bandelier Tuff, logging of boreholes and a gas pipeline trench, and structural analysis using profiles, cross sections, structure contour maps, and stereographic projections. This work contributes to an improved understanding of the paleoseismic and geomorphic history of the area, which will aid in future seismic hazard evaluations and other investigations. The study area lies at the base of the main, 120-m (400-ft) high escarpment formed by the Pajarito fault, an active fault of the Rio Grande rift that bounds Los Alamos National Laboratory on the west. Subsidiary fracturing, faulting, and folding associated with the Pajarito fault zone extends at least 1,500 m (5,000 ft) to the east of the main Pajarito fault escarpment. Stratigraphic units in the study area include upper units of the Tshirege Member of the early Pleistocene Bandelier Tuff, early Pleistocene alluvial fan deposits that predate incision of canyons on this part of the Pajarito Plateau, and younger Pleistocene and Holocene alluvium and colluvium that postdate drainage incision. We discriminate four sets of structures in the area between TA-3 and TA-16: (a) north-striking faults and folds that mark the main zone of deformation, including a graben in the central part of the study area; (b) north-northwest-striking fractures and rare faults that bound the eastern side of the principal zone of deformation and may be the surface expression of deep-seated faulting; (c) rare northeast-striking structures near the northern limit of the area associated with the southern end of the Rendija Canyon fault; and (d) several small east

  13. Characterization and wear properties of nanoscaled TiN/TaN multilayer coatings

    Institute of Scientific and Technical Information of China (English)

    AN Jian; ZHANG Qing-yu

    2006-01-01

    The structural, morphological, mechanical and tribological characterization of nanoscaled multilayer TiN/TaN coatings deposited by magnetron sputtering technology were investigated by low angle X-ray diffractometry, high angle X-ray diffractometry, atomic force microscopy, microhardness, pin-on-disc testing and 3-D surface profiler. The results show that the TiN/TaN coatings exhibit good modulation period and sharp interface between TiN and TaN layers. In mutilayered TiN/TaN coatings, TiN layers have cubic structure, but hexagonal structure emerged among TaN layers besides cubic structure as modulation period is beyond 8.5 nm. The microhardness is affected by modulation period and the maximum hardness value of 31.5 GPa appears at a modulation period of 8.5 nm. The coefficient of friction is high and the wear resistance is improved for TiN/TaN coatings compared with those of TiN coating; the wear mechanism exhibits predominantly ploughing, material transfer and localized spallation.

  14. Nano-electromechanical oscillators (NEMOs) for RF technologies.

    Energy Technology Data Exchange (ETDEWEB)

    Wendt, Joel Robert; Czaplewski, David A.; Gibson, John Murray (Argonne National Laboratory, Argonne, IL); Webster, James R.; Carton, Andrew James; Keeler, Bianca Elizabeth Nelson; Carr, Dustin Wade; Friedmann, Thomas Aquinas; Tallant, David Robert; Boyce, Brad Lee; Sullivan, John Patrick; Dyck, Christopher William; Chen, Xidong (Cedarville University, Cedarville, OH)

    2004-12-01

    Nano-electromechanical oscillators (NEMOs), capacitively-coupled radio frequency (RF) MEMS switches incorporating dissipative dielectrics, new processing technologies for tetrahedral amorphous carbon (ta-C) films, and scientific understanding of dissipation mechanisms in small mechanical structures were developed in this project. NEMOs are defined as mechanical oscillators with critical dimensions of 50 nm or less and resonance frequencies approaching 1 GHz. Target applications for these devices include simple, inexpensive clocks in electrical circuits, passive RF electrical filters, or platforms for sensor arrays. Ta-C NEMO arrays were used to demonstrate a novel optomechanical structure that shows remarkable sensitivity to small displacements (better than 160 fm/Hz {sup 1/2}) and suitability as an extremely sensitive accelerometer. The RF MEMS capacitively-coupled switches used ta-C as a dissipative dielectric. The devices showed a unipolar switching response to a unipolar stimulus, indicating the absence of significant dielectric charging, which has historically been the major reliability issue with these switches. This technology is promising for the development of reliable, low-power RF switches. An excimer laser annealing process was developed that permits full in-plane stress relaxation in ta-C films in air under ambient conditions, permitting the application of stress-reduced ta-C films in areas where low thermal budget is required, e.g. MEMS integration with pre-existing CMOS electronics. Studies of mechanical dissipation in micro- and nano-scale ta-C mechanical oscillators at room temperature revealed that mechanical losses are limited by dissipation associated with mechanical relaxation in a broad spectrum of defects with activation energies for mechanical relaxation ranging from 0.35 eV to over 0.55 eV. This work has established a foundation for the creation of devices based on nanomechanical structures, and outstanding critical research areas that need

  15. Idaho National Engineering Laboratory Waste Area Groups 1-7 and 10 Technology Logic Diagram. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    O`Brien, M.C.; Meservey, R.H.; Little, M.; Ferguson, J.S.; Gilmore, M.C.

    1993-09-01

    The Idaho National Engineering Laboratory (INEL) Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates Environmental Restoration (ER) and Waste Management (WM) problems at the INEL to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to an environmental restoration need. It is essential that follow-on engineering and system studies be conducted to build on the output of this project. These studies will begin by selecting the most promising technologies identified in this TLD and finding an optimum mix of technologies that will provide a socially acceptable balance between cost and risk to meet the site windows of opportunity. The TLD consists of three separate volumes: Volume I includes the purpose and scope of the TLD, a brief history of the INEL Waste Area Groups, and environmental problems they represent. A description of the TLD, definitions of terms, a description of the technology evaluation process, and a summary of each subelement, is presented. Volume II (this volume) describes the overall layout and development of the TLD in logic diagram format. This section addresses the environmental restoration of contaminated INEL sites. Specific INEL problem areas/contaminants are identified along with technology solutions, the status of the technologies, precise science and technology needs, and implementation requirements. Volume III provides the Technology Evaluation Data Sheets (TEDS) for Environmental Restoration and Waste Management (EM) activities that are referenced by a TEDS codenumber in Volume II. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than provided for technologies in Volume II.

  16. PROBLEMS OF PROTECTION OF URBAN AREAS FROM RADIONUCLIDES STRONTIUM-90 AND CAESIUM-137 AFTER TECHNOLOGICAL DISASTERS

    Directory of Open Access Journals (Sweden)

    Olga Cheremisina

    2017-05-01

    Full Text Available The methods of decontamination of radionuclides from soils are considered. The literature focuses on fixing radionuclides in soils and creating geochemical barriers that it is prevent the spread of pollution. The main disadvantage of these methods is exclude the possibility of building a territory. It is need to clean up the area to the sanitary and hygienic requirements for further use and then it is desirable to fix the residual activity. Carried out an analysis of forms of radionuclides fixation in soils and mechanics of this fixation, therewith revealed that Cs-137 fixed more strongly on mineral component of soil, than Sr-90, which is mainly in the acid-soluble and exchangeable form, and, as a consequence, passes into the liquid phase during soil deactivation more easily. Contaminated soil deactivation in the urbanized territory is possible by washing it by ferric chloride solution at a concentration 0.02-0.05 M and with an equimolar addition of an ammonium chloride. Therewith most efficient methods, which used in-situ conditions, are heap and convection leaching technologies with treatment degree, which not less than 80%. At the same time, the most efficient methods which used in-situ conditions are heap and the convection leaching. The hardware-technological scheme of a convection leaching is presented. Noted that ammonium salts additions slightly rising coefficient of treatment from Sr-90. Because ammonium salts aren’t expensive, their additions allow to obtain significant economic benefits due to decreasing of ferric chloride consumption, which is more valuable, and waste water volume reduction.

  17. The 181Ta Nuclear Quadrupole Interaction in the Charge Density Wave Phases of 1T-TaS2

    Science.gov (United States)

    Ganal, P.; Butz, T.; Lerf, A.; Naito, M.; Nishihara, H.

    1990-04-01

    With a high resolution time differential perturbed angular correlation spectrometer we investigated the nuclear quadrupole interaction of Ta in 1T-TaS2 . The results obtained for the commensurate charge density wave phase lead to a revised assignment of the previously observed 181Ta NQR resonances. Differences in the intracluster architecture of the 13-atom Star of David cluster between 1T-TaS2 and 1T-TaSe2 could be responsible for the metal to semiconductor transition which occurs in lT-TaS2 but not in lT-TaSe2 .

  18. Ta thickness-dependent perpendicular magnetic anisotropy features in Ta/CoFeB/MgO/W free layer stacks

    Energy Technology Data Exchange (ETDEWEB)

    Yang, SeungMo; Lee, JaBin; An, GwangGuk [Novel Functional Materials and Devices Lab, The Research Institute for Natural Science, Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of); Kim, JaeHong [Division of Nano-Scale Semiconductor Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Chung, WooSeong [Nano Quantum Electronics Lab, Department of Electronics and Computer Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Hong, JinPyo, E-mail: jphong@hanyang.ac.kr [Novel Functional Materials and Devices Lab, The Research Institute for Natural Science, Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of); Division of Nano-Scale Semiconductor Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of)

    2015-07-31

    We describe Ta underlayer thickness influence on thermal stability of perpendicular magnetic anisotropy in Ta/CoFeB/MgO/W stacks. It is believed that thermal stability based on Ta underlay is associated with thermally-activated Ta atom diffusion during annealing. The difference in Ta thickness-dependent diffusion behaviors was confirmed with X-ray photoelectron spectroscopy analysis. Along with a feasible Ta thickness model, our observations suggest that an appropriate seed layer choice is needed for high temperature annealing stability, a critical issue in the memory industry. - Highlights: • We observed changes in the diffusion behavior with regard to Ta seed layer thickness. • It was observed that a thinner Ta seed layer induced more annealing-stable features. • However, ultra-thin (0.75 nm) Ta shows unstable characteristics about the annealing process. • It was possibly due to a rugged interface of the Ta layer by the island growth process.

  19. Spin polarization effect for molecule Ta2

    Institute of Scientific and Technical Information of China (English)

    Xie An-Dong

    2006-01-01

    Density functional theory (DFT) (B3p86) has been used to optimize the structure of the molecule Taa- The result shows that the ground state of molecule Ta,2 is a 7- multiple state and its electronic configuration is 7∑+u which shows the spin polarization effect for molecule Ta2 of transition metal elements for the first time. Meanwhile, spin pollution has not been found because the wavefunction of the ground state does not mix with those of higher states. So, the fact that the ground state of molecule Ta2 is a 7-multiple state indicates a spin polarization effect of molecule Ta2 of the transition metal elements, i.e. there exist 6 parallel spin electrons and the non-conjugated electrons are greatest in number. These electrons occupy different space orbitals so that the energy of molecule Ta2 is minimized. It can be concluded that the effect of parallel spin of the molecule Ta2 is larger than the effect of the conjugated molecule, which is obviously related to the effect of d-electron delocalization. In addition, the Murrell-Sorbie potential functions with parameters for the ground state 7∑+u and other states of the molecule Ta2 are derived. The dissociation energy De, equilibrium bond length Re and vibration frequency ωe for the ground state of molecule Ta2 are 4.5513eV, 0.2433nm and 173.06cm-1, respectively. Its force constants f2,f3 and f4 are 1.5965×l02aJ·nm-2,-6.4722×l03aJ·nm-3 and 29.4851×04aJ·nm-4, respectively. Other spectroscopic data ωe χe, Be and αe for the ground state of Ta2 are 0.2078cm-1, 0.0315cm-1 and 0.7858×104 cm-1, respectively.

  20. Enabling technologies to improve area-wide integrated pest management programmes for the control of screwworms.

    Science.gov (United States)

    Robinson, A S; Vreysen, M J B; Hendrichs, J; Feldmann, U

    2009-06-01

    The economic devastation caused in the past by the New World screwworm fly Cochliomyia hominivorax (Coquerel) (Diptera: Calliphoridae) to the livestock industry in the U.S.A., Mexico and the rest of Central America was staggering. The eradication of this major livestock pest from North and Central America using the sterile insect technique (SIT) as part of an area-wide integrated pest management (AW-IPM) programme was a phenomenal technical and managerial accomplishment with enormous economic implications. The area is maintained screwworm-free by the weekly release of 40 million sterile flies in the Darien Gap in Panama, which prevents migration from screwworm-infested areas in Columbia. However, the species is still a major pest in many areas of the Caribbean and South America and there is considerable interest in extending the eradication programme to these countries. Understanding New World screwworm fly populations in the Caribbean and South America, which represent a continuous threat to the screwworm-free areas of Central America and the U.S.A., is a prerequisite to any future eradication campaigns. The Old World screwworm fly Chrysomya bezziana Villeneuve (Diptera: Calliphoridae) has a very wide distribution ranging from Southern Africa to Papua New Guinea and, although its economic importance is assumed to be less than that of its New World counterpart, it is a serious pest in extensive livestock production and a constant threat to pest-free areas such as Australia. In the 1980s repeated introductions and an expansion of Old World screwworm populations were reported in the Middle East; in the 1990s it invaded Iraq and since late 2007 it has been reported in Yemen, where a severe outbreak of myiasis occurred in 2008. Small-scale field trials have shown the potential of integrating the SIT in the control of this pest and various international organizations are considering using the release of sterile insects as part of an AW-IPM approach on a much wider scale

  1. Nanoinformatics: an emerging area of information technology at the intersection of bioinformatics, computational chemistry and nanobiotechnology.

    Science.gov (United States)

    González-Nilo, Fernando; Pérez-Acle, Tomás; Guínez-Molinos, Sergio; Geraldo, Daniela A; Sandoval, Claudia; Yévenes, Alejandro; Santos, Leonardo S; Laurie, V Felipe; Mendoza, Hegaly; Cachau, Raúl E

    2011-01-01

    After the progress made during the genomics era, bioinformatics was tasked with supporting the flow of information generated by nanobiotechnology efforts. This challenge requires adapting classical bioinformatic and computational chemistry tools to store, standardize, analyze, and visualize nanobiotechnological information. Thus, old and new bioinformatic and computational chemistry tools have been merged into a new sub-discipline: nanoinformatics. This review takes a second look at the development of this new and exciting area as seen from the perspective of the evolution of nanobiotechnology applied to the life sciences. The knowledge obtained at the nano-scale level implies answers to new questions and the development of new concepts in different fields. The rapid convergence of technologies around nanobiotechnologies has spun off collaborative networks and web platforms created for sharing and discussing the knowledge generated in nanobiotechnology. The implementation of new database schemes suitable for storage, processing and integrating physical, chemical, and biological properties of nanoparticles will be a key element in achieving the promises in this convergent field. In this work, we will review some applications of nanobiotechnology to life sciences in generating new requirements for diverse scientific fields, such as bioinformatics and computational chemistry.

  2. Analysing the Effects of Flood-Resilience Technologies in Urban Areas Using a Synthetic Model Approach

    Directory of Open Access Journals (Sweden)

    Reinhard Schinke

    2016-11-01

    Full Text Available Flood protection systems with their spatial effects play an important role in managing and reducing flood risks. The planning and decision process as well as the technical implementation are well organized and often exercised. However, building-related flood-resilience technologies (FReT are often neglected due to the absence of suitable approaches to analyse and to integrate such measures in large-scale flood damage mitigation concepts. Against this backdrop, a synthetic model-approach was extended by few complementary methodical steps in order to calculate flood damage to buildings considering the effects of building-related FReT and to analyse the area-related reduction of flood risks by geo-information systems (GIS with high spatial resolution. It includes a civil engineering based investigation of characteristic properties with its building construction including a selection and combination of appropriate FReT as a basis for derivation of synthetic depth-damage functions. Depending on the real exposition and the implementation level of FReT, the functions can be used and allocated in spatial damage and risk analyses. The application of the extended approach is shown at a case study in Valencia (Spain. In this way, the overall research findings improve the integration of FReT in flood risk management. They provide also some useful information for advising of individuals at risk supporting the selection and implementation of FReT.

  3. Rutile is holding Nb and Ta in the mantle, negligible Nb and Ta in the core

    Science.gov (United States)

    McDonough, W. F.; Rudnick, R. L.

    2008-12-01

    Continental Crust has a significant depletion in Nb and Ta relative to La that has been attributed to convergent margin (arc) magmatism and greater retention of Nb and Ta in the mantle source. This depleted pattern is a consequence of the plotting order of elements, which has been established by the relative partitioning behavior of elements during MORB-OIB genesis. It is our hypothesis that rutile in subducting slabs or delaminated lower continental crust is the important phase causing Nb(Ta)-depletion in the continental crust, as well as lowering its Nb/Ta. Experimental studies reveal a range of Nb/Ta fractionation responses in residual rutile depending on temperature and phase relations(melting vs dehydration). Examples of rutile-bearing, refractory eclogites have been identified that serve as analog materials for residues of the continental crust. These rutiles have radiogenic Hf isotopes (Vervoort, unpubl. data), and thus are not recent precipitates from metasomatic melts, as has been recently suggested. What remains is to understand the total silicate Earth's mass balance. In this regard, it is worth noting that early Archean Barbarton komatiites possess chondritic La/Nb ratios, and Nb/Ta ~15, a value comparable to Allende CV3 chondrite. This observation is not consistent with the storage of Nb (or Ta) in the core and suggests that the silicate Earth controls the planetary budget of Nb and Ta. Constraints on the amount of Nb in the core must be evaluated by multi-element approaches, using ratios of refractory lithophile elements. Chondritic ratios for La/Nb and Nb/Ta are not defined simply as a single value with a restricted range and are not always constant, with examples of both negligible and distinct differences between groups of chondrites. The database for chondrites is still small for Nb and Ta.

  4. The potential of Biochar technology in combating rocky desertification in the Karst area of south China*

    Science.gov (United States)

    Lee, X.; Xing, Y.; Fang, B.; Zhang, L.; Yang, F.; Zhou, H.

    2012-04-01

    field experiments using the Biochar technology. Here we report the results. As a province with the dominating agriculture, Guizhou produces 10~30 million tons of crop stalks annually, of which roughly 10% were used as fodder of domestic animals or in some other ways while most were subject to the notorious field combustion. The provincial government has issued policies calling for the exploitation of this renewable resource, no breakthrough, however, has been made toward this goal due to the low economic benefit of the current straw use technologies. Should the straws be used in the biochar way, based on our data of field experiments in Guizhou province, the biomass could yield 300~900 thousand tons of charcoal, which would sequester the atmospheric CO2 by 10~30 million tons. Meanwhile the application of the biochar in the basic farmland would enhance the production of corn and rapeseed by about 30%, and the total production of crop by 300 thousand tons. The increased benefit from these two sources is equivalent to a total of 6600 million RMB, or 244 Yuan per capita of farmers per year in the whole province. This income would enable 850 thousand hectares of hill slopes to be relieved from cultivation without impairing the food security. This area accounts for 25% of the total rocky desertification of the province, or 65% of its medium ~severe desertified hillsides. *This research was financially supported by the Strategic Priority Research Program of the Chinese Academy of Sciences (No. XDA05070400), the National Natural Science Foundation of China (No. 41021062, 40872212) and the Key Technologies R & D Project in Agriculture of Guizhou Province (No.[2011]3079).

  5. Traditional Science and Technology in the Socio-Cultural Context of Rural Areas. Teaching of Science and Technology in Rural Areas.

    Science.gov (United States)

    National Council of Educational Research and Training, New Delhi (India).

    Most science curriculum innovations seem to have their origins and emphases in urban intellectual concerns and their content generally caters to university bound students. The reason for the failure of rural students in science subjects may be the lack of relevancy of the program to the needs of individuals living in rural areas. This 22-hour…

  6. Metropolitian area network services comprised of virtual local area networks running over hybrid fiber-coax and asynchronous transfer mode technologies

    Science.gov (United States)

    Biedron, William S.

    1995-11-01

    Since 1990 there has been a rapid increase in the demand for communication services, especially local and wide area network (LAN/WAN) oriented services. With the introduction of the DFB laser transmitter, hybrid-fiber-coax (HFC) cable plant designs, ATM transport technologies and rf modems, new LAN/WAN services can now be defined and marketed to residential and business customers over existing cable TV systems. The term metropolitan area network (MAN) can be used to describe this overall network. This paper discusses the technical components needed to provision these services as well as provides some perspectives on integration issues. Architecture at the headend and in the backbone is discussed, as well as specific service definitions and the technology issues associated with each. The TCP/IP protocol is suggested as a primary protocol to be used throughout the MAN.

  7. Improving Indigenous Technologies for Sustainable Land Use in Northern Mountainous Areas of Vietnam

    Institute of Scientific and Technical Information of China (English)

    Le Quoc Doanh; Ha Dinh Tuan

    2004-01-01

    More than 30 ethnic groups are now living in northern mountainous regions, Vietnam, mainly relying on shifting cultivation with the fallow period being shortened from time to time. Naturally, soil fertility reduces from cycle to cycle, entailing the reduction of productivity. Large areas of moderately sloping lands suitable for upland agriculture have become bare after many cultivation-fallow cycles. The soils there have been severely degraded with more toxicity, low porosity, low water retention capacity and poor floral diversity. Normally, these lands cannot be used for food crop cultivation. So farmers in uplands have to rely on slash-and-burn practices for their livelihood. As there is no more forest with good soil in medium slopes, farmers go to cut forests in watershed, high slope lands and old forests up to the mountains' top. There are ecologically and environmentally very sensitive areas, so their destruction will inevitably cause hazardous consequences in the whole basin. Meanwhile, cultivation in these areas has low economic efficiency and sustainability because the crop yield may decrease very fast due to severe erosion as the higher the slope, the more serious erosion. Consequently living standards of highland farmers remain low and unstable.Sustainable farming on these lands in the perspective of a seriously deteriorated ecology and environmental is not an easy task. There have beenmany projects trying to help mountainous farmers get out of their vicious circle. However, due to different reasons, the results gained are low, and in some cases, things ceased to move after the projects phased out.During past few years, based on the farmer experiences, the Vietnam Agricultural Science Institute has cooperated with local and international partners to implement different projects in order to solve the problems by developing simple, easy and cheap cultivation technologies, which can be accepted and applied by local poor farmers for sustainable agricultural

  8. Manufacturing process applications team (MATEAM). [technology transfer in the areas of machine tools and robots

    Science.gov (United States)

    1979-01-01

    The transfer of NASA technology to the industrial sector is reported. Presentations to the machine tool and robot industries and direct technology transfers of the Adams Manipulator arm, a-c motor control, and the bolt tension monitor are discussed. A listing of proposed RTOP programs with strong potential is included. A detailed description of the rotor technology available to industry is given.

  9. Wet ammonia Synthesis of Semiconducting N:Ta2O5, Ta3N5 and β-TaON Films for Photoanode Applications

    NARCIS (Netherlands)

    Dabirian, A.; Van 't Spijker, H.; Van der Krol, R.

    2012-01-01

    Tantalum oxynitride (β-TaON) is a promising photoanode material for photoelectrochemical water splitting. However, the synthesis of phase-pure β-TaON films is a challenging task. This paper describes a novel approach to achieve this by the controlled nitridation of Ta2O5 films under a flow of ammoni

  10. Chemical Concentrations in Field Mice from Open-Detonation Firing Sites TA-36 Minie and TA-39 Point 6 at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Fresquez, Philip R. [Los Alamos National Laboratory

    2011-01-01

    Field mice (mostly Peromyscus spp.) were collected at two open-detonation (high explosive) firing sites - Minie at Technical Area (TA) 36 and Point 6 at TA-39 - at Los Alamos National Laboratory in August of 2010 and in February of 2011 for chemical analysis. Samples of whole body field mice from both sites were analyzed for target analyte list elements (mostly metals), dioxin/furans, polychlorinated biphenyl congeners, high explosives, and perchlorate. In addition, uranium isotopes were analyzed in a composite sample collected from TA-36 Minie. In general, all constituents, with the exception of lead at TA-39 Point 6, in whole body field mice samples collected from these two open-detonation firing sites were either not detected or they were detected below regional statistical reference levels (99% confidence level), biota dose screening levels, and/or soil ecological chemical screening levels. The amount of lead in field mice tissue collected from TA-39 Point 6 was higher than regional background, and some lead levels in the soil were higher than the ecological screening level for the field mouse; however, these levels are not expected to affect the viability of the populations over the site as a whole.

  11. Cyanide destruction/immobilization of residual sludge - mixed waste focus area. Innovative Technology Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-02-01

    Innovative Technology Summary Reports are designed to provide potential users with the information they need to quickly determine if a technology would apply to a particular environmental management problem. They are also designed for readers who may recommend that a technology be considered by prospective users. Each report describes a technology, system, or process that has been developed and tested with funding from DOE`s Office of Science and Technology (OST). A report presents the full range of problems that a technology, system, or process will address and its advantages to the DOE cleanup in terms of system performance, cost, and cleanup effectiveness. Most reports include comparisons to baseline technologies as well as other competing technologies. Information about commercial availability and technology readiness for implementation is also included. Innovative Technology Summary Reports are intended to provide summary information. References for more detailed information are provided in an appendix. Efforts have been made to provide key data describing the performance, cost, and regulatory acceptance of the technology. If this information was not available at the time of publication, the omission is noted.

  12. Thermally stable perpendicular magnetic anisotropy features of Ta/TaO{sub x}/Ta/CoFeB/MgO/W stacks via TaO{sub x} underlayer insertion

    Energy Technology Data Exchange (ETDEWEB)

    Yang, SeungMo; Lee, JaBin; An, GwangGuk [Novel Functional Materials and Devices Laboratory, Research Institute for Natural Science, Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of); Kim, JaeHong [Division of Nano-Scale Semiconductor Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Chung, WooSeong [Nano Quantum Electronics Lab, Department of Electronics and Computer Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Hong, JinPyo, E-mail: jphong@hanyang.ac.kr [Novel Functional Materials and Devices Laboratory, Research Institute for Natural Science, Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of); Division of Nano-Scale Semiconductor Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of)

    2014-09-21

    We report that a TaO{sub x} underlayer enhances the stability of perpendicular magnetic anisotropy (PMA) in TaO{sub x}/Ta/CoFeB/MgO stacks during annealing; control of oxygen content in the TaO{sub x} layer is critical. X-ray photoelectron spectroscopy observations revealed clear suppression of Ta atom diffusion towards the CoFeB/MgO interface or MgO regions. The TaO{sub x} underlayer possibly served as a diffusion sponge, permitting some thermally activated Ta atoms to impregnate the TaO{sub x} underlayer via a diffusion path, such as grain boundaries. We propose a possible mechanism for enhanced PMA stability based on diffusion of thermally activated Ta atoms.

  13. Prevention and control of coalfield fire technology: A case study in the Antaibao Open Pit Mine goaf burning area, China

    Institute of Scientific and Technical Information of China (English)

    Cao Kai; Zhong Xiaoxing; Wang Deming; Shi Guoqing; Wang Yanming; Shao Zhenlu

    2012-01-01

    It is very difficult to clearly detect the location of a burning area in a coal mine since it is hidden underground.So we conducted research on the distribution of the burning area before controlling it.Firstly,the original drilling technique was used to analyze and determine the loose and scope of caving of burning area through field test,and then obtained the gases and the temperature data in this area were according to the borehole data.By analyzing these data,we found out that the location of burning area concentrated in the loose and caving area; and finally,the location and development of the burning area within the tested area were accurately determined.Based on this theory,we used the ground penetrating radar (GPR) to find out the loose and caving scale in the burning area during the control process of the burning area,and then located the fire-extinguishing boreholes within target which we used to control burning fire in the section.A mobile comprehensive fire prevention and extinguishing system based on the three-phase foam fire prevention and control technique was then adopted and conducted in the burning area which took only 9 months to extinguish the 227,000 m2 of burning area of 9# coal.This control technology and experience will provide a very important reference to the control of other coalfield fire and hillock fire in the future.

  14. Intrabeam Scattering Studies at CesrTA

    CERN Document Server

    Fermilab; Peterson, DP; Rider, NT; Rubin, DL; Holtzapple, R; Campbell, R; Shanks, JP; Strohman, CR; Wang, S; Papaphilippou, Y

    2012-01-01

    Intrabeam scattering (IBS) dilutes the emittance of low energy, low emittance rings. Because CesrTA can be operated at low energies with low transverse emittances and high bunch intensity, it is well-suited for the study of IBS. Furthermore, CesrTA is instrumented for accurate beam size measurements in all three dimensions, providing the possibility of a complete determination of the intensity dependence of emittances. Measurements from dedicated IBS machine studies at different emittances, intensities, and species are presented. A model based on analytic IBS theories is developed and compared to the data.

  15. Innovation on Energy Power Technology (15)Great Advances in Power System Stabilizing Technology triggered by the Wide-area Outage

    Science.gov (United States)

    Egawa, Masanao

    On July 23, 1987, a very hot day, the largest wide-area power outage occurred in Kanto-Area, Japan. The cause was a voltage collapse on the bulk power network of Tokyo Electric Power Company, due to the abnormal rate of demand rising following resume after lunch break. Aggressive studies on voltage collapse throughout industry and university have led to great advances in power system stability. This essay describes the detail record of the outage, the applied countermeasures, and the inside story when the multiple voltage solutions of power flow on actual power system were found out for the first time.

  16. Technology campuses and cities: A study on the relation between innovation and the built environment at the urban area level

    Directory of Open Access Journals (Sweden)

    Flavia Teresa de Jesús Curvelo Magdaniel

    2016-08-01

    Full Text Available This thesis examines the development of technology campuses as built environments and their role  in stimulating innovation. Technology campuses entail a variety of built environments developed to accommodate technology-driven research activities of multiple organisations. The science park is the most common type of technology campus. Other types include the campuses of universities  of technology and corporate R&D parks.In industrialised countries, the demand for developing  technology  campuses  to  stimulate innovation has been growing in line with the attention given to knowledge in global, national and regional policies. There are over 700 technology campuses worldwide occupying hundred thousands  of hectares in- and around cities. This type of built environments have emerged and developed during critical periods of technological advancements throughout the 20th century, to support technology-based development in industrialised countries. With the adoption of the knowledge- based economy, governments in many countries have encouraged research as an essential activity in their science, technology and innovation policies. The infrastructure that supports research is also gaining momentum. The number of registered science parks is steadily increasing since the late 1990s. The number of programmes supporting research infrastructure is growing in the European policy agenda. Municipalities are formally engaged with other public and private parties in the development of urban areas targeted to stimulate innovation. Governments, universities and R&D companies are investing billions of euros in developing the infrastructure that will not only support their core processes, but will help them to remain competitive by attracting and retaining the best talent. Part of these investments are targeted to develop new buildings or entire areas that often result in campuses as we know them: a concentration of buildings accommodating organisations

  17. Discussion on Sustainable Water Technologies for Peri-Urban Areas of Mexico City: Balancing Urbanization and Environmental Conservation

    Directory of Open Access Journals (Sweden)

    Laura Essl

    2012-09-01

    Full Text Available Often centralized water supply, sanitation and solid waste services struggle to keep up with the rapid expansion of urban areas. The peri-urban areas are at the forefront of this expansion and it is here where decentralized technologies are increasingly being implemented. The introduction of decentralized technologies allows for the development of new opportunities that enable the recovery and reuse of resources in the form of water, nutrients and energy. This resource-oriented management of water, nutrients and energy requires a sustainable system aimed at low resource use and high recovery and reuse rates. Instead of investigating each sector separately, as has been traditionally done, this article proposes and discusses a concept that seeks to combine the in- and outflows of the different sectors, reusing water and other liberated resources where possible. This paper shows and demonstrates examples of different types of sustainable technologies that can be implemented in the peri-urban areas of Mexico City [rainwater harvesting, EcoSan and biofiltros (small constructed wetlands, and (vermi-composting]. An innovative participatory planning method, combining scenario development with a participatory planning workshop with key stakeholders, was applied and resulted in three concept scenarios. Specific technologies were then selected for each concept scenario that the technical feasibility and applicability was assessed. Following this, the resulting resource flows (nutrients, water and energy were determined and analyzed. The results show that decentralized technologies not only have the potential to deliver adequate water supply, sanitation and solid waste services in peri-urban areas and lessen environmental pollution, but also can recover significant amounts of resources thereby saving costs and providing valuable inputs in, for instance, the agricultural sector. Social acceptance of the technologies and institutional cooperation, however, is

  18. Discussion on Sustainable Water Technologies for Peri-Urban Areas of Mexico City: Balancing Urbanization and Environmental Conservation

    Directory of Open Access Journals (Sweden)

    Tiemen A. Nanninga

    2012-09-01

    Full Text Available Often centralized water supply, sanitation and solid waste services struggle to keep up with the rapid expansion of urban areas. The peri-urban areas are at the forefront of this expansion and it is here where decentralized technologies are increasingly being implemented. The introduction of decentralized technologies allows for the development of new opportunities that enable the recovery and reuse of resources in the form of water, nutrients and energy. This resource-oriented management of water, nutrients and energy requires a sustainable system aimed at low resource use and high recovery and reuse rates. Instead of investigating each sector separately, as has been traditionally done, this article proposes and discusses a concept that seeks to combine the in- and outflows of the different sectors, reusing water and other liberated resources where possible. This paper shows and demonstrates examples of different types of sustainable technologies that can be implemented in the peri-urban areas of Mexico City [rainwater harvesting, EcoSan and biofiltros (small constructed wetlands, and (vermi-composting]. An innovative participatory planning method, combining scenario development with a participatory planning workshop with key stakeholders, was applied and resulted in three concept scenarios. Specific technologies were then selected for each concept scenario that the technical feasibility and applicability was assessed. Following this, the resulting resource flows (nutrients, water and energy were determined and analyzed. The results show that decentralized technologies not only have the potential to deliver adequate water supply, sanitation and solid waste services in peri-urban areas and lessen environmental pollution, but also can recover significant amounts of resources thereby saving costs and providing valuable inputs in, for instance, the agricultural sector. Social acceptance of the technologies and institutional cooperation

  19. Miks ta nii teeb? / Kristiina Voolaid

    Index Scriptorium Estoniae

    Voolaid, Kristiina

    1999-01-01

    Kuidas mõtleb ruumikujundaja, kui ta valib vorme, värve, materjale ja esemeid? Sisearhitekt Kristiina Voolaid seletab oma mõtteid Kawe Plaza hoones asuvate Hüvitusfondi ja Werol Tehased kontorite ning noorele perekonnale sisustatud vanalinnakorteri näitel

  20. Miks ta nii teeb? / Kristiina Voolaid

    Index Scriptorium Estoniae

    Voolaid, Kristiina

    1999-01-01

    Kuidas mõtleb ruumikujundaja, kui ta valib vorme, värve, materjale ja esemeid? Sisearhitekt Kristiina Voolaid seletab oma mõtteid Kawe Plaza hoones asuvate Hüvitusfondi ja Werol Tehased kontorite ning noorele perekonnale sisustatud vanalinnakorteri näitel

  1. Assistive Technology and Supports Provision: A Selective Review of the Literature and Proposed Areas of Application

    Science.gov (United States)

    Bryant, Brian R.; Bryant, Diane Pedrotty; Shih, Minyi; Seok, Soohwha

    2010-01-01

    Thirty-one research articles were examined to investigate the empirical evidence supporting the use of assistive technology as a type of support for people with intellectual disability in relation to the seven domains of support provision identified in the Supports Intensity Scale. Results indicated that assistive technology devices can be a…

  2. Dry etching of poly-Si/TaN/HfSiON gate stack for advanced complementarymetal-oxide-semiconductor devices

    Institute of Scientific and Technical Information of China (English)

    Li Yongliang; Xu Qiuxia

    2011-01-01

    A novel dry etching process of a poly-Si/TaN/HfSiON gate stack for advanced complementary metal-oxide-semiconductor (CMOS) devices is investigated.Our strategy to process a poly-Si/TaN/HfSiON gate stack is that each layer of gate stack is selectively etched with a vertical profile.First,a three-step plasma etching process is developed to get a vertical poly-Si profile and a reliable etch-stop on a TaN metal gate.Then different BCl3-based plasmas are applied to etch the TaN metal gate and find that BC13/Cl2/O2/Ar plasma is a suitable choice to get a vertical TaN profile.Moreover,considering that C12 almost has no selectivity to Si substrate,BCl3/Ar plasma is applied to etch HfSiON dielectric to improve the selectivity to Si substrate after the TaN metal gate is vertically etched off by the optimized BCl3/Cl2/O2/Ar plasma.Finally,we have succeeded in etching a poly-Si/TaN/HfSiON stack with a vertical profile and almost no Si loss utilizing these new etching technologies.

  3. Critical role of the semiconductor-electrolyte interface in photocatalytic performance for water-splitting reactions using Ta3N5 particles

    KAUST Repository

    Nurlaela, Ela

    2014-08-26

    Distinct photocatalytic performance was observed when Ta3N 5 was synthesized from commercially available Ta2O 5 or from Ta2O5 prepared from TaCl5 via the sol-gel route. With respect to photocatalytic O2 evolution with Ag+ as a sacrificial reagent, the Ta3N5 produced from commercial Ta2O5 exhibited higher activity than the Ta3N5 produced via the sol-gel route. When the Ta3N5 photocatalysts were decorated with Pt nanoparticles in a similar manner, the Ta3N5 from the sol-gel route exhibited higher photocatalytic hydrogen evolution activity from a 10% aqueous methanol solution than Ta3N5 prepared from commercial Ta2O5 where no hydrogen can be detected. Detailed surface and bulk characterizations were conducted to obtain fundamental insight into the resulting photocatalytic activities. The characterization techniques, including XRD, elemental analysis, Raman spectroscopy, UV-vis spectroscopy, and surface-area measurements, revealed only negligible differences between these two photocatalysts. Our thorough characterization of the surface properties demonstrated that the very thin outermost layer of Ta3N5, with a thickness of a few nanometers, consists of either the reduced state of tantalum (TaN) or an amorphous phase. The extent of this surface layer was likely dependent on the nature of precursor oxide surfaces. DFT calculations based on partially oxidized Ta3N4.83O0.17 and N deficient Ta3N4.83 consisting of reduced Ta species well described the optoelectrochemical properties obtained from the experiments. Electrochemical and Mott-Schottky analyses demonstrated that the surface layer drastically affects the energetic picture at the semiconductor-electrolyte interface, which can consequently affect the photocatalytic performance. Chemical etching of the surface of Ta3N5 particles to remove this surface layer unites the photocatalytic properties with the photocatalytic performance of these two materials. Mott-Schottky plots of these chemically etched Ta3N5 materials

  4. Capacity building for the effective adoption of renewable energy technologies in rural areas. Experience of India NGOs

    Energy Technology Data Exchange (ETDEWEB)

    Myles, R. [Integrated Sustainable Energy and Ecological Development Association (INSEDA), New Delhi (India)

    2002-07-01

    The experience of NGO network in the promotions of biogas and other low cost RET gadgets, devices, equipments and machines in the rural areas of India, for over two decades, have shown that there are serveral problems yet challenging opportunities in the promotion and implementation of renewable energy technologies in villages. First of all, the field and extension organizations should recognise that these technologies are new and aliens to the rural people, therefore like any other technologies, developed outside the rural environment, RETs are first view with skepticism by the rural community. Even if 100 units of a RE technology are successfully demonstrated, failure of even one could create negative impact within a radius of 30-50 KMs, and its shortcomings are spread like a wild fire. The appropriate technology demonstration backed by systematic capacity building of different stakeholders/actors/players (i.e. Energy Producers, Energy Service Providers and the Energy End Users) is a must for the acceptance and large-scale adoption of RETs in rural areas of the developing countries. The programme funds for the promotion and implementation of RETs should have good percentage earmarked for the capacity building as well as supporting infrastructure for awareness, motivation, promotional and post installation services activities by local field level organizations and NGOs on a long term basis. (orig.)

  5. Analysis of adoption of improved rice production technologies in Jeer local government area of Borno state, Nigeria

    Directory of Open Access Journals (Sweden)

    Mustapha, S.B.

    2013-12-01

    Full Text Available The study analysed adoption of improved rice production technologies in Jere Local Government Area of Borno State, Nigeria. Descriptive statistics such as frequencies and percentages were used to analyse the data. The study revealed that 98.12% of the respondents were male, 57.5% were within 41-50 years and most (33.12% of the respondents had adult education. The study revealed that majority (56.25% of the respondents was aware of the rice production technologies in the study area. Majority of the respondents tried rice production technologies with respect to high yielding varieties (77.50%, early maturing varieties (69.37%, use of weedicides (93.75%, broadcasting method (55.00%, manual harvesting (75.00% and bagging (63.75%. The study revealed that unavailability of fertilizer was the major (96.25% constraint affecting the adoption of rice production technologies by respondents. The study recommends that extension services should be strengthened with necessary inputs for improved adoption of rice production technologies by respondents.

  6. Factors Influencing Willingness and Ability of Farmers to Adopt New Technologies:A Case Study of Guanzhong Area

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Based on data of 248 rural households in Pucheng County and Huxian County,we established the Two-Level Logit Model to analyze the willingness of farmers to adopt new technologies,its influence factors,and probability of successful adoption of new technologies.Results show that the willingness has positive correlation with whether the farmer is head of household,the educational level,occupation,agricultural loan,the number of family labor,and information dissemination channel,while it has negative correlation with non-agricultural employment proportion and whether the farmer is village cadre.In the model of the probability of farmers’successfully adopting new technologies,occupation,agricultural loan,planting area,gender and educational level are positively correlated,while age and non-agricultural employment proportion are negatively correlated.Largescale flow of rural labor plays a negative role in popularization of technologies in rural areas through influencing factors,including number of family labor,non-agricultural employment proportion,educational level,gender,and whether the farmer is village cadre.Finally,on the basis of results of empirical study,we put forward countermeasures and suggestions for strengthening ability of farmers to adopt new technologies.

  7. "ta surnud sõbrad..." : [luuletused] / Caspar Tops

    Index Scriptorium Estoniae

    Tops, Caspar

    2002-01-01

    Autorist lk 133. Sisu: "ta surnud sõbrad..." ; "ta kummaline hüüd..." ; "nii salakaval oli üks naine..." ; "ta tõmbas..." ; "mul meeles üks..." ; "rohi saab lahti iga päev üha..." ; "aeg riietab end lahti..." ; "ta kunagi..." ; "me riietume..." ; "ma tean armastuse põsepuna..." ; "kunas see suudlus..." ; "sina mu mälestuste tydruk..." ; "su õde mind armastas..." ; "hingata valutult..." ; "need juuksed pesemata..." ; "ah saab olema..." ; "siit natuke maad edasi..."

  8. The Geography of the ta-ra-si-ja

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    2000-01-01

    Thies paper demonstrates how ta-ra-si-ja is connected to a fixed series of toponyms in Crete, and concludes that ta-ra-si-ja is a duty limited to certain places......Thies paper demonstrates how ta-ra-si-ja is connected to a fixed series of toponyms in Crete, and concludes that ta-ra-si-ja is a duty limited to certain places...

  9. "ta surnud sõbrad..." : [luuletused] / Caspar Tops

    Index Scriptorium Estoniae

    Tops, Caspar

    2002-01-01

    Autorist lk 133. Sisu: "ta surnud sõbrad..." ; "ta kummaline hüüd..." ; "nii salakaval oli üks naine..." ; "ta tõmbas..." ; "mul meeles üks..." ; "rohi saab lahti iga päev üha..." ; "aeg riietab end lahti..." ; "ta kunagi..." ; "me riietume..." ; "ma tean armastuse põsepuna..." ; "kunas see suudlus..." ; "sina mu mälestuste tydruk..." ; "su õde mind armastas..." ; "hingata valutult..." ; "need juuksed pesemata..." ; "ah saab olema..." ; "siit natuke maad edasi..."

  10. Idaho National Engineering Laboratory Waste Area Groups 1-7 and 10 Technology Logic Diagram. Volume 3

    Energy Technology Data Exchange (ETDEWEB)

    O`Brien, M.C.; Meservey, R.H.; Little, M.; Ferguson, J.S.; Gilmore, M.C.

    1993-09-01

    The Idaho National Engineering Laboratory (INEL) Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates Environmental Restoration (ER) and Waste Management (WM) problems at the INEL to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to an environmental restoration need. It is essential that follow-on engineering and system studies be conducted to build on the output of this project. These studies will begin by selecting the most promising technologies identified in this TLD and finding an optimum mix of technologies that will provide a socially acceptable balance between cost and risk to meet the site windows of opportunity. The TLD consists of three separate volumes: Volume I includes the purpose and scope of the TLD, a brief history of the INEL Waste Area Groups, and environmental problems they represent. A description of the TLD, definitions of terms, a description of the technology evaluation process, and a summary of each subelement, is presented. Volume II describes the overall layout and development of the TLD in logic diagram format. This section addresses the environmental restoration of contaminated INEL sites. Volume III (this volume) provides the Technology Evaluation Data Sheets (TEDS) for Environmental Restoration and Waste Management (EM) activities that are reference by a TEDS code number in Volume II. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than provided for technologies in Volume II. Data sheets are arranged alphanumerically by the TEDS code number in the upper right corner of each sheet.

  11. Ethical considerations of clinical photography in an area of emerging technology and smartphones.

    Science.gov (United States)

    Van der Rijt, Rhys; Hoffman, Stuart

    2014-03-01

    Recent advances in digital technology including internet, email and smartphones has revolutionised clinical photography and medical record data storage. The use of smartphones is becoming ubiquitous among medical professionals and the use of clinical photography has become an integral component of the management of patients in a variety of visually orientated specialties. Although clinical photography has its benefits, with this evolving technology also emerge new ethical, legal and social issues, which clinicians must be aware of.

  12. Area Efficient 3.3GHZ Phase Locked Loop with Four Multiple Output Using 45NM VLSI Technology

    Directory of Open Access Journals (Sweden)

    Ms. Ujwala A. Belorkar

    2011-03-01

    Full Text Available This paper present area efficient layout designs for 3.3GigaHertz (GHz Phase Locked loop (PLL withfour multiple output. Effort has been taken to design Low Power Phase locked loop with multiple output,using VLSI technology. VLSI Technology includes process design, trends, chip fabrication, real circuitparameters, circuit design, electrical characteristics, configuration building blocks, switching circuitry,translation onto silicon, CAD and practical experience in layout design. The proposed PLL is designedusing 45 nm CMOS/VLSI technology with microwind 3.1. This software allows designing and simulatingan integrated circuit at physical description level. The main novelties related to the 45 nm technology arethe high-k gate oxide, metal gate and very low-k interconnect dielectric. The effective gate lengthrequired for 45 nm technology is 25nm. Low Power (0.211miliwatt phase locked loop with four multipleoutputs as PLL8x, PLL4x, PLL2x, & PLL1x of 3.3 GHz, 1.65 GHz, 0.825 GHz, and 0.412 GHzrespectively is obtained using 45 nm VLSI technology.

  13. Analytical Study of Interdisciplinary Relations in Selected High Priority Areas of Science and Technology Based on Data of ISI Database

    Directory of Open Access Journals (Sweden)

    Mehri Sedighi

    2014-03-01

    Full Text Available The purpose of this research is to investigate the interdisciplinary relations in selected high priority areas of science and technology based on ISI data. This is an applied study using scientometric, citation analysis and network analysis methods. After identifying and extracting data from WOS, in order to determine the interdisciplinary relations and the evolution of these relationships, all citations of these records have been analysed. In order to judge the interdisciplinarity of data, the results of the two approaches have been considered: 1-To determine the subject areas of the journals 2- To determine the institutional affiliation of the authors.There is a positive correlation between co-authorship and interdisciplinary approach in all studied areas. There is no significant relation between the number of citations and interdisciplinary approach. Mapping of interdisciplinary relationships in nanotechnology showed this is a unique method to discover the structural patterns of a research area.

  14. Fabrication of tunnel junctions on thick X-ray absorbing substrates of Nb and Ta

    NARCIS (Netherlands)

    Hamster, A.W.; Ferrari, E.; Adelerhof, D.J.; Brons, G.C.S.; Schoofs, I.J.E.; Flokstra, J.; Rogalla, H.; Bruijn, M.P.; Kiewiet, F.; Luiten, O.J.; Korte, de P.A.J.

    1996-01-01

    X-ray detectors based on absorber-junction combinations can combine a large detector area with position resolution and good energy resolution. We plan to use a thick, single crystal Nb or Ta absorber with readout tunnel junctions integrated on top as our next generation X-ray detector. The thickness

  15. Hydrogen storage for vehicular applications: Technology status and key development areas

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, S.L.; Handrock, J.L.

    1994-04-01

    The state-of-the-art of hydrogen storage technology is reviewed, including gaseous, liquid, hydride, surface adsorbed media, glass microsphere, chemical reaction, and liquid chemical technologies. The review of each technology includes a discussion of advantages, disadvantages, likelihood of success, and key research and development activities. A preferred technological path for the development of effective near-term hydrogen storage includes both cur-rent DOT qualified and advanced compressed storage for down-sized highly efficient but moderate range vehicles, and liquid storage for fleet vehicle applications. Adsorbate media are also suitable for fleet applications but not for intermittent uses. Volume-optimized transition metal hydride beds are also viable for short range applications. Long-term development of coated nanoparticulate or metal matrix high conductivity magnesium alloy, is recommended. In addition, a room temperature adsorbate medium should be developed to avoid cryogenic storage requirements. Chemical storage and oxidative schemes present serious obstacles which must be addressed for these technologies to have a future role.

  16. Participatory evaluation of monitoring and modeling of sustainable land management technologies in areas prone to land degradation.

    Science.gov (United States)

    Stringer, L C; Fleskens, L; Reed, M S; de Vente, J; Zengin, M

    2014-11-01

    Examples of sustainable land management (SLM) exist throughout the world. In many cases, SLM has largely evolved through local traditional practices and incremental experimentation rather than being adopted on the basis of scientific evidence. This means that SLM technologies are often only adopted across small areas. The DESIRE (DESertIfication mitigation and REmediation of degraded land) project combined local traditional knowledge on SLM with empirical evaluation of SLM technologies. The purpose of this was to evaluate and select options for dissemination in 16 sites across 12 countries. It involved (i) an initial workshop to evaluate stakeholder priorities (reported elsewhere), (ii) field trials/empirical modeling, and then, (iii) further stakeholder evaluation workshops. This paper focuses on workshops in which stakeholders evaluated the performance of SLM technologies based on the scientific monitoring and modeling results from 15 study sites. It analyses workshop outcomes to evaluate how scientific results affected stakeholders' perceptions of local SLM technologies. It also assessed the potential of this participatory approach in facilitating wider acceptance and implementation of SLM. In several sites, stakeholder preferences for SLM technologies changed as a consequence of empirical measurements and modeling assessments of each technology. Two workshop examples are presented in depth to: (a) explore the scientific results that triggered stakeholders to change their views; and (b) discuss stakeholders' suggestions on how the adoption of SLM technologies could be up-scaled. The overall multi-stakeholder participatory approach taken is then evaluated. It is concluded that to facilitate broad-scale adoption of SLM technologies, de-contextualized, scientific generalisations must be given local context; scientific findings must be viewed alongside traditional beliefs and both scrutinized with equal rigor; and the knowledge of all kinds of experts must be

  17. Singular technology – the research area promoting sustainable noosphere d evelopment in Belarus, Russia and other CIS nations

    Directory of Open Access Journals (Sweden)

    Petr Georgievich Nikitenko

    2014-05-01

    Full Text Available The article is devoted to nano- and femtotechnology as the basis for sustainable noosphere development of the global socio-economic mega system “nature–man–society” in its relation with the Universe (cosmos in Belarus, Kazakhstan, Russia, Ukraine and other CIS nations. Such factors as the formation of a new (noospheric political and economic outlook and the changes in scientific and technological structure of economy are gaining paramount importance under the action of the law of time and the adequate need to change the logic of socio-economic behavior of the population of planet Earth. Singular technology can become a strategic priority in finding practical solutions to these issues. When creating new productive forces and relations of production, these technologies act as a synergetic and bifurcation (unpredictable interaction of the three system technologies: artificial intelligence, molecular nanotechnology and molecular biotechnology. As soon as man grasps the essence of singular technology, it will be possible to create a new structure of matter at the nano- and femtotechnology levels, and to exercise control over this process. The new structure of matter is the basis for the creation of new productive forces and relations of production in the noosphere economy. Technological singularity originated in the mapping of the human genome, creation of a self-replicating organism, and a self-replicating machine. The nearest strategic objective (2020–2030s of singular technology is to create an artificial brain – a “digital man” on the basis of nano-and femtotechnology. This research area and practice will open the way to new forms of energy, productive forces, industrial relations and socio-economic noosphere systems in general. The wide application of singular technology in the economy will contribute to the conservation and civilizational development of the planetary megasystem “cosmos–nature–man–society”

  18. Electrical and Electrochemical Properties of Nitrogen-Containing Tetrahedral Amorphous Carbon (ta-C) Thin Films

    Science.gov (United States)

    Yang, Xingyi

    Tetrahedral amorphous carbon (ta-C) is a diamond-like carbon (DLC) material comprised of a mixture of sp2 (˜40%) and sp3-bonded (˜60%) carbon domains. The physicochemical structure and electrochemical properties depend strongly on the sp2/sp3 bonding ratio as well as the incorporation of impurities, such as hydrogen or nitrogen. The ability to grow ta-C films at lower temperatures (25-100 °C) on a wider variety of substrates is a potential advantage of these materials as compared with diamond films. In this project, the basic structural and electrochemical properties of nitrogen-incorporated ta-C thin films will be discussed. The major goal of this work was to determine if the ta-C:N films exhibit electrochemical properties more closely aligned with those of boron-doped diamond (sp 3 carbon) or glassy carbon (amorphous sp2 carbon). Much like diamond, ta-C:N thin-film electrodes are characterized by a low background voltammetric current, a wide working potential window, relatively rapid electron-transfer kinetics for aqueous redox systems, such as Fe(CN) 6-3/-4 and Ru(NH3)6+3/+2 , and weak adsorption of polar molecules from solution. For example, negligible adsorption of methylene blue was found on the ta-C:N films in contrast to glassy carbon; a surface on which this molecule strongly adsorbs. The film microstructure was studied with x-ray photoelectron microscopy (XPS), visible Raman spectroscopy and electron-energy loss spectroscopy (EELS); all of which revealed the sp2-bonded carbon content increased with increasing nitrogen. The electrical properties of ta-C:N films were studied by four-point probe resistance measurement and conductive-probe AFM (CP-AFM). The incorporation of nitrogen into ta-C films increased the electrical conductivity primarily by increasing the sp2-bonded carbon content. CP-AFM showed the distribution of the conductive sp2-carbon on the film surface was not uniform. These films have potential to be used in field emission area. The

  19. Research Update: Large-area deposition, coating, printing, and processing techniques for the upscaling of perovskite solar cell technology

    Science.gov (United States)

    Razza, Stefano; Castro-Hermosa, Sergio; Di Carlo, Aldo; Brown, Thomas M.

    2016-09-01

    To bring perovskite solar cells to the industrial world, performance must be maintained at the photovoltaic module scale. Here we present large-area manufacturing and processing options applicable to large-area cells and modules. Printing and coating techniques, such as blade coating, slot-die coating, spray coating, screen printing, inkjet printing, and gravure printing (as alternatives to spin coating), as well as vacuum or vapor based deposition and laser patterning techniques are being developed for an effective scale-up of the technology. The latter also enables the manufacture of solar modules on flexible substrates, an option beneficial for many applications and for roll-to-roll production.

  20. Potential of nano-technology for applications in the energy area; Potenziale der Nanotechnologien fuer Anwendungen im Energiebereich

    Energy Technology Data Exchange (ETDEWEB)

    Hoehener, K.; Moeckli, M.

    2002-07-01

    This short report for the Swiss Federal Office of Energy (SFOE) presents an overview on nano-technologies and reviews their potential for use in the energy area. Three categories - nano-materials, nano-structures and nano-structuring - are proposed and described. Illustrative examples for each category are given and their possible use in the materials, energy-efficiency and renewable energy areas are discussed. Reference is made to projects being carried out under the Swiss 'Top-Nano 21' programme including thermally protective coatings for gas-turbine components, cold-cathode fluorescent lamps and thin-film solar cells.

  1. Estimating soil erosion changes in the Wenchuan earthquake disaster area using geo-spatial information technology

    Science.gov (United States)

    Zhang, Bing; Jiao, Quanjun; Wu, Yanhong; Zhang, Wenjuan

    2009-05-01

    The secondary disasters induced by the Wenchuan earthquake of May 12, 2008, such as landslides, collapsing rocks, debris flows, floods, etc., have changed the local natural landscape tremendously and caused heavy soil erosion in the earthquake-hit areas. Using thematic mapper images taken before the earthquake and airborne images taken after the earthquake, we extracted information about the destroyed landscape by utilizing remote sensing and geographical information system techniques. Then, taking into account multi-year precipitation, vegetation cover, soil type, land use, and elevation data, we evaluated the soil erosion area and intensity using the revised universal soil loss equation. Results indicate that the soil erosion in earthquake-hit areas was exacerbated, with the severe erosion area increasing by 279.2 km2, or 1.9% of the total statistical area. Large amounts of soil and debris blocked streams and formed many barrier lakes over an area of more than 3.9 km2. It was evident from the spatial distribution of soil erosion areas that the intensity of soil erosion accelerated in the stream valley areas, especially in the valleys of the Min River and the Jian River.

  2. Adaption of Cognitive Radio technology to low-cost and low-power wireless Personal Area Network devices

    DEFF Research Database (Denmark)

    Rohde, John; Toftegaard, Thomas Skjødeberg

    2011-01-01

    The application of wireless personal area network (WPAN) and simple point-to-point wireless communication devices has increased drastically both in private household and in our workspaces in general over the last decade. Combined with the fact that the total number of wireless devices and associa......The application of wireless personal area network (WPAN) and simple point-to-point wireless communication devices has increased drastically both in private household and in our workspaces in general over the last decade. Combined with the fact that the total number of wireless devices...... discusses the challenges associated with the implementation of highly reliable low-power WPAN networks for the future and the adaption of Cognitive Radio technology as a potential solution. A brief status on the maturity of CR technology will be presented as an integral part of this discussion....

  3. CO oxidation on Ta-Modified SnO2 solid solution catalysts

    Science.gov (United States)

    Han, Xue; Xu, Xianglan; Liu, Wenming; Wang, Xiang; Zhang, Rongbin

    2013-06-01

    Co-precipitation method was adopted to prepare Sn-Ta mixed oxide catalysts with different Sn/Ta molar ratios and used for CO oxidation. The catalysts were investigated by N2-Brunauer-Emmett-Teller (N2-BET), X-ray diffraction patterns (XRD), H2-temperature programmed reduction (H2-TPR), Thermal Gravity Analysis - Differential Scanning Calorimetry (TGA-DSC) techniques. It is revealed that a small amount of Ta cations can be doped into SnO2 lattice to form solid solution by co-precipitation method, which resulted in samples having higher surface areas, improved thermal stability and more deficient oxygen species on the surface of SnO2. As a result, those Sn rich Sn-Ta solid solution catalysts with an Sn/Ta molar ratio higher than 4/2 showed significantly enhanced activity as well as good resistance to water deactivation. It is noted here that if tantala disperses onto SnO2 surface instead of doping into its lattice, it will then have negative effect on its activity.

  4. Application Summary of Ultrasonic Electric Desalting Technology in Yong-ping Refinery 2,500,000 t/a Atmospheric Distillation Unit%超声波电脱盐技术在永坪炼油厂250万吨/年常压装置应用总结

    Institute of Scientific and Technical Information of China (English)

    白雪莲; 殷飞

    2012-01-01

    超声波电脱盐破乳技术是新兴的原油破乳技术,具有无污染、脱盐效果好等特点。超声波全部代替破乳荆在延长石油永坪炼油厂250万怕常压装置电脱盐系统中的工业应用表明:超声波电脱盐系统操作方便,设备使用性能稳定、可靠,电脱盐效果较好,脱后含盐降低,由投用前平均4.0mg/L降至投用后的3.6mg/L,脱水含油、COD投用前后基本相当,不仅每月节约破乳剂16t、节资17.6万元,而且大大减轻了工人劳动强度,达到了预期的技术改造目的。%Ultrasonic electric desalting demulsification technology is a new crude oil demulsification technology with some characteristics, includingnon-pollution, good desalting effect and so on. The industrial application of ultrasonic which has completely instead of demulsifier in the Shaanxi Yancbang Petroleum(Group) Corp. Ltd. Yongping Refinery 2,500,000 t/a atmospheric distillation unit shows that the ultrasonic electric desalting system is convenient operation, the equipments serviceability is stable and reliable, the electric desalting has obverse effect that the salt content decrease from 4.0 mg/L before the new technology is used to 3.6 mg/L after it's used and the oil content of dehydration and COD are basically equal and the new technology not only saves 16ton demulsifier and 17.6 million RMB every month, but also decreases greatly the intensity of labor, reaching the aim as planed.

  5. Idaho National Engineering Laboratory waste area groups 1--7 and 10 Technology Logic Diagram. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    O`Brien, M.C.; Meservey, R.H.; Little, M.; Ferguson, J.S.; Gilmore, M.C.

    1993-09-01

    The Technology Logic Diagram was developed to provide technical alternatives for environmental restoration projects at the Idaho National Engineering Laboratory. The diagram (three volumes) documents suggested solutions to the characterization, retrieval, and treatment phases of cleanup activities at contaminated sites within 8 of the laboratory`s 10 waste area groups. Contaminated sites at the laboratory`s Naval Reactor Facility and Argonne National Laboratory-West are not included in this diagram.

  6. The Research on The Fusion Technology of Wireless LANs and Personal Area Networks for Emergency Secure in Coal Mine

    Science.gov (United States)

    Chiyuan, Li

    The author has provided craft brother with predictive wireless communication modality and imaginative solutions, and discussed the applied mode of amalgamation technology of wireless LANs and personal area networks for emergency secure in coal mine. The fire protection jobs of emergency secure will become more scientific, more efficient and more flexible in this circumstance. The study can supply bailout team with the situation of a disaster and the location of miner, enhance the efficiency of emergency secure in coal mine.

  7. Deformation Twinning During Nanoindentation of Nanocrystalline Ta

    OpenAIRE

    Wang, Y. M.; Hodge, A. M.; Biener, J.; Hamza, A.V.; Barnes, D E; Liu, Kai; Nieh, T. G.

    2005-01-01

    The deformation mechanism of body-centered cubic (bcc) nanocrystalline tantalum with grain sizes of 10–30 nm is investigated by nanoindentation, scanning electron microscopy and high-resolution transmission electron microscopy. In a deviation from molecular dynamics simulations and existing experimental observations on other bcc nanocrystalline metals, the plastic deformation of nanocrystalline Ta during nanoindentation is controlled by deformation twinning. The observation of multiple twin i...

  8. Interpreting Medieval Inter-tidal Features at Weelie's Taing on Papa Westray, Orkney, NE Scotland

    Science.gov (United States)

    Pollard, Edward; Gibson, Julie; Littlewood, Mark

    2016-12-01

    Investigation of the inter-tidal heritage of the Orkney Islands is used to interpret a previously perplexing complex at Weelie's Taing on Papa Westray. The study revealed a previously unknown type of harbour since identified in several locations around Orkney. Situated in exposed environmental situations, shelter is formed by an `ayre', a type of spit that encloses a loch, and which has been used historically as a landing place or crossing of the inter-tidal zone. A complex landing area, pier, tower and ship-blockage suggest Weelie's Taing was used as a harbour. Important fishing grounds exploited since the Neolithic are nearby, and Papa Westray was the site of water-focussed religious communities. It is suggested that Weelie's Taing was in use in the medieval period when Papa Westray was less isolated than today with the presence of ecclesiastical communities and situation on the Orkney-Shetland route.

  9. Key seismic exploration technology for the Longwangmiao Fm gas reservoir in Gaoshiti–Moxi area, Sichuan Basin

    Directory of Open Access Journals (Sweden)

    Guangrong Zhang

    2016-10-01

    Full Text Available The dolomite reservoirs of the Lower Cambrian Longwangmiao Fm in the Gaoshiti–Moxi area, Sichuan Basin, are deeply buried (generally 4400–4900 m, with high heterogeneity, making reservoir prediction difficult. In this regard, key seismic exploration technologies were developed through researches. Firstly, through in-depth analysis on the existing geologic, drilling, seismic data and available research findings, basic surface and subsurface structures and geologic conditions within the study area were clarified. Secondly, digital seismic data acquisition technologies with wide azimuth, wide frequency band and minor bins were adopted to ensure even distribution of coverage of target formations through optimization of the 3D seismic geometry. In this way, high-accuracy 3D seismic data can be acquired through shallow, middle and deep formations. Thirdly, well-control seismic data processing technologies were applied to enhance the signal-to-noise ratio (SNR of seismic data for deep formations. Fourthly, a seismic response model was established specifically for the Longwangmiao Fm reservoir. Quantitative prediction of the reservoir was performed through pre-stack geo-statistics. In this way, plan distribution of reservoir thicknesses was mapped. Fifthly, core tests and logging data analysis were conducted to determine gas-sensitive elastic parameters, which were then used in pre-stack hydrocarbon detection to eliminate the multiple solutions in seismic data interpretation. It is concluded that application of the above-mentioned key technologies effectively promote the discovery of largescale marine carbonate gas reservoirs of the Longwangmiao Fm.

  10. Exploitation technology of pressure relief coalbed methane in vertical surface wells in the Huainan coal mining area

    Institute of Scientific and Technical Information of China (English)

    HAN Jia-zhang; SANG Shu-xun; CHENG Zhi-zhong; HUANG Hua-zhou

    2009-01-01

    Exploitation technology of pressure relief coalbed methane in vertical surface wells is a new method for exploration of gas and coalbed methane exploitation in mining areas with high concentrations of gas, where tectonic coal developed. Studies on vertical surface well technology in the Huainan Coal Mining area play a role in demonstration in the use of clean, new energy re-sources, preventing and reducing coal mine gas accidents and protecting the environment. Based on the practice of gas drainage engineering of pressure relief coalbed methane in vertical surface wells and combined with relative geological and exploration en-gineering theories, the design principles of design and structure of wells of pressure relief coaibed methane in vertical surface wells are studied. The effects of extraction and their causes are discussed and the impact of geological conditions on gas production of the vertical surface wells are analyzed. The results indicate that in mining areas with high concentrations of gas, where tectonic coal developed, a success rate of pressure relief coalbed methane in surface vertical well is high and single well production usually great. But deformation due to coal exploitation could damage boreholes and cause breaks in the connection between aquifers and bore-holes, which could induce a decrease, even a complete halt in gas production of a single well. The design of well site location and wellbore configuration are the key for technology. The development of the geological conditions for coalbed methane have a sig-nificant effect on gas production of coalbed methane wells.

  11. Science and Technology Librarians: User Engagement and Outreach Activities in the Area of Scholarly Communication

    Science.gov (United States)

    Salisbury, Lutishoor; Speer, Julie

    2016-01-01

    This paper highlights the findings of a survey completed by ACRL/STS [Association of College and Research Libraries/Science and Technology Section] members on scholarly communication issues. In particular it identifies the percentage of their daily activities that are spent in support of scholarly communication activities; extent of change of job…

  12. Information Technology Applications on Human Resources Management Functions in Large U.S. Metropolitan Areas

    Science.gov (United States)

    Alsawafy, Qais Abdulkadum Kahalf

    2013-01-01

    The existing bond between human resources (HR) that team up in a business enterprise and the "real medium" information technology (IT) itself appears in the moment that the relationship is generated independently of the kind of enterprise and the relationship established between them. In today's competitive business world, companies who…

  13. Information Technology Applications on Human Resources Management Functions in Large U.S. Metropolitan Areas

    Science.gov (United States)

    Alsawafy, Qais Abdulkadum Kahalf

    2013-01-01

    The existing bond between human resources (HR) that team up in a business enterprise and the "real medium" information technology (IT) itself appears in the moment that the relationship is generated independently of the kind of enterprise and the relationship established between them. In today's competitive business world, companies who…

  14. Cost effective flip chip assembly and interconnection technologies for large area pixel sensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Fritzsch, T., E-mail: thomas.fritzsch@izm.fraunhofer.de [Fraunhofer IZM, Gustav-Meyer-Allee 25, Berlin 13355 (Germany); Jordan, R.; Oppermann, H. [Fraunhofer IZM, Gustav-Meyer-Allee 25, Berlin 13355 (Germany); Ehrmann, O. [Berlin Institute of Technology (TUB), Berlin 10623 (Germany); Toepper, M.; Baumgartner, T.; Lang, K.-D. [Fraunhofer IZM, Gustav-Meyer-Allee 25, Berlin 13355 (Germany)

    2011-09-11

    Much of the cost of manufacturing pixel detectors is due to bumping and flip chip assembly of the readout chips onto sensor tiles, even if it is done on wafer level. To address this issue, Fraunhofer IZM investigated two new technological approaches, namely screen printing using dry film resist and chip-to-wafer assembly. In the first approach, solder bumps with diameters of 80 and 25 {mu}m in pitches of 110 and 60 {mu}m, respectively, were produced by screen-printing solder paste using a photo-structured dry film resist. Results indicated that the technology is a viable high yield and low cost bumping process. The second approach was developed to decrease the number of manual handling steps in pixel module manufacturing, which is critical for reducing processing time and cost. Here, chip designs on 200 mm readout chip (ROC) wafers and 150 mm sensor wafers were especially adapted for chip-to-wafer assembly and to ensure that the interconnection yield and reliability could be tested. After bumping and dicing of the readout chip wafer and UBM plating on the sensor wafer, individual dice were flip chip mounted on the pre-diced sensor wafer. This paper describes the technological steps, key processing parameters and first results for both technologies.

  15. 电化学Ta2O5薄膜漏电流机理的研究进展%Research progress of formation mechanisms of electrochemically prepared Ta2O5 thin films

    Institute of Scientific and Technical Information of China (English)

    石维; 杨邦朝; 张选红; 方鸣; 马建华; 李玮; 王兴伟

    2013-01-01

    介绍了阳极Ta2O5薄膜的电化学形成机理,并重点分析了电化学形成的Ta2O5薄膜漏电流机理的研究进展.描述了影响电化学Ta2O5薄膜生长的关键因素,包括氧含量、杂质缺陷和薄膜晶化等;分析了Ta2O5薄膜漏电流机理,如空间电荷限制电流(SCLC)、Fowler-Nordheim (F-N)导电机理、Pool-Frenkel (PF)发射、Schottky(S)发射等.最后展望了降低电化学Ta2O5薄膜材料的漏电流的理论及技术发展前景,Ta2O5薄膜后期的热处理、高分子增强塑性和复合薄膜技术等方面的新技术的应用将值得期待.%Research on formation mechanisms of electrochemical Ta2O5 thin films is reviewed. The emphasis is on the mechanism of leakage current in response to light for electrochemical Ta2O5 thin films. The influence factors for the formation of Ta2O5 thin films, including oxygen content, impurities and crystallization are described. The mechanisms of leakage current, such as the Fowler-Nordheim (F-N) conductive mechanism, space charge limited current (SCLC), Pool-Frenkel (PF) emission and Schottky (S) emission are outlined. The theory and technology for decreasing leakage current Ta2O5 thin films are prospected. New technology applications, including Ta2O5 thin film heat treatment, high polymer enhanced plastic and composite thin film are expected.

  16. Nanoindentation and Adhesion Properties of Ta Thin Films

    Directory of Open Access Journals (Sweden)

    Yuan-Tsung Chen

    2013-01-01

    Full Text Available Ta films were sputtered onto a glass substrate with thicknesses from 500 Å to 1500 Å under the following conditions: (a as-deposited films were maintained at room temperature (RT, (b films were postannealed at TA=150°C for 1 h, and (c films were postannealed at TA=250°C for 1 h. X-ray diffraction (XRD results revealed that the Ta films had a body-centered cubic (BCC structure. Postannealing conditions and thicker Ta films exhibited a stronger Ta (110 crystallization than as-deposited and thinner films. The nanoindention results revealed that Ta thin films are sensitive to mean grain size, including a valuable hardness (H and Young’s modulus (E. High nanomechanical properties of as-deposited and thinner films can be investigated by grain refinement, which is consistent with the Hall-Petch effect. The surface energy of as-deposited Ta films was higher than that in postannealing treatments. The adhesion of as-deposited Ta films was stronger than postannealing treatments because of crystalline degree effect. The maximal H and E and the optimal adhesion of an as-deposited 500-Å-thick Ta film were 15.6 GPa, 180 GPa, and 51.56 mJ/mm2, respectively, suggesting that a 500-Å-thick Ta thin film can be used in seed and protective layer applications.

  17. Integration of educational and scientific-technological areas during the process of education of aerospace engineers

    Science.gov (United States)

    Mayorova, Vera

    2011-09-01

    National priorities, defined by modern state of high-tech industries, demand adequate problem solving of training professionals possessing required modern qualifications. Modern tendencies of the development of aerospace technologies, harsh competition in the market of space services and expansion of international cooperation for implementation of space projects, demand sharp increase of the scientific/technical level and competitiveness of the developed projects. Especially important is to be able to solve technological problems, which in turn define the cost and quality attributes of the designed item, as well as the ability to utilize the most modern design principles. Training of highly efficient, creative professionals who are capable of generating and implementing new ideas is a very important factor driving not only the development of national economy and industry, but also enriching the human capital of the country. Moscow State Technical University named after N.E. Bauman developed and successfully implemented the project-oriented technology of professional training for aerospace industry. It assumes a multitude of forms, methodologies and organizational events, which allow preparing the specialists - on the basis of integration of scientific/technological and educational environment - who are adapted to the conditions of the intellectual market. The Youth Space Center of the University is the base where graduate and post-graduate students attend unique lectures as a part of the facultative course "Applied Cosmonautics", participate in annual International Youth Science School "Space Development: Theory and Practice" and develop innovative technical projects aimed at creation of real-life space hardware. Microsatellite technologies are being developed in Bauman University through various projects, which are implemented in a coordinated manner by way of accomplishing the following steps: development of small-size satellites by universities, using them as

  18. The Optical Properties of Nanostructured Ta2O5 Films

    Institute of Scientific and Technical Information of China (English)

    Minmin Zhu; Wei Miao; Zhengjun Zhang

    2006-01-01

    Amorphous Ta2O5 films were prepared on Si (100) substrates by thermal oxidization. The film consisted of amorphous Ta2O5 nanostructure that grew vertically and compactly at a large range. It was found that Ta2O5 films became crystalline when annealed at or above 650℃ and remained amorphous below 650℃. The effects of annealing on the optical properties of Ta2O5 film were also discussed. It is estimated that the refraction indexes and the optical energy gaps of both amorphous Ta2O5 film and crystal one are stable. The optical energy gap of as-deposited Ta2O5 film is about 4.81 eV. The above results indicate that Ta2O5 films have a promising application in the optical devices.

  19. The Use of TaBoRR as a Heavy Oil Upgrader

    Energy Technology Data Exchange (ETDEWEB)

    Lee Brecher; Charles Mones

    2009-02-05

    Preliminary testing has shown that Western Research Institute's (WRI) Tank Bottom Recovery and Remediation (TaBoRR{reg_sign}) technology shows promise for heavy oil upgrading. Approximately 70 to 75 wt% of a Canadian Cold Lake bitumen feed was converted to a partially upgraded overhead product that could be transported directly by pipeline or blended with the parent bitumen to produce transportable crude. TaBoRR{reg_sign} was originally developed to remediate tank bottom wastes by producing a distillate product and solid waste. TaBoRR{reg_sign}'s processing steps include breaking a water-oil emulsion, recovering a light hydrocarbon fraction by distillation in a stripper unit, and pyrolyzing the residua reducing it to additional overhead and a benign coke for disposal. Cold Lake bitumen was tested in WRI's bench-scale equipment to evaluate the potential use of TaBoRR{reg_sign} technology for heavy oil upgrading to produce a stable, partially (or fully) upgraded product that will allow diluent-reduced or diluent-free transportation of bitumen or ultra-heavy crudes to market. Runs were conducted at temperatures of low, intermediate and high severity in the stripper to produce stripper overhead and bottoms. The bottoms from each of these runs were processed further in a 6-inch screw pyrolyzer to produce pyrolyzer overhead for blending with the corresponding stripper overheads. Proceeding in this fashion yielded three partially upgraded crudes. The products from TaBoRR{reg_sign} processing, the parent bitumen, and bitumen blends were subjected to stability and compatibility testing at the National Centre for Upgrading Technology (NCUT). Chemical analyses of the overhead product blends have met pipeline specifications for viscosity and density; however the bromine number does not, which might indicate the need for mild hydrotreating. Storage stability tests showed the blends to be stable. The blends were also soluble and compatible with most other Alberta

  20. Direct Electrolytic Reduction of Solid Ta2O5 to Ta with SOM Process

    Science.gov (United States)

    Chen, Chaoyi; Yang, Xiaqiong; Li, Junqi; Lu, Xionggang; Yang, Shufeng

    2016-06-01

    A process that uses the solid-oxide-oxygen-ion conducting membrane has been investigated to produce tantalum directly from solid Ta2O5 in molten CaCl2 or a molten mixture of 55.5MgF2-44.5CaF2 (in wt pct). The sintered porous Ta2O5 pellet was employed as the cathode, while the liquid copper alloy, saturated with graphite powder and encased in a one-end-closed yttria-stabilized-zirconia (YSZ) tube, acted as the anode. The electrolysis potential in this method is higher than that of the Fray-Farthing-Chen Cambridge process because the YSZ membrane tube blocks the melts to electrolyze, and only Ta2O5 is will be electrolyzed. The microstructures of reduced pellets and a cyclic voltammogram of solid Ta2O5 in molten CaCl2 were analyzed. In addition, the influence of particle size and porosity of the cathode pellets on metal-oxide-electrolyte, three-phase interlines was also discussed. The results demonstrate that the sintering temperature of cathode pellets and electrolytic temperature play important roles in the electrochemical process. Furthermore, this process can be used to produce Ta metal efficiently without the expensive cost of pre-electrolysis and generation of harmful by-products.

  1. TA-CIN, a vaccine incorporating a recombinant HPV fusion protein (HPV16 L2E6E7) for the potential treatment of HPV16-associated genital diseases.

    Science.gov (United States)

    Hibbitts, Sam

    2010-10-01

    Commercially available prophylactic HPV vaccines for cervical cancer prevention have limited use in women with previous viral exposure. Therefore, a therapeutic HPV vaccine would benefit patients with HPV-associated genital diseases. Being developed by Cancer Research Technology Ltd, under license from Xenova Group plc, TA-CIN (Tissue Antigen - Cervical Intraepithelial Neoplasia) is a fusion protein vaccine comprising the HPV16 viral proteins L2, E6 and E7 for the treatment of HPV16-associated genital diseases. In mouse models, TA-CIN induced dose-dependent HPV16-specific CD4 and CD8 T-cell responses, which were enhanced when boosted with the vaccinia-based vector vaccine TA-HPV (Therapeutic Antigen - HPV). A phase I clinical trial of TA-CIN in healthy volunteers reported no serious adverse events and HPV16-specific cellular immune responses. Phase II trials in patients with anogenital and vulval intraepithelial neoplasia investigated heterologous prime/boost strategies with TA-CIN/TA-HPV and TA-HPV/TA-CIN, but neither of the regimens offered advantages over single-agent TA-HPV. A recent phase II trial investigating imiquimod/TA-CIN in patients with vulval intraepithelial neoplasia demonstrated significant infiltration of CD4 and CD8 T-cells in lesion responders and complete lesion regression in 63% of patients. More comprehensive case-controlled trials are needed to define responders to immunotherapy with TA-CIN and verify its prophylactic and therapeutic properties.

  2. Design of the low area monotonic trim DAC in 40 nm CMOS technology for pixel readout chips

    Science.gov (United States)

    Drozd, A.; Szczygiel, R.; Maj, P.; Satlawa, T.; Grybos, P.

    2014-12-01

    The recent research in hybrid pixel detectors working in single photon counting mode focuses on nanometer or 3D technologies which allow making pixels smaller and implementing more complex solutions in each of the pixels. Usually single pixel in readout electronics for X-ray detection comprises of charge amplifier, shaper and discriminator that allow classification of events occurring at the detector as true or false hits by comparing amplitude of the signal obtained with threshold voltage, which minimizes the influence of noise effects. However, making the pixel size smaller often causes problems with pixel to pixel uniformity and additional effects like charge sharing become more visible. To improve channel-to-channel uniformity or implement an algorithm for charge sharing effect minimization, small area trimming DACs working in each pixel independently are necessary. However, meeting the requirement of small area often results in poor linearity and even non-monotonicity. In this paper we present a novel low-area thermometer coded 6-bit DAC implemented in 40 nm CMOS technology. Monte Carlo simulations were performed on the described design proving that under all conditions designed DAC is inherently monotonic. Presented DAC was implemented in the prototype readout chip with 432 pixels working in single photon counting mode, with two trimming DACs in each pixel. Each DAC occupies the area of 8 μm × 18.5 μm. Measurements and chips' tests were performed to obtain reliable statistical results.

  3. Better-Than-Visual Technologies for Next Generation Air Transportation System Terminal Maneuvering Area Operations

    Science.gov (United States)

    Prinzel, Lawrence J., III; Bailey, Randall E.; Shelton, Kevin J.; Jones, Denise R.; Kramer, Lynda J.; Arthur, Jarvis J., III; Williams, Steve P.; Barmore, Bryan E.; Ellis, Kyle E.; Rehfeld, Sherri A.

    2011-01-01

    A consortium of industry, academia and government agencies are devising new concepts for future U.S. aviation operations under the Next Generation Air Transportation System (NextGen). Many key capabilities are being identified to enable NextGen, including the concept of Equivalent Visual Operations (EVO) replicating the capacity and safety of today's visual flight rules (VFR) in all-weather conditions. NASA is striving to develop the technologies and knowledge to enable EVO and to extend EVO towards a Better-Than-Visual (BTV) operational concept. The BTV operational concept uses an electronic means to provide sufficient visual references of the external world and other required flight references on flight deck displays that enable VFR-like operational tempos and maintain and improve the safety of VFR while using VFR-like procedures in all-weather conditions. NASA Langley Research Center (LaRC) research on technologies to enable the concept of BTV is described.

  4. Phytoremediation: a technology using green plants to remove contaminants from polluted areas.

    Science.gov (United States)

    Garbisu, Carlos; Hernández-Allica, Javier; Barrutia, Oihana; Alkorta, Itziar; Becerril, José M

    2002-01-01

    Phytoremediation is an emerging cost-effective, non-intrusive, esthetically pleasing, and low cost technology using the remarkable ability of plants to concentrate elements and compounds from the environment and to metabolize various molecules in their tissues. Phytoremediation technology is applicable to a broad range of contaminants, including metals and radionuclides, as well as organic compounds like chlorinated solvents, polychlorobiphenyls, polycyclic aromatic hydrocarbons, pesticides/insecticides, explosives, and surfactants. The use of plants to transport and concentrate metals from the soil into the harvestable parts of roots and above-ground shoots, usually called 'phytoextraction', has appeared on the scene as a valid alternative to traditional physicochemical remediation methods that do not provide acceptable solutions for the removal of metals from soils. Positive results are becoming available regarding the ability of plants to degrade certain organic compounds. Nonetheless, despite the firm establishment of phytoremediation technology in the literature and in extensive research study and in small-scale demonstrations, full-scale applications are currently limited to a small number of projects. At present, the phytoremediation of metal pollutants from the environment could be approaching commercialization.

  5. Technology campuses and cities: A study on the relation between innovation and the built environment at the urban area level

    Directory of Open Access Journals (Sweden)

    Flavia Teresa de Jesús Curvelo Magdaniel

    2016-08-01

    Full Text Available This thesis examines the development of technology campuses as built environments and their role  in stimulating innovation. Technology campuses entail a variety of built environments developed to accommodate technology-driven research activities of multiple organisations. The science park is the most common type of technology campus. Other types include the campuses of universities  of technology and corporate R&D parks.In industrialised countries, the demand for developing  technology  campuses  to  stimulate innovation has been growing in line with the attention given to knowledge in global, national and regional policies. There are over 700 technology campuses worldwide occupying hundred thousands  of hectares in- and around cities. This type of built environments have emerged and developed during critical periods of technological advancements throughout the 20th century, to support technology-based development in industrialised countries. With the adoption of the knowledge- based economy, governments in many countries have encouraged research as an essential activity in their science, technology and innovation policies. The infrastructure that supports research is also gaining momentum. The number of registered science parks is steadily increasing since the late 1990s. The number of programmes supporting research infrastructure is growing in the European policy agenda. Municipalities are formally engaged with other public and private parties in the development of urban areas targeted to stimulate innovation. Governments, universities and R&D companies are investing billions of euros in developing the infrastructure that will not only support their core processes, but will help them to remain competitive by attracting and retaining the best talent. Part of these investments are targeted to develop new buildings or entire areas that often result in campuses as we know them: a concentration of buildings accommodating organisations

  6. Variation in the measurement of cranial volume and surface area using 3D laser scanning technology.

    Science.gov (United States)

    Sholts, Sabrina B; Wärmländer, Sebastian K T S; Flores, Louise M; Miller, Kevin W P; Walker, Phillip L

    2010-07-01

    Three-dimensional (3D) laser scanner models of human crania can be used for forensic facial reconstruction, and for obtaining craniometric data useful for estimating age, sex, and population affinity of unidentified human remains. However, the use of computer-generated measurements in a casework setting requires the measurement precision to be known. Here, we assess the repeatability and precision of cranial volume and surface area measurements using 3D laser scanner models created by different operators using different protocols for collecting and processing data. We report intraobserver measurement errors of 0.2% and interobserver errors of 2% of the total area and volume values, suggesting that observer-related errors do not pose major obstacles for sharing, combining, or comparing such measurements. Nevertheless, as no standardized procedure exists for area or volume measurements from 3D models, it is imperative to report the scanning and postscanning protocols employed when such measurements are conducted in a forensic setting.

  7. 75 FR 43556 - TA-W-73,381, MT Rail Link, Inc., Missoula, MT; TA-W-73,381A, Billings, MT; TA-W-73,381B, Laurel...

    Science.gov (United States)

    2010-07-26

    ... Employment and Training Administration TA-W-73,381, MT Rail Link, Inc., Missoula, MT; TA-W-73,381A, Billings, MT; TA-W-73,381B, Laurel, MT; TA-W-73,381C, Livingston, MT; TA-W-73,381D, Helena, MT; Amended... applicable to TA-W-73,381 is hereby issued as follows: All workers of Montana Rail Link, Inc.,...

  8. Public policy performance for social development: solar energy approach to assess technological outcome in Mexico City Metropolitan Area.

    Science.gov (United States)

    Arenas-Aquino, Angel Raúl; Matsumoto-Kuwabara, Y; Kleiche-Dray, M

    2017-01-11

    Mexico City Metropolitan Area (MCMA) is the most populated urban area in the country. In 2010, MCMA required 14.8% of total energy domestic demand, but greenhouse gas emissions accounted for 7.7% of domestic emissions. Mexico has massive renewable energy potential that could be harnessed through solar photovoltaic (PV) technology. The problem to explore is the relationship between local and federal public strategies in MCMA and their stance on energy transition concern, social empowerment, new technology appropriation, and the will to boost social development and urban sustainability. A public policy typology was conducted through instruments of State intervention approach, based on political agenda articulation and environmental local interactions. Social equality is encouraged by means of forthright funding and in-kind support and energy policies focus on non-renewable energy subsidies and electric transmission infrastructure investment. There is a lack of vision for using PV technology as a guiding axis for marginalized population development. It is essential to promote economic and political rearrangement in order to level and structure environmental governance. It is essential to understand people's representation about their own needs along with renewable energy.

  9. Single-grain Silicon Technology for Large Area X-ray Imaging

    NARCIS (Netherlands)

    Arslan, A.

    2015-01-01

    Digital flat panel X-ray imagers are currently using a-Si and poly-Si thin-film-transistors (TFTs). a-Si TFT permits the use of large area substrates, however, due to the amorphous nature, the carrier mobility is very low (<1 cm2/Vs). Poly-Si TFT improves the mobility (~150 cm2/Vs) but due to random

  10. Single-grain Silicon Technology for Large Area X-ray Imaging

    NARCIS (Netherlands)

    Arslan, A.

    2015-01-01

    Digital flat panel X-ray imagers are currently using a-Si and poly-Si thin-film-transistors (TFTs). a-Si TFT permits the use of large area substrates, however, due to the amorphous nature, the carrier mobility is very low (<1 cm2/Vs). Poly-Si TFT improves the mobility (~150 cm2/Vs) but due to random

  11. From BAN to AmI-BAN: micro and nano technologies in future Body Area Networks

    NARCIS (Netherlands)

    Unknown, [Unknown; Jones, V.M.; Jones, Valerie M.

    2006-01-01

    At the University of Twente we have been researching mobile healthcare applications since 1999. Since 2002 the University of Twente and partners have been developing health Body Area Networks (BANs) and a BAN service platform. We define a BAN as a network of communicating devices worn on, around or

  12. From BAN to AmI-BAN: micro and nano technologies in future Body Area Networks

    NARCIS (Netherlands)

    Jones, Val

    2006-01-01

    At the University of Twente we have been researching mobile healthcare applications since 1999. Since 2002 the University of Twente and partners have been developing health Body Area Networks (BANs) and a BAN service platform. We define a BAN as a network of communicating devices worn on, around or

  13. Conducting polymer coatings in electrochemical technology: part 2 – application areas.

    OpenAIRE

    Ponce De Leon, Carlos; Campbell, Sheelagh; Smith, James; Walsh, Frank

    2008-01-01

    Conducting polymers can combine the electronic characteristics of metals with the engineering properties of polymers. Polypyrrole (PPy), polythiophene (PTh) and polyaniline (PAni) are common examples of conducting polymers which can be electrodeposited from their respective heterocyclic monomers. The applications of these and other electrodeposited polymer materials are considered in this review. Application areas include electronic and optical materials, sensors, bioimplants, actuators and c...

  14. The Use of Personal Information Technology in Military Area of Operations

    Science.gov (United States)

    2013-04-19

    use these apps to gather intelligence, map out dangerous areas in hostile territory, and upload data into a central database to analyze parameters...ship’s configuration data onto the REDI tablet system to enable the conduct of maintenance research, update documentation, and generate maintenance

  15. RESULTS FROM RECENT SCIENCE AND TECHNOLOGY INVESTIGATIONS TARGETING CHROMIUM IN THE 100D AREA HANFORD SITE WASHINGTON USA

    Energy Technology Data Exchange (ETDEWEB)

    PETERSEN SW; THOMPSON KM; TONKIN MJ

    2009-12-03

    Sodium dichromate was used in Hanford's 100D Area during the reactor operations period of 1950 to 1964 to retard corrosion in the reactor cooling systems. Some of the sodium dichromate was released to the environment by spills and/or leaks from pipelines used to deliver the chemical to water treatment plants in the area. As a result, hexavalent chromium [Cr(VI)] has migrated through the vadose zone to the groundwater and contaminated nearly 1 km{sup 2} of groundwater to above the drinking water standard of 48 {micro}g/L. Three technology tests have recently been completed in this area to characterize the source area of the plumes and evaluate alternative methods to remove Cr(VI) from groundwater. These are (1) refine the source area of the southern plume; (2) test electrocoagulation as an alternative groundwater treatment technology; and (3) test the ability to repair a permeable reactive barrier by injecting micron or nanometer-size zero-valent iron (ZVI). The projects were funded by the US Department of Energy as part of a program to interject new technologies and accelerate active cleanup. Groundwater monitoring over the past 10 years has shown that Cr(VI) concentrations in the southern plume have not significantly diminished, strongly indicating a continuing source. Eleven groundwater wells were installed in 2007 and 2008 near a suspected source area and monitored for Cr(VI) and groundwater levels. Interpretation of these data has led to refinement of the source area location to an area of less than 1 hectare (ha, 2.5 acres). Vadose zone soil samples collected during drilling did not discover significant concentrations of Cr(VI), indicating the source is localized, with a narrow wetted path from the surface to the water table. Electrocoagulation was evaluated through a pilot-scale treatability test. Over 8 million liters of groundwater were treated to Cr(VI) concentrations of {le}20 {micro}g/L. The test determined that this technology has the potential to

  16. Growth and characteristics of tantalum oxide thin films deposited using thermionic vacuum arc technology

    Science.gov (United States)

    Vladoiu, Rodica; Ciupina, Victor; Mandes, Aurelia; Dinca, Virginia; Prodan, Madalina; Musa, Geavit

    2010-11-01

    Tantalum pentoxide (Ta2O5) thin films were synthesized using thermionic vacuum arc (TVA) technology. TVA is an original deposition method using a combination of anodic arc and electron gun system for the growth of thin films from solid precursors under vacuum of 10-6 Torr. The properties of the deposited Ta2O5 thin films were investigated in terms of wettability, refractive index, morphology, and structure. The surface free energy was determined by means of surface energy evaluation system indicating a hydrophilic character and the refractive index was measured by Filmetrics F20 device. The morphology was determined from bright field transmission electron microscopy (TEM) image performed by Philips CM 120 ST TEM system. It exhibits nanoparticles of 3-6 nm diameter smoothly distributed. Selected area electron diffraction pattern revealed the contrast fringes given by complex polycrystalline particles included in the amorphous film. The measured fringes could be indexed using monoclinic structure of Ta2O5.

  17. Synthesis by two methods and crystal structure determination of a new pyrochlore-related compound Sm{sub 2}FeTaO{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Martinez, Leticia M., E-mail: lettorresg@yahoo.com [Departamento de Ecomateriales y Energia, Facultad de Ingenieria Civil, Universidad Autonoma de Nuevo Leon, Cd. Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Ruiz-Gomez, Miguel A. [Departamento de Ecomateriales y Energia, Facultad de Ingenieria Civil, Universidad Autonoma de Nuevo Leon, Cd. Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Facultad de Ciencias Quimicas, Universidad Autonoma de San Luis Potosi, Av. Manuel Nava 6, San Luis Potosi, S.L.P. 78290 (Mexico); Figueroa-Torres, M.Z.; Juarez-Ramirez, Isaias [Departamento de Ecomateriales y Energia, Facultad de Ingenieria Civil, Universidad Autonoma de Nuevo Leon, Cd. Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Moctezuma, Edgar [Facultad de Ciencias Quimicas, Universidad Autonoma de San Luis Potosi, Av. Manuel Nava 6, San Luis Potosi, S.L.P. 78290 (Mexico); and others

    2012-04-16

    Graphical abstract: The monoclinic (space group C2/c) structure of a new compound, Sm{sub 2}FeTaO{sub 7} shows an alternating Sm-O and Fe/Ta-O layers. In the Fe/Ta-O layer, Fe/Ta1 and Fe/Ta3 cations are coordinated by six oxygen atoms, forming irregular octahedral interconnected into a hexagonal tungsten bronze (HTB) type network. The HTB layer is a fundamental framework in the pyrohlore-related structure. Highlights: Black-Right-Pointing-Pointer Pyrochlore-related compound Sm{sub 2}FeTaO{sub 7} prepared by solid state reaction and sol-gel. Black-Right-Pointing-Pointer Sm{sub 2}FeTaO{sub 7} crystallizes with a monoclinic crystal structure and space group C2/c. Black-Right-Pointing-Pointer The compound is synthesized by sol-gel at lower temperature and time than solid state. Black-Right-Pointing-Pointer Surface area of sol-gel Sm{sub 2}FeTaO{sub 7} is 10 times higher than that prepared by solid state. - Abstract: This paper reports on the synthesis of a new pyrochlore-related compound Sm{sub 2}FeTaO{sub 7} by both solid state reaction and sol-gel synthesis routes. Structural features were determined by X-ray powder diffraction and Rietveld refinement and were corroborated using Transmission Electron Microscopy (TEM). The results revealed that Sm{sub 2}FeTaO{sub 7} crystallized in the monoclinic system with space group C2/c and the following cell parameters: a = 13.1307(5) Angstrom-Sign , b = 7.5854(3) Angstrom-Sign , c = 11.6425(4) Angstrom-Sign and {beta} = 100.971(2) Degree-Sign . The monoclinic structure of Sm{sub 2}FeTaO{sub 7} showed an arrangement of alternating Sm-O and Fe/Ta-O layers and two types of irregular octahedra of Fe/Ta-O, which are interconnected into a hexagonal tungsten bronze (HTB)-type network. On the other hand, Sm{sub 2}FeTaO{sub 7} prepared by sol-gel was obtained with lower particle sizes than the solid state produced compound. The difference in particle size causes a difference of one order of magnitude in the specific surface area. In

  18. Advantages of genome sequencing by long-read sequencer using SMRT technology in medical area.

    Science.gov (United States)

    Nakano, Kazuma; Shiroma, Akino; Shimoji, Makiko; Tamotsu, Hinako; Ashimine, Noriko; Ohki, Shun; Shinzato, Misuzu; Minami, Maiko; Nakanishi, Tetsuhiro; Teruya, Kuniko; Satou, Kazuhito; Hirano, Takashi

    2017-07-01

    PacBio RS II is the first commercialized third-generation DNA sequencer able to sequence a single molecule DNA in real-time without amplification. PacBio RS II's sequencing technology is novel and unique, enabling the direct observation of DNA synthesis by DNA polymerase. PacBio RS II confers four major advantages compared to other sequencing technologies: long read lengths, high consensus accuracy, a low degree of bias, and simultaneous capability of epigenetic characterization. These advantages surmount the obstacle of sequencing genomic regions such as high/low G+C, tandem repeat, and interspersed repeat regions. Moreover, PacBio RS II is ideal for whole genome sequencing, targeted sequencing, complex population analysis, RNA sequencing, and epigenetics characterization. With PacBio RS II, we have sequenced and analyzed the genomes of many species, from viruses to humans. Herein, we summarize and review some of our key genome sequencing projects, including full-length viral sequencing, complete bacterial genome and almost-complete plant genome assemblies, and long amplicon sequencing of a disease-associated gene region. We believe that PacBio RS II is not only an effective tool for use in the basic biological sciences but also in the medical/clinical setting.

  19. Reconnaissance of the Hydrogeology of Ta'u, American Samoa

    Science.gov (United States)

    Izuka, Scot K.

    2005-01-01

    Analysis of existing data and information collected on a reconnaissance field visit supports a conceptual model of ground-water occurrence in Ta'u, American Samoa, in which a thin freshwater lens exists in a predominantly high-permeability aquifer that receives high rates of recharge. Because the freshwater lens is thin throughout most of the island, the productivity of wells, especially those near the coast where the lens is the thinnest, is likely to be limited by saltwater intrusion. The landfill in northwestern Ta'u is closer to the north coast of the island than to any of the existing or proposed well sites. Although this may indicate that ground water beneath the landfill would flow away from the existing and proposed well sites, this interpretation may change depending on the hydraulic properties of a fault and rift zone in the area. Of four plausible scenarios tested with a numerical ground-water flow model, only one scenario indicated that ground water from beneath the landfill would flow toward the existing and proposed well sites; the analysis does not, however, assess which of the four scenarios is most plausible. The analysis also does not consider the change in flow paths that will result from ground-water withdrawals, dispersion of contaminants during transport by ground water, other plausible hydrogeologic scenarios, transport of contaminants by surface-water flow, or that sources of contamination other than the landfill may exist. Accuracy of the hydrologic interpretations in this study is limited by the relatively sparse data available for Ta'u. Understanding water resources on Ta'u can be advanced by monitoring rainfall, stream-flow, evaporation, ground-water withdrawals, and water quality, and with accurate surveys of measuring point elevations for all wells and careful testing of well-performance. Assessing the potential for contaminants in the landfill to reach existing and proposed well sites can be improved with additional information on the

  20. Improved parameters metropolitan area network supported with all-optical network's technology

    Science.gov (United States)

    Gradkowska, Magdalena; Kalita, Mariusz

    2006-03-01

    The advantages of all-optical network's technics make them one of main elements of the metropolitan area networks. They enable different applications in high quality mulitimedia services and guarantee a constant and reliable access to the Internet. As the growing expansion of the Internet continues in an unpredictable direction, many new solutions are expected. The major challenge is the increasing demand for flexible, transparent and customised bandwidth services for both private and business customers.

  1. Limited Range Sesame EOS for Ta

    Energy Technology Data Exchange (ETDEWEB)

    Greeff, Carl William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Crockett, Scott [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rudin, Sven Peter [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Burakovsky, Leonid [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-30

    A new Sesame EOS table for Ta has been released for testing. It is a limited range table covering T ≤ 26, 000 K and ρ ≤ 37.53 g/cc. The EOS is based on earlier analysis using DFT phonon calculations to infer the cold pressure from the Hugoniot. The cold curve has been extended into compression using new DFT calculations. The present EOS covers expansion into the gas phase. It is a multi-phase EOS with distinct liquid and solid phases. A cold shear modulus table (431) is included. This is based on an analytic interpolation of DFT calculations.

  2. Assessment and Risk Zonation of Landslides in Panxi Area Based on 3S Technology

    Institute of Scientific and Technical Information of China (English)

    ZHANG Baolei; SONG Shujun; FENG Wenlan; ZHOU Wancun

    2006-01-01

    Based on field survey located by GPS, it is obtained landslides' location and distribution information by the method of remote sensing in this paper. The vector data of environmental factors that breed and induce landslides such as the elevation,the slope, the vegetation cover,the lithology,the rainfall and so on are gained using GIS(geographical information system) techniques of spatial analysis. All the data obtained are managed through building landslide management system. At the same time,the system is made the platform to appraise the relationship between the distribution of landslides and the environmental factors. The results indicate: landslides take place relatively easily in the slope range between 10° and 25°; most landslides are in the mixed area of bush and grass with a coverage degree of from 20% to 65%; the distribution of landslides has a positive relationship with the distribution of annual rainfall. The risk degree of Panxi Area is zoned and mapped by the model of liner stack using GIS technique,and the result indicates: the place of high risk degree is the belt of Panzhihua-Miyi-Dechang-Mugu and southeast of Huili county and Huidong county,and area is about 512 707 hm2.

  3. A Patent Analysis for Sustainable Technology Management

    Directory of Open Access Journals (Sweden)

    Junhyeog Choi

    2016-07-01

    Full Text Available Technology analysis (TA is an important issue in the management of technology. Most R&D (Research & Development policies have depended on diverse TA results. Traditional TA results have been obtained through qualitative approaches such as the Delphi expert survey, scenario analysis, or technology road mapping. Although they are representative methods for TA, they are not stable because their results are dependent on the experts’ knowledge and subjective experience. To solve this problem, recently many studies on TA have been focused on quantitative approaches, such as patent analysis. A patent document has diverse information of developed technologies, and thus, patent is one form of objective data for TA. In addition, sustainable technology has been a big issue in the TA fields, because most companies have their technological competitiveness through the sustainable technology. Sustainable technology is a technology keeping the technological superiority of a company. So a country as well as a company should consider sustainable technology for technological competition and continuous economic growth. Also it is important to manage sustainable technology in a given technology domain. In this paper, we propose a new patent analysis approach based on statistical analysis for the management of sustainable technology (MOST. Our proposed methodology for the MOST is to extract a technological structure and relationship for knowing the sustainable technology. To do this, we develop a hierarchical diagram of technology for finding the causal relationships among technological keywords of a given domain. The aim of the paper is to select the sustainable technology and to create the hierarchical technology paths to sustainable technology for the MOST. This contributes to planning R&D strategy for the sustainability of a company. To show how the methodology can be applied to real problem, we perform a case study using retrieved patent documents related to

  4. Using Technology of .Net Web Services in the Area of Automation

    Directory of Open Access Journals (Sweden)

    Martin Hnik

    2009-12-01

    Full Text Available This work deals with a technology for data exchange XML Web Services and its application to specific tasks. One of the applications created allows you to monitor and control the real thermal process through a number of client devices, independent of the operating system, the type or their location. The thermal process can be controlled, for example, by another process, a website or a mobile phone. The system is designed from its base and contains three main parts. The hardware part consists from a measuring card, actuators and temperature sensors. The core application is a server that is running the XML Web Service, Windows Service and SQL Server. Client software for mobile phones and web sites was also created.

  5. The technology of multiuser large display area and auto free-viewing stereoscopic display

    Science.gov (United States)

    Zhao, Tian-Qi; Zhang, He-Ling; Han, Jing

    2010-11-01

    No-glasses optical grating stereoscopic display is one of a chief development of stereoscopic display, but it is always confined by the range of stereoscopic visible and quantity of stereoscopic information and quantity of users. This research use the combination of Fresnel lens array and controllable point lights to output information of the two eyes of different users separately. Combining the technology of eyes-tracking, it can make no-glasses optical grating stereoscopic display be visible in 3D orientation range by multiuser in the condition of two-angle image sources. And it also can be visible in 360° stereoscopic overlook by one user in the condition of multi-angle image sources.

  6. Technology transfer report: feasibility study for the use of geothermal brine in the Ashdod area, Israel

    Energy Technology Data Exchange (ETDEWEB)

    Benson, S.M.

    1984-08-01

    The hydrothermal potential of the Ashdod area, Israel, was evaluated to determine its suitability as the low grade energy source required to operate the Ashdod desalination plant. An estimated 1250 cubic meters per hour of 120/sup 0/C brine would be adequate to supply the hot water necessary for operating the desalination plant. Considerable interest in oil exploration in the Ashdod area resulted in the drilling of six wells into the Jurassic formations by Oil Exploration (Investments) Ltd. (OEL) in 1976-1980. A small amount of oil was found in two wells, Ashdod 2 and 5. The remaining wells were abandoned as ''dry holes''. Evaluation of the drill cuttings, cores, and the electric logs defined two lithologic units of potential interest for hydrothermal exploitation, the Zohar and Shderot Dolomites. Investigation of the hydrothermal potential of the Jurassic formations underlying the Ashdod area has revealed that the aquifer temperatures range between 85 and 92/sup 0/C. The hydrologic parameters are not well defined; however the matrix permeability of the dolomites and limestones is probably between 1 and 10 md. This is insufficient permeability for a large scale pumping operation such as the one required to operate the desalination plant. Therefore, successful utilization of the resource requires the presence of significant fractures and/or connected vugs in the formation. The very low well productivity and formation plugging may indicate that permeability of the fracture zones may easily be impaired, suggesting that the fracture zones are not suitable production intervals. Until a test is conducted on a properly completed well, it is not possible to evaluate the deliverability of wells tapping these aquifers. 14 refs., 8 figs.

  7. Gate-tunable phase transitions in thin flakes of 1T-TaS2

    Science.gov (United States)

    Yu, Yijun; Yang, Fangyuan; Lu, Xiu Fang; Yan, Ya Jun; Cho, Yong-Heum; Ma, Liguo; Niu, Xiaohai; Kim, Sejoong; Son, Young-Woo; Feng, Donglai; Li, Shiyan; Cheong, Sang-Wook; Chen, Xian Hui; Zhang, Yuanbo

    2015-03-01

    The ability to tune material properties using gating by electric fields is at the heart of modern electronic technology. It is also a driving force behind recent advances in two-dimensional systems, such as the observation of gate electric-field-induced superconductivity and metal-insulator transitions. Here, we describe an ionic field-effect transistor (termed an iFET), in which gate-controlled Li ion intercalation modulates the material properties of layered crystals of 1T-TaS2. The strong charge doping induced by the tunable ion intercalation alters the energetics of various charge-ordered states in 1T-TaS2 and produces a series of phase transitions in thin-flake samples with reduced dimensionality. We find that the charge-density wave states in 1T-TaS2 collapse in the two-dimensional limit at critical thicknesses. Meanwhile, at low temperatures, the ionic gating induces multiple phase transitions from Mott-insulator to metal in 1T-TaS2 thin flakes, with five orders of magnitude modulation in resistance, and superconductivity emerges in a textured charge-density wave state induced by ionic gating. Our method of gate-controlled intercalation opens up possibilities in searching for novel states of matter in the extreme charge-carrier-concentration limit.

  8. An Area-Efficient Carry Select Adder Design by using 180 nm Technology

    OpenAIRE

    Garish Kumar Wadhwa; Amit Grover; Neeti Grover; GurpreetSingh

    2013-01-01

    In this paper, we proposed an area-efficient carry select adder by sharing the common Boolean logic term. After logic simplification and sharing partial circuit, we only need one XOR gate and one inverter gate in each summation operation as well as one AND gate and one inverter gate in each carry-out operation. Through the multiplexer, we can select the correct output result according to the logic state of carry-in signal. In this way, the transistor count in a 32-bit carry select adder can b...

  9. An Area-Efficient Carry Select Adder Design by using 180 nm Technology

    Directory of Open Access Journals (Sweden)

    Garish Kumar Wadhwa

    2013-02-01

    Full Text Available In this paper, we proposed an area-efficient carry select adder by sharing the common Boolean logic term. After logic simplification and sharing partial circuit, we only need one XOR gate and one inverter gate in each summation operation as well as one AND gate and one inverter gate in each carry-out operation. Through the multiplexer, we can select the correct output result according to the logic state of carry-in signal. In this way, the transistor count in a 32-bit carry select adder can be greatly reduced from 1947 to 960.

  10. Research Update: Large-area deposition, coating, printing, and processing techniques for the upscaling of perovskite solar cell technology

    Directory of Open Access Journals (Sweden)

    Stefano Razza

    2016-09-01

    Full Text Available To bring perovskite solar cells to the industrial world, performance must be maintained at the photovoltaic module scale. Here we present large-area manufacturing and processing options applicable to large-area cells and modules. Printing and coating techniques, such as blade coating, slot-die coating, spray coating, screen printing, inkjet printing, and gravure printing (as alternatives to spin coating, as well as vacuum or vapor based deposition and laser patterning techniques are being developed for an effective scale-up of the technology. The latter also enables the manufacture of solar modules on flexible substrates, an option beneficial for many applications and for roll-to-roll production.

  11. CONDITIONS OF INVESTMENT DECISION-MAKING IN AREA OF RFID TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    Marzena Jankowska-Mihułowicz

    2014-07-01

    Full Text Available The application of the electronic product code (EPC in an enterprise may turn out to be one of the choices in the future. The subject of this article is an analysis preceding decisive conditions in an investment process of its implementation. These reflections are preceded by the research in Polish enterprises, aiming at an estimation of the possibility of the RFID (Radio Frequency IDentification transponder commercialisation (market potential being consistent with the EPC requirements. Conducting such research in the future will lead to a decrease in the decision gap among managers within the scope of the possibility of implementing the innovative solution described, as well as the anticipated business results.  Methods of analysis and synthesis have been applied, within the theory of decision-making and telecommunications. An interdisciplinary approach to the issue in question constitutes the added value of this article.  The conclusion comprises a synthesis of the article contents—crucial decisive areas that require monitoring and simultaneous estimation (now and in the future regarding implementation of the electronic product code in an organization. In general, these areas are macro environment, competitive environment, strategic potential of an organization, and managers’ decisiveness.

  12. Technology demonstration: geostatistical and hydrologic analysis of salt areas. Assessment of effectiveness of geologic isolation systems

    Energy Technology Data Exchange (ETDEWEB)

    Doctor, P.G.; Oberlander, P.L.; Rice, W.A.; Devary, J.L.; Nelson, R.W.; Tucker, P.E.

    1982-09-01

    The Office of Nuclear Waste Isolation (ONWI) requested Pacific Northwest Laboratory (PNL) to: (1) use geostatistical analyses to evaluate the adequacy of hydrologic data from three salt regions, each of which contains a potential nuclear waste repository site; and (2) demonstrate a methodology that allows quantification of the value of additional data collection. The three regions examined are the Paradox Basin in Utah, the Permian Basin in Texas, and the Mississippi Study Area. Additional and new data became available to ONWI during and following these analyses; therefore, this report must be considered a methodology demonstration here would apply as illustrated had the complete data sets been available. A combination of geostatistical and hydrologic analyses was used for this demonstration. Geostatistical analyses provided an optimal estimate of the potentiometric surface from the available data, a measure of the uncertainty of that estimate, and a means for selecting and evaluating the location of future data. The hydrologic analyses included the calculation of transmissivities, flow paths, travel times, and ground-water flow rates from hypothetical repository sites. Simulation techniques were used to evaluate the effect of optimally located future data on the potentiometric surface, flow lines, travel times, and flow rates. Data availability, quality, quantity, and conformance with model assumptions differed in each of the salt areas. Report highlights for the three locations are given.

  13. Thin TaC layer produced by ion mixing

    DEFF Research Database (Denmark)

    Barna, Árpád; Kotis, László; Pécz, Béla

    2012-01-01

    Ion-beam mixing in C/Ta layered systems was investigated. C 8nm/Ta 12nm and C 20nm/Ta 19nm/C 20nm layer systems were irradiated by Ga+ ions of energy in the range of 2–30keV. In case of the 8nm and 20nm thick C cover layers applying 5–8keV and 20–30keV Ga+ ion energy, respectively resulted...... in strongly asymmetric ion mixing; the carbon was readily transported to the Ta layer, while the reverse process was much weaker. Because of the asymmetrical transport the C/TaC interface remained sharp independently from the applied fluence. The carbon transported to the Ta layer formed Ta......Cx. The stoichiometry of the carbide produced varied along the depth. The TaCx layer contained implanted Ga, the concentration of which decreased with increasing depth. The thickness of the TaCx layer could be tailored by the ion fluence and energy making possible to produce coating layer of desired thickness....

  14. Generation of the regulatory protein rtTA transgenic mice

    Institute of Scientific and Technical Information of China (English)

    Kang Xu; Xin-Yan Deng; Ying Yue; Zhong-Min Guo; Bing Huang; Xun Hong; Dong Xiao; Xi-Gu Chen

    2005-01-01

    AIM: To translate Tet-on system into a conditional mouse model, in which hepatitis B or C virus (HBV or HCV) gene could be spatiotemporally expressed to overcome "immune tolerance" formed during the embryonic development and "immune escape" against hepatitis virus antigen(s), an effector mouse, carrying the reverse tetracycline-responsive transcriptional activator (rtTA) gene under the tight control of liver-specific human apoE promoter, is required to be generated. METHODS: To address this end, rtTA fragment amplified by PCR was effectively inserted into the vector of pLiv.7 containing apoE promoter to create the rtTA expressing vector, I.e., pApoE-rtTA. ApoE-rtTA transgenic fragment (-6.9 kb) released from pApoE-rtTA was transferred into mice by pronucleus injection, followed by obtaining one transgene (+) founder animal from microinjection through PCR and Southern blot analysis.RESULTS: rtTA transgene which could be transmitted to subsequent generation (F1) derived from founder was expressed in a liver-specific fashion. CONCLUSION: Taken together, these findings demonstrate that rtTA transgenic mice, in which rtTA expression is appropriately targeted to the murine liver, are successfully produced, which lays a solid foundation to 'off-on-off' regulate expression of target gene (s) (e.g., HBV and/or HCV) in transgenic mice mediated by Tet-on system.

  15. Criticality Detection Using a Mirion Technologies DRM-2NC Remote Area Monitor Geiger-Mueller Probe

    Science.gov (United States)

    Kryskow, Adam P.

    The prompt fission neutron activation and subsequent response of a DRM-2NC Geiger-Mueller probe (manufactured by Mirion Technologies) was investigated for the purpose of creating a criticality accident detection algorithm with sensitivity and false positive suppression comparable to modern criticality accident detection systems. The expected decay pattern of secondary emissions arising from the neutron induced activity of the Geiger-Mueller probe was investigated experimentally in high neutron fluence environments at research reactors operated by the University of Massachusetts Lowell, Pennsylvania State University, and the White Sands Missile Range of Los Alamos National Laboratory. Monte Carlo techniques were used to both identify key probe materials responsible for the majority of the Geiger-Mueller response and investigate the effects of boron doping to increase detector sensitivity and enhance the signal to noise ratio. Subsequently, a statistical algorithm centered on a point weighted linear regression of the combined effective half-life was developed as the basis for criticality declaration. Final testing of the system indicated that the system was capable of meeting all ANSI criticality accident criteria with sufficient sensitivity to the minimum accident of concern, an adequate response time, and an extremely low likelihood of false alarm.

  16. Silicon photonic switch technology for optical networks in telecom and datacom areas

    Science.gov (United States)

    Nakamura, Shigeru; Yanagimachi, Shigeyuki; Takeshita, Hitoshi; Tajima, Akio

    2017-01-01

    As a promising platform technology for optical switches, silicon photonics is recently attracting much attention. In this paper, we demonstrate compact 8 × 8 silicon photonic switch modules with low loss, low polarization sensitivity, and low cross-talk properties. An optical circuit including 152 thermo-optical switch elements and spot size converters were formed within a silicon chip size of 12 mm × 14 mm. The developed module where a silicon photonic chip was assembled with a fiber array showed about 6-dB average excess optical loss, including optical coupling loss, on all 64 paths of the 8 × 8 optical switch. Measured polarization dependent loss was about 0.6 dB on average over 64 paths and cross-talk was less than -35 dB. These optical switch modules are intended for applying to ROADMs in telecom optical networks, but, the port count extensibility using multiple compact modules and the faster switching capability of the optical switch are also useful for datacenter applications where hybrid network scheme with electronic packet switches and optical circuit switches is intensively investigated.

  17. Study on the mechanism of perpendicular magnetic anisotropy in Ta/CoFeB/MgO system

    Science.gov (United States)

    Lou, Yongle; Zhang, Yuming; Guo, Hui; Xu, Daqing; Yimen, Zhang

    2017-06-01

    The mechanism of perpendicular magnetic anisotropy (PMA) in a MgO-based magnetic tunnel junction (MTJ) has been studied in this article. By comparing the magnetic properties and elementary composition analysis for different CoFeB-based structures, such as Ta/CoFeB/MgO, Ta/CoFeB/Ta and Ru/CoFeB/MgO structures, it is found that a certain amount of Fe-oxide existing at the interface of CoFeB/MgO is helpful to enhance the PMA and the PMA is originated from the interface of CoFeB/MgO. In addition, Ta film plays an important role to enhance the PMA in Ta/CoFeB/MgO structure. Project supported by the National Defense Advance Research Foundation (No. 9140A08XXXXXX0DZ106), the Basic Research Program of Ministry of Education, China (No. JY10000925005), the Scientific Research Program Funded by Shaanxi Provincial Education Department (No.11JK0912), the Scientific Research Foundation of Xi’an University of Science and Technology (No. 2010011), the Doctoral Research Startup Fund of Xi’an University of Science and Technology (No. 2010QDJ029).

  18. Research into comprehensive gas extraction technology of single coal seams with low permeability in the Jiaozuo coal mining area

    Institute of Scientific and Technical Information of China (English)

    Fu Jiangwei; Fu Xuehai; Hu Xiao; Chen Li; Ou Jianchun

    2011-01-01

    For a low permeability single coal seam prone to gas outbursts,pre-drainage of gas is difficult and inefficient,seriously restricting the safety and efficiency of production.Radical measures of increasing gas extraction efficiency are pressure relief and infrared antireflection.We have analyzed the effect of mining conditions and the regularity of mine pressure distribution in front of the working face of a major coal mine of the Jiaozuo Industrial (Group) Co.as our test area,studied the width of the depressurization zone in slice mining and analyzed gas efficiency and fast drainage in the advanced stress relaxation zone.On that basis,we further investigated and practiced the exploitation technology of shallow drilling,fan drilling and grid shape drilling at the working face.Practice and our results show that the stress relaxation zone is the ideal region for quick and efficient extraction of gas.By means of an integrated extraction technology,the amount of gas emitted into the zone was greatly reduced,while the risk of dangerous outbursts of coal and gas was lowered markedly.This exploration provides a new way to control for gas in working faces of coal mines with low permeability and risk of gas outbursts of single coal seams in the Jiaozuo mining area.

  19. Pipe Crawler{reg_sign} internal piping characterization system - deactivation and decommissioning focus area. Innovative Technology Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-02-01

    Pipe Crawler{reg_sign} is a pipe surveying system for performing radiological characterization and/or free release surveys of piping systems. The technology employs a family of manually advanced, wheeled platforms, or crawlers, fitted with one or more arrays of thin Geiger Mueller (GM) detectors operated from an external power supply and data processing unit. Survey readings are taken in a step-wise fashion. A video camera and tape recording system are used for video surveys of pipe interiors prior to and during radiological surveys. Pipe Crawler{reg_sign} has potential advantages over the baseline and other technologies in areas of cost, durability, waste minimization, and intrusiveness. Advantages include potentially reduced cost, potential reuse of the pipe system, reduced waste volume, and the ability to manage pipes in place with minimal disturbance to facility operations. Advantages over competing technologies include potentially reduced costs and the ability to perform beta-gamma surveys that are capable of passing regulatory scrutiny for free release of piping systems.

  20. The Impact of 3D Stacking and Technology Scaling on the Power and Area of Stereo Matching Processors

    Science.gov (United States)

    Ok, Seung-Ho; Lee, Yong-Hwan; Shim, Jae Hoon; Lim, Sung Kyu; Moon, Byungin

    2017-01-01

    Recently, stereo matching processors have been adopted in real-time embedded systems such as intelligent robots and autonomous vehicles, which require minimal hardware resources and low power consumption. Meanwhile, thanks to the through-silicon via (TSV), three-dimensional (3D) stacking technology has emerged as a practical solution to achieving the desired requirements of a high-performance circuit. In this paper, we present the benefits of 3D stacking and process technology scaling on stereo matching processors. We implemented 2-tier 3D-stacked stereo matching processors with GlobalFoundries 130-nm and Nangate 45-nm process design kits and compare them with their two-dimensional (2D) counterparts to identify comprehensive design benefits. In addition, we examine the findings from various analyses to identify the power benefits of 3D-stacked integrated circuit (IC) and device technology advancements. From experiments, we observe that the proposed 3D-stacked ICs, compared to their 2D IC counterparts, obtain 43% area, 13% power, and 14% wire length reductions. In addition, we present a logic partitioning method suitable for a pipeline-based hardware architecture that minimizes the use of TSVs. PMID:28241437

  1. The Impact of 3D Stacking and Technology Scaling on the Power and Area of Stereo Matching Processors

    Directory of Open Access Journals (Sweden)

    Seung-Ho Ok

    2017-02-01

    Full Text Available Recently, stereo matching processors have been adopted in real-time embedded systems such as intelligent robots and autonomous vehicles, which require minimal hardware resources and low power consumption. Meanwhile, thanks to the through-silicon via (TSV, three-dimensional (3D stacking technology has emerged as a practical solution to achieving the desired requirements of a high-performance circuit. In this paper, we present the benefits of 3D stacking and process technology scaling on stereo matching processors. We implemented 2-tier 3D-stacked stereo matching processors with GlobalFoundries 130-nm and Nangate 45-nm process design kits and compare them with their two-dimensional (2D counterparts to identify comprehensive design benefits. In addition, we examine the findings from various analyses to identify the power benefits of 3D-stacked integrated circuit (IC and device technology advancements. From experiments, we observe that the proposed 3D-stacked ICs, compared to their 2D IC counterparts, obtain 43% area, 13% power, and 14% wire length reductions. In addition, we present a logic partitioning method suitable for a pipeline-based hardware architecture that minimizes the use of TSVs.

  2. The Impact of 3D Stacking and Technology Scaling on the Power and Area of Stereo Matching Processors.

    Science.gov (United States)

    Ok, Seung-Ho; Lee, Yong-Hwan; Shim, Jae Hoon; Lim, Sung Kyu; Moon, Byungin

    2017-02-22

    Recently, stereo matching processors have been adopted in real-time embedded systems such as intelligent robots and autonomous vehicles, which require minimal hardware resources and low power consumption. Meanwhile, thanks to the through-silicon via (TSV), three-dimensional (3D) stacking technology has emerged as a practical solution to achieving the desired requirements of a high-performance circuit. In this paper, we present the benefits of 3D stacking and process technology scaling on stereo matching processors. We implemented 2-tier 3D-stacked stereo matching processors with GlobalFoundries 130-nm and Nangate 45-nm process design kits and compare them with their two-dimensional (2D) counterparts to identify comprehensive design benefits. In addition, we examine the findings from various analyses to identify the power benefits of 3D-stacked integrated circuit (IC) and device technology advancements. From experiments, we observe that the proposed 3D-stacked ICs, compared to their 2D IC counterparts, obtain 43% area, 13% power, and 14% wire length reductions. In addition, we present a logic partitioning method suitable for a pipeline-based hardware architecture that minimizes the use of TSVs.

  3. Application of remote monitoring technology in landslides in the Luoshan mining area

    Energy Technology Data Exchange (ETDEWEB)

    Man-chao He; Zhi-gang Tao; Bin Zhang [China University of Mining & Technology, Beijing (China). Research Center of Geotechnical Engineering

    2009-09-15

    With the scale extending of mining, the landslide disaster in the earth's surface will become more and more serious, and these landslide disasters are being threatened to the sustainable safe mining of the underground mine and the open-pit mine. Based on the theory that sliding force is greater than the shear resistance (resisting force) at the potential slip surface is the necessary and sufficient condition to occur the landslide as the sliding criterion, the principle and method for sliding force remote monitoring is presented, and the functional relationship between the human mechanical quantity and the natural sliding force is derived, hereby, the natural sliding force can be calculated according to the human mechanical quantity. Based on above principle and method, a new system of landslide remote monitoring is designed and 53 systems are installed on the landslide body in the Luoshan mining area, which make up the landslide remote monitoring network. According to the results of field test around 8 months, monitoring curves between sliding force and time are obtained, which can describe and forecast the develop trend of landslide. According to above analysis, the results show that this system has some following advantages: (1) real-time monitoring; (2) remote intelligent transmission; (3) landslides early warning. 11 refs., 8 figs., 1 tab.

  4. Application of remote monitoring technology in landslides in the Luoshan mining area

    Institute of Scientific and Technical Information of China (English)

    HE Man-chao; TAO Zhi-gang; ZHANG Bin

    2009-01-01

    With the scale extending of mining, the landslide disaster in the earth's surface will become more and more serious, and these landslide disasters are being threatened to the sustainable safe mining of the underground mine and the open-pit mine. Based on the theory that sliding force is greater than the shear resistance (resisting force) at the potential slip surface is the necessary and sufficient condition to occur the landslide as the sliding criterion, the principle and method for sliding force remote monitoring is presented, and the functional relationship between the human mechanical quantity and the natural sliding force is derived, hereby, the natural sliding force can be calculated according to the human mechanical quantity. Based on above principle and method, a new system of landslide remote monitoring is designed and 53 systems are installed on the landslide body in the Luoshan mining area, which make up the landslide remote monitoring network. According to the results of field test around 8 months, monitoring curves between sliding force and time are obtained, which can describe and forecast the develop trend of landslide. According to above analysis, the results show that this system has some following advantages: (1) real-time monitoring; (2) remote intelligent transmission; (3) landslides early warning.

  5. Innovative technologies of outsourcing at the machine-building enterprises of Sverdlovsk area

    Directory of Open Access Journals (Sweden)

    P. P. Krylatkov

    2010-09-01

    Full Text Available The analysis of the basic problems connected with infringements of integrity of the machine-building enterprises of Sverdlovsk area is lead in the article. The specified problems are considered from a position of the complete approach developed by the author. Display of infringements of integrity of some the enterprises are illustrated by data of their inspection. As the effective tool of increase of integrity of the enterprises — expansion use of attitudes of outsourcing is offered. The comparative given applications of outsourcing in developed the country of the West and at the domestic enterprises, and also its benefits and risks are cited. Outsourcing, insoursing and subcontracting are considered by the author as the innovative tool of the decision of many serious problems of the machine-building enterprises of region. As an example practice of work of «The Sverdlovsk regional center of industrial cooperation» on coordination of attitudes of outsourcing, subcontracting and cooperation is offered. The author recommends the tabulated form, with the instruction of kinds of works for which performance the method of allocation or attraction outsourcing of the companies can be used.

  6. Wet ammonia Synthesis of Semiconducting N:Ta2O5, Ta3N5 and β-TaON Films for Photoanode Applications

    OpenAIRE

    Dabirian, A.; Van't Spijker, H; Van de Krol, R.

    2012-01-01

    Tantalum oxynitride (β-TaON) is a promising photoanode material for photoelectrochemical water splitting. However, the synthesis of phase-pure β-TaON films is a challenging task. This paper describes a novel approach to achieve this by the controlled nitridation of Ta2O5 films under a flow of ammonia gas (ammonolysis), which was obtained by bubbling argon through an aqueous ammonium hydroxide solution followed by a 5 Å molecular sieve to remove the water. Depending on the nitridation conditio...

  7. Visible Light Photocatalytic Properties of Ta and N Codoped SrTiO3 Nanoparticles

    Directory of Open Access Journals (Sweden)

    Uyi Sulaeman

    2010-01-01

    Full Text Available Ta and N co-doped SrTiO3 was synthesized by microwave-assisted solvothermal reaction using SrCl2⋅6H2O, Ti(OC3H74, TaCl5, and HMT (hexamethylenetetramine in KOH and oleic acid mixed solutions. The products were characterized by XRD, TG-DTA, BET surface area measurement, TEM, EDX, DRS, PL-Spectra, and XPS. The nanoparticles of perovskite-type SrTi1-xTaxO3-yNy (x=0−0.1 were successfully synthesized. The photocatalytic activity of SrTiO3 for DeNOxability in the visible light region could be improved by the codoping of Ta5+ and N3-. The excellent visible light photocatalytic activity of this substance may be due to the generation of a new band gap by doping nitrogen that enables the absorption of visible light as well as a decrease in the incidence of the lattice defects, which acts as a recombination center of photo-induced electrons and holes by codoping with Ta5+.

  8. The large area crop inventory experiment: An experiment to demonstrate how space-age technology can contribute to solving critical problems here on earth

    Science.gov (United States)

    1977-01-01

    The large area crop inventory experiment is being developed to predict crop production through satellite photographs. This experiment demonstrates how space age technology can contribute to solving practical problems of agriculture management.

  9. Evaluation of treated sewage reuse potential and membrane-based water reuse technology for the Bangkok Metropolitan area.

    Science.gov (United States)

    Chiemchaisri, Chart; Chiemchaisri, Wilai; Prasertkulsak, Sirilak; Hamjinda, Nutta Sangnarin; Kootatep, Thammarat; Itonaga, Takanori; Yamamoto, Kazuo

    2015-01-01

    Only 3.4% of total water use in the Bangkok Metropolitan area is reused treated sewage. This study anticipates that further treated-sewage reuse in industrial sectors, commercial buildings and public parks, in addition to present in-plant and street cleaning purposes, would increase total water reuse to about 10%. New water reuse technologies using membrane bioreactor (MBR) and microfiltration (MF) as tertiary treatment were implemented to assess their potential for their application in the Bangkok Metropolitan area. The MBR was applied to the treatment of raw sewage in a central treatment plant of the Bangkok Metropolitan area. The MF membrane was used for polishing the effluent of the treatment plant. The results show the quality of treated water from MBR and tertiary MF treatment could meet stringent water reuse quality standard in terms of biochemical oxygen demand, suspended solids and biological parameters. Constant permeate flux of the membrane was achieved over long-term operation, during which inorganic fouling was observed. This is due to the fact that incoming sewage contains a considerable amount of inorganic constituents contributed from storm water and street inlet in the combined sewerage systems. The total cost of the MBR for sewage treatment and production of reuse water is estimated to be about USD1.10/m3.

  10. Intrabeam Scattering Studies at CesrTA

    CERN Document Server

    Ehrlichman, M P; Heltsley, B; Peterson, D P; Rider, N; Rubin, D; Sagan, D; Shanks, J; Wang, S T; Campbell, R; Holtzapple, R

    2013-01-01

    Intrabeam scattering (IBS) limits the emittance and single-bunch current that can be achieved in electron or positron storage ring colliders, damping rings, and light sources. Much theoretical work on IBS exists, and while the theories have been validated in hadron and ion machines, the presence of strong damping makes IBS in lepton machines a different phenomenon. We present the results of measurements at CesrTA of IBS dominated beams, and compare the data with theory. The beams we study have parameters typical of those specified for the next generation of wiggler dominated storage rings: low emittance, small bunch length, and few GeV energy. Our measurements are in good agreement with IBS theory, provided a tail-cut procedure is applied.

  11. Characterization and Modeling of Nonfilamentary Ta/TaOx/TiO2/Ti Analog Synaptic Device.

    Science.gov (United States)

    Wang, Yu-Fen; Lin, Yen-Chuan; Wang, I-Ting; Lin, Tzu-Ping; Hou, Tuo-Hung

    2015-05-08

    A two-terminal analog synaptic device that precisely emulates biological synaptic features is expected to be a critical component for future hardware-based neuromorphic computing. Typical synaptic devices based on filamentary resistive switching face severe limitations on the implementation of concurrent inhibitory and excitatory synapses with low conductance and state fluctuation. For overcoming these limitations, we propose a Ta/TaOx/TiO2/Ti device with superior analog synaptic features. A physical simulation based on the homogeneous (nonfilamentary) barrier modulation induced by oxygen ion migration accurately reproduces various DC and AC evolutions of synaptic states, including the spike-timing-dependent plasticity and paired-pulse facilitation. Furthermore, a physics-based compact model for facilitating circuit-level design is proposed on the basis of the general definition of memristor devices. This comprehensive experimental and theoretical study of the promising electronic synapse can facilitate realizing large-scale neuromorphic systems.

  12. Corrective measures evaluation work plan : Technical Area V Groundwater : revision 0.

    Energy Technology Data Exchange (ETDEWEB)

    Lebow, Patrick S.; Dettmers, Dana L.; Hall, Kevin A.

    2004-12-01

    This document, which is prepared as directed by the Compliance Order on Consent (COOC) issued by the New Mexico Environment Department, identifies and outlines a process to evaluate remedial alternatives to identify a corrective measure for the Sandia National Laboratories/New Mexico Technical Area (TA)-V Groundwater. The COOC provides guidance for implementation of a Corrective Measures Evaluation (CME) for the TA-V Groundwater. This Work Plan documents an initial screening of remedial technologies and presents a list of possible remedial alternatives for those technologies that passed the screening. This Work Plan outlines the methods for evaluating these remedial alternatives and describes possible site-specific evaluation activities necessary to estimate remedy effectiveness and cost. These methods will be reported in the CME Report. This Work Plan outlines the CME Report, including key components and a description of the corrective measures process.

  13. Microstructural and weldability evaluation of 310TaN

    Energy Technology Data Exchange (ETDEWEB)

    Lundin, C.D.; Qiao, C.Y.P. [Univ. of Tennessee, Knoxville, TN (United States); Swindeman, R.W. [Oak Ridge National Lab., TN (United States)

    1996-08-01

    Excellent weldability and good microstructural stability of 310TaN, in terms of the formation and growth of secondary phases at elevated temperature, was revealed in this investigation. The interganular stress corrosion resistance of 310TaN is superior to modified 800H and 310HCbN evaluated previously due to the fact that TaC, TaN and Ta(C,N) particles are more stable compared to Nb-rich or Ti-rich carbides, nitrides and carbonitrides presented in the other advanced alloys. Using resistance spot welding technique for which extremely fast cooling is a characteristic, it was found that a very minor amount of gain boundary liquation takes place during welding thermal cycling. The limited grain boundary liquation is of the eutectic type i.e., a low tendency to weld HAZ hot cracking.

  14. Cs10Ta29.27O78

    Directory of Open Access Journals (Sweden)

    Wolfgang Schnick

    2009-02-01

    Full Text Available Single crystals of caesium tantalate(V, Cs10Ta29.27O78, were obtained as a serendipitous product in a welded tantalum ampoule by a blank reaction of CsBr and bismuth subnitrate [Bi5O(OH9(NO34] with the container material. The crystal structure of the title compound is made up of a three-dimensional framework constituted by two types of layers, viz. (Ta6O15n and (Ta3O9n, parallel to (001, which are linked together by TaO6 octahedra (3m. symmetry along [001]. This framework has cavities where three independent Cs+ ions (3m. and overline{6}m2 symmetry, respectively are located. The compound reveals a Ta deficiency at one trigonal prismatic coordinated site (overline{6}m2 symmetry. The composition of the title compound was verified by energy-dispersive X-ray analysis of single crystals.

  15. Status and Benefits of Renewable Energy Technologies in the Rural Areas of Ethiopia: A Case Study on Improved Cooking Stoves and Biogas Technologies

    Directory of Open Access Journals (Sweden)

    Yitayal Addis Alemayehu

    2015-07-01

    Full Text Available The majority of Ethiopia’s people (85% reside in rural areas, deriving their livelihood from agriculture. Ethiopia’s energy system is characterized mainly by biomass fuel supply, with households being the greatest energy consumers. The household sector takes up nearly 94 % of the total energy supplies. Access to energy resources and technologies in rural Ethiopia is highly constrained which makes the energy supply and consumption pattern of the country to show many elements of un-sustainability. The concern on cooking practices, household economics, health, forest and agricultural resource management, and global greenhouse gas emissions has emerged as a transformative opportunity to improve individual lives, livelihoods, and the global environment. More decentralized renewable energy projects could play an important role in mitigating traditional biomass fuel use. Improved cooking stove (ICS dissemination projects have been launched involving the private sector in the production and commercialization of the stoves. In doing so, about 3.7 million ICSs have been disseminated in the country so far which benefited stove users, producers and the total environment as about 30 million hectare of forest per year can be conserved. Conversion of animal waste to biogas energy to replace traditional fuel and use of the slurry as a fertilizer is the other current focus of the government of Ethiopia and installed more than 860 biogas digesters. The benefits obtained from these technologies are considerable and promising. However, the programs are not that much benefited the rural households where it had been intended to address. So, due attention should be given for those of the rural households in order to address the fuel wood crisis, environmental degradation and their health condition.

  16. Research on Monitoring Area Division of Quality Grade Changes in County Cultivated Land and Technology of Deploying Monitoring Point

    Institute of Scientific and Technical Information of China (English)

    Wei; WEI; Lijun; LIAO; Jianxin; YU

    2013-01-01

    It is an important means in management of improving both the quality and quantity of cultivated land to monitor grade changes in cultivated land quality. How to deploy monitoring network system and its point reasonably and roundly are the key to the technology of monitoring grade changes in cultivated land quality by monitoring grade changes in cultivated land quality dynamically in order to obtain the information to the index of cultivated land quality and its changes based on the existing achievements of farmland classification and grading. Spatial analysis method is used to demarcate monitoring area and deploy monitoring point according to ARCGIS,of which the result can meet the demand for monitoring grade changes in cultivated land.

  17. The african origin of complex projectile technology: an analysis using tip cross-sectional area and perimeter.

    Science.gov (United States)

    Sisk, Matthew L; Shea, John J

    2011-01-01

    Despite a body of literature focusing on the functionality of modern and stylistically distinct projectile points, comparatively little attention has been paid to quantifying the functionality of the early stages of projectile use. Previous work identified a simple ballistics measure, the Tip Cross-Sectional Area, as a way of determining if a given class of stone points could have served as effective projectile armatures. Here we use this in combination with an alternate measure, the Tip Cross-Sectional Perimeter, a more accurate proxy of the force needed to penetrate a target to a lethal depth. The current study discusses this measure and uses it to analyze a collection of measurements from African Middle Stone Age pointed stone artifacts. Several point types that were rejected in previous studies are statistically indistinguishable from ethnographic projectile points using this new measure. The ramifications of this finding for a Middle Stone Age origin of complex projectile technology is discussed.

  18. The African Origin of Complex Projectile Technology: An Analysis Using Tip Cross-Sectional Area and Perimeter

    Directory of Open Access Journals (Sweden)

    Matthew L. Sisk

    2011-01-01

    Full Text Available Despite a body of literature focusing on the functionality of modern and stylistically distinct projectile points, comparatively little attention has been paid to quantifying the functionality of the early stages of projectile use. Previous work identified a simple ballistics measure, the Tip Cross-Sectional Area, as a way of determining if a given class of stone points could have served as effective projectile armatures. Here we use this in combination with an alternate measure, the Tip Cross-Sectional Perimeter, a more accurate proxy of the force needed to penetrate a target to a lethal depth. The current study discusses this measure and uses it to analyze a collection of measurements from African Middle Stone Age pointed stone artifacts. Several point types that were rejected in previous studies are statistically indistinguishable from ethnographic projectile points using this new measure. The ramifications of this finding for a Middle Stone Age origin of complex projectile technology is discussed.

  19. Developing a concept of social-ecological-technological systems to characterize resilience of urban areas and infrastructure to extreme events

    Science.gov (United States)

    Chester, M.; Grimm, N. B.; Redman, C.; Miller, T.; McPherson, T.; Munoz-Erickson, T.; Chandler, D. G.

    2015-12-01

    Climate change is widely considered one of the greatest challenges to global sustainability, with extreme events being the most immediate way that people experience this phenomenon. Urban areas are particularly vulnerable to these events given their location, concentration of people, and increasingly complex and interdependent infrastructure. We are developing a conceptual framework for urban social-ecological-technological systems (SETS) that will allow researchers and practitioners to assess how infrastructure can be resilient, provide ecosystem services, improve social well being, and exploit new technologies in ways that benefit urban populations. The framework integrates the three domains of social and equity issues, environmental quality and protection, and technical/engineering aspects, to form a concept of infrastructure that occurs at the intersection of the domains. Examples show how the more common socioecological systems and socially sensitive engineering approaches that fail to incorporate the third dimension may elevate vulnerability to climate-related disaster. The SETS conceptual framework bridges currently siloed social science, environmental science, and engineering approaches to significantly advance research into the structure, function, and emergent properties of SETS. Extreme events like heat waves in Phoenix; coastal and urban flooding in the wake of superstorm Sandy and following hurricanes in Miami, FL; drought in Mexico; and urban flooding in Baltimore, Portland, San Juan PR, Syracuse, and Valdivia, Chile provide examples of the impacts of and vulnerability to extreme events that demand a new approach. The infrastructure of the future must be resilient, leverage ecosystem services, improve social well being, and exploit new technologies in ways that benefit all segments of urban populations and are appropriate to the particular urban contexts. These contexts are defined not only by the biophysical environment but also by culture and

  20. Atomic resolution imaging of precipitate transformation from cubic TaN to tetragonal CrTaN

    DEFF Research Database (Denmark)

    Danielsen, Hilmar Kjartansson; Hald, John; Somers, Marcel A. J.

    2012-01-01

    In 9–12% Cr creep-resistant steels Cr(V,Nb,Ta)N Z-phase is known to replace metastable (V,Nb,Ta)N MN precipitates at high temperatures. The precipitation process of Z-phase does not follow the classical nucleation theory, where dissolving MN particles provide constituents for Z-phase nucleation...

  1. mHealth Application Areas and Technology Combinations*. A Comparison of Literature from High and Low/Middle Income Countries.

    Science.gov (United States)

    Abaza, Haitham; Marschollek, Michael

    2017-08-08

    With the continuous and enormous spread of mobile technologies, mHealth has evolved as a new subfield of eHealth. While eHealth is broadly focused on information and communication technologies, mHealth seeks to explore more into mobile devices and wireless communication. Since mobile phone penetration has exceeded other infrastructure in low and middle-income countries (LMICs), mHealth is seen as a promising component to provide pervasive and patient-centered care. The aim of our research work for this paper is to examine the mHealth literature to identify application areas, target diseases, and mHealth service and technology types that are most appropriate for LMICs. Based on the 2011 WHO mHealth report, a combination of search terms, all including the word "mHealth", was identified. A literature review was conducted by searching the PubMed and IEEE Xplore databases. Articles were included if they were published in English, covered an mHealth solution/ intervention, involved the use of a mobile communication device, and included a pilot evaluation study. Articles were excluded if they did not provide sufficient detail on the solution covered or did not focus on clinical efficacy/effectiveness. Cross-referencing was also performed on included articles. 842 articles were retrieved and analyzed, 255 of which met the inclusion criteria. North America had the highest number of applications (n=74) followed by Europe (n=50), Asia (n=44), Africa (n=25), and Australia (n=9). The Middle East (n=5) and South America (n=3) had the least number of studies. The majority of solutions addressed diabetes (n=51), obesity (n=25), CVDs (n=24), HIV (n=18), mental health (n=16), health behaviors (n=16), and maternal and child's health (MCH) (n=11). Fewer solutions addressed asthma (n=7), cancer (n=5), family health planning (n=5), TB (n=3), malaria (n=2), chronic obtrusive pulmonary disease (COPD) (n=2), vision care (n=2), and dermatology (n=2). Other solutions targeted stroke, dental

  2. Order within disorder: The atomic structure of ion-beam sputtered amorphous tantala (a-Ta2O5

    Directory of Open Access Journals (Sweden)

    Riccardo Bassiri

    2015-03-01

    Full Text Available Amorphous tantala (a-Ta2O5 is a technologically important material often used in high-performance coatings. Understanding this material at the atomic level provides a way to further improve performance. This work details extended X-ray absorption fine structure measurements of a-Ta2O5 coatings, where high-quality experimental data and theoretical fits have allowed a detailed interpretation of the nearest-neighbor distributions. It was found that the tantalum atom is surrounded by four shells of atoms in sequence; oxygen, tantalum, oxygen, and tantalum. A discussion is also included on how these models can be interpreted within the context of published crystalline Ta2O5 and other a-T2O5 studies.

  3. Thermodynamics of formation reactions of intermetallides Ni/sub 3/Ta and Ni/sub 2/Ta

    Energy Technology Data Exchange (ETDEWEB)

    Lyakishev, N.P.; Snitko, Yu.P.; Alekseev, V.I.; Levshin, G.A. (Tsentral' nyj Nauchno-Issledovatel' skij Inst. Chernoj Metallurgii, Moscow (USSR))

    1981-01-01

    Thermodynamical functions of the formation of Ni/sub 3/Ta and Ni/sub 2/Ta intermetallides are studied when investigating the electromotive force of the cell MoVertical BarTa/sub 2/O/sub 5/, Nisub(x)Tasub(y)Vertical Bar0.99ThOsub(2)i0.01 CaOVertical Bar Fe, Fesub(0.95)OVertical BarMo in the temperature range of 1173-1323 K. Thermodynamical functions of Ni/sub 3/Ta and Ni/sub 2/Ta formation are equal to: ..delta..Gsub(f)sup(0) (1273 K) 31.70 and 28.86; ..delta..Hsub(f)sup(0) (1173-1323 K) 27.88, 07.9 kcal/mol; ..delta..Ssub(f)sup(0) (1173-1323 K) 3,U and 0.75 cal/molxdegree, respectively.

  4. LAFD: TA-16 HE Facility Familiarization Tour, OJT 55258

    Energy Technology Data Exchange (ETDEWEB)

    Rutherford, Victor Stephen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-05-31

    Los Alamos National Laboratory (LANL) will conduct familiarization tours for personnel of the Los Alamos County Fire Department (LAFD) at TA-16 high explosives (HE) facilities. These familiarization tours are official LANL business; the purpose of these tours is to orient LAFD firefighters to the facility so that they can respond efficiently and quickly to a variety of emergency situations. This orientation includes, among other topics, ingress and egress of the area and buildings, layout and organization of the facility, evacuation procedures and assembly points, and areas of concern within the various buildings at the facility. LAFD firefighters have the skills and abilities to perform firefighting operations and other emergency response tasks that cannot be provided by LANL personnel who have the required clearance. This handout provides details of the information, along with maps and diagrams, to be presented during the familiarization tours. The handout will be distributed to the trainees at the time of the tour. A corresponding checklist will also be used as guidance during the familiarization tours to ensure that all required information is presented to LAFD personnel.

  5. Dynamic surface tension of surfactant TA: experiments and theory.

    Science.gov (United States)

    Otis, D R; Ingenito, E P; Kamm, R D; Johnson, M

    1994-12-01

    A bubble surfactometer was used to measure the surface tension of an aqueous suspension of surfactant TA as a function of bubble area over a range of cycling rates and surfactant bulk concentrations. Results of the surface tension-interfacial area loops exhibited a rich variety of phenomena, the character of which varied systematically with frequency and bulk concentration. A model was developed to interpret and explain these data and for use in describing the dynamics of surface layers under more general circumstances. Surfactant was modeled as a single component with surface tension taken to depend on only the interfacial surfactant concentration. Two distinct mechanisms were considered for the exchange of surfactant between the bulk phase and interface. The first is described by a simple kinetic relationship for adsorption and desorption that pertains only when the interfacial concentration is below its maximum equilibrium value. The second mechanism is "squeeze-out" by which surfactant molecules are expelled from an interface compressed past a maximum packing state. The model provided good agreement with experimental measurements for cycling rates from 1 to 100 cycles/min and for bulk concentrations between 0.0073 and 7.3 mg/ml.

  6. Emergy-based comparative analysis on industrial clusters: economic and technological development zone of Shenyang area, China.

    Science.gov (United States)

    Liu, Zhe; Geng, Yong; Zhang, Pan; Dong, Huijuan; Liu, Zuoxi

    2014-09-01

    In China, local governments of many areas prefer to give priority to the development of heavy industrial clusters in pursuit of high value of gross domestic production (GDP) growth to get political achievements, which usually results in higher costs from ecological degradation and environmental pollution. Therefore, effective methods and reasonable evaluation system are urgently needed to evaluate the overall efficiency of industrial clusters. Emergy methods links economic and ecological systems together, which can evaluate the contribution of ecological products and services as well as the load placed on environmental systems. This method has been successfully applied in many case studies of ecosystem but seldom in industrial clusters. This study applied the methodology of emergy analysis to perform the efficiency of industrial clusters through a series of emergy-based indices as well as the proposed indicators. A case study of Shenyang Economic Technological Development Area (SETDA) was investigated to show the emergy method's practical potential to evaluate industrial clusters to inform environmental policy making. The results of our study showed that the industrial cluster of electric equipment and electronic manufacturing produced the most economic value and had the highest efficiency of energy utilization among the four industrial clusters. However, the sustainability index of the industrial cluster of food and beverage processing was better than the other industrial clusters.

  7. A Robust WLS Power System State Estimation Method Integrating a Wide-Area Measurement System and SCADA Technology

    Directory of Open Access Journals (Sweden)

    Tao Jin

    2015-04-01

    Full Text Available With the development of modern society, the scale of the power system is rapidly increased accordingly, and the framework and mode of running of power systems are trending towards more complexity. It is nowadays much more important for the dispatchers to know exactly the state parameters of the power network through state estimation. This paper proposes a robust power system WLS state estimation method integrating a wide-area measurement system (WAMS and SCADA technology, incorporating phasor measurements and the results of the traditional state estimator in a post-processing estimator, which greatly reduces the scale of the non-linear estimation problem as well as the number of iterations and the processing time per iteration. This paper firstly analyzes the wide-area state estimation model in detail, then according to the issue that least squares does not account for bad data and outliers, the paper proposes a robust weighted least squares (WLS method that combines a robust estimation principle with least squares by equivalent weight. The performance assessment is discussed through setting up mathematical models of the distribution network. The effectiveness of the proposed method was proved to be accurate and reliable by simulations and experiments.

  8. Technologies of oxygen supply for life support during the development of mineral resources in high altitude areas

    Institute of Scientific and Technical Information of China (English)

    Liu Yingshu; Jia Yanxiang; Wu Tianyi; Deng Ling; Yang Xiong; Liu Wenhai; Zhang Hui

    2013-01-01

    In order to fulfill the needs of life-support oxygen supply during the development of plateau mineral resources,four oxygen supply patterns suitable for the plateau mine in specific environment were developed:tunnel face diffusive oxygen supply,tunnel oxygen-bar car,carried oxygen cylinder and portable oxygen generator.Through the study of safety oxygen supply experiments in low-pressure plateau areas,the mathematical relationship between maximum integration of secure oxygen volume and altitude has been achieved.Oxygen supply safety control should follow this relationship in plateau mines during the time of executing tunnel face or in room air diffusive oxygen supply.The application results of life-support oxygen supplement technologies in the development of mineral resources in high altitude areas show that the oxygen supply for tunneling miners in plateau mines can not only effectively enhance the oxygen saturation,reduce the pulse rate and the breath rate per minute,but also improve various symptoms caused by altitude hypoxia and high-intensity physical labor.

  9. Interactive Technology Assessment in the Real World

    NARCIS (Netherlands)

    Marris, Claire; Joly, Pierre-Benoit; Rip, Arie

    2008-01-01

    Participatory Technology Assessment (pTA) initiatives have usually been analyzed as if they existed in a social and political vacuum. This article analyzes the linkages that occur, in both directions, between the microcosm set up by a pTA exercise and the real world outside. This dual-dynamics persp

  10. Interactive technology assessment and wide reflective equilibrium.

    NARCIS (Netherlands)

    Reuzel, R.P.B.; Wilt, G.J. van der; Have, H.A.M.J. ten; Vries Robbé, P.F. de

    2001-01-01

    Interactive technology assessment (iTA) provides an answer to the ethical problem of normative bias in evaluation research. This normative bias develops when relevant perspectives on the evaluand (the thing being evaluated) are neglected. In iTA this bias is overcome by incorporating different persp

  11. Scientific and technological capabilities in health-related areas: opportunities, challenges, and interactions with the industrial sector.

    Science.gov (United States)

    Vargas, Marco Antonio; Britto, Jorge

    2016-11-03

    Characterization of the scientific and technological infrastructure in health and its interactions with the industrial sector provides key elements for understanding the dynamics of innovation in health. This study conducts an exploratory analysis of the potentialities and limitations associated with scientific and technological capabilities in the health area in Brazil and the different links between the scientific and industrial sectors in health. The analysis points to important growth in internationally indexed research output, especially in certain areas such as pharmaceutics, public health, genetics, morphology, physiology, and microbiology. There has also been important growth in research groups that interact with the industrial sector in selected areas of health. The study highlights the importance of building more solid and permanent bridges between companies, research institutions, and the health system, linking the knowledge developed in research institutions to the dynamics of the industrial sector in health. Resumo: A caracterização da infraestrutura científica e tecnológica na área da saúde e das suas formas de articulação com a base produtiva representam elementos centrais na compreensão da dinâmica de inovação em saúde. Este estudo faz uma análise exploratória sobre as potencialidades e limitações associadas às capacitações científicas e tecnológicas na área da saúde no Brasil e as formas de articulação entre a base científica e a base produtiva em saúde. A análise aponta para o crescimento expressivo da produção bibliográfica com circulação internacional no campo da saúde, particularmente em determinadas áreas como farmácia, saúde coletiva, genética, morfologia, fisiologia e microbiologia. Além disso, observa-se um crescimento expressivo dos grupos de pesquisa com relacionamentos com o setor produtivo em áreas selecionadas da saúde. Destaca-se a importância da construção de pontes mais sólidas e

  12. Defense Technology Area Plan.

    Science.gov (United States)

    1996-05-01

    will be demonstrated as a remediation alternative for hydrocarbon-contaminated sites. Compliance -- The use of plasma arc pyrolysis to destroy ships...development will use an airborne radar test to collect amplitude and phase information on clutter backgrounds representative of those expected for a SBR ...the validity of SBR models and simulations. Upcoming studies of non-conventional radar processing against diverse clutter environments, and automatic

  13. Laser-deposited Ti-Nb-Zr-Ta orthopedic alloys.

    Science.gov (United States)

    Banerjee, R; Nag, S; Samuel, S; Fraser, H L

    2006-08-01

    The complex quaternary Ti-35Nb-7Zr-5Ta orthopedic alloy has been successfully deposited from a powder feedstock consisting of a blend of elemental titanium, niobium, zirconium, and tantalum powders, using the laser engineered net-shaping (LENStrade mark) process. In the as laser-deposited form, these alloys exhibit a substantially higher tensile strength as compared with more conventionally processed counterparts of similar composition, while maintaining excellent ductility and a low modulus. Furthermore, the as-deposited alloys appear to exhibit a texture, with a substantially large number of grains of the beta phase aligning one of their axes nearly normal to the substrate or parallel to the growth direction. The microstructure of the as-deposited as well as tensile-tested alloys have been characterized in detail using scanning electron microscopy (SEM), orientation microscopy (OM), and transmission electron microscopy (TEM). Formation of a high density of shear bands, possibly arising from slip localization due to precipitates of the omega phase in the beta matrix, is clearly evident in the tensile-tested sample. The enhanced tensile strength and low modulus in these laser-deposited alloys coupled with the ability to form near-net shape components makes LENS an attractive processing technology for orthopedic implants.

  14. Ta/TA6V heterogeneous welding. Study of the formation and the metallurgical properties of the melted zones; Soudage heterogene Ta/TA6V Etude de la formation et des proprietes metallurgiques des zones fondues

    Energy Technology Data Exchange (ETDEWEB)

    Malicrot, A.; Naudy, P.; Durut, L. [CEA Valduc, 21120 Is-sur-Tille (France); Grevey, D. [Pole Laser Creusot Bourgogne, 71200 Le Creusot (France); Daloz, D. [Ecole des Mines de Nancy, 54000 Nancy (France)

    2006-07-01

    The welding laboratory of the department of manufacturing and nuclear technologies is in charge to assemble prototype objects which appeal to a lot of materials as for instance titanium or tantalum. The autogenous weldability of these two materials is relatively well known nowadays, by laser beam or electrons beam. On the other hand, the heterogeneous welding is most difficult on account of the important differences of the thermophysical and metallurgical properties of the two involved materials. This work deals more particularly with the Nd:YAG laser welding of tantalum with the titanium alloy TA6V. Two modes of energy contribution are considered: impulsional and continuous. The aim of this work is to finely characterized, in a metallurgical point of view, the melted zones in order to control their composition (constitution and distribution of the phases in presence, identification of the eventual defects), as well as the reactional processes occurring in the liquid bath during and after the interaction of the laser beam with the matter. Thus, a first study has been carried out at the macroscopic scale in order to obtain global views of the melted zones. The magnification is then strongly increased for analyzing the weldings at the microstructure scale. (O.M.)

  15. Brazilian university technology transfer to rural areas Transferência de tecnologia de universidades brasileiras na área rural

    Directory of Open Access Journals (Sweden)

    Enio Marchesan

    2010-10-01

    Full Text Available In agriculture, there is a difference between average yield obtained by farmers and crop potential. There is technology available to increase yields, but not all farmers have access to it and/or use this information. This clearly characterizes an extension and technology transference problem. There are several technology transfer systems, but there is no system to fit all conditions. Therefore, it is necessary to create extension solutions according to local conditions. Another rural extension challenge is efficiency, despite continuous funding reductions. One proposal that has resulted from extension reform worldwide has suggested integration between the public and private sectors. The public universities could play the role of training and updating technical assistance of human resources, which is the one of the main aspects that has limited technology transfer. The objective of this study was to identify approaches to promote technology transfer generated in Brazilian public universities to rural areas through literature review. An experimental approach of technology transfer is presented here where a Brazilian university extension Vice-chancellor incorporates professionals from consolidated research groups according to demand. In this way, public universities take part of their social functions, by integrating teaching, research, and extension.Em agricultura, há diferenças entre a produtividade média obtida pelos produtores e o potencial produtivo dos cultivos. Há informação tecnológica disponível para aumentar a produtividade, mas nem todos os produtores têm acesso e/ou usam a informação. Isso caracteriza claramente um problema de extensão e transferência de tecnologia. Há vários sistemas de transferência de tecnologia, mas, como não há sistema que se ajuste a todas as condições, é necessário criar alternativas adequadas às condições de cada local. Outro desafio da extensão rural é ser eficiente, apesar da cont

  16. Bridging the Gap Between Innovation and ELSA: The TA Program in the Dutch Nano-R&D Program NanoNed

    NARCIS (Netherlands)

    Rip, A.; Lente, H. van

    2013-01-01

    The Technology Assessment (TA) Program established in 2003 as part of the Dutch R&D consortium NanoNed is interesting for what it did, but also as an indication that there are changes in how new science and technology are pursued: the nanotechnologists felt it necessary to spend part of their fundin

  17. Bridging the Gap Between Innovation and ELSA: The TA Program in the Dutch Nano-R&D Program NanoNed

    NARCIS (Netherlands)

    Rip, A.; Lente, H. van

    2013-01-01

    The Technology Assessment (TA) Program established in 2003 as part of the Dutch R&D consortium NanoNed is interesting for what it did, but also as an indication that there are changes in how new science and technology are pursued: the nanotechnologists felt it necessary to spend part of their

  18. Structural and dielectric properties of Sr3(MgTa2)O9 and Sr3(ZnTa2)O9

    Science.gov (United States)

    Hoque, Md. M.; Dutta, Alo; Kumar, S.; Sinha, T. P.

    2015-07-01

    Herein, we report the crystal structures and morphological properties of Sr3(MgTa2)O9 (SMT) and Sr3(ZnTa2)O9 (SZT) synthesized by solid state ceramic method along with the results of alternating current impedance spectroscopic (ACIS) study in a frequency range from 50 Hz to 1 MHz at selective temperatures between 393 and 573 K. The crystal structures of SMT and SZT have been determined by Rietveld refinement of powder X-ray diffraction pattern using an initial structural model developed on the basis of literature survey. The results indicate that both the samples possess hexagonal structure of trigonal P 3 bar m 1 space group. The lattice parameters of SMT are a=b=5.65162 Å, c=6.94440 Å, α=β=90° and γ=120° and those of SZT are a=b=5.65832 Å, c=6.95911 Å and α=β=90° and γ=120°. SMT and SZT are isostructural and they exhibit 2:1 B site ordering with the staking sequence of {-Ta-Ta-Mg (Zn)-} (Mg for SMT and Zn for SZT) layer repeat on (111) plane of the pseudocells. The characteristic vibrational bands due to Ta-O, Mg-O and Zn-O bonds have been observed in the FTIR spectra of the samples. The FESEM micrographs of the samples show that the grains size ranges between 0.40 and 3.65 μm and 0.9 to 4.2 μm for SMT and SZT, respectively. To account for the polydispersive nature of the dielectric relaxation mechanism along with the effects of dc conductivity and localized space charges the variation of real (ε‧) and imaginary (ε″) parts of dielectric constant with frequency has been analytically interpreted in the framework of modified Cole-Cole model. SMT and SZT having the activation energies of 0.35 eV and 0.33 eV, respectively (obtained from the Arrhenius plot of dc conductivity), are semiconducting in nature. The electrical current conduction in the samples occurs by polaron hopping process. Further, we have shown that chemical property of A site cations has significant role in determining the dielectric properties of A3B‧B″2O9 type perovskites

  19. First-principles study of the charge transfer and evolution of Si doping 2N2Ta islands adsorption on TaN (001) surfaces

    Science.gov (United States)

    Ren, Yuan; Zhang, Honglv; Zhang, Chao; Zeng, Haiqing; Liu, Xuejie

    2017-01-01

    The separation and aggregation of Si atoms around TaN grains during deposition of Ta-Si-N nanocomposite films were studied, and the adsorption energies, charge transfer and atomic partial density of state of Si-2N2Ta islands on the TaN (001) surface and diffusion energy of the islands during their evolution were evaluated using the first-principles method based on density functional theory (DFT). In the lowest total energy stable configuration, N and Ta atoms tended to combine to form 2N2Ta islands, whereas Si atoms tended to stay at a position diagonal to the Ta atom outside of the island. Si atoms entered the position of the missing N atom of the TaN island and formed a substitute solid solution during Ta-Si-N growth. The Si atoms of the solid solution in the island could be easily extruded by Ta- or N-rich island during the deposition process. The process of Si atom extrusion by a N atom which was the configuration of N-by-2Ta1N1Si island evolved into Si-by-2N2Ta island in rich N-atom. The process of Si atom was extruded by the Ta atom which was the configuration of Ta-by-2N1Ta1Si island evolved into Si-of-2Ta2N island, that reduced the total energy of island. The diffusion energies of these evolutions were 0.974 and 1.712 eV, respectively. The Si atoms and TaN grain phase tended to separate during the deposition process. Si atoms could give way to Ta and N atoms during the Ta-Si-N nanocomposite film deposition process.

  20. Magnetism of Ta dichalcogenide monolayers tuned by strain and hydrogenation

    Energy Technology Data Exchange (ETDEWEB)

    Manchanda, Priyanka; Sellmyer, D. J.; Skomski, Ralph [Department of Physics and Astronomy and Nebraska Center for Materials and Nanoscience, University of Nebraska, Lincoln, Nebraska 68588 (United States); Sharma, Vinit [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Yu, Hongbin [School of Electrical, Computer, and Energy Engineering, Arizona State University, Tempe, Arizona 85287 (United States)

    2015-07-20

    The effects of strain and hydrogenation on the electronic, magnetic, and optical properties of monolayers of Ta based dichalcogenides (TaX{sub 2}; X = S, Se, and Te) are investigated using density-functional theory. We predict a complex scenario of strain-dependent magnetic phase transitions involving paramagnetic, ferromagnetic, and modulated antiferromagnetic states. Covering one of the two chalcogenide surfaces with hydrogen switches the antiferromagnetic/nonmagnetic TaX{sub 2} monolayers to a semiconductor, and the optical behavior strongly depends on strain and hydrogenation. Our research opens pathways towards the manipulation of magnetic as well as optical properties for future spintronics and optoelectronics applications.

  1. Theoretic models for recommendation and implementation of assistive technology

    Directory of Open Access Journals (Sweden)

    Ana Cristina de Jesus Alves

    2016-07-01

    Full Text Available Introduction: The latest international researches seek to understand the factors affecting the successful use of assistive technology devices through studies regarding the assessments systematizing; abandonment of devices; or theoric models that consider the aspects of those devices implementation. In Brazil the researches are focused on developing new technologies and there are still not sufficient studies related to the successful use of devices and ways of assistive technology implementation. Objective: To identify conceptual models used for indication and implementation of assistive technology devices. Method: Literature review. The survey was conducted in six databases: CINAHAL, Eric, GALE, LILACS, MEDLINE e PsycInfo. A critical analysis described by Grant and Booth was used. Results: There are no records of a Brazilian survey and among 29 selected articles, 17 conceptual models used in the area of AT were found; of these, 14 were specific to AT. The results showed that the new conceptual models of TA are under development and the conceptual model “Matching Person and Technology – MPT” was the most mentioned. Conclusion: We can observe that the practices related to TA area in international context shows a correlation with conceptual models, thus, we hope this study might have the capacity to contribute for the propagation of this precepts at national level

  2. An Applied Local Wisdom to Manage Water for Developing Riverside Community: A Case Study of the Lam Ta Kong River Basin

    Directory of Open Access Journals (Sweden)

    Surapong Kongsat

    2009-01-01

    Full Text Available Problem statement: An integrated water resource management is accepted technique to solve the water resource problems both water shortage and flood plane in order to improve human life. The combination between local wisdom and modern technology by farmer participation is a main part of integrated management. The mentioned techniques had been being applied for human life in the northeast region of Thailand. Approach: This study investigated the local wisdom of water resource management and an application of the local wisdom to manage water resource for developing the economic, society and culture of Lam Ta Kong’s community, Nakhorn Ratchasima province, Thailand. Information was investigated from relevant document and field survey including questionnaire and interview. Results: The result founded that there were two types of the local wisdoms including an original local wisdom on water management and a combination of original and modern science local wisdom to manage available water. For original wisdom, there were earth dam, rock dam, rocks dyke, wooden weir, waterwheel and shallow well that were found in source and midst of the river basin. They constructed the dams and weirs barrier flow river along the Lam Ta Kong River in order to storage water for using purposes in dry season and to mitigate flood plane during rainy season as an early age of the local wisdom. The waterwheel was used to bail water from river to their community. For the combination of original and modern science, there were concrete dam, Watergate, irrigating tube, irrigation channel, water pump, water pump dynamo and underground water drilling that were found at the source, midst and tide tail of the river basin. These combined local wisdoms are considered as a current apparatus in water resource management of the area. The stored water was managed with annual rainfall for cultivation, industrial, family activity and residences for the necessaries of life. Conclusion

  3. NaTa03/MCM-48 composites for photocatalytic conversion of organic molecules

    Science.gov (United States)

    Senevirathne, K.; Xia, C.-K.; Adhikari, S. P.; Zhang, L.; Williams, R. T.; Lachgar, A.

    2016-10-01

    The synthesis, characterization, and photocatalytic activity of a series of NaTaO3/MCM-48 composite photocatalysts prepared by sol-gel method is reported. The composite catalysts were investigated by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), and N2 adsorption-desorption porosimetry. Their photocatalytic activity for conversion of organic molecules was tested using p-nitroaniline as a model pollutant. The surface area was found to be in the order of 235-964 m2/g and 35-407 m2/g for photocatalysts calcined at 500 °C and 850 °C, respectively. The surface area was found to depend on the MCM silica content. The pore size for samples calcined at 500 °C ranges from 2.6-3.2 nm, and becomes significantly larger at 850 °C (12.6-30.0 nm) for most composites. All composites have been found to be photocatalytically active towardsp-nitroaniline conversion intop-phenylenediamine under uv- visible irradiation. The conversion of p-nitroaniline per weight of NaTaO3 in the composite photocatalysts is found to be higher than that of pristine NaTaO3. The composites lose 12% of their original activity after three consecutive catalytic cycles.

  4. TaLHY, a 1R-MYB Transcription Factor, Plays an Important Role in Disease Resistance against Stripe Rust Fungus and Ear Heading in Wheat.

    Directory of Open Access Journals (Sweden)

    Zijin Zhang

    Full Text Available LHY (late elongated hypocotyl is an important gene that regulates and controls biological rhythms in plants. Additionally, LHY is highly expressed in the SSH (suppression subtractive hybridization cDNA library-induced stripe rust pathogen (CYR32 in our previous research. To identify the function of the LHY gene in disease resistance against stripe rust, we used RACE-PCR technology to clone TaLHY in the wheat variety Chuannong19. The cDNA of TaLHY is 3085 bp long with an open reading frame of 1947 bp. TaLHY is speculated to encode a 70.3 kDa protein of 648 amino acids , which has one typical plant MYB-DNA binding domain; additionally, phylogenetic tree shows that TaLHY has the highest homology with LHY of Brachypodium distachyon(BdLHY-like. Quantitative fluorescence PCR indicates that TaLHY has higher expression in the leaf, ear and stem of wheat but lower expression in the root. Infestation of CYR32 can result in up-regulated expression of TaLHY, peaking at 72 h. Using VIGS (virus-induced gene silencing technology to disease-resistant wheat in the fourth leaf stage, plants with silenced TaLHY cannot complete their heading stage. Through the compatible interaction with the stripe rust physiological race CYR32, Chuannong 19 loses its immune capability toward the stripe rust pathogen, indicating that TaLHY may regulate and participate in the heading of wheat, as well as the defense responses against stripe rust infection.

  5. Giant strain control of magnetoelectric effect in Ta|Fe|MgO.

    Science.gov (United States)

    Odkhuu, Dorj

    2016-09-06

    The exploration of electric field controlled magnetism has come under scrutiny for its intriguing magnetoelectric phenomenon as well as technological advances in spintronics. Herein, the tremendous effect of an epitaxial strain on voltage-controlled perpendicular magnetic anisotropy (VPMA) is demonstrated in a transition-metal|ferromagnet|MgO (TM|FM|MgO) heterostructure from first-principles electronic structure computation. By tuning the epitaxial strain in Ta|Fe|MgO as a model system of TM|FM|MgO, we find distinctly different behaviours of VPMA from V- to Λ-shape trends with a substantially large magnetoelectric coefficient, up to an order of 10(3) fJV(-1)m(-1). We further reveal that the VPMA modulation under strain is mainly governed by the inherently large spin-orbit coupling of Ta 5d-Fe 3d hybridized orbitals at the TM|FM interface, although the Fe 3d-O 2p hybridization at the FM|MgO interface is partly responsible in determining the PMA of Ta|Fe|MgO. These results suggest that the control of epitaxial strain enables the engineering of VPMA, and provides physical insights for the divergent behaviors of VPMA and magnetoelectric coefficients found in TM|FM|MgO experiments.

  6. Giant strain control of magnetoelectric effect in Ta|Fe|MgO

    Science.gov (United States)

    Odkhuu, Dorj

    2016-09-01

    The exploration of electric field controlled magnetism has come under scrutiny for its intriguing magnetoelectric phenomenon as well as technological advances in spintronics. Herein, the tremendous effect of an epitaxial strain on voltage-controlled perpendicular magnetic anisotropy (VPMA) is demonstrated in a transition-metal|ferromagnet|MgO (TM|FM|MgO) heterostructure from first-principles electronic structure computation. By tuning the epitaxial strain in Ta|Fe|MgO as a model system of TM|FM|MgO, we find distinctly different behaviours of VPMA from V- to Λ-shape trends with a substantially large magnetoelectric coefficient, up to an order of 103 fJV‑1m‑1. We further reveal that the VPMA modulation under strain is mainly governed by the inherently large spin-orbit coupling of Ta 5d–Fe 3d hybridized orbitals at the TM|FM interface, although the Fe 3d–O 2p hybridization at the FM|MgO interface is partly responsible in determining the PMA of Ta|Fe|MgO. These results suggest that the control of epitaxial strain enables the engineering of VPMA, and provides physical insights for the divergent behaviors of VPMA and magnetoelectric coefficients found in TM|FM|MgO experiments.

  7. Giant strain control of magnetoelectric effect in Ta/Fe/MgO

    CERN Document Server

    Odkhuu, Dorj

    2016-01-01

    The exploration of electric field controlled magnetism has come under scrutiny for its intriguing magnetoelectric phenomenon as well as technological advances in spintronics. Herein, the tremendous effect of an epitaxial strain on voltage-controlled perpendicular magnetic anisotropy (VPMA) is demonstrated in a transition-metal/ferromagnet/MgO (TM/FM/MgO) heterostructure from first-principles electronic structure computation. By tuning the epitaxial strain in Ta/Fe/MgO as a model system of TM/FM/MgO, we find distinctly different behaviours of VPMA from V- to {\\Lambda}-shape trends with a substantially large magnetoelectric coefficient, up to an order of 1000 fJ/Vm. We further reveal that the VPMA modulation under strain is mainly governed by the inherently large spin-orbit coupling of Ta 5d-Fe 3d hybridized orbitals at the TM/FM interface, although the Fe 3d-O 2p hybridization at the FM/MgO is partly responsible in determining the PMA of Ta/Fe/MgO. These results suggest that the control of epitaxial strain ena...

  8. Diffusion of $^{6}$Li in Ta and W

    CERN Document Server

    Vacik, J

    2006-01-01

    The objective of this work was the study of 6Li diffusion in the Ta and W refractory metals. The samples were prepared by ion implantation of 380 keV 6Li+ ions into W and Ta thin foils (up to the fluence of 1016 ions/cm2) and annealed up to the temperature 1940 °C. The depth profiles of 6Li were determined using the Thermal Neutron Depth Profiling (TNDP) technique. The results showed that diffusion of 6Li in both W and Ta foils is very complex and cannot be described by simple Fick’s laws. Trapping centers (in the subsurface layers of both W and Ta metals) were supposed in a trial to explain the 6Li diffusion behaviour. However, the 6Li depth profiles were only partly explained. Other aspects are necessary to take into account for more proper quantification; such as spatially dependent diffusion coefficients, etc.

  9. EPA-developed, patented technologies related to miscellaneous areas of environmental experties and invention that are available for licensing

    Data.gov (United States)

    U.S. Environmental Protection Agency — Under the Federal Technology Transfer Act (FTTA), Federal Agencies can patent inventions developed during the course of research. These technologies can then be...

  10. Proposal for the decision making in sensitive technology: application to the nuclear area; Proposta de modelo decisorio em tecnologia sensivel: aplicacao a area nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Eduardo Ramos Ferreira da [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mail: erfsilva@ipen.br

    2007-07-01

    In a previous article, a correlation is made among the phases of the nuclear technology development and the decision making processes, showing that from the 70's decade, such processes are connected to the national security doctrines, influenced by the Brazilian War College. In this paper it is shown the developed model for the decision making when the sensitive technologies are involved that in our special case will be specific oriented to the nuclear technology. An assessment are made for such decisions must having the the population approval, showing the main existent obstacles and how the present model, although defined at the end of the year 2003, will not be succeeded in a short period of time. It is mainly shown that the linear models must be abandoned, essential since the Word War II, for a holistic model more realistic with a new global state of affairs.

  11. Ultrasensitive Anomalous Hall Effect in Ta/CoFe/Oxide/Ta Multilayers

    Directory of Open Access Journals (Sweden)

    Guang Yang

    2016-01-01

    Full Text Available Ultrahigh anomalous Hall sensitivity has been demonstrated in Ta/CoFe/Oxide/Ta multilayers. By changing oxides (MgO and HfO2 and annealing temperature, different annealing dependence of sensitivity was found in MgO-sample and HfO2-sample. For the MgO-sample, the anomalous Hall sensitivity reaches 18792 Ω/T in the as-deposited state and significantly reduces as annealing temperature increases. On the contrary, the sensitivity of the as-deposited HfO2-sample is only 765 Ω/T, while it remarkably increases with annealing temperature increasing, finally reaching 14741 Ω/T at 240°C. The opposite variation of anomalous sensitivity in two samples originates from the different change of magnetic anisotropy and anomalous Hall resistance during the annealing process. Our study provides a new perspective that both the choice of oxide material and the optimization of annealing treatment are important to the anomalous Hall sensitivity.

  12. EPA-developed, patented technologies related to miscellaneous areas of environmental experties and invention that are available for licensing

    Science.gov (United States)

    Under the Federal Technology Transfer Act (FTTA), Federal Agencies can patent inventions developed during the course of research. These technologies can then be licensed to businesses or individuals for further development and sale in the marketplace. These technologies relate to ecological research, human health, and manufacturing.

  13. Mobile Technology and the Challenge to Promote a Communicative City in Indonesia. Case Study Bandung Metropolitan Area

    Science.gov (United States)

    Sutriadi, Ridwan

    2011-01-01

    The objective of this study is to assess the role of mobile technology to promote a communicative city in Indonesia. The focus is on mobile technologies as symbols of the latest information and communication technology (ICT). Communication influences the capacity building of the governmental planning employees to conduct better planning…

  14. Thermodynamic assessment of the Si-Ta system

    Energy Technology Data Exchange (ETDEWEB)

    Drouelle, I., E-mail: coletteservant@orange.fr [Laboratoire de Physicochimie de l' Etat Solide, ICMMO, Universite de Paris-Sud, 91405 Orsay Cedex (France); Servant, C. [Laboratoire de Physicochimie de l' Etat Solide, ICMMO, Universite de Paris-Sud, 91405 Orsay Cedex (France)

    2013-02-25

    Highlights: Black-Right-Pointing-Pointer The thermodynamic modelling of the Si-Ta system is made with the CALPHAD method. Black-Right-Pointing-Pointer The liquid and bcc phases are treated with a solution model and compounds as stoichiometric. Black-Right-Pointing-Pointer The excess Gibbs energy of the solution phases is assessed with the T dependence by Kaptay. Black-Right-Pointing-Pointer The calculations based on the thermodynamic optimisation agree well with the experiments. - Abstract: The thermodynamic modeling of the silicon-tantalum binary system was carried out with the help of the CALPHAD (CALculation of PHAse Diagram) method. A solution model was used for the description of the liquid and bcc phases while the Si{sub 2}Ta, Si{sub 3}Ta{sub 5L}T, Si{sub 3}Ta{sub 5H}T SiTa{sub 2} and SiTa{sub 3} compounds are treated as stoichiometric. The excess Gibbs energy function of the solution phases was assessed with the recent exponential temperature dependence of the interaction parameters by Kaptay [1-3] and compared with the Redlich-Kister [4] polynomial equation results. The calculations based on the thermodynamic modeling are in good agreement with the phase diagram data and experimental thermodynamic values available in literature.

  15. Modelling the mechanical behaviour of heterogeneous Ta/TA6V welded joints: behaviour and failure criteria; Modelisation du comportement mecanique des liaisons soudees heterogenes Ta/TA6V: comportement et critere de rupture

    Energy Technology Data Exchange (ETDEWEB)

    Paris, Th

    2008-12-15

    As laser welding of two different materials (heterogeneous welding) leads to a joint having a characteristic size close to the millimetre, i.e. much smaller than that of a structure, and as such a junction displays completely different mechanical properties because of the metallurgical transformations induced by intense thermal loading, the aim of this research thesis is to develop a behaviour model, flexible and robust enough, to represent all together the mechanical behaviours of the Ta, the TA6V and the melted zone. This model must be able to take plasticity and visco-plasticity into account, and also to provide a failure criterion through damage mechanics and its coupling with the behaviour. The author first reports the experimental characterization of the base materials (Ta and TA6V) by using tensile tests under different strain rates and different directions, relaxation tests and fatigue shear tests. He also characterizes the melted zone by describing the influence of a thermal treatment (induced by welding) on the formation of the melted zone, and by using different tests: four point bending on notched specimens, nano-indentation test, and longitudinal tensile test. In a second part, the author develops the model within the framework of continuum thermodynamics, and explores the numerical issues. The last part deals with the validation of the model for the concerned materials (Ta and TA6V) and melted zone.

  16. Technology

    Directory of Open Access Journals (Sweden)

    Xu Jing

    2016-01-01

    Full Text Available The traditional answer card reading method using OMR (Optical Mark Reader, most commonly, OMR special card special use, less versatile, high cost, aiming at the existing problems proposed a method based on pattern recognition of the answer card identification method. Using the method based on Line Segment Detector to detect the tilt of the image, the existence of tilt image rotation correction, and eventually achieve positioning and detection of answers to the answer sheet .Pattern recognition technology for automatic reading, high accuracy, detect faster

  17. 计算机局域网技术发展及维护研究%Analysis of Technology Development and Maintenance of Computer Local Area Network

    Institute of Scientific and Technical Information of China (English)

    王锡智

    2013-01-01

      In recent years, computer local area network technology has made an important development, which the wireless LAN network technology to get rid of the burdensome project of laying the cable to enhance the efficiency of the local area network construction and maintenance work efficiency. With the development of local area network technology, the maintenance work becomes more complex and detail, the focus of this article is the analysis to proceed from the development of local area network technology, to further explore the local area network maintenance.%  近些年来计算机局域网技术取得了重要的发展,其中无线局域网更是让网络技术摆脱了铺设电缆的繁冗工程,提升了局域网建设的效率和维护工作的效率。而随着局域网技术的发展,相应的维护工作也变得更加复杂和细致,本文的重点就是从局域网技术的发展分析着手,进一步探究局域网的维护工作。

  18. Effect of Ta concentration on the refractive index of TiO2:Ta studied by spectroscopic ellipsometry

    Science.gov (United States)

    Nurfani, Eka; Kurniawan, Robi; Muhammady, Shibghatullah; Marlina, Resti; Sutjahja, Inge M.; Winata, Toto; Rusydi, Andrivo; Darma, Yudi

    2016-04-01

    We have investigated optical properties of Ta-doped TiO2 thin film on LaAlO3 (LAO) substrate using Spectroscopic Ellipsometry (SE) at room temperature. Amplitude ratio Ψ and phase difference L1 between p- and s- polarized light waves are obtained by multiple incident angles measurement (60°, 70°, and 80°) at energy range of 0.5 - 6.5 eV. In order to obtain optical properties for every Ta concentrations (0.01, 0.4, and 5 at. %), multilayer modelling was performed simultaneously by using Drude-Lorentz model. Refractive index and optical dispersion parameters were determined by Wemple-DiDomenico relation. In general, refractive index at zero photon energy n(0) increases by increasing Ta concentration. Furthermore, optical band gap shows a significant increasing due to presence of Ta dopant. In addition, other optical constants are discussed as well.

  19. Pre-Test Analysis Predictions for the Shell Buckling Knockdown Factor Checkout Tests - TA01 and TA02

    Science.gov (United States)

    Thornburgh, Robert P.; Hilburger, Mark W.

    2011-01-01

    This report summarizes the pre-test analysis predictions for the SBKF-P2-CYL-TA01 and SBKF-P2-CYL-TA02 shell buckling tests conducted at the Marshall Space Flight Center (MSFC) in support of the Shell Buckling Knockdown Factor (SBKF) Project, NASA Engineering and Safety Center (NESC) Assessment. The test article (TA) is an 8-foot-diameter aluminum-lithium (Al-Li) orthogrid cylindrical shell with similar design features as that of the proposed Ares-I and Ares-V barrel structures. In support of the testing effort, detailed structural analyses were conducted and the results were used to monitor the behavior of the TA during the testing. A summary of predicted results for each of the five load sequences is presented herein.

  20. Competitive policies in the Nordic energy research and innovation area - eNERGIA : Part 2: Technology reports

    Energy Technology Data Exchange (ETDEWEB)

    Klitkou, Antje; Pedersen, Trond Einar; Scordato, Lisa; Mariussen, Aage

    2008-07-01

    This (Part 2: Technology reports) is the second report about the results from the eNERGIA project. The first report deals with the countries covered by the eNERGIA project, while the third report sums up the SWOT-analysis, the eNERGIA workshops and the case studies of good practice. A short synthesis report summarises the entire project. This second report mainly deals with selected renewable energy technologies from different perspectives. The report comprises the following nine chapters. Chapter 1 is the presentation of the selected renewable technologies (solar photovoltaic technology, wind technology, 2nd generation bio-energy technology, wave technology and hydroelectric technology) and a subsequent elaboration of the status of the technologies in the Nordic and Baltic countries. Chapter 2 gives an overview of patterns of international R&D collaboration as seen from the countries in question. Chapter 3 draws on technology specific patenting data and bibliometric data, describing the level of technology specific activity in each country. Chapter 4 and 5 describe the status of renewable energy production and renewable energy research respectively in each country. The four last chapters are relatively brief descriptions of the situation in the Nordic and Baltic countries. Chapter 6 gives an overview of the venture capital situation. Chapter 7 is about market regulations and Chapter 8 is about social concerns. Finally, Chapter 9 addresses infrastructural challenges. (Author) 77 figs., 70 tabs

  1. Applying heat integration total site based pinch technology to a large industrial area in Japan to further improve performance of highly efficient process plants

    Energy Technology Data Exchange (ETDEWEB)

    Matsuda, Kazuo; Hirochi, Yoshiichi [Chiyoda Corporation, Energy Frontier Business Development Office, 2-12-1 Tsurumichuo, Tsurumi-ku, Yokohama 230-8601 (Japan); Tatsumi, Hiroyuki [Simulation Technology Limited, Yokohama-Kanazawa High-Tech Center, Techno-Core 5F, 1-1-1 Fukuura, Kanazawa-ku, Yokohama 236-0004 (Japan); Shire, Tim [KBC Energy Services (Formerly Linnhoff March), Targeting House, Gadbrook Park, Northwich, Cheshire CW9 7UZ (United Kingdom)

    2009-10-15

    ''Area-wide pinch technology'' which consists of R-curve analysis and Site Source Sink Profile (SSSP) analysis, was applied to Kashima industrial area, one of the biggest heavy chemical complexes in Japan. This case study demonstrates that despite the very high efficiency of the individual sites in the complex, there is a huge amount of energy saving potential through energy sharing among the various sites. In addition it was found that appropriate use of the available pinch technology tools and techniques allows an industrial area of enormous scale and complexity to be analysed conveniently. This has resulted in practical area-wide energy saving projects being proposed and implemented. (author)

  2. Petrochemical Characteristics and Age of Rare Metal (Ta-Nb Mineralization in Precambrian Pegmatites, Komu, Nigeria

    Directory of Open Access Journals (Sweden)

    A. OLUGBENGA

    2010-06-01

    Full Text Available The Precambrian pegmatites of Komu area intrude semi discordantly older rock types, such as biotite gneiss, amphibolites and pelitic schists. The pegmatites occur as near flat lying bodies. This study aims at elucidating the geological setting, petrography, geochemical features and age of mineralization of these pegmatite bodies, with a view to classifying them and knowing their economic potential. The petrographic analysis shows that the pegmatite samples contain mainly quartz (35%, plagioclase (15%, microcline (10% and muscovite (12% with accessories like tourmaline, tantalum, niobium and illmeno-rutiles. Geochemical analysis of the muscovites extracted from pegmatites show that these rocks are enriched in silica (>60% and Al2O3 (>12% and depleted in Fe2O3, MgO and TiO2. Trace element analysis shows that the pegmatites contain rare metals with moderately high Ta, Nb, Sn, Rb, Li and Cs values and depleted in Ti, Ba and Zr. Elemental ratios indicate low ratios of K/Cs, Th/U and K/Rb. Variation plots of Ta/(Ta+Nb versus Mn/ (Mn+Fe show that the pegmatites plot in the complex (beryl subtype field. The Na/K versus Sn, Nb, Rb variation plots show that the pegmatites of Komu area are mineralized and compare favourably with those of other mineralized pegma-tite areas like Egbe and Ijero in southwestern Nigeria. The variation plots of Ta versus K/Cs, and Ta/W versus Cs, also confirm rare metal mineralization of Komu pegmatites, which plot over the mineralized line of Beus and Gordiyenko. The K/Rb versus Rb, Cs and Sn plots indicate low K/Rb ratios indicating moderate differentiation. The Rare Earth Elements (REE show high heavy REE values and lower light REE values with prominent positive Ce anomaly and negative Eu anomaly from normalized chondrite plots. K/Ar dating of the age of mineralization of muscovites extracted from the pegmatite yielded late Pan-African ages between 502.8±13Ma and 514.5±13.2Ma. This period represents the cooling ages of the

  3. NASA's Marshall Space Flight Center Recent Studies and Technology Developments in the Area of SSA/Orbital Debris

    Science.gov (United States)

    Wiegmann, Bruce M.; Hovater, Mary; Kos, Larry

    2012-01-01

    NASA/MSFC has been investigating the various aspects of the growing orbital debris problem since early 2009. Data shows that debris ranging in size from 5 mm to 10 cm presents the greatest threat to operational spacecraft today. Therefore, MSFC has focused its efforts on small orbital debris. Using off-the-shelf analysis packages, like the ESA MASTER software, analysts at MSFC have begun to characterize the small debris environment in LEO to support several spacecraft concept studies and hardware test programs addressing the characterization, mitigation, and ultimate removal, if necessary, of small debris. The Small Orbital Debris Active Removal (SODAR) architectural study investigated the overall effectiveness of removing small orbital debris from LEO using a low power, space-based laser. The Small Orbital Debris Detection, Acquisition, and Tracking (SODDAT) conceptual technology demonstration spacecraft was developed to address the challenges of in-situ small orbital debris environment classification including debris observability and instrument requirements for small debris observation. Work is underway at MSFC in the areas of hardware and testing. By combining off the shelf digital video technology, telescope lenses, and advanced video image FPGA processing, MSFC is building a breadboard of a space based, passive orbital tracking camera that can detect and track faint objects (including small debris, satellites, rocket bodies, and NEOs) at ranges of tens to hundreds of kilometers and speeds in excess of 15 km/sec,. MSFC is also sponsoring the development of a one-of-a-kind Dynamic Star Field Simulator with a high resolution large monochrome display and a custom collimator capable of projecting realistic star images with simple orbital debris spots (down to star magnitude 11-12) into a passive orbital detection and tracking system with simulated real-time angular motions of the vehicle mounted sensor. The dynamic star field simulator can be expanded for multiple

  4. NASAs Marshall Space Flight Center Recent Studies and Technology Developments in the Area of SSA/Orbital Debris

    Science.gov (United States)

    Wiegman, B.; Hovater, M.; Kos, L.

    2012-09-01

    NASA/MSFC has been investigating the various aspects of the growing orbital debris problem since early 2009. Data shows that debris ranging in size from 5 mm to 10 cm presents the greatest threat to operational spacecraft today. Therefore, MSFC has focused its efforts on small orbital debris. Using off-the-shelf analysis packages, like the ESA MASTER software, analysts at MSFC have begun to characterize the small debris environment in LEO to support several spacecraft concept studies and hardware test programs addressing the characterization, mitigation, and ultimate removal, if necessary, of small debris. The Small Orbital Debris Active Removal (SODAR) architectural study investigated the overall effectiveness of removing small orbital debris from LEO using a low power, space-based laser. The Small Orbital Debris Detection, Acquisition, and Tracking (SODDAT) conceptual technology demonstration spacecraft was developed to address the challenges of in-situ small orbital debris environment classification including debris observability and instrument requirements for small debris observation. Work is underway at MSFC in the areas of hardware and testing. By combining off the shelf digital video technology, telescope lenses, and advanced video image FPGA processing, MSFC is building a breadboard of a space based, passive orbital tracking camera that can detect and track faint objects (including small debris, satellites, rocket bodies, and NEOs) at ranges of tens to hundreds of kilometers and speeds in excess of 15 km/sec,. MSFC is also sponsoring the development of a one-of-a-kind Dynamic Star Field Simulator with a high resolution large monochrome display and a custom collimator capable of projecting realistic star images with simple orbital debris spots (down to star magnitude 11-12) into a passive orbital detection and tracking system with simulated real-time angular motions of the vehicle mounted sensor. The dynamic star field simulator can be expanded for multiple

  5. Areas where geologic conditions are more favorable for current underground mining technology in the Kaiparowits Plateau study area, southern Utah (kaisumg )

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This is a coverage that shows areas in the Kaiparowits Plateau where geologic conditions in the Calico and A-sequences are more favorable for current underground...

  6. Gate-tunable Phase Transitions in 1T-TaS$_2$

    OpenAIRE

    Yu, Yijun; Yang, Fangyuan; Lu, Xiu Fang; Yan, Ya Jun; Cho, Y.H.; Ma, Liguo; Niu, Xiaohai; Kim, Sejoong; Son, Young-Woo; Feng, Donglai; Li, Shiyan; Cheong, Sang-Wook; Chen, Xian Hui; Zhang, Yuanbo

    2014-01-01

    The ability to tune material properties using gate electric field is at the heart of modern electronic technology. It is also a driving force behind recent advances in two-dimensional systems, such as gate-electric-field induced superconductivity and metal-insulator transition. Here we describe an ionic field-effect transistor (termed "iFET"), which uses gate-controlled lithium ion intercalation to modulate the material property of layered atomic crystal 1T-TaS$_2$. The extreme charge doping ...

  7. Combined experimental and theoretical assessments of the lattice dynamics and optoelectronics of TaON and Ta3N5

    KAUST Repository

    Nurlaela, Ela

    2015-06-15

    Presented herein is a detailed discussion of the properties of the lattice dynamic and optoelectronic properties of tantalum(V) oxynitride (TaON) and tantalum(V) nitride (Ta3N5), from experimental and theoretical standpoint. The active Raman and infra red (IR) frequencies of TaON and Ta3N5 were measured using confocal Raman and Fourier Transform Infrared spectroscopies (FTIR) and calculated using the linear response method within the density functional perturbation theory (DFPT). The detailed study leads to an exhaustive description of the spectra, including the symmetry of the vibrational modes. Electronic structures of these materials were computed using DFT within the range-separated hybrid HSE06 exchange–correlation formalism. Electronic and ionic contributions to the dielectric constant tensors of these materials were obtained from DFPT within the linear response method using the PBE functional. Furthermore, effective mass of photogenerated holes and electrons at the band edges of these compounds were computed from the electronic band structure obtained at the DFT/HSE06 level of theory. The results suggest that anisotropic nature in TaON and Ta3N5 is present in terms of dielectric constant and effective masses.

  8. Combined experimental and theoretical assessments of the lattice dynamics and optoelectronics of TaON and Ta3N5

    Science.gov (United States)

    Nurlaela, Ela; Harb, Moussab; del Gobbo, Silvano; Vashishta, Manish; Takanabe, Kazuhiro

    2015-09-01

    Presented herein is a detailed discussion of the properties of the lattice dynamic and optoelectronic properties of tantalum(V) oxynitride (TaON) and tantalum(V) nitride (Ta3N5), from experimental and theoretical standpoint. The active Raman and infra red (IR) frequencies of TaON and Ta3N5 were measured using confocal Raman and Fourier Transform Infrared spectroscopies (FTIR) and calculated using the linear response method within the density functional perturbation theory (DFPT). The detailed study leads to an exhaustive description of the spectra, including the symmetry of the vibrational modes. Electronic structures of these materials were computed using DFT within the range-separated hybrid HSE06 exchange-correlation formalism. Electronic and ionic contributions to the dielectric constant tensors of these materials were obtained from DFPT within the linear response method using the PBE functional. Furthermore, effective mass of photogenerated holes and electrons at the band edges of these compounds were computed from the electronic band structure obtained at the DFT/HSE06 level of theory. The results suggest that anisotropic nature in TaON and Ta3N5 is present in terms of dielectric constant and effective masses.

  9. Prediction of new high pressure phase of TaB{sub 3}: First-principles

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xiaozheng [College of Science, Inner Mongolia University of Technology, Hohhot 010051 (China); State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Zhao, Erjun, E-mail: ejzhao@yahoo.com [College of Science, Inner Mongolia University of Technology, Hohhot 010051 (China); Wu, Zhijian, E-mail: zjwu@ciac.ac.cn [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2015-05-25

    Highlights: • Crystal structure of TaB{sub 3} is predicted using the evolutionary algorithm USPEX code. • The structural and mechanical properties of tantalum borides are investigated by DFT. • The stable phases are found by enthalpy-pressure relationship and convex hull. • oC16–TaB{sub 3} has a estimated hardness (41.2 GPa) and indentation strength (22.8 GPa). • High pressure is advantageous to syntheses of ruthenium Triborides oC16–TaB{sub 3}. - Abstract: The phase stability, elastic, mechanical, dynamical and electronic properties of tantalum borides, i.e., Ta{sub 2}B, TaB, Ta{sub 3}B{sub 4}, Ta{sub 5}B{sub 6}, TaB{sub 2} and TaB{sub 3}, have been investigated by first-principles. The calculated convex hull indicates that at ambient conditions, the ground state phases are tI12–Ta{sub 2}B, oC8–TaB, oC22–Ta{sub 5}B{sub 6}, oI14–Ta{sub 3}B{sub 4}, and hP3–TaB{sub 2}; while at 75 GPa, they are tI12–Ta{sub 2}B, oC8–TaB, oC22–Ta{sub 5}B{sub 6}, oI14–Ta{sub 3}B{sub 4}, hP3–TaB{sub 2} and oC16–TaB{sub 3}; oC8–TaB, oC22–Ta{sub 5}B{sub 6}, oI14–Ta{sub 3}B{sub 4}, oC16–TaB{sub 3} are the most stable phases at 120 GPa. The enthalpy-pressure relationship reveals that the hP3–TaB{sub 2} is the most stable below 75 GPa, while the predicted oC16–TaB{sub 3} becomes the most stable above 75 GPa. Combining the estimated hardness (41.2 GPa) and indentation strength (22.8 GPa) for oC16–TaB{sub 3}, it is suggested that oC16–TaB{sub 3} is hard or potential superhard. Since it is not available experimentally, further experimental synthesis could be rewarding.

  10. Study on Cultural Technologies and Salt-resistance of Nitraria sibirica in Coastal Areas with Serious Salt-affected Soil

    Institute of Scientific and Technical Information of China (English)

    ZHANGJianfeng; XINGShangjun; SUNQixiang; XIJinbiao; SONGYumin

    2004-01-01

    In this research, five Nitraria sibirica provenances such as Dayilu were selected to do experiment of salt-resistance, combining fixed plots test with typical plot investigation, measuring survival rate and growth as main indicators. The experiments of main cultural technology were done on Nitraria sibirica in 4 types of site preparation, 3 types of planting, 3 designs for planting density. The Nitraria sibirica experiments for the effects of curbing salt and improving soil were done by testing soil nutrients, salt content, soil physical properties as focal points in typical site of 3-4 years woods. The experiment results showed that the Nitraria sibirica could survive well with soil salt content of 0.6%, and that survival rate declined distinctively as soil salt content exceeded 0.8%. However, high soil salt content did not influence growth in the year of planting. There were obvious differences in salt-tolerance among Nitraria sibirica provenances; Dayilu was the best on salt-tolerance, the other 4 provenances had no differences, and obviously inferior to Dayilu. The different types of site preparation clearly influenced planting survival rate, conserving rate and growth. The method of two-ploughing-two-harrowing was the best among all 4 types of site preparation. Seed forestation was largely limited, bared-rooted seedling forestation may be popularised when soil salt content was less than 1% and soil moisture content was better in spring. Forestation with container seedling was suited to coastal saline soil in rainy season. The optimum planting density of Nitraria sibirica was 2 505/ha in the Yellow River Delta area in view of coverage rate, yield of fruits and cost of planting. Generally speaking,Nitraria sibirica could effectively refrain soil from accumulation of salt in the surface soil, decrease salt content and increase soil nutrient, and heighten soil capillary pore rate.

  11. The potential for LiDAR technology to map fire fuel hazard over large areas of Australian forest.

    Science.gov (United States)

    Price, Owen F; Gordon, Christopher E

    2016-10-01

    Fuel load is a primary determinant of fire spread in Australian forests. In east Australian forests, litter and canopy fuel loads and hence fire hazard are thought to be highest at and beyond steady-state fuel loads 15-20 years post-fire. Current methods used to predict fuel loads often rely on course-scale vegetation maps and simple time-since-fire relationships which mask fine-scale processes influencing fuel loads. Here we use Light Detecting and Remote Sensing technology (LiDAR) and field surveys to quantify post-fire mid-story and crown canopy fuel accumulation and fire hazard in Dry Sclerophyll Forests of the Sydney Basin (Australia) at fine spatial-scales (20 × 20 m cell resolution). Fuel cover was quantified in three strata important for crown fire propagation (0.5-4 m, 4-15 m, >15 m) over a 144 km(2) area subject to varying fire fuel ages. Our results show that 1) LiDAR provided a precise measurement of fuel cover in each strata and a less precise but still useful predictor of surface fuels, 2) cover varied greatly within a mapped vegetation class of the same fuel age, particularly for elevated fuel, 3) time-since-fire was a poor predictor of fuel cover and crown fire hazard because fuel loads important for crown fire propagation were variable over a range of fire fuel ages between 2 and 38 years post-fire, and 4) fuel loads and fire hazard can be high in the years immediately following fire. Our results show the benefits of spatially and temporally specific in situ fuel sampling methods such as LiDAR, and are widely applicable for fire management actions which aim to decrease human and environmental losses due to wildfire.

  12. Lockheed Martin Idaho Technologies Company information management technology architecture

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, M.J.; Lau, P.K.S.

    1996-05-01

    The Information Management Technology Architecture (TA) is being driven by the business objectives of reducing costs and improving effectiveness. The strategy is to reduce the cost of computing through standardization. The Lockheed Martin Idaho Technologies Company (LMITCO) TA is a set of standards and products for use at the Idaho National Engineering Laboratory (INEL). The TA will provide direction for information management resource acquisitions, development of information systems, formulation of plans, and resolution of issues involving LMITCO computing resources. Exceptions to the preferred products may be granted by the Information Management Executive Council (IMEC). Certain implementation and deployment strategies are inherent in the design and structure of LMITCO TA. These include: migration from centralized toward distributed computing; deployment of the networks, servers, and other information technology infrastructure components necessary for a more integrated information technology support environment; increased emphasis on standards to make it easier to link systems and to share information; and improved use of the company`s investment in desktop computing resources. The intent is for the LMITCO TA to be a living document constantly being reviewed to take advantage of industry directions to reduce costs while balancing technological diversity with business flexibility.

  13. Inkjet printing as a roll-to-roll compatible technology for the production of large area electronic devices on a pre-industrial scale

    NARCIS (Netherlands)

    Teunissen, P.; Rubingh, E.; Lammeren, T. van; Abbel, R.J.; Groen, P.

    2014-01-01

    Inkjet printing is a promising approach towards the solution processing of electronic devices on an industrial scale. Of particular interest is the production of high-end applications such as large area OLEDs on flexible substrates. Roll-to-roll (R2R) processing technologies involving inkjet printin

  14. Inkjet printing as a roll-to-roll compatible technology for the production of large area electronic devices on a pre-industrial scale

    NARCIS (Netherlands)

    Teunissen, P.; Rubingh, E.; Lammeren, T. van; Abbel, R.J.; Groen, P.

    2014-01-01

    Inkjet printing is a promising approach towards the solution processing of electronic devices on an industrial scale. Of particular interest is the production of high-end applications such as large area OLEDs on flexible substrates. Roll-to-roll (R2R) processing technologies involving inkjet

  15. Environmental measurement-while-drilling-gamma ray spectrometer (EMWD-GRS) system technology demonstration plan for use at the Savannah River Site F-Area Retention Basin

    Energy Technology Data Exchange (ETDEWEB)

    Williams, C.V.; Lockwood, G.J.; Normann, R.A. [Sandia National Labs., Albuquerque, NM (United States); Gruebel, R.D. [Tech Reps, Inc., Albuquerque, NM (United States)

    1996-08-01

    The Environmental Measurement-While-Drilling-Gamma Ray Spectrometer (EMWD-GRS) system represents an innovative blend of new and existing technology that provides the capability of producing real-time environmental and drillbit data during drilling operations. This demonstration plan presents information on the EMWD-GRS technology, demonstration design, Cs-137 contamination at the Savannah River Site F-Area Retention Basin, responsibilities of demonstration participants, and the policies and procedures for the demonstration to be conducted at the Savannah River Site F-Area Retention Basin. The EMWD-GRS technology demonstration will consist of continuously monitoring for gamma-radiation contamination while drilling two horizontal boreholes below the backfilled retention basin. These boreholes will pass near previously sampled vertical borehole locations where concentrations of contaminant levels are known. Contaminant levels continuously recorded by the EMWD-GRS system during drilling will be compared to contaminant levels previously determined through quantitative laboratory analysis of soil samples.

  16. A simple particulate sol-gel route to synthesize nanostructural TiO{sub 2}-Ta{sub 2}O{sub 5} binary oxides and their characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Mohammadi, M.R. [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Department of Materials Science and Engineering, Sharif University of Technology, Azadi Street, Tehran (Iran, Islamic Republic of)], E-mail: mrm41@cam.ac.uk; Fray, D.J. [Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom)], E-mail: djf25@cam.ac.uk; Sadrnezhaad, S.K. [Materials and Energy Research Center, P.O. Box 14155-4777, Karaj (Iran, Islamic Republic of)], E-mail: sadrnezhad@sharif.ir; Mohammadi, A. [Department of Materials Engineering, I.K. International University, Qazvin (Iran, Islamic Republic of)

    2007-08-25

    Nanostructured and mesoporous TiO{sub 2}-Ta{sub 2}O{sub 5} films and powders with various TiO{sub 2}:Ta{sub 2}O{sub 5} molar ratios and high specific surface area (SSA) have been prepared by a straightforward particulate sol-gel route. Titanium isopropoxide and tantalum ethoxide were used as precursors and hydroxypropyl cellulose (HPC) was used as a polymeric fugitive agent (PFA) in order to increase the SSA. X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FTIR) revealed that powders contained both hexagonal {delta}-Ta{sub 2}O{sub 5} and monoclinic {beta}-Ta{sub 2}O{sub 5} phases, as well as anatase and rutile. It was observed that Ta{sub 2}O{sub 5} retarded anatase-to-rutile transformation. Furthermore, {delta} {yields} {beta} phase transformation temperature increased with decreasing TiO{sub 2}:Ta{sub 2}O{sub 5} molar ratio. Transmission electron microscope (TEM) analysis also showed that Ta{sub 2}O{sub 5} hindered the crystallisation and crystal growth of the powders. SSA of powders, as measured by Brunauer-Emmett-Teller (BET) analysis, was enhanced by introducing Ta{sub 2}O{sub 5}. TiTa11 binary oxide (TiO{sub 2}:Ta{sub 2}O{sub 5} = 50:50 molar ratio) annealed at 500 {sup o}C produced the smallest crystallite size (3.4 nm), the smallest grain size (15 nm), the highest SSA (172 m{sup 2}/g) and the highest roughness. Atomic force microscope (AFM) analysis revealed that columnar-like morphology with nanosized grains was obtained for TiO{sub 2}-Ta{sub 2}O{sub 5} films. One of the smallest crystallite size and one of the highest SSA reported in the literature is obtained, and they can be used in many applications in areas from optical electronics to gas sensors.

  17. Enhanced post-annealing stability of perpendicular Ta/CoFeB/Mg/MgO multilayers by inhibiting Ta diffusion

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xu-Jing; Jiang, Shao-Long; Zhang, Jing-Yan; Liu, Qian-Qian; Liu, Yi-Wei; Zhao, Jian-Cheng [Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Wu, Zheng-Long [Analytical and Testing Center, Beijing Normal University, Beijing 100875 (China); Feng, Chun, E-mail: fengchun@ustb.edu.cn [Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Li, Ming-Hua [Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Yu, Guang-Hua, E-mail: ghyu@mater.ustb.edu.cn [Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China)

    2016-03-01

    Graphical abstract: To reveal the underlying mechanism of Mg influence on the enhanced post-annealing stability of perpendicular Ta/CoFeB/Mg/MgO multilayers, the X-ray photoelectron spectroscopy analysis have been performed. It is found that a certain amount of Mg interlayer at the CoFeB/MgO interface could prevent the Ta oxidation to some extent due to the oxygen deficit MgO{sub x} (x < 1), and consequently lower the diffusion motivation of Ta from the bottom layer to the CoFeB/MgO interfaces to some extent during the annealing process. The prevention of Ta diffusion realizes the effective hybridization of Fe and O at the CoFeB/MgO interface and maintains interfacial magnetic anisotropy (K{sub CoFeB/MgO}). As a result, the perpendicular magnetic anisotropy at high annealing temperatures was maintained. - Highlights: • High annealing stability of perpendicular Ta/CoFeB/Mg/MgO multilayers was realized. • X-ray photoelectron spectroscopy analysis has been performed to explore the reasons. • The prevention of Ta diffusion was realized by introducing Mg at the CoFeB/MgO interface. - Abstracts: To reveal the underlying mechanism of Mg influence on the enhanced post-annealing stability of perpendicular Ta/CoFeB/Mg/MgO multilayers, the X-ray photoelectron spectroscopy analysis has been performed. It is found that a certain amount of Mg interlayer at the CoFeB/MgO interface could prevent the Ta oxidation, and consequently lower the diffusion motivation of Ta from the bottom layer to the CoFeB/MgO interfaces to some extent in the annealing process. The prevention of Ta diffusion realizes the effective hybridization of Fe and O at the CoFeB/MgO interface and maintains interfacial magnetic anisotropy (KCoFeB/MgO). As a result, the perpendicular magnetic anisotropy at high annealing temperatures is maintained.

  18. Developing Public Policy Options for Access to Drinking Water in Peripheral, Disaster and Polluted Rural Areas: A Case Study on Environment-Friendly and Conventional Technologies

    OpenAIRE

    Ruxandra Mălina Petrescu-Mag; Dacinia Crina Petrescu; Ovidiu Călin Safirescu; Mihaela Hetvary; Ioan Gheorghe Oroian; Dumitru Vâju

    2016-01-01

    Peripheral, disaster and polluted rural areas (PDP rural areas) are generally perceived as a “Cinderella” of water public policy measures, deepening the rural-urban cleavage in terms of opportunities for a decent life. The main goal of the study is to develop public policy options regarding the supply of safe drinking water in Romanian PDP rural areas. The main instrument to achieve it is an ex-ante policy analysis of three solutions: a conventional technology, based on chlorine, a green tech...

  19. 77 FR 47671 - TA-W-81,520, T-Mobile USA, Inc., Call Center, Allentown, PA; TA-W-81,520G, T-Mobile USA, Inc...

    Science.gov (United States)

    2012-08-09

    ... Employment and Training Administration TA-W-81,520, T-Mobile USA, Inc., Call Center, Allentown, PA; TA- W-81..., Inc., Call Center, Allentown, Pennsylvania (TA-W-81,520), Fort Lauderdale, Florida (TA-W-81,520A), Frisco, Texas (TA-W-81,520B), Brownsville, Texas (TA-W- 81,520C), Lenexa, Kansas (TA-W-81,520D),...

  20. Technology for the oil spills clean-up which provides preliminary accumulation of sorbents into the area of emergence and localization oil spills

    Directory of Open Access Journals (Sweden)

    M.L.Soroka

    2012-12-01

    Full Text Available Introduction: The implementation of measures for the prevention and spill of dangerous goods is an important aspect of sustainable development of railway transport. oil spills accident are the most dangerous. They are accompanied by significant pollution of all environmental objects. Studying and development of oil localization and clean-up technologies of such accidents is an important problem of environmental protection to modern conditions of railway transport development. The purpose: to improve the effectiveness of traditional methods of oil spill elimination and the development of new clean-up technologies adapted to the real conditions of the railway transport of Ukraine. Methods: To achieve the research purposes was used analysis of material flows, typical for places emergence and localization of the oil spill on the railways. Results: Analysis of standard technological scheme for the oil spills eliminations has shown that the most difficult task of effective clean-up surfaces is the timely delivery of oil sorbents and special equipment to the area spill containment. The general effectiveness of the elimination activities specifies the time from the beginning contact of dangerous goods with environmental objects to the absorption it into the structure of sorbent . Us was developed the technological scheme of oil spill elimination. This scheme provide a permanent and fast access to the sorbents into the oil spill localization area. It was proposed to device that allows you to transport the sorbent into sorption booms directly on the tank for transportation of petroleum products. Conclusions: Preventative accumulation of sorbents to the oil spill elimination into the localization area provides the organizational and operational simplicity of all stages of clean-up technology. Technical and economic assessment shows that the proposed technology is effective, technologically feasible and economically competitive.

  1. Barriers to the use of Information and Communication Technology by occupational therapists working in a rural area of New South Wales, Australia.

    Science.gov (United States)

    Chedid, Rebecca Jean; Dew, Angela; Veitch, Craig

    2013-06-01

    This qualitative study formed part of a large-scale, multi-phase study into the delivery of therapy services to people with a disability, living in one rural area of New South Wales, Australia. The study's purpose was to identify the impact of Information and Communication Technology on the workforce practices of occupational therapists' working in a rural area of New South Wales. Individual semi-structured telephone interviews were conducted with 13 occupational therapists working in disability, health and private practice in a rural area of New South Wales. Participants were asked about access to, skills and limitations of using Information and Communication Technology. A modified grounded theory approach, based on thematic analysis and constant comparison, was used to analyse the interview transcripts. This study found widespread use of technology by rurally based occupational therapists working in the disability sector in New South Wales. However, Information and Communication Technology was primarily used for client contact, professional development and professional networking rather than therapy provision. The study identified individual, workplace and community barriers to greater uptake of Information and Communication Technology by this group. The individual barriers included: age cohort, knowledge and personal preferences. The workplace barriers included: support and training and availability of resources. The community barriers included: infrastructure and perceptions of clients' acceptance. The potential exists for Information and Communication Technology to supplement face-to-face therapy provision, enhance access to professional development and reduce professional isolation thereby addressing the rural challenges of large distances, travel times and geographic isolation. To overcome these challenges, individual, workplace and community Information and Communication Technology barriers should be addressed concurrently. © 2012 The Authors Australian

  2. 75 FR 43564 - TA-W-71,483, Continental Airlines, Inc., Reservations Division, Houston, TX; TA-W-71,483A...

    Science.gov (United States)

    2010-07-26

    ... Employment and Training Administration TA-W-71,483, Continental Airlines, Inc., Reservations Division, Houston, TX; TA-W-71,483A, Continental Airlines, Inc., Reservations Division, Tampa, FL; TA-W-71,483B, Continental Airlines, Inc., Reservations Division, Salt Lake City, UT; Notice of Negative Determination...

  3. A new RHQT Nb3Al superconducting wire with a Ta/Cu/Ta three-layer filament-barrier structure

    Science.gov (United States)

    Takeuchi, Takao; Tsuchiya, Kiyosumi; Nakagawa, Kazuhiko; Nimori, Shigeki; Banno, Nobuya; Iijima, Yasuo; Kikuchi, Akihiro; Nakamoto, Tatsushi

    2012-06-01

    To suppress the low-magnetic-field instability (flux jumps in low magnetic fields) of a rapid-heating, quenching and transformation (RHQT) processed Nb3Al superconductor, we had previously modified the cross-sectional design of an RHQT Nb3Al by adopting a Ta filament-barrier structure. Unlike Nb barriers, Ta barriers are not superconducting in magnetic fields at 4.2 K so that they electromagnetically decouple filaments. However, small flux jumps still occurred at 1.8 K, which is a typical operating temperature for the magnets used in high-energy particle accelerators. Furthermore, poor bonding at the Ta/Ta interface between neighboring Ta-coated jelly-roll (JR) filaments frequently caused precursor wires to break during drawing. To overcome these problems, we fabricated a new RHQT Nb3Al wire with a Ta/Cu/Ta three-layer filament-barrier structure for which an internal stabilization technique (Cu rods encased in Ta are dispersed in the wire cross section) was extended. Removing the Ta/Ta interface in the interfilamentary barrier (JR filament/Ta/Cu/Ta/JR filament) allowed precursor wires to be drawn without breaking. Furthermore, the Cu filament barrier electromagnetically decoupled filaments to suppress flux jumps at 1.8 K. The ductile Cu layer also improved the bending strain tolerance of RHQT Nb3Al.

  4. Pd/Ta2O5/SiC Schottky-diode hydrogen sensors formed by using rapid thermal oxidation of Ta thin films

    Science.gov (United States)

    Joo, Sung-Jae; Choi, Je Hoon; Kim, Seong Jeen; Kim, Sang-Cheol

    2013-11-01

    Pd/Ta2O5/SiC Schottky-diode hydrogen sensors were fabricated, and their hydrogen gas sensing performance was investigated at 573 K and 773 K. Interfacial Ta2O5 films of 120 nm in thickness were formed by using rapid thermal oxidation (RTO) of the sputtered Ta films on SiC. The crystallinity of the Ta and the Ta2O5 films were characterized by using X-ray diffraction (XRD). As-sputtered Ta films on 4H-SiC are composed of α-Ta (body-centered-cubic) and β-Ta (tetragonal), and α-Ta (110) is the dominant orientation. After RTO at 573 K, the Ta films are converted to β-Ta2O5 (orthorhombic). The diode sensors show high sensitivity to H2 even at the low H2 concentration of 500 ppm, and the voltage change of the sensor upon H2 exposure is proportional to the H2 concentration in the range of 500 ˜ 2000 ppm at 573 K. The response voltage ΔV is shown to arise mostly from the change in the series resistance component of the sensor upon H2 exposure; the main origin of that change is believed to be the Ta2O5 interfacial layer. The response time t90 of the sensor at 573 K was estimated to be approximately 8 s.

  5. Initiation of student-TA interactions in tutorials

    Directory of Open Access Journals (Sweden)

    Raymond A. Hodges

    2006-12-01

    Full Text Available At the University of Maryland we videotaped several semesters of tutorials as part of a large research project. A particular research task required us to locate examples of students calling the teaching assistants (TAs over for assistance with a physics question. To our surprise, examples of this kind of interaction were difficult to find. We undertook a systematic study of TA-student interactions in tutorial: In particular, how are the interactions initiated? Do the students call the TA over for help with a particular issue, does the TA stop by spontaneously, or does the worksheet require a discussion with the TA at that point? The initiation of the interaction is of particular interest because it provides evidence of the motivation for and purpose of the interaction. This paper presents the results of that systematic investigation. We discovered that the majority of student-TA interactions in tutorial are initiated by teaching assistants, confirmed our initial observation that relatively few interactions are initiated by students, and found, further, that even fewer interactions are worksheet initiated. Perhaps most importantly, we found that our sense of who initiates tutorial interactions—based on extensive but informal observations—is not necessarily accurate. We need systematic investigations to uncover the reality of our classroom experiences.

  6. Fibroblast functionality on novel Ti-30Ta nanotube array

    Energy Technology Data Exchange (ETDEWEB)

    Capellato, Patricia, E-mail: pat_capellato@yahoo.com.br [Department of Materials, Faculty of Engineering Guaratingueta, Sao Paulo State University-UNESP, Av. Ariberto Pereira da Cunha, 333, Pedregulho, CEP 12516-410, Guaratingueta, SP (Brazil); Smith, Barbara S. [School of Biomedical Engineering, Colorado State University, Fort Collins CO 80523 (United States); Popat, Ketul C. [School of Biomedical Engineering, Colorado State University, Fort Collins CO 80523 (United States); Department of Mechanical Engineering, Colorado State University, Fort Collins, CO 80523 (United States); Claro, Ana P.R. Alves [Department of Materials, Faculty of Engineering Guaratingueta, Sao Paulo State University-UNESP, Av. Ariberto Pereira da Cunha, 333, Pedregulho, CEP 12516-410, Guaratingueta, SP (Brazil)

    2012-10-01

    In this study, the mechanical substrate and topographical surface properties of anodized Ti-30Ta alloy were investigated using scanning electron microscopy (SEM), energy-dispersive spectroscopy (EDS) and contact angle measurement. The anodization process was performed in an electrolyte solution containing HF (48%) and H{sub 2}SO{sub 4} (98%) in the volumetric ratios 1:9 with the addition of 5% dimethyl sulfoxide (DMSO) at 15 V, 25 V and 35 V for 20 and 40 min, producing a nanotube architecture when anodized at 35 V for 40 min. Human dermal fibroblasts (HDF, neonatal) were utilized to evaluate the biocompatibility of Ti-30Ta nanotubes and Ti-30Ta alloy after 1 and 3 days of culture. Cellular adhesion, proliferation, viability, cytoskeletal organization and morphology were investigated using fluorescence microscope imaging, biochemical assay and SEM imaging respectively. The results presented identify altered material properties and improved cellular interaction on Ti-30Ta nanotubes as compared to Ti-30 Ta alloy. - Highlights: Black-Right-Pointing-Pointer The surface was modified by anodization, biomimetic treatment and ion bean etching. Black-Right-Pointing-Pointer SEM, EDS and contact angle measurements were used to characterize the surface. Black-Right-Pointing-Pointer Group 5 the most hydrophobic. Black-Right-Pointing-Pointer Group 4 the most hydrophilic. Black-Right-Pointing-Pointer Group 3 and 4 are the more indicated for biomedical application.

  7. The potential capacities of Ta'ziyeh in Modern Imagism

    Directory of Open Access Journals (Sweden)

    A.M Nedai

    2009-03-01

    Full Text Available Ta'ziyeh as the most important method in religious and ritual theatre in Iran has many capabilities which can be used in modern visualization. The only element in this theatre which has been studied is distancing in performance styles. But by studying the existent versions of Ta'ziyehs, there are other elements for recognition and use, which has not still been studied. The relationship between religious and ritual theatre with Ta'ziyeh and also their main themes helps to identify these elements and their capabilities. Meanwhile, the presence of music as an expressive and performing element provides a basis which can be used in finding a new manner of expression in visual/dramatic works (such as music videos. Studying on such elements as time-place interlace, character replacement, functions of music, and their effects on audiences, shows that Ta'ziyeh has specific capabilities in visualization (even in Cinema and Media. This article, through capitalizing on this subject and introducing one paradigm (Moses and poor Pilgrim, and comparing two versions of it, tries to represent these capabilities, and illuminates Ta'ziyeh's abilities for modern (and even postmodern visualization.

  8. Environmenal analysis of the Bayo Canyon (TA-10) Site, Los Alamos, New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Ferenbaugh, R.W.; Buhl, T.E.; Stoker, A.K.; Hansen, W.R.

    1982-05-01

    The radiological survey of the old TA-10 site in Bayo Canyon found low levels of surface contamination in the vicinity of the firing sites and subsurface contamination in the old waste disposal area. The three alternatives proposed for the site are: (1) to take no action; (2) to restrict usage of the area of subsurface contamination to activities that cause no subsurface disturbance (minimal action); and (3) to remove the subsurface conamination to levels below the working criteria. Dose calculations indicate that doses from surface contamination for recreational users of the canyon, permanent residents, and construction workers and doses for workers involved in excavation of contaminated soil under the clean up alternative are only small percentages of applicable guidelines. No environmental impacts are associated with either the no-action or minimal action alternatives. The impact associated with the cleanup alternative is small, especially considering that the area already has been affected by the original TA-10 decommissioning action, but nevertheless, the preferred alternative is the minimal action alternative, where 0.6 hectare of land is restricted to surface activities. This leaves the rest of the canyon available for development with up to 400 homes. The restricted area can be used for a park, tennis courts, etc., and the /sup 90/Sr activity will decay to levels permitting unrestricted usage in about 160 y.

  9. Support technologies to cater for rockbursts and falls of ground in the immediate face area, volume 1.

    CSIR Research Space (South Africa)

    Daehnk, A

    2000-03-01

    Full Text Available The aim of this project is to investigate temporary and face area support systems (with special reference to the use of tendon support). Improved face area support design methodologies are proposed, and a probability analysis is conducted...

  10. Cloning of Wheat TaWRKY46-1 Gene and Construction of Plant Inducible Expression Vector by Gateway Cloning Technique%小麦TaWRKY46-1基因克隆及建立在Gateway技术上的可诱导表达载体的构建

    Institute of Scientific and Technical Information of China (English)

    李明; 丁博; 牛有雄; 吕芳芳; 杨文丽; Silin Zhong; 孙守钧; 谢晓东

    2011-01-01

    In this study ,the wheat variety, Yangmai 158 (Triticum aestivem L. ) ,was used as the experimental material for cloning the wheat TaWRKY46 gene. Primers were designed based on a known wheat TaWRKY46 gene sequence in NCBI,subsequently an 870 bp eDNA fragment was amplified from total RNA of Yanmai 158 by RT-PCR.Sequence analysis revealed that the cloned fragment contains the fulL-length cDNA and is highly homologous to the TaWRKY46 sequence in NCBI. The sequence alignment revealed a Q to E change within the conserved ″WRKYGQK″domain,suggesting it was a new allele of TaWRKY46. Hence we designated it as TaWRKY46-1. In order to elucidate the functional role of the new Yangmai 158 TaWRKY46-1 allele, a plant inducible over-expression vector, pKIGWTaWRKY46-1, was constructed via Gateway cloning technology and transformed into Agrobacterium cells successfully.This work provides the key basis for future detailed functional analysis of wheat TaWRKY46-1 gene.%以小麦品种扬麦158为材料,根据NCBI中小麦TaWRKY46基因序列设计引物,采用RT-PCR技术从小麦总RNA中分离了大小为870 bp的cDNA片段.测序表明,该片段与NCBI中已克隆的小麦TaWRKY6基因高度同源,包含完整的读码框,值得注意的是此蛋白保守氨基酸序列WRKYGQK突变为WRKYGEK,为TaWRKY46的新等位基因,命名为TaWRKY46-1.采用Gateway克隆技术构建了该基因的可诱导型超量表达载体,并转化农杆菌,为接下来转基因验证TaWRKY46-1的功能奠定了基础.

  11. Cloning and Functional Analysis of MADS-box Genes, TaAG-A and TaAG-B, from a Wheat K-type Cytoplasmic Male Sterile Line

    Directory of Open Access Journals (Sweden)

    Wenlong Yang

    2017-06-01

    Full Text Available Wheat (Triticum aestivum L. is a major crop worldwide. The utilization of heterosis is a promising approach to improve the yield and quality of wheat. Although there have been many studies on wheat cytoplasmic male sterility, its mechanism remains unclear. In this study, we identified two MADS-box genes from a wheat K-type cytoplasmic male sterile (CMS line using homology-based cloning. These genes were localized on wheat chromosomes 3A and 3B and named TaAG-A and TaAG-B, respectively. Analysis of TaAG-A and TaAG-B expression patterns in leaves, spikes, roots, and stems of Chinese Spring wheat determined using quantitative RT-PCR revealed different expression levels in different tissues. TaAG-A had relatively high expression levels in leaves and spikes, but low levels in roots, while TaAG-B had relatively high expression levels in spikes and lower expression in roots, stems, and leaves. Both genes showed downregulation during the mononucleate to trinucleate stages of pollen development in the maintainer line. In contrast, upregulation of TaAG-B was observed in the CMS line. The transcript levels of the two genes were clearly higher in the CMS line compared to the maintainer line at the trinucleate stage. Overexpression of TaAG-A and TaAG-B in Arabidopsis resulted in phenotypes with earlier reproductive development, premature mortality, and abnormal buds, stamens, and stigmas. Overexpression of TaAG-A and TaAG-B gives rise to mutants with many deformities. Silencing TaAG-A and TaAG-B in a fertile wheat line using the virus-induced gene silencing (VIGS method resulted in plants with green and yellow striped leaves, emaciated spikes, and decreased selfing seed set rates. These results demonstrate that TaAG-A and TaAG-B may play a role in male sterility in the wheat CMS line.

  12. Preparation and Characterization of TaN ALD Precursors

    Institute of Scientific and Technical Information of China (English)

    Delong Zhang; Tracy Yund; Cynthia A.Hoover

    2004-01-01

    High purity organic-tantalum precursors for thin film ALD TaN were synthesized and characterized.Vapor pressure and thermal stability of these precursors were studied.From the vapor pressure analysis,it was found that TBTEMT has a higher vapor pressure than any other published liquid TaN precursor,including TBTDET,TAITMATA,and IPTDET.Thermal stability of the alkyl groups on the precursors was investigated using a 1H NMR technique.The results indicated that the tertbutylimino group is the most stable group on TBTDET and TBTEMT as compared to the dialkylamido groups.Thermal stability of TaN precursors decreased in the following order:TBTDET > PDMAT > TBTEMT.In conclusion,precursor vapor pressure and thermal stability were tuned by making slight variations in the ligand sphere around the metal center.

  13. Synthesis and characterization of nanocrystalline NaTaO3

    Institute of Scientific and Technical Information of China (English)

    CHEN Jingfang; HU Long; ZHAO Jianling; TANG Chengchun; LI Yangxian

    2006-01-01

    Tantalum pentoxide reacts actively with concentrated NaOH solution under hydrothermal conditions at 180 ℃.In the reaction between NaOH solution and Ta2O5, the structure and composition of the tantalates depend on the reaction time, and the structure evolution results in a remarkable change in light absorption.Powder X-ray diffraction (XRD), scanning electron microscopy (SEM), and ultraviolet-visible (UV-Vis) diffused reflection spectrum were used to characterize various properties of the obtained solid products.At 180 ℃, the reaction proceeds rapidly.With the increase of time, the reflection peaks of unreacted Ta2O5 in the XRD patterns becomes weaker and weaker.Pure NaTaO3 is obtained after 60 min, which is well crystallized with a uniform cubic morphology.

  14. Microstructural evolution and creep of Fe-Al-Ta alloys

    Energy Technology Data Exchange (ETDEWEB)

    Prokopcakova, Petra; Svec, Martin [Technical University of Liberec (Czech Republic). Dept. of Material Science; Palm, Martin [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany). Structure and Nano-/Micromechanics of Materials

    2016-05-15

    The microstructural evolution in Fe-Al-Ta alloys containing 23 - 31 at.% Al and 1.5 - 2.2 at.% Ta has been studied in the temperature range 650 - 750 C by annealing for 1, 10, 100 and 1 000 h. The experiments confirm that in this temperature range the precipitation of the stable hexagonal C14 Laves phase is preceded by formation of coherent, metastable L2{sub 1} Heusler phase precipitates within the Fe-Al matrix. However, precipitates of C14 are observed after much shorter annealing times than previously assumed. Creep strength increases substantially with increasing Al content of the alloys because the solid solubility for Ta in the Fe-Al matrix increases with increasing Al content and solid-solution hardening contributes substantially to the observed high creep strength. It may therefore be that the microstructural changes during creep have no noticeable effect on creep strength.

  15. Nb/Ta variations of mafic volcanics on the Archean-Proterozoic boundary: Implications for the Nb/Ta imbalance

    Institute of Scientific and Technical Information of China (English)

    LIU Yongsheng; GAO Shan; WANG Xuance; HU Shenghong; WANG Jianqi

    2005-01-01

    The HFSE and REE of the Precambrian mafic volcanics from the North China craton demonstrate obvious A(Archean)-P(Proterozoic) boundary. The Neoarchean mafic vol-canics show weak correlation between HFSE and TiO2. Their superchondritic Nb/Ta ratio (18.8(1.2) could be attributed to partial melting of mantle peridotite in the presence of garnet. Compared with Neoarchean mafic volcanics, the Paleoproterozoic ones have higher HFSE contents and lower Nb/Ta ratio (15.6(2.9). The significantly elevated HFSE and REE contents of Paleoproterozoic mafic volcanics imply metasomatic enrichment of mantle source, in which Ti-rich silicates could be present as suggested by significant positive correlations between TiO2 and HFSE. The global database of Precambrian mafic volcanics shows a similar A-P boundary. 23 Archean mafic volcanic suites yield an average Nb/Ta ratio of 17.8(1.9 higher than or close to the PM value; Proterozoic mafic volcanics from 28 suites yield an average Nb/Ta ratio of 14.7(4.1 deficit could be mainly formed in post-Archean time. Archean mafic volcanics could be one of the geochemical reservoirs complementing the low Nb/Ta of the post-Archean continental crust and DM.

  16. TA-60 Warehouse and Salvage SWPPP Rev 2 Jan 2017-Final

    Energy Technology Data Exchange (ETDEWEB)

    Burgin, Jillian Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-07

    The Stormwater Pollution Prevention Team (PPT) for the TA-60-0002 Salvage and Warehouse Area consists of operations and management personnel from the facility, Multi-Sector General Permitting (MSGP) stormwater personnel from Environmental Compliance Programs (EPC-CP) organization, and Deployed Environmental Professionals. The EPC-CP representative is responsible for Laboratory compliance under the National Pollutant Discharge Elimination System (NPDES) permit regulations. The team members are selected on the basis of their familiarity with the activities at the facility and the potential impacts of those activities on stormwater runoff. The Warehouse and Salvage Yard are a single shift operation; therefore, a member of the PPT is always present during operations.

  17. Evaluation of Subsequent Heat Treatment Routes for Near-β Forged TA15 Ti-Alloy

    Directory of Open Access Journals (Sweden)

    Zhichao Sun

    2016-10-01

    Full Text Available TA15 Ti-alloy is widely used to form key load-bearing components in the aerospace field, where excellent service performance is needed. Near-β forging technology provides an attractive way to form these complicated Ti-alloy components but subsequent heat treatment has a great impact on the final microstructure and mechanical properties. Therefore evaluation and determination of the heat treatment route is of particular significance. In this paper, for the near-β forged TA15 alloy, the formation and evolution of microstructures under different subsequent heat treatment routes (annealing, solution and aging, toughening and strengthening were studied and the cooling mode after forging was also considered. Then, the type and characteristics of the obtained microstructures were discussed through quantitative metallographic analysis. The corresponding mechanical properties (tensile, impact toughness, and fracture toughness and effects of microstructural characteristics were investigated. Finally, for a required microstructure and performance a reasonable heat treatment route was recommended. The work is of importance for the application and development of near-β forging technology.

  18. U.S. EPA honors San Francisco Bay Area firm Hybrid Coating Technologies with Green Chemistry Award

    Science.gov (United States)

    SAN FRANCISCO - Today the U.S. Environmental Protection Agency recognized Hybrid Coating Technologies of Daly City, Calif. with a Presidential Green Chemistry Award for developing a safer, plant-based polyurethane for use on floors, furniture and in

  19. Comprehensive solutions for mobile communication safety network based on CDMA2000 Ev-Do/GoTa technology%基于CDMA2000 Ev-Do/GoTa技术的移动通信安全网综合解决方案

    Institute of Scientific and Technical Information of China (English)

    徐勇

    2012-01-01

    首先,分析CDMA2000 Ev-Do/GoTa集群通信系统的原理、网络架构和技术特点,通过比较欧洲的TETRA、美国的iDENY以及中国的GoTa 3种集群通信系统,指出GoTa具有前两者无法比拟的优势.然后,结合非洲某国安全网项目,详细讨论了CDMA2000 Ev-Do/GoTa安全网网络规划、系统设计以及视频监控、紧急联动等业务应用系统设计.

  20. Perceptions of Paddy Farmers towards Sustainable Agricultural Technologies: Case of Haraz Catchments Area in Mazandaran province of Iran

    Directory of Open Access Journals (Sweden)

    A. Bagheri

    2008-01-01

    Full Text Available Sustainable agriculture has defined and described in many ways. Despite the diversity in conceptualizing sustainable agriculture, there is a consensus on three basic dimensions of the concept, namely, ecological soundness economically viable and socially acceptable. The dimensions of ecological soundness refers to the preservation and improvement of the natural environment. Environmental issues emerge from the human use of natural resources. Farmers' decisions to adopt a new agricultural technology depend on complex factors. One of the factors is farmers' perception. The objective of this study was to investigate perceptions of paddy farmers towards applying sustainable agricultural technologies and to identify factors influencing their perceptions. The results of the study show that farmers had good perception about sustainable technologies such as diversification and rotation, application of manure but in general, they preferred modern technologies to local ones. They perceived agrochemicals as the best means to combat against pests and to increase rice production. Their perception of intangible impacts of modern technologies was weak. It was found that there should be a relationship between a numbers of socio-economic factors, such as human capital factors, information sources use, extension participation and landholding size and the perception towards selected sustainable agricultural technologies. Also, educational level, contact with agricultural experts and extension participation were best predictors of their perceptions.

  1. Remediation Technology of Contaminated Areas with Organochlorines: A Preliminary Evaluation Seeking Potential Applications on the Site of Street Capua, Santo André - SP

    Directory of Open Access Journals (Sweden)

    Mauro Silva Ruiz

    2012-12-01

    Full Text Available This paper is aimed to analyze the use of remediation technologies for areas contaminated with organochlorine based on a literature review and discussions with specialists. The remediation technologies analyzed were bioremediation, phytoremediation, nanotechnology, chemical oxidation, and thermal desorption. The purpose is to identify and compare “key problems” for each of these technologies envisaging the use of one or more of these them f or the remediation of the Capua Street site in Santo André, SP. Four databases were used in the preliminary literature review: Scopus, SciELO, Web of Science, and Science Direct. A survey questionnaire was designed to gather information on publications of scientific papers and patents, specific uses of these technologies by companies, and cases of application. Since the quality of the data and information obtained from this questionnaire application was not satisfactory, a new research approach for complementing them was undertaken. For this purpose, the Web of Science was selected as the most adequate data basis to carry out this second survey. However, it was realized that even for this database - that is reference for evaluating academic institutions, researchers and maturity of technologies – bias coming from the original data source can affect the survey results. Moreover, as the number of keywords used in the research consisted of generic terms for each technology, it can also be assumed that if some authors have used very specific terms, a small amount of work published by them would possibly have been misrepresented in the final result.

  2. Sm2FeTaO7 Photocatalyst for Degradation of Indigo Carmine Dye under Solar Light Irradiation

    Directory of Open Access Journals (Sweden)

    Leticia M. Torres-Martínez

    2012-01-01

    Full Text Available This paper is focused to study Sm2FeTaO7 pyrochlore-type compound as solar photocatalyst for the degradation of indigo carmine dye in aqueous solution. Sm2FeTaO7 was synthesized by using conventional solid state reaction and sol-gel method. X-ray diffraction results indicated that Sm2FeTaO7 exhibit a monoclinic crystal structure. By scanning electron microscopy analysis, it was observed that sol-gel material presents particle size of around 150 nm. The specific surface area and energy bandgap values were 12 m2 g−1 and 2.0 eV, respectively. The photocatalytic results showed that indigo carmine molecule can be degraded under solar light irradiation using the synthesized materials, sol-gel photocatalyst was 8 times more active than solid state. On the other hand, when Sm2FeTaO7 was impregnated with CuO as cocatalyst the photocatalytic activity was increased because CuO acts as electron trap decreasing electron-hole pair recombination rates.

  3. Methylene blue degradation by NaTaO3 sol-gel doped with Sm and La.

    Science.gov (United States)

    Torres-Martínez, Leticia M; Cruz-López, Arquímedes; Juárez-Ramírez, Isaías; Meza-de la Rosa, Ma Elena

    2009-06-15

    In this work, NaTaO(3) compounds doped with 1M% of La and Sm, were prepared by the sol-gel (SG) method and solid state (SS) reaction; and tested as photocatalysts on the degradation of methylene blue (MB) under UV light. The structural characterization by X-ray powder diffraction revealed that the crystallization of the NaTaO(3) phase prepared by the sol-gel method started at 600 degrees C, reaching maximum crystallization at 800 degrees C. It was determined that the presence of Sm and La retard the crystallization of the NaTaO(3) phase. On the other hand, the compounds synthesized in this work showed particle sizes in the nanometric scale, as it was observed by scanning electron microscopy (SEM). The specific surface area of the compounds synthesized by the sol-gel method, showed values 4 times higher than those obtained by the solid state reaction, favoring their functional and photocatalytic performance in the methylene blue degradation. In addition, the best photocatalytic performance was shown by the NaTaO(3) doped with Sm and heated at 600 degrees C, having a half-life time of 65 min.

  4. Methylene blue degradation by NaTaO{sub 3} sol-gel doped with Sm and La

    Energy Technology Data Exchange (ETDEWEB)

    Torres-Martinez, Leticia M., E-mail: letorre@fic.uanl.mx [Departmento de Ecomateriales y Energia, Facultad de Ingenieria Civil, Universidad Autonoma de Nuevo Leon, Cd. Universitaria, S/N San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Cruz-Lopez, Arquimedes; Juarez-Ramirez, Isaias; Meza-de la Rosa, Ma. Elena [Departmento de Ecomateriales y Energia, Facultad de Ingenieria Civil, Universidad Autonoma de Nuevo Leon, Cd. Universitaria, S/N San Nicolas de los Garza, Nuevo Leon 66450 (Mexico)

    2009-06-15

    In this work, NaTaO{sub 3} compounds doped with 1 M% of La and Sm, were prepared by the sol-gel (SG) method and solid state (SS) reaction; and tested as photocatalysts on the degradation of methylene blue (MB) under UV light. The structural characterization by X-ray powder diffraction revealed that the crystallization of the NaTaO{sub 3} phase prepared by the sol-gel method started at 600 deg. C, reaching maximum crystallization at 800 deg. C. It was determined that the presence of Sm and La retard the crystallization of the NaTaO{sub 3} phase. On the other hand, the compounds synthesized in this work showed particle sizes in the nanometric scale, as it was observed by scanning electron microscopy (SEM). The specific surface area of the compounds synthesized by the sol-gel method, showed values 4 times higher than those obtained by the solid state reaction, favoring their functional and photocatalytic performance in the methylene blue degradation. In addition, the best photocatalytic performance was shown by the NaTaO{sub 3} doped with Sm and heated at 600 deg. C, having a half-life time of 65 min.

  5. A new synthesis route of perovskite-related Sr2TaO3N oxynitride via Sr2Ta6O10.188

    Science.gov (United States)

    Sarda, Narendra G.; Hayashi, Takanori; Takeuchi, Yuta; Harada, Kyosuke; Murai, Kei-Ichiro; Moriga, Toshihiro

    2016-12-01

    Formation process of the new layered perovskite Sr2TaO3N oxynitride having a K2NiF4-type structure from oxide precursor of Sr6Ta2O10.188 was examined under an ammonia flow. Using the oxide precursor, it is possible to make a Sr2TaO3N phase within a shorter period of the nitridation than the previous paper reported by Marchant et al. (J. Solid State Chem., 146: 390-393(1999)). Excess amount of strontium deviated from the stoichiometric composition of Sr/Ta=2 also seemed to promote the formation of Sr2TaO3N under the ammonia flow. The synthesized Sr2TaO3N after two cycles of 24h-nitridation of the oxide precursors showed brighter reddish-orange color than SrTaO2N.

  6. 抗全蚀病的转PvPGIP2-TaLTP5双价基因小麦的创制及鉴定%Development and Characterization of Both PvPGIP2 and TaLTP5 Transgenic Wheat Lines with Resistance to Take-all

    Institute of Scientific and Technical Information of China (English)

    荣玮; 王金凤; 李钊; 王爱云; 杜丽璞; 叶兴国; 魏学宁; 张增艳

    2013-01-01

    [Objective] Take-all is a destructive disease of wheat production worldwide. The aim of this study is to develop and select stable PvPGIP2 and TaLTP5 transgenic wheat lines with resistance to take-all pathogen Gaeumannomyces graminis.[Method]Gene recombination technology was used to prepare the transformation vector pA25-PvPGIP2-TaLTP5 expressing both PvPGIP2 and TaLTP5. Particle bombardment method was used to introduce both PvPGIP2 and TaLTP5 into wheat cultivar Yangmai 18. PCR, RT-PCR and qRT-PCR methods were used to detect the presence and transcript levels of PvPGIP2 and TaLTP5 in the transgenic wheat plants of T0-T4 generations. G. graminis mycelia plug inoculation and take-all severity and the disease index were used to score the resistance degrees of these transgenic wheat lines and non-transgenic wheat Yangmai 18 at young seedling-stage.[Result]The results indicated that the introduced PvPGIP2 and TaLTP5 genes were stably inherited, and could be highly expressed in six transgenic wheat lines. The transgenic wheat plants expressing PvPGIP2 and TaLTP5 showed significantly enhanced resistance to G. graminis compared with non-transgenic wheat Yangmai 18. [Conclusion] These results suggested that the introduced PvPGIP2 and TaLTP5 genes can be used for improving wheat resistance to take-all.%[目的]全蚀病是小麦的毁灭性病害。创制转PvPGIP2和TaLTP5双价基因小麦,分析外源PvPGIP2和TaLTP5在转基因小麦中的遗传与表达情况,选育抗全蚀病的转基因小麦新种质。[方法]采用基因重组技术构建了PvPGIP2和TaLTP5双价表达转基因载体pA25-PvPGIP2-TaLTP5,利用基因枪介导法将该载体转入小麦品种扬麦18,采用PCR、RT-PCR与qRT-PCR方法分析转基因小麦T 0-T 4植株中目的基因及其表达量,并对T 3和T 4逐株进行全蚀病接种与抗性鉴定。[结果]创制并选育出稳定的抗全蚀病转PvPGIP2和TaLTP5小麦株系6个。PvPGIP2和TaLTP5能够在这6个转基因小麦

  7. (Ag,Cu)-Ta-O ternaries as high-temperature solid-lubricant coatings.

    Science.gov (United States)

    Gao, Hongyu; Otero-de-la-Roza, Alberto; Gu, Jingjing; Stone, D'Arcy; Aouadi, Samir M; Johnson, Erin R; Martini, Ashlie

    2015-07-22

    Ternary oxides have gained increasing attention due to their potential use as solid lubricants at elevated temperatures. In this work, the tribological properties of three ternary oxides-AgTaO3, CuTaO3, and CuTa2O6-were studied using a combination of density-functional theory (DFT), molecular dynamics (MD) simulations with newly developed empirical potential parameters, and experimental measurements (AgTaO3 and CuTa2O6 only). Our results show that the MD-predicted friction force follows the trend AgTaO3 behavior of these materials.

  8. Preparation, characterization, and catalytic performance of Ta-HMS mesoporous molecular sieve

    Science.gov (United States)

    Li, Xuefeng; Zhang, Like; Gao, Huanxin; Chen, Qingling

    2016-08-01

    Various Ta-HMS (hexagonal mesoporous silica) samples with different Ta content were hydrothermally prepared and characterized by XRD, N2-adsorption, ICP-AES, FTIR, and UV-Vis spectroscopy. The catalytic performance of the samples was also evaluated in the epoxidation of cyclohexene with cumene hydroperoxide as oxidant. The regularity of mesoporous structure decreases while more extraframe Ta ions are formed with increasing the Ta content. Ta-HMS with Ta/Si ratio of 0.015 shows the highest conversion and selectivity in the studied epoxidation reaction. The catalyst can be used for three times without significant activity loss.

  9. 高温高压盆地东方区黄流组三维压力建模技术%The three-dimensional pressure modeling technology for Huangliu Formation of Dongfang area in the HTHP basin

    Institute of Scientific and Technical Information of China (English)

    刘爱群; 范彩伟; 蔡军; 方小宇; 李文拓; 严恒

    2016-01-01

    莺歌海盆地是一个富烃盆地,在中深层、特别是在高温超压地层中,存在着众多的大型勘探目标,其中东方区中深层高温超压领域天然气勘探势头良好,其黄流组目的层为中深层勘探的主力层系,已实现探明储量千亿方。准确的压力预测和三维压力模型的建立是勘探取得重大突破的基石,三维压力模型的建立又基于三维岩性模型,本次岩性模型的建立突破了传统的以地震阻抗门槛值为唯一手段的岩性预测方法,而采用三重趋势约束方法构建岩性模型。通过钻后测压数据与钻前预测的三维压力模型数据进行校验,证实三维压力模型建立技术方法的有效性,并指示该技术方法有着广泛的发展应用前景。%The Yinggehai Basin is a hydrocarbon⁃rich basin,and in the high⁃temperature and overpressure strata,there exist numerous large⁃sized exploration targets.Especially in the high⁃temperature and overpressure field at the medium and deep depths in the Dongfang area,the natural gas exploration is very promising.The target strata of Huangliu Formation in the Dongfang area serve as the major stra⁃ta,where a thousand billion cubic meters of gas resources have been proved. The accurate pressure prediction and the establishment of the three⁃dimensional pressure model constitute the cornerstone for the breakthrough in the exploration,and the establishment of the three⁃dimensional pressure model is based on the three⁃dimensional lithologic model. The establishment of this lithologic model breaks through the traditional lithologic prediction method in which the seismic impedance threshold value is used as the only means. In this study,the triple constraint trends lithological model is adopted to establish the lithologic model. The verification based on post⁃drilling pressure⁃measuring data and pre⁃drilling predicted three⁃dimensional pressure model data has proved the

  10. Everyday life innovation potential: when technology has to make sense. Citizens living in high-risk areas for health, using health-promoting technologies

    DEFF Research Database (Denmark)

    Madsen, Jacob Østergaard

    2014-01-01

    Societal and political focus on both a European and worldwide level calls for a scope on what research have been done within the area of "inequality in health" in order to form both a theoretical and operational foundation for health professionals (in this case occupational therapists) to contrib...

  11. Energy-Efficient Technologies and the Building’s Saleable Floor Area: Bust or Boost for Highly-Efficient Green Construction?

    Directory of Open Access Journals (Sweden)

    Staffan Hintze

    2013-08-01

    Full Text Available When the external measurements of a building are fixed, an increase in external wall thickness caused by additional insulation, for example, will lead to loss of saleable floor area. This issue has to be taken into account in the evaluation of investment profitability. This paper examines how technologies used in energy-efficient residential building construction affect the available saleable floor area and how this impacts profitability of investment. Using a modeled building and an analysis of the average construction cost, we assessed losses and gains of saleable floor area in energy-efficient buildings. The analysis shows that the impact of potential losses or gains of saleable floor area should be taken into account when comparing investment alternatives: building energy-efficient green dwellings or building conventional ones. The results indicate that constructing energy-efficient buildings and introducing very energy-efficient technologies may be energy- and cost-effective even compared with conventional buildings. Employing new products in energy-efficient construction allows benefit to be drawn from lower energy consumption during the life cycle of the building, but also from the increase in saleable floor area.

  12. Where Does the Formula Come from? Students Investigating Total Surface Areas of a Pyramid and Cone Using Models and Technology

    Science.gov (United States)

    Obara, Samuel

    2009-01-01

    Spatial reasoning is a skill that needs to be developed in students as it is important in geometry for determining total surface areas and volumes of 3-dimensional shapes (Liedtke, 1995). Simply teaching children the formulae, in this case for finding total surface areas, can limit them in understanding mathematics conceptually (Bonotto, 2003).…

  13. Optical properties of 1T and 2H phases of TaS2 and TaSe2

    Indian Academy of Sciences (India)

    Sangeeta Sharma; S Auluck; M A Khan

    2000-03-01

    We have calculated the anisotropic frequency dependent dielectric function for the 1T and 2H phases of TaS2 and TaSe2 using the linear muffin tin orbital method within the atomic sphere approximation. We find significant anisotropy in the frequency dependent dielectric function for the 1T and 2H phases at low energies (less than 4 eV). Unfortunately there are no experimental data to compare with. The averaged dielectric function agrees with the available experimental data except that the calculated peak heights are underestimated and shifted to higher energies by 1–2 eV.

  14. ADOPTION OF RENEWABLE ENERGY TECHNOLOGIES (RET) IN TOURISM INDUSTRY- (A CASE OF OSOGBO AND OLORUNDA LOCAL GOVERNMENT AREAS IN OSUN STATE, NIGERIA)

    OpenAIRE

    Sonubi, O.K.; Ogunjimi, A. A.; Adeyemo, A. I.

    2017-01-01

    Hotel accommodation in Nigeria is comparatively more expensive than its neighbours in the sub region of West Africa. It is one of the most expensive globally. This is attributable to its operating environment. Any sustainable means of reducing running costs would be most welcome. A study on adoption of renewable energy technologies (RET) was conducted in Osogbo and Olorunda Local Government Areas of Osun State, Nigeria. Data were obtained from registered hotels in the two local government are...

  15. Spectrum average cross section measurement of (183)W (n, p)(183)Ta and (184)W (n, p)(184)Ta reaction cross section in (252)Cf(sf) neutron field.

    Science.gov (United States)

    Makwana, Rajnikant; Mukherjee, S; Snoj, L; S Barala, S; Mehta, M; Mishra, P; Tiwari, S; Abhangi, M; Khirwadkar, S; Naik, H

    2017-09-01

    Neutron induced nuclear reactions are of prime importance for both fusion and fission nuclear reactor technology. Present work describes the first time measurement of spectrum average cross section of nuclear reactions (183)W(n,p)(183)Ta and (184)W(n,p)(184)Ta using (252)Cf spontaneous fission neutron source. Standard neutron activation analysis (NAA) technique was used. The neutron spectra were calculated using Monte Carlo N Particle Code (MCNP). The effects of self-shielding and back scattering were taken into account by optimizing the detector modeling. These effects along with efficiency of detector were corrected for volume sample in the actual source-detector geometry. The measured data were compared with the previously measured data available in Exchange Format (EXFOR) data base and evaluated data using EMPIRE - 3.2.2. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Structure-dependent size effects in CuTa/Cu nanolaminates

    Energy Technology Data Exchange (ETDEWEB)

    Gu, C. [State-Key Laboratory for Mechanical Behavior of Material, Xi’an Jiaotong University Xi’an, 710049 (China); Wang, F., E-mail: wangfei@mail.xjtu.edu.cn [State Key Laboratory for Strength and Vibration of Mechanical Structures, Xian Jiaotong University Xi’an, 710049 (China); Huang, P., E-mail: huangping@mail.xjtu.edu.cn [State-Key Laboratory for Mechanical Behavior of Material, Xi’an Jiaotong University Xi’an, 710049 (China); Xu, K.W. [State-Key Laboratory for Mechanical Behavior of Material, Xi’an Jiaotong University Xi’an, 710049 (China); Lu, T.J. [State Key Laboratory for Strength and Vibration of Mechanical Structures, Xian Jiaotong University Xi’an, 710049 (China)

    2016-03-21

    CuTa monolayers with different Ta contents (34 at% and 37 at%) and CuTa/Cu multilayers with varying nanoscale Cu layer thickness (3–24 nm) were prepared by magnetron sputtering. Their microstructure and mechanical properties were investigated by means of high resolution transmission electron microscopy (HRTEM) and nanoindentation testing. The microstructure of CuTa34 was pure amorphous phase while that of CuTa37 was amorphous phase embedded with nanoparticles. Adding Cu layers into the two different CuTa monolayers led to CuTa-Cu interfaces with different microstructures. For CuTa34/Cu, the interface was relatively straight and the Cu layers exhibited textured growth. For CuTa37/Cu, the interface was wavy and GBs (grain boundaries) were formed in the Cu layers. To investigate the influence of the two different microstructures on multilayer deformation, the residue indentation morphologies of CuTa/Cu were observed under scanning electronic microscope (SEM). For both CuTa34/Cu and CuTa37/Cu, SBs (shear bands) could be effectively inhibited if the Cu layers had a proper thickness. Dominant deformation mechanisms and size effects were proposed and discussed for CuTa/Cu thin films possessing different interfaces and Cu layer structures.

  17. Developing Public Policy Options for Access to Drinking Water in Peripheral, Disaster and Polluted Rural Areas: A Case Study on Environment-Friendly and Conventional Technologies

    Directory of Open Access Journals (Sweden)

    Ruxandra Mălina Petrescu-Mag

    2016-03-01

    Full Text Available Peripheral, disaster and polluted rural areas (PDP rural areas are generally perceived as a “Cinderella” of water public policy measures, deepening the rural-urban cleavage in terms of opportunities for a decent life. The main goal of the study is to develop public policy options regarding the supply of safe drinking water in Romanian PDP rural areas. The main instrument to achieve it is an ex-ante policy analysis of three solutions: a conventional technology, based on chlorine, a green technology using an advanced oxidation process with bio-filter (O3BioFilter, and “do nothing”. Environment protection, social equity, technical performance, economic efficiency and political feasibility were the criteria selected for analysis, within a focus-group. Several qualitative and quantitative methods were used: evaluation matrix, weighted cost-effectiveness and break-even point. The results of the first two indicate that the O3BioFilter has the best score, but not much higher than the conventional alternative (10% higher, revealing a possible path-dependency to familiar technologies. This analysis is not a ready-made solution valid in any case, nor a direct indication of “the best choice”, but a decision tool in the adoption and implementation of sustainable water public policies.

  18. Using Remote Sensing Technology on the Delimitation of the Conservation Area for the Jianan Irrigation System Cultural Landsccape

    Science.gov (United States)

    Wang, C. H.

    2015-08-01

    In recent years the cultural landscape has become an important issue for cultural heritages throughout the world. It represents the "combined works of nature and of man" designated in Article 1 of the World Heritage Convention. When a landscape has a cultural heritage value, important features should be marked and mapped through the delimitation of a conservation area, which may be essential for further conservation work. However, a cultural landscape's spatial area is usually wider than the ordinary architectural type of cultural heritage, since various elements and impact factors, forming the cultural landscape's character, lie within a wide geographic area. It is argued that the conservation of a cultural landscape may be influenced by the delimitation of the conservation area, the corresponding land management measures, the limits and encouragements. The Jianan Irrigation System, an historical cultural landscape in southern Taiwan, was registered as a living cultural heritage site in 2009. However, the system's conservation should not be limited to just only the reservoir or canals, but expanded to irrigated areas where farmland may be the most relevant. Through the analysis process, only approximately 42,000 hectares was defined as a conservation area, but closely related to agricultural plantations and irrigated by the system. This is only half of the 1977 irrigated area due to urban sprawl and continuous industrial expansion.

  19. Structural Geology of the Northwestern Portion of Los Alamos National Laboratory, Rio Grande Rift, New Mexico: Implications for Seismic Surface Rupture Potential from TA-3 to TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Jamie N. Gardner: Alexis Lavine; Giday WoldeGabriel; Donathon Krier; David Vaniman; Florie Caporuscio; Claudia Lewis; Peggy Reneau; Emily Kluk; M. J. Snow

    1999-03-01

    Los Alamos National Laboratory lies at the western boundary of the Rio Grande rift, a major tectonic feature of the North American Continent. Three major faults locally constitute the modem rift boundary, and each of these is potentially seismogenic. In this study we have gathered structural geologic data for the northwestern portion of Los Alamos National Laboratory through high-precision geologic mapping, conventional geologic mapping, stratigraphic studies, drilling, petrologic studies, and stereographic aerial photograph analyses. Our study area encompasses TA-55 and TA-3, where potential for seismic surface rupture is of interest, and is bounded on the north and south by the townsite of Los Alamos and Twomile Canyon, respectively. The study area includes parts of two of the potentially active rift boundary faults--the Pajarito and Rendija Canyon faults-that form a large graben that we name the Diamond Drive graben. The graben embraces the western part of the townsite of Los Alamos, and its southern end is in the TA-3 area where it is defined by east-southeast-trending cross faults. The cross faults are small, but they accommodate interactions between the two major fault zones and gentle tilting of structural blocks to the north into the graben. North of Los Alamos townsite, the Rendija Canyon fault is a large normal fault with about 120 feet of down-to-the-west displacement over the last 1.22 million years. South from Los Alamos townsite, the Rendija Canyon fault splays to the southwest into a broad zone of deformation. The zone of deformation is about 2,000 feet wide where it crosses Los Alamos Canyon and cuts through the Los Alamos County Landfill. Farther southwest, the fault zone is about 3,000 feet wide at the southeastern corner of TA-3 in upper Mortandad Canyon and about 5,000 feet wide in Twomile Canyon. Net down-to-the-west displacement across the entire fault zone over the last 1.22 million years decreases to the south as the fault zone broadens as

  20. Evaluation of Project Based Learning in the Area of Manufacturing and Statistics in the Degree of Industrial Technology

    Science.gov (United States)

    Buj-Corral, Irene; Marco-Almagro, Lluís; Riba, Alex; Vivancos-Calvet, Joan; Tort-Martorell, Xavier

    2015-01-01

    In the subject Project I in the second year of the Degree in Industrial Technology Engineering taught at the School of Industrial Engineering of Barcelona (ETSEIB), subgroups of 3-4 students within groups of 20 students develop a project along a semester. Results of 2 projects are presented related to manufacturing, measurement of parts and the…

  1. Participatory evaluation of monitoring and modelling of sustainable land management technologies in areas prone to land degradation

    NARCIS (Netherlands)

    Stringer, L.C.; Fleskens, L.; Reed, M.S.; Vente, de J.; Zengin, M.

    2014-01-01

    Examples of sustainable land management (SLM) exist throughout the world. In many cases, SLM has largely evolved through local traditional practices and incremental experimentation rather than being adopted on the basis of scientific evidence. This means that SLM technologies are often only adopted

  2. Science and Technology Educators' Enacted Curriculum: Areas of Possible Collaboration for an Integrative STEM Approach in Public Schools

    Science.gov (United States)

    Brown, Josh; Brown, Ryan; Merrill, Chris

    2012-01-01

    Science, Technology, Engineering, and Mathematics (STEM) teachers teach multiple concepts that lend themselves to possible collaboration on a daily basis. Much like Metz's (2009) insightful discussion about the importance of science educators creating partnerships in the community "outside the school walls," integrative STEM teaching also requires…

  3. Using remote-sensing technologies in combination with Cesium-137 measurements to estimate soil-erosion quantity in semi-arid steppe areas

    Institute of Scientific and Technical Information of China (English)

    ZhanJiang Sha; HaiZhou Ma; LingQin Li; Jinzhou Du; FeiQuan Wu; QiShun Fan

    2009-01-01

    Soil erosion by wind is one of the most important processes in the changing the earth's surface in semi-arid areas, Thus it is of great importance to study soil-erosion action. Using integrated technologies of remote sensing and geochemistry radioactivity isotope to extract regional soil-erosion information and to calculate quantity of soil erosion is accomplished successfully in this paper by means of beneficial experiments in the Talatan region of the Gonghe Basin, which is located in northeastern Qinghai-Tibet Plateau in China. The results show that the soil erosion by wind is not intensive in this region; the erosion types belong to the classes of very-soft erosion and soft-erosion type, which account for 47.12 percent and 35.58 percent, respectively, of the total study area.In total, two kinds of soil erosion account for 82.70 percent of the study area; only a small area belongs to the classes of severe erosion and very-severe erosion; this area is about 22.14 km2. Severe deposition activity has taken place in this region, and has appeared in a large area (322.67 km2), which accounts for 11.78 percent of the total study area. The results of this study show that soil erosion and deposition inventories are 870,000-1,150,000 tons and 550,000-780,000 tons, respectively, per year. The soil inventory shows about 320,000-370,000 tons from Talatan to Longyangxia reservoir per year. Using remote-sensing technology and 137Cs techniques is a valid means to analyze and to evaluate the quantity of soil erosion by wind in semi-arid environments.

  4. Using remote-sensing technologies in combination with Cesium-137 measurements to estimate soil-erosion quantity in semi-arid steppe areas

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Soil erosion by wind is one of the most important processes in the changing the earth’s surface in semi-arid areas,Thus it is of great importance to study soil-erosion action.Using integrated technologies of remote sensing and geochemistry radioactivity iso-tope to extract regional soil-erosion information and to calculate quantity of soil erosion is accomplished successfully in this paper by means of beneficial experiments in the Talatan region of the Gonghe Basin,which is located in northeastern Qinghai-Tibet Pla-teau in China.The results show that the soil erosion by wind is not intensive in this region;the erosion types belong to the classes of very-soft erosion and soft-erosion type,which account for 47.12 percent and 35.58 percent,respectively,of the total study area.In total,two kinds of soil erosion account for 82.70 percent of the study area;only a small area belongs to the classes of severe erosion and very-severe erosion;this area is about 22.14 km2.Severe deposition activity has taken place in this region,and has appeared in a large area(322.67 km2),which accounts for 11.78 percent of the total study area.The results of this study show that soil erosion and deposition inventories are 870,000-1,150,000 tons and 550,000-780,000 tons,respectively,per year.The soil in-ventory shows about 320,000-370,000 tons from Talatan to Longyangxia reservoir per year.Using remote-sensing technology and 137Cs techniques is a valid means to analyze and to evaluate the quantity of soil erosion by wind in semi-arid environments.

  5. Land use maps of the Tanana and Purcell Mountain areas, Alaska, based on Earth Resources Technology Satellite imagery

    Science.gov (United States)

    Anderson, J. H. (Principal Investigator)

    1974-01-01

    The author has identified the following significant results. ERTS imagery in photographic format was used to make land use maps of two areas of special interest to native corporations under terms of the Alaska Native Claims Settlement Act. Land selections are to be made in these areas, and the maps should facilitate decisions because of their comprehensive presentation of resource distribution information. The ERTS images enabled mapping broadly-defined land use classes in large areas in a comparatively short time. Some aerial photography was used to identify colors and shades of gray on the various images. The 14 mapped land use categories are identified according to the classification system under development by the U.S. Geological Survey. These maps exemplify a series of about a dozen diverse Alaskan areas. The principal resource depicted is vegetation, and clearly shown are vegetation units of special importance, including stands possibly containing trees of commercial grade and stands constituting wildlife habitat.

  6. Applying Integrated ITS Technologies to Parking Management Systems: A Transit-Based Case Study in the San Francisco Bay Area

    OpenAIRE

    Shaheen, Susan; Rodier, Caroline J.; Eaken, Amanda M.

    2004-01-01

    California Partners for Advanced Transit and Highways has teamed with the California Department of Transportation, the Bay Area Rapid Transit (BART) District, ParkingCarmaâ„¢, and Quixote Corporation to launch a smart parking research demonstration at the Rockridge BART station in the East San Francisco Bay Area (California, USA). The results of an extensive literature review demonstrate that different smart parking applications implemented worldwide can ease traveler delays, increase transit...

  7. Studies on layer growth and interfaces on Ta-base thin layers by means of XPS; Untersuchungen zu Schichtwachstum und Grenzflaechen an Ta-basierten Duennschichten mittels XPS

    Energy Technology Data Exchange (ETDEWEB)

    Zier, M.

    2007-11-02

    In this thesis studies on the growth and on the formation of the interfaces of Ta and TaN layers on Si and SiO{sub 2} were performed. In the system TaN on SiO{sub 2} no reaction on the interface could be found. As the system with the mostly disturbed interface Ta on SiO{sub 2} was proved. Here a reduction of the SiO{sub 2} at simultaneous oxidation of the Ta was to be observed. Additionally tantalum silicide was formed to be considered concerning the bonding state as Ta{sub 5}Si{sub 3}, from which a double layer of a tantalum silicide and a tantalum suboxide resulted. A whole thickness of the double layer of above 1 nm resulted. In the system Ta on Si at the deposition of the film on the interface a tantalum silicide was formed to be characterized concerning the bonding state as TaSi{sub 2}. The thickness of the interlayer growed thereby up to 0.8 nm in form of islands. Finally in the system TaN on Si a silicon nitride formation during the deposition was observed, which was attributed to the insertion of adsorbed nitrogen from the sputtering atmosphere by recoil implantation of the sputtered Ta atoms. The silicon nitride interlayer growed thereby up to a thickness of 0.8 nm.

  8. The Wheat Mediator Subunit TaMED25 Interacts with the Transcription Factor TaEIL1 to Negatively Regulate Disease Resistance against Powdery Mildew.

    Science.gov (United States)

    Liu, Jie; Zhang, Tianren; Jia, Jizeng; Sun, Jiaqiang

    2016-03-01

    Powdery mildew, caused by the biotrophic fungal pathogen Blumeria graminis f. sp. tritici, is a major limitation for the production of bread wheat (Triticum aestivum). However, to date, the transcriptional regulation of bread wheat defense against powdery mildew remains largely unknown. Here, we report the function and molecular mechanism of the bread wheat Mediator subunit 25 (TaMED25) in regulating the bread wheat immune response signaling pathway. Three homoalleles of TaMED25 from bread wheat were identified and mapped to chromosomes 5A, 5B, and 5D, respectively. We show that knockdown of TaMED25 by barley stripe mosaic virus-induced gene silencing reduced bread wheat susceptibility to the powdery mildew fungus during the compatible plant-pathogen interaction. Moreover, our results indicate that MED25 may play a conserved role in regulating bread wheat and barley (Hordeum vulgare) susceptibility to powdery mildew. Similarly, bread wheat ETHYLENE INSENSITIVE3-LIKE1 (TaEIL1), an ortholog of Arabidopsis (Arabidopsis thaliana) ETHYLENE INSENSITIVE3, negatively regulates bread wheat resistance against powdery mildew. Using various approaches, we demonstrate that the conserved activator-interacting domain of TaMED25 interacts physically with the separate amino- and carboxyl-terminal regions of TaEIL1, contributing to the transcriptional activation activity of TaEIL1. Furthermore, we show that TaMED25 and TaEIL1 synergistically activate ETHYLENE RESPONSE FACTOR1 (TaERF1) transcription to modulate bread wheat basal disease resistance to B. graminis f. sp. tritici by repressing the expression of pathogenesis-related genes and deterring the accumulation of reactive oxygen species. Collectively, we identify the TaMED25-TaEIL1-TaERF1 signaling module as a negative regulator of bread wheat resistance to powdery mildew.

  9. Order within disorder: The atomic structure of ion-beam sputtered amorphous tantala (a-Ta{sub 2}O{sub 5})

    Energy Technology Data Exchange (ETDEWEB)

    Bassiri, Riccardo, E-mail: rbassiri@stanford.edu; Liou, Franklin; Lin, Angie C.; Byer, Robert L.; Route, Roger K.; Fejer, Martin M. [E. L. Ginzton Laboratory, Stanford University, Stanford, California 94305 (United States); Abernathy, Matthew R.; Gustafson, Eric K. [LIGO Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Kim, Namjun; Stebbins, Jonathan F. [Department of Geological and Environmental Sciences, Stanford University, Stanford, California 94305 (United States); Mehta, Apurva; Shyam, Badri [Stanford Synchrotron Radiation Lightsource, SLAC National Accelerator Laboratory, Menlo Park, California 94025 (United States); Hart, Martin; MacLaren, Ian; Martin, Iain W.; Rowan, Sheila [SUPA, School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ (United Kingdom)

    2015-03-01

    Amorphous tantala (a-Ta{sub 2}O{sub 5}) is a technologically important material often used in high-performance coatings. Understanding this material at the atomic level provides a way to further improve performance. This work details extended X-ray absorption fine structure measurements of a-Ta{sub 2}O{sub 5} coatings, where high-quality experimental data and theoretical fits have allowed a detailed interpretation of the nearest-neighbor distributions. It was found that the tantalum atom is surrounded by four shells of atoms in sequence; oxygen, tantalum, oxygen, and tantalum. A discussion is also included on how these models can be interpreted within the context of published crystalline Ta{sub 2}O{sub 5} and other a-T{sub 2}O{sub 5} studies.

  10. Fibroblast Adhesion and Proliferation on a New β Type Ti-39Nb-13Ta-4.6Zr Alloy for Biomedical Application

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Cell attachment and spreading on Ti-based alloy surfaces is a major parameter in implant technology. Ti39Nb-13Ta-4.6Zr alloy is a new β type Ti alloy developed for biomedical application. This alloy has low modulus and high strength, which indicates that it can be used for medical purposes such as surgical implants.To evaluate the biocompatibility and effects of the surface morphology of Ti-39Nb-13Ta-4.6Zr on the cellular behaviour, the adhesion and proliferation of rat gingival fibroblasts were studied with substrates having different surface roughness and the results were also compared with commercial pure titanium and Ti-6Al-4V. The results indicate that fibroblast shows similar adhesion and proliferation on the smooth surfaces of commercial pure titanium (Cp Ti), Ti-39Nb-13Ta-4.6Zr, and Ti-6Al-4V, suggesting that Ti-39Nb-13Ta-4.6Zr has similar biocompatibility to Cp Ti and Ti-6Al-4V. The fibroblast adhesion and spreading was lower on rough surfaces of Cp Ti, Ti-39Nb-13Ta-4.6Zr and Ti-6Al-4V than on smooth ones. Surface roughness appeared to be a dominant factor that determines the fibroblast adhesion and proliferation.

  11. Advances in Navy pharmacy information technology: accessing Micromedex via the Composite Healthcare Computer System and local area networks.

    Science.gov (United States)

    Koerner, S D; Becker, F

    1999-07-01

    The pharmacy profession has long used technology to more effectively bring health care to the patient. Navy pharmacy has embraced technology advances in its daily operations, from computers to dispensing robots. Evolving from the traditional role of compounding and dispensing specialists, pharmacists are establishing themselves as vital team members in direct patient care: on the ward, in ambulatory clinics, in specialty clinics, and in other specialty patient care programs (e.g., smoking cessation). An important part of the evolution is the timely access to the most up-to-date information available. Micromedex, Inc. (Denver, Colorado), has developed a number of computer CD-ROM-based full-text pharmacy, toxicology, emergency medicine, and patient education products. Micromedex is a recognized leader with regard to total pharmaceutical information availability. This article discusses the implementation of Micromedex products within the established Composite Healthcare Computer System and the subsequent use by and effect on the international Navy pharmacy community.

  12. Conversion of Industrial Buildings and Areas in Terms of Sustainable Development by Using BIM Technology: Analysis and Further Developments

    Directory of Open Access Journals (Sweden)

    Miroslavas Pavlovskis

    2016-02-01

    Full Text Available The article deals with abandoned industrial buildings and lands conversion concept, objectives, problems, beneficial results of a successful conversion for urban expansion, as a complex process of sustainable development. The tools for making effective management and usage of abandoned buildings decisions are considered. The article analyzes the 5D BIM model throughout the life cycle of the building. The foreign good practice is analyzed, where the modern digital technology is used for reconstruction of old buildings. The building information model application possibilities are examined throughout the lifespan of a building. The measures for CO2 emission reduction in the construction sector are proposed. Finaly, the model for conversion of abanoded buildings is proposed, based on MCDM and BIM technologies.

  13. Assessment of Radiometer Calibration with GPS Radio Occultation for the MiRaTA CubeSat Mission.

    Science.gov (United States)

    Marinan, Anne D; Cahoy, Kerri L; Bishop, Rebecca L; Lui, Susan S; Bardeen, James R; Mulligan, Tamitha; Blackwell, William J; Leslie, R Vincent; Osaretin, Idahosa; Shields, Michael

    2016-12-01

    The Microwave Radiometer Technology Acceleration (MiRaTA) is a 3U CubeSat mission sponsored by the NASA Earth Science Technology Office (ESTO). The science payload on MiRaTA consists of a tri-band microwave radiometer and Global Positioning System (GPS) radio occultation (GPSRO) sensor. The microwave radiometer takes measurements of all-weather temperature (V-band, 50-57 GHz), water vapor (G-band, 175-191 GHz), and cloud ice (G-band, 205 GHz) to provide observations used to improve weather forecasting. The Aerospace Corporation's GPSRO experiment, called the Compact TEC (Total Electron Content) and Atmospheric GPS Sensor (CTAGS), measures profiles of temperature and pressure in the upper troposphere/lower stratosphere (∼20 km) and electron density in the ionosphere (over 100 km). The MiRaTA mission will validate new technologies in both passive microwave radiometry and GPS radio occultation: (1) new ultra-compact and low-power technology for multi-channel and multi-band passive microwave radiometers, (2) the application of a commercial off the shelf (COTS) GPS receiver and custom patch antenna array technology to obtain neutral atmospheric GPSRO retrieval from a nanosatellite, and (3) a new approach to spaceborne microwave radiometer calibration using adjacent GPSRO measurements. In this paper, we focus on objective (3), developing operational models to meet a mission goal of 100 concurrent radiometer and GPSRO measurements, and estimating the temperature measurement precision for the CTAGS instrument based on thermal noise. Based on an analysis of thermal noise of the CTAGS instrument, the expected temperature retrieval precision is between 0.17 K and 1.4 K, which supports the improvement of radiometric calibration to 0.25 K.

  14. Empirical Performance Evaluation of Enhanced Throughput Schemes of IEEE802.11 Technology in Wireless Area Networks

    OpenAIRE

    2013-01-01

    The success in the growing wireless standards can be measured by the achievement of quality of service (QoS) specifications by the designers. The IEEE802.11 wireless standards are widely accepted as wireless technology for wireless LAN. Efforts have been made over the years by the task group to provide adequate number of QoS enhancement schemes for the increasing numbers of multimedia applications. This paper examines the empirical performances of ad hoc wireless networks deployed on IEEE802....

  15. Discuss on Key Coalbed Methane Drainage Technology in Jiaoping Mining Area%焦坪矿区煤层气排采关键技术探讨

    Institute of Scientific and Technical Information of China (English)

    万志杰

    2012-01-01

    This paper aims to propose viewpoint concerning equipment selection and drainage technology for further coalbed methane development after Jurassic system coal seam of Jiaoping mining area to pro- vide references for coalbed methane development of Jiaoping mining area combining problems arising from on - site drainage management process of JPC-O1 well of Jiaoping mining area.%结合焦坪矿区JPC—01井现场排采管理过程中遇到的问题,对焦坪矿区侏罗系煤层以后开发煤层气的设备选型以及排采工艺提出相应的观点,为以后焦坪矿区开发煤层气提供参考。

  16. Tuning the charge density wave and superconductivity in CuxTaS2

    NARCIS (Netherlands)

    Wagner, K.E.; Morosan, E.; Hor, Y.S.; Tao, J.; Zhu, Y.; Sanders, T.; McQueen, T.M.; Zandbergen, H.W.; Williams, A.J.; West, D.V.; Cava, R.J.

    2008-01-01

    We report the characterization of layered 2H-type CuxTaS2 for 0≤x≤0.12. The charge density wave (CDW), at 70 K for TaS2, is destabilized with Cu doping. The sub-1 K superconducting transition in undoped 2H-TaS2 jumps quickly to 2.5 K at low x, increases to 4.5 K at the optimal composition Cu0.04TaS2

  17. Analysis of the Tuition Assistance Program: does the method of instruction matter in TA classes?

    OpenAIRE

    Mehay, Stephen L; Pema, Elda

    2010-01-01

    The Navy's Tuition Assistance (TA) program subsidizes the tuition costs of off-duty college classes for Navy personnel. Although prior studies have investigated the effect of completing college courses via TA on enlisted retention and promotion (Mehay and Pema, 2009), no prior study has examined the effect of the instructional methods in the courses taken via TA. Interest in course delivery methods has been stimulated by the rapid growth in online TA classes. This study analyzes the effects o...

  18. 香蕉产地初加工技术分类及集成%Classification, integration of preliminary processing technology in banana producing areas of China

    Institute of Scientific and Technical Information of China (English)

    徐贞贞; 孙洁; 赵靓; 沈瑾; 朱明; 廖小军

    2015-01-01

    Banana is the worldwide 2nd fruit with the biggest trade,it is also the only one of top five fruits with trade deficit compared with the other four, like apple, citrus, pear and peach, having great contributions to fruits export business in China. The import quantity of banana is continuing to rise even as the increasing production recent years, meanwhile the loss of banana in its producing area is approaching one million, almost two times of its export quantity in China, which suggests that loss reduction will contribute to shrink the trade deficit. Based on the statistics, more than 700 projects about banana research were approved by the Chinese governments and almost 500 scientific research institutions and universities were involved. However, few of them were about loss reduction in producing areas. Further researches about the exiting preliminary processing technologies may reduce banana loss in its producing area, then trying a new way to break through the bottleneck problem of banana industries and improve banana industry in China. This study has collected all harvesting, plantation transportation, commercialization, storage and transport technologies used currently in banana producing area, do further classification for all those preliminary processing technologies, and integrated four principal technology chains, then gave more information about the current Chinese banana production industry. Compared with other well-developed banana producers in the world, the gaps about large-scale production, market internationalization, technology integration, equipment serialization, facilities supporting and logistics professionalization of Chinese banana production industry are still obvious, which directly induced Chinese banana products showing no international competitiveness, no high-end brands, and only sharing the lower and middle markets. However, large-scale banana plantations are not fully accords with the retails-dominated condition in China, and it is

  19. Development of (Nb,Ta3Sn multifilamentary superconductor wire for high current applications

    Directory of Open Access Journals (Sweden)

    Rodrigues Jr. Durval

    2000-01-01

    Full Text Available The optimization of the energy generated by a MagnetoHydroDynamic (MHD channel using a superconducting magnet demands the optimization of the magnetic field of the system and of the critical points on the magnet winding. This work must include the development of a high performance superconductor wire suitable for this system. Aiming to the construction of improved performance MHD channel, it was developed a low cost superconductor wire, with the required characteristics. The wire was made using a technology compatible with the assembling steps and heat treatment conditions of the MHD superconducting magnets fabrication. It was used the internal Sn method in Nb-7.5wt%Ta tube to fabricate a 271-filament wire with a diameter of 0.81 mm and a Cu/nonCu ratio of 2.3. The wire was heat treated at 200 °C to diffuse the Sn into the Cu shell, producing bronze, followed by the final reaction at temperatures ranging from 670 °C to 730 °C during 25 to 150 h, to produce (Nb,Ta3Sn. The superconducting wire characterization was made measuring the critical current Ic versus the applied magnetic field in the range of 5 to 20 T, the critical temperature Tc and the residual resistivity ratio (RRR. The wire transported critical currents above those available in commercial superconducting wires. These values of Ic are higher than the expected values for the optimization of the MHD channel.

  20. Remote Sensing Technology for Identification of Alteration Information of Gold Deposits in the Eastern Tianshan Area, Xinjiang

    Institute of Scientific and Technical Information of China (English)

    FU Shuixing; ZHANG Shoulin; LI Chunxia; FENG Jianzhong; FANG Tonghui; SUN Baosheng

    2004-01-01

    Based on specific well-exposed rocks useful for high-quality remote sensing interpretation in the goldprospecting area in the eastern Tianshan, this paper gives a detailed description of a remote sensing model for metallogenic prediction. The model reveals that multi-spectral remote sensing data are integrated with high-resolution remote sensing data, and enhanced extraction and visual description of weak remote sensing information are used for prospecting. This model has tested in the given gold deposit, and used successfully in Au-Cu prospecting in the Kalatage area.

  1. Influence of Ta content on hot corrosion behaviour of a directionally solidified nickel base superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Han, F.F. [Superalloy Division, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Chang, J.X., E-mail: jxchang11s@imr.ac.cn [Superalloy Division, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Li, H.; Lou, L.H. [Superalloy Division, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Zhang, J. [Superalloy Division, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China); Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, 72 Wenhua Road, Shenyang 110016 (China)

    2015-01-15

    Highlights: • Three nickel-base superalloys containing different Ta content were subjected to Na{sub 2}SO{sub 4}-induced hot corrosion. • Ta improved the hot corrosion resistance. • Ta decreased the diffusion rate of alloying elements. • Ta promoted the formation of (Cr, Ti)TaO{sub 4} layer. - Abstract: Hot corrosion behaviour of a directionally solidified nickel base superalloy with different tantalum (Ta) addition in fused sodium sulphate (Na{sub 2}SO{sub 4}) under an oxidizing atmosphere at 900 °C has been studied. It was shown that the hot corrosion resistance was improved by increasing of Ta content. The hot corrosion kinetics of the alloy with lower Ta content deviated from parabolic law after 60 h corrosion test, whereas the corrosion kinetics of the alloy with high Ta content followed the parabolic law before 60 h and with less mass change afterwards. A detailed microstructure study using scanning electron microscopy (SEM) equipped with an energy dispersive spectroscopy (EDS), transmission electron microscopy (TEM) and X-ray diffraction (XRD) was performed to investigate the corrosion products and mechanisms. The beneficial effect of Ta was found to be resulted from a Ta-enriched (Cr, Ti)TaO{sub 4} layer inside the corrosion scale, which led to the retarding of the element diffusion so as to decrease the hot corrosion kinetics.

  2. Signature splitting and quasiparticle alignment in the yrast band of Ta-165

    NARCIS (Netherlands)

    Roux, DG; Fetea, MS; Gueorguieva, E; Babu, BRS; Newman, RT; Lawrie, JJ; Fearick, R; Aschman, DG; Beetge, R; Benatar, M; Mabala, GK; Mullins, SM; Murray, SHT; Naguleswaran, S; Rigollet, C; Sharpey-Schafer, JF; Smit, FD; Whittaker, WJ

    Excited states in Ta-165 were populated in the Nd-142(Al-27,4n)Ta-165 and Pr-141(Si-28,4n)Ta-165 reactions and investigated using the AFRODITE array. The yrast rotational decay sequence up to spin 53/2(-) is identified and assigned to the [514]9/2(-) configuration. The nuclear shape is investigated

  3. Technology Review of Nondestructive Methods for Examination of Water Intrusion Areas on Hanford’s Double-Shell Waste Tanks

    Energy Technology Data Exchange (ETDEWEB)

    Watkins, Michael L.; Pardini, Allan F.

    2008-05-09

    Under a contract with CH2M Hill Hanford Group, Inc., PNNL has performed a review of the NDE technology and methods for examination of the concrete dome structure of Hanford’s double-shell tanks. The objective was to provide a matrix of methodologies that could be evaluated based on applicability, ease of deployment, and results that could provide information that could be used in the ongoing structural analysis of the tank dome. PNNL performed a technology evaluation with the objective of providing a critical literature review for all applicable technologies based on constraints provided by CH2M HILL. These constraints were not mandatory, but were desired. These constraints included performing the evaluation without removing any soil from the top of the tank, or if necessary, requesting that the hole diameter needed to gain access to evaluate the top of the tank structure to be no greater than approximately 12-in. in diameter. PNNL did not address the details of statistical sampling requirements as they depend on an unspecified risk tolerance. PNNL considered these during the technology evaluation and have reported the results in the remainder of this document. Many of the basic approaches to concrete inspection that were reviewed in previous efforts are still in use. These include electromagnetic, acoustic, radiographic, etc. The primary improvements in these tools have focused on providing quantitative image reconstruction, thus providing inspectors and analysts with three-dimensional data sets that allow for operator visualization of relevant abnormalities and analytical integration into structural performance models. Available instruments, such as radar used for bridge deck inspections, rely on post-processing algorithms and do not provide real-time visualization. Commercially available equipment only provides qualitative indications of relative concrete damage. It cannot be used as direct input for structural analysis to assess fitness for use and if

  4. Enhanced/Synthetic Vision and Head-Worn Display Technologies for Terminal Maneuvering Area NextGen Operations

    Science.gov (United States)

    Arthur, Jarvis J., III; Prinzell, Lawrence J.; Williams, Steven P.; Bailey, Randall E.; Shelton, Kevin J.; Norman, R. Mike

    2011-01-01

    NASA is researching innovative technologies for the Next Generation Air Transportation System (NextGen) to provide a "Better-Than-Visual" (BTV) capability as adjunct to "Equivalent Visual Operations" (EVO); that is, airport throughputs equivalent to that normally achieved during Visual Flight Rules (VFR) operations rates with equivalent and better safety in all weather and visibility conditions including Instrument Meteorological Conditions (IMC). These new technologies build on proven flight deck systems and leverage synthetic and enhanced vision systems. Two piloted simulation studies were conducted to access the use of a Head-Worn Display (HWD) with head tracking for synthetic and enhanced vision systems concepts. The first experiment evaluated the use a HWD for equivalent visual operations to San Francisco International Airport (airport identifier: KSFO) compared to a visual concept and a head-down display concept. A second experiment evaluated symbology variations under different visibility conditions using a HWD during taxi operations at Chicago O'Hare airport (airport identifier: KORD). Two experiments were conducted, one in a simulated San Francisco airport (KSFO) approach operation and the other, in simulated Chicago O'Hare surface operations, evaluating enhanced/synthetic vision and head-worn display technologies for NextGen operations. While flying a closely-spaced parallel approach to KSFO, pilots rated the HWD, under low-visibility conditions, equivalent to the out-the-window condition, under unlimited visibility, in terms of situational awareness (SA) and mental workload compared to a head-down enhanced vision system. There were no differences between the 3 display concepts in terms of traffic spacing and distance and the pilot decision-making to land or go-around. For the KORD experiment, the visibility condition was not a factor in pilot's rating of clutter effects from symbology. Several concepts for enhanced implementations of an unlimited field

  5. Visual inspection technology of the narrow and small confined area for monitoring feederpipe support of pressure tube in calandria reactor

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Jae Wan; Lee, Nam Ho; Choi, Young Soo [Korea Atomic Energy Research Institute, Taejon (Korea)

    1999-12-01

    There are 760 feederpipes, which they are connected to inlet/outlet of the 380 pressure tube channels on the front of the calandria, in CANDU-type Reactor of Wolsung Nuclear Power Plant. As an ISI(In-Service Inspection) and PSI (Post-Service Inspection) requirements, maintenance activities of measuring the thickness of curvilinear part of feederpipe and inspecting the feederpipe support area within calandria are needed to ensure continued reliable operation of nuclear power plant. And ultrasonic probe is used to measure the thickness of curvilinear part of feederpipe, however workers are exposed to radioactivity irradiation during the measurement period. But, it is exposed to radioactivity irradiation during the measurement period. But, it is impossible to inspect feederpipe support area thoroughly because of narrow and confined accessibility, that is , an inspection space between the pressure tube channels is less than 100 mm and pipes in feederpipe support area are congested. And also, workers involved in inspecting feederpipe support area are under the jeopardy of high-level radiation exposure. Concerns about sliding home, which make the move of feederpipe connected to pressure tube channel smooth as pressure tube expands and contracts in its axial direction, stuck to feedeerpipe support and some of the structural components have made necessary the development of video inspection probe system with narrow and confined accessibility to observe and inspect feederpipe support area more close. Using video inspection probe system, it is possible to inspect and repair abnormality of feederpipe support connected to pressure tube channels of the calandria more accurate and quantative than naked eye. Therefore, that will do much for ensuring safety of CANDU-type nuclear power plant. 45 figs.,31 tabs. (Author)

  6. Momordica charantia L. Cultivation Technology of Yinchuan Area%银川地区苦瓜栽培技术

    Institute of Scientific and Technical Information of China (English)

    杨素萍

    2012-01-01

    从品种选择、播种育苗、整地施肥、合理密植、水肥管理、整枝拉蔓、病虫害防治等方面介绍了银川地区苦瓜栽培技术。%The paper summarized the cultivation technology of Momordica charantia L, in aspects of variety selection, sowing and seedling raising, soil preparation and fertilization, rational close planting, irrigation and fertilizer management, pruning and vine-pulling and pest control.

  7. Demonstration of Advanced Geophysics and Classification Technologies on Munitions Response Sites, Pole Mountain Target and Maneuver Area, Wyoming

    Science.gov (United States)

    2012-03-01

    TECHNOLOGY A Geonics EM61-MK2, paired with a Trimble R8 Real Time Kinetic ( RTK ) Global Positioning System ( GPS ), was used to conduct the DGM survey over...EM61-MK2, paired with a Trimble R8 RTK GPS , and an Allegro CX field computer. The EM61-MK2 system consisted of a 1.0 m by 0.5 m coil containing...point data spacing measured using EM61-MK2 and RTK GPS point positioning.  Data Requirements: Mapped production survey data.  Success Criteria

  8. Evaluation of project based learning in the area of manufacturing and statistics in the degree of industrial technology

    Directory of Open Access Journals (Sweden)

    Irene Buj-Corral

    2015-06-01

    Full Text Available In the subject Project I in the second year of the Degree in Industrial Technology Engineering taught at the School of Industrial Engineering of Barcelona (ETSEIB, groups of 3-4 students develop a project along a semester. Results of 2 projects are presented related to manufacturing, measurement of parts and the statistical treatment of data, placing emphasis on cross-curricular issues, recording of oral presentations and how this helped improving its quality, as well as evaluation of the subject by the students by means of questionnaires and open-ended questions.

  9. Wireless Technology Use Case Requirement Analysis for Future Space Applications

    Science.gov (United States)

    Abedi, Ali; Wilkerson, DeLisa

    2016-01-01

    This report presents various use case scenarios for wireless technology -including radio frequency (RF), optical, and acoustic- and studies requirements and boundary conditions in each scenario. The results of this study can be used to prioritize technology evaluation and development and in the long run help in development of a roadmap for future use of wireless technology. The presented scenarios cover the following application areas: (i) Space Vehicles (manned/unmanned), (ii) Satellites and Payloads, (iii) Surface Explorations, (iv) Ground Systems, and (v) Habitats. The requirement analysis covers two parallel set of conditions. The first set includes the environmental conditions such as temperature, radiation, noise/interference, wireless channel characteristics and accessibility. The second set of requirements are dictated by the application and may include parameters such as latency, throughput (effective data rate), error tolerance, and reliability. This report provides a comprehensive overview of all requirements from both perspectives and details their effects on wireless system reliability and network design. Application area examples are based on 2015 NASA Technology roadmap with specific focus on technology areas: TA 2.4, 3.3, 5.2, 5.5, 6.4, 7.4, and 10.4 sections that might benefit from wireless technology.

  10. Benefits of agricultural technology innovation capacity to peasant farmers in rural poor areas: The case of DBN-Group, China

    Directory of Open Access Journals (Sweden)

    Mathias Agri Eneji

    2012-09-01

    Full Text Available DaBeiNong (DBN Technology Group Co Ltd is a private enterprise, at the cutting edge of the agricultural high-tech industry in China. It has developed its innovative capabilities through Research and Development (R&D activities, skilled R&D personnel, new products, services, processes and markets. This study contributes to knowledge by identifying and constructing a model of the enterprise innovation capacity; the inputs and outputs of innovation in DBN and 9 other agricultural high-tech enterprises in China. We analyzed the enterprise technology innovation capacity and offered recommendations. Two sets of questionnaires were used; for the peasant farmers, and for the agricultural enterprises. We used the rank factors on an ordinal scale and simple percentages. We used econometric model to analyze seven factors of agricultural enterprise innovation capacity. The results show that R&D is strategic to Agricultural Enterprise Innovation Capacity (AETIC. However, the benefits to the peasant farmers need to be further intensified, and stepped up from its present average level. We found that enterprises with higher capital and larger sales have more R&D investment than those with smaller sales. Promoting agricultural research and rural development is crucial to pro-poor growth, given the potential for smallholder agriculture to rapidly absorb and adopt innovations.

  11. High-precision geologic mapping to evaluate the potential for seismic surface rupture at TA-55, Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, J.N.; Lavine, A.; Vaniman, D.; WoldeGabriel, G.

    1998-06-01

    In this report the authors document results of high-precision geologic mapping in the vicinity of TA-55 that has been done to identify parts of the southern portion of the Rendija Canyon Fault, or any other faults, with the potential for seismic surface rupture. To assess the potential for surface rupture at TA-55, an area of approximately 3 square miles that includes the Los Alamos County Landfill and Twomile, Mortandad, and Sandia Canyons has been mapped in detail. Map units are mostly cooling or flow units within the Tshirege Member (1.2 Ma) of the Bandelier Tuff. Stratigraphic markers that are useful for determining offsets in the map area include a distinct welding break at or near the cooling Unit 2-Unit 3 contact, and the Unit 3-Unit 4 contact. At the County Landfill the contact between the Tshirege Member of the Bandelier Tuff and overlying Quaternary alluvium has also been mapped. The mapping indicates that there is no faulting in the near-surface directly below TA-55, and that the closest fault is about 1500 feet west of the Plutonium Facility. Faulting is more abundant on the western edge of the map area, west of TA-48 in uppermost Mortandad Canyon, upper Sandia Canyon, and at the County Landfill. Measured vertical offsets on the faults range from 1 to 8 feet on mapped Bandelier Tuff contacts. Faulting exposed at the Los Alamos County Landfill has deformed a zone over 1000 feet wide, and has a net vertical down-to-the-west displacement of at least 15 feet in the Bandelier Tuff. Individual faults at the landfill have from less than 1 foot to greater than 15 feet of vertical offset on the Bandelier Tuff. Most faults in the landfill trend N-S, N20W, or N45E. Results of the mapping indicate that the Rendija Canyon Fault does not continue directly south to TA-55. At present, the authors have insufficient data to connect faulting they have mapped to areas of known faulting to the north or south of the study area.

  12. Combined experimental and theoretical assessments of the lattice dynamics and optoelectronics of TaON and Ta{sub 3}N{sub 5}

    Energy Technology Data Exchange (ETDEWEB)

    Nurlaela, Ela; Harb, Moussab [Division of Physical Sciences and Engineering, KAUST Catalysis Center (KCC), King Abdullah University of Science and Technology (KAUST), 4700 KAUST, Thuwal 23955-6900 Saudi Arabia (Saudi Arabia); Gobbo, Silvano del [Solar and Photovoltaic Engineering Center, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); Vashishta, Manish [Division of Physical Sciences and Engineering, KAUST Catalysis Center (KCC), King Abdullah University of Science and Technology (KAUST), 4700 KAUST, Thuwal 23955-6900 Saudi Arabia (Saudi Arabia); Takanabe, Kazuhiro, E-mail: kazuhiro.takanabe@kaust.edu.sa [Division of Physical Sciences and Engineering, KAUST Catalysis Center (KCC), King Abdullah University of Science and Technology (KAUST), 4700 KAUST, Thuwal 23955-6900 Saudi Arabia (Saudi Arabia)

    2015-09-15

    Presented herein is a detailed discussion of the properties of the lattice dynamic and optoelectronic properties of tantalum(V) oxynitride (TaON) and tantalum(V) nitride (Ta{sub 3}N{sub 5}), from experimental and theoretical standpoint. The active Raman and infra red (IR) frequencies of TaON and Ta{sub 3}N{sub 5} were measured using confocal Raman and Fourier Transform Infrared spectroscopies (FTIR) and calculated using the linear response method within the density functional perturbation theory (DFPT). The detailed study leads to an exhaustive description of the spectra, including the symmetry of the vibrational modes. Electronic structures of these materials were computed using DFT within the range-separated hybrid HSE06 exchange–correlation formalism. Electronic and ionic contributions to the dielectric constant tensors of these materials were obtained from DFPT within the linear response method using the PBE functional. Furthermore, effective mass of photogenerated holes and electrons at the band edges of these compounds were computed from the electronic band structure obtained at the DFT/HSE06 level of theory. The results suggest that anisotropic nature in TaON and Ta{sub 3}N{sub 5} is present in terms of dielectric constant and effective masses. - Graphical abstract: Detailed investigation has been conducted from combined experimental and theoretical approaches on Raman and IR spectroscopies, electronic structures, dielectric constants and effective masses of TaON and Ta{sub 3}N{sub 5}. - Highlights: • Crystal structures of TaON and Ta{sub 3}N{sub 5} are discussed based on XRD and DFT calculation. • Raman and IR spectra of TaON and Ta{sub 3}N{sub 5} materials are measured and computed by DFPT method. • Optoelectronic properties of TaON and Ta{sub 3}N{sub 5} are discussed. • Dielectric constant and effective masses of TaON and Ta{sub 3}N{sub 5} are calculated.

  13. Ultrafast magnetization and structural dynamics in the intercalated transition metal dichalcogenides Fe0.25TaS2 and Mn0.25TaS2.

    Science.gov (United States)

    Liu, Q; Zhu, X D; Wang, L H; Cheong, S-W; Tobey, R I

    2016-05-18

    We measure magnetization and structural dynamics in two intercalant-ordered transition metal dichalcogenides: Fe0.25TaS2 and Mn0.25TaS2. The structurally equivalent materials allow us to probe the effect of orbital angular momentum which is active in Fe0.25TaS2 and absent in Mn0.25TaS2. Interestingly, we find that the magnetooptics dynamics are nearly indistinguishable in these two materials, in contradiction to conventional explanations of a spin-lattice mechanism. We compare our results to other materials where spin-lattice demagnetization has been put forth as a demagnetization channel.

  14. 沂蒙山区石榴繁育技术%Reproductive Technology of Pomegranate in Yimeng Mountain Area

    Institute of Scientific and Technical Information of China (English)

    史立华

    2014-01-01

    石榴中富含碳水化合物和微量元素,有较高的药用价值。通过研究沂蒙山石榴的扦插、防治病虫害等技术措施,为沂蒙山石榴种植提供一定的理论指导。%Pomegranate is rich in carbohydrates and trace elements,and has high medicinal value. The technical measures of pomegranate in Yimeng Mountain area were studied,such as cutting,disease and pest control etc,so as to provide certain theoretical guidance for pomegranate cultivation in Yimeng Mountain area.

  15. Evaluation of Particle Counter Technology for Detection of Fuel Contamination Detection Utilizing Advanced Aviation Forward Area Refueling System

    Science.gov (United States)

    2014-01-24

    UNCLASSIFIED 6 UNCLASSIFIED Receipt Vehicle Fuel Tank Fuel Injector Aviation Fuel DEF (AUST) 5695B 18/16/13 Parker 18/16/13 14/10/7 Pamas... Alcohol to Jet (ATJ) fuel flight testing at Redstone Test Center, TARDEC was afforded the opportunity to evaluate light obscuration particle counters on...Advanced Aviation Forward Area Refueling System (AAFARS) setup for Alcohol to Jet (ATJ) fuel flight testing. Figure 2. AAFARS fuel sampling port

  16. Shock Hugoniot measurements on Ta to 0. 78 TPa

    Energy Technology Data Exchange (ETDEWEB)

    Froeschner, K.E.; Lee, R.S.; Chau, H.H.; Weingart, R.C.

    1983-08-18

    Symmetric impact shock Hugoniot measurements have been made on Ta with an electrically exploded foil gun system. The results obtained to date for the Hugoniot of Ta cover the range 0.19 to 0.78 TPa (impact velocities from 4.0 to 9.7 km/s) and agree with data obtained by other researchers to within 2.7% rms. Recent improvements in the system include electromagnetic shielding of impactor and target, continuous measurement of impactor velocity with a Fabry-Perot interferometer and computer-aided analysis of shot film. Conservative extrapolation from current operating conditions indicate that pressures of 1.1 to 1.5 TPa could be achieved with little difficulty.

  17. Ordering Effects in NbC and TaC

    Science.gov (United States)

    Venables, J. D.; Meyerhoff, M. H.

    1972-01-01

    By means of transmission electron microscopy and electron diffraction, evidence has been obtained for the existence of long range carbon atom ordering in single-crystal niobium carbide that has a carbon-to-metal ratio close to the integral composition Nb6C5. The ordering, which gives rise to superlattice and domain structures similar to those observed in V6C5, appears, however, only in samples that have been cooled slowly through the order-disorder temperature of 1025 C. In TaC of similar composition, the ordering, although present, remains very imperfect even after the crystals are subjected to the same thermal treatment. The results are interpreted in terms of the electronic structure of the transition metal carbides as it is currently understood, and their relevance to the mechanical properties of NbC and TaC are discussed.

  18. Construction and Identification of Plasmid pTA-TUB2

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    An about 1.40 Kb target gene fragment was yielded by PCR amplification with the plasmid pRB 129,which was identified by restriction enzyme digestion that the PCR product was TU B2 gene.The gene was digested by the restriction enzyme and was linked with pTA plasmid to construct pTA-TU B2 plasmid.The plasmid was transformed into Chaetomium spp.by PEG method and the transformation rate was 27/(2×105) and it is nine times higher than that of pRB 129.The transformants can grow on the PDA containing 1 000 μg*mL-1 carbendazim,which is 1 000 times higher than the original Chaetomium spp.The resistance was stable after 10 times transfer on non-selective medium.

  19. CoTaZr/Pd multilayer with perpendicular magnetic anisotropy

    Directory of Open Access Journals (Sweden)

    Yong Chang Lau

    2013-08-01

    Full Text Available We report a novel perpendicularly magnetized thin film [Co91.5Ta4.5Zr4/Pd]5 multilayer, which exhibits strong perpendicular magnetic anisotropy when grown on 5 nm of Pd and Ru seed layers. The Pd-seeded multilayer annealed at 300 °C shows an effective uniaxial anisotropy constant, Keff = 1.1 MJ m−3, with an anisotropy field as high as 1.6 T. The perpendicular anisotropy is sustained on annealing at 400 °C for 1 h. X-ray diffraction on multilayers with 30 repeats suggests that the use of amorphous CoTaZr reduces the stress of the stack, compared to [Co/Pd] multilayer.

  20. Satellite imagery technology in public health: analysis of site catchment areas for assessment of poliovirus circulation in Nigeria and Niger.

    Science.gov (United States)

    Takane, Marina; Yabe, Shizu; Tateshita, Yumiko; Kobayashi, Yusuke; Hino, Akihiko; Isono, Kazuo; Okayasu, Hiromasa; Diop, Ousmane M; Tadono, Takeo

    2016-11-21

    Environmental surveillance supplements the surveillance of acute flaccid paralysis by monitoring wastewater for poliovirus circulation. Building on previous work, we analysed wastewater flow to optimise selection and placement of sampling sites with higher digital surface model (DSM) resolution. The newly developed 5-m mesh DSM from the panchromatic, remote-sensing instruments for stereo mapping on-board the Japanese advanced land observing satellite was used to estimate catchment areas and flow of sewage water based on terrain topography. Optimal sampling sites for environmental surveillance were identified to maximise sensitivity to poliovirus circulation. Population data were overlaid to prioritise selection of catchment areas with dense populations. The results for Kano City, Nigeria were compared with an analysis based on existing 30- and 90-m mesh digital elevation model (DEM). Analysis based on 5-m mesh DSM was also conducted for three cities in Niger to prioritise the selection of new sites. The analysis demonstrated the feasibility of using DSMs to estimate catchment areas and population size for programme planning and outbreak response with respect to polio. Alternative sampling points in Kano City that would cover a greater population size have been identified and potential sampling sites in Niger are proposed. Comparison with lower-resolution DEMs suggests that the use of a 5-m mesh DSMs would be useful where the terrain is flat or includes small-scale topographic changes not captured by 30-m data searches.

  1. Due testimonianze di Josip Vaništa

    Directory of Open Access Journals (Sweden)

    Radmila Iva Janković

    2013-12-01

    Full Text Available Radmila Iva Janković ha intervistato nel luglio 2013 Josip Vaništa, artista che aveva partecipato al gruppo Gorgona e preso parte alla residenza d'artista a Brunnenburg nel 1991, organizzata da Francesco Conz con l'obiettivo di includere il gruppo di artisti nel progetto La Livre, una monumentale edizione d'artista dedicata a Ezra Pound.

  2. TaN resistor process development and integration.

    Energy Technology Data Exchange (ETDEWEB)

    Romero, Kathleen (LMATA, Albuquerque, NM); Martinez, Marino John; Clevenger, Jascinda; Austin, Franklin H., IV (, LMATA, Albuquerque, NM); Sullivan, Charles Thomas; Wolfley, Steven L.; Patrizi, Gary A.; Vigil, Pablita S. (LMATA, Albuquerque, NM); Grine, Alejandro J.

    2010-05-01

    This paper describes the development and implementation of an integrated resistor process based on reactively sputtered tantalum nitride. Image reversal lithography was shown to be a superior method for liftoff patterning of these films. The results of a response surface DOE for the sputter deposition of the films are discussed. Several approaches to stabilization baking were examined and the advantages of the hot plate method are shown. In support of a new capability to produce special-purpose HBT-based Small-Scale Integrated Circuits (SSICs), we developed our existing TaN resistor process, designed for research prototyping, into one with greater maturity and robustness. Included in this work was the migration of our TaN deposition process from a research-oriented tool to a tool more suitable for production. Also included was implementation and optimization of a liftoff process for the sputtered TaN to avoid the complicating effects of subtractive etching over potentially sensitive surfaces. Finally, the method and conditions for stabilization baking of the resistors was experimentally determined to complete the full implementation of the resistor module. Much of the work to be described involves the migration between sputter deposition tools - from a Kurt J. Lesker CMS-18 to a Denton Discovery 550. Though they use nominally the same deposition technique (reactive sputtering of Ta with N{sup +} in a RF-excited Ar plasma), they differ substantially in their design and produce clearly different results in terms of resistivity, conformity of the film and the difference between as-deposited and stabilized films. We will describe the design of and results from the design of experiments (DOE)-based method of process optimization on the new tool and compare this to what had been used on the old tool.

  3. TA53:19 Reverb Chamber Quick-Look

    Energy Technology Data Exchange (ETDEWEB)

    Bishofberger, Kip A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-05-19

    Within Building 19 of TA-53, a screen room has been evaluated for use as a reverb chamber (with deep gratitude to Dale Dalmas and Greg Dale for their assistance). With minimal additional sealing of the chamber, we expect the Q to increase even more, and thus field levels for the same RF source power. Future studies need to determine leakage field levels, which will define maximum achievable field levels.

  4. Proton induced fission of 181-Ta at relativistic energies

    CERN Document Server

    Ayyad, Y; Casarejos, E; Álvarez-Pol, H; Bacquias, A; Boudard, A; Caamaño, M; Enqvist, T; Föhr, V; Kelić-Heil, A; Kezzar, K; Leray, S; Paradela, C; Pérez-Loureiro, D; Pleskač, R; Tarrío, D

    2012-01-01

    Total fission cross sections of 181-Ta induced by protons at different relativistic energies have been measured at GSI, Darmstadt. The inverse kinematics technique used together with a dedicated set-up, made it possible to determine these cross sections with high accuracy. The new data obtained in this experiment will contribute to the understanding of the fission process at high excitation energies. The results are compared with data from previous experiments and systematics for proton-induced fission cross sections.

  5. Dolphin Watching in the Southern Tañon Strait Protected Seascape, Philippines: Issues and Challenges

    Directory of Open Access Journals (Sweden)

    Lemnuel V. Aragones

    2013-12-01

    Full Text Available Dolphin watching is a growing economic activity in the southern Tañon Strait Protected Seascape (TSPS, the Philippines, an area that is also heavily exploited by fisheries. In order to examine the issues and challenges in this growing industry, we monitored relevant information regarding cetacean watching, conducted focus group discussions (FGDs and educational seminar-workshops for various local stakeholders from 2004 to 2006, and followed these up from 2008-2012. From 9 May to 16 August 2004, we conducted structured interviews to determine the perceptions of cetacean-watching tourists (CWTs and assess the level of local knowledge of f ishers and non-fishers (NFs regarding marine mammals and environmental management in this area. Ninety f ive (95 CWTs, 100 local fishers, and 64 NFs were interviewed. Sixty seven percent (n=64 of the CWTs believed that the overall quality of tours was impressive primarily because they were able to watch, at reasonable costs, large groups of dolphins in close proximity and in an almost pristine environment. The majority of CWTs (~91% felt that there is a need to develop a ‘Special Management Plan’ (SMP for the southern TSPS focusing on cetaceans and their habitats. The increasing number of dolphin watching boats, heavy exploitation of f ishing ground, misperception of local f ishers that cetaceans are competitors with f isheries, and lack of a SMP or a Management Plan per se for TSPS warranted the facilitation of a participatory management process to protect the cetaceans and their habitats.This study has shown that even with only preliminary results, survey interviews of key stakeholders in combination with FGDs and seminar-workshop could be critical in facilitating a participatory management process. In the case of the TSPS, this par ticipatory approach led to the formation of the Tañon Strait Association of Dolphin and Whale Watching Operators, Inc. (TaSADoWWI, and eventual development of cetacean

  6. MCrA1Y/TaC Metal Matrix Composite Coatings Produced by Electrospark Deposition

    Institute of Scientific and Technical Information of China (English)

    Yujiang XIE; Yanhong YANG; Mingsheng WANG; Jian HOU

    2013-01-01

    MCrAlY/TaC metal matrix composite coatings with 10,20 and 30 wt.% TaC have been successfully produced by electrospark deposition (ESD).The effects of TaC content on microstructure,hardness and oxidation behavior of the composite coatings were studied.The results showed that the composite coatings were composed of superfine γ columnar dendrite and large TaC particles dispersedly distributed.The hardness was enhanced but oxidation resistance of the composite coatings was reduced with increasing TaC contents.

  7. Empirical Performance Evaluation of Enhanced Throughput Schemes of IEEE802.11 Technology in Wireless Area Networks

    Directory of Open Access Journals (Sweden)

    Femi-Jemilohun Oladunni.Juliet

    2013-08-01

    Full Text Available The success in the growing wireless standards can be measured by the achievement of quality of service(QoS specifications by the designers. The IEEE802.11 wireless standards are widely accepted as wirelesstechnology for wireless LAN. Efforts have been made over the years by the task group to provide adequatenumber of QoS enhancement schemes for the increasing numbers of multimedia applications. This paperexamines the empirical performances of ad hoc wireless networks deployed on IEEE802.11 standardvariants. A survey to some of the QoS schemes incorporated in IEEE802.11 wireless PHY layers werecarried out. Then the effects of this enhancement schemes in relation to data throughput and systemcapacity and reliability in the newest technology deployed on IEEE802.11ac standards was investigatedusing real time applications and simulation based approaches.

  8. A simulation study of TaMAC protocol using network simulator 2.

    Science.gov (United States)

    Ullah, Sana; Kwak, Kyung Sup

    2012-10-01

    A Wireless Body Area Network (WBAN) is expected to play a significant role in future healthcare system. It interconnects low-cost and intelligent sensor nodes in, on, or around a human body to serve a variety of medical applications. It can be used to diagnose and treat patients with chronic diseases such as hypertensions, diabetes, and cardiovascular diseases. The lightweight sensor nodes integrated in WBAN require low-power operation, which can be achieved using different optimization techniques. We introduce a Traffic-adaptive MAC protocol (TaMAC) for WBAN that supports dual wakeup mechanisms for normal, emergency, and on-demand traffic. In this letter, the TaMAC protocol is simulated using a well-known Network Simulator 2 (NS-2). The problem of multiple emergency nodes is solved using both wakeup radio and CSMA/CA protocol. The power consumption, delay, and throughput performance are closely compared with beacon-enabled IEEE 802.15.4 MAC protocol using extensive simulations.

  9. Alkane metathesis with the tantalum methylidene [(≡SiO)Ta(=CH2)Me2]/[(≡SiO)2Ta(=CH2)Me] generated from well-defined surface organometallic complex [(≡SiO)TaVMe4

    KAUST Repository

    Chen, Yin

    2015-01-21

    By grafting TaMe5 on Aerosil700, a stable, well-defined, silica-supported tetramethyl tantalum(V) complex, [(≡SiO)TaMe4], is obtained on the silica surface. After thermal treatment at 150 °C, the complex is transformed into two surface tantalum methylidenes, [(≡SiO)2Ta(=CH2)Me] and [(≡SiO)Ta(=CH2)Me2], which are active in alkane metathesis and comparable to the previously reported [(≡SiO)2TaHx]. Here we present the first experimental study to isolate and identify a surface tantalum carbene as the intermediate in alkane metathesis. A systematic experimental study reveals a new reasonable pathway for this reaction.

  10. Diffusion barrier performance of nanoscale TaNx thin-film

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    TaNx nanoscale thin-films and Cu/TaNx multilayer structures were deposited on P-type Si(100) substrates by DC reactive magnetron sputtering. The characteristics of TaNx films and thermal stabilities of Cu/TaNx/Si systems annealed at various temperatures were studied by four-point probe(FPP) sheet resistance measurement, atomic force microscopy(AFM), scanning electron microscope-energy dispersive spectrum (SEM-EDS), Alpha-Step IQ Profilers and X-ray diffraction(XRD), respectively. The results show that the surfaces of deposited TaNx thin-films are smooth. With the increasing of N2 partial pressure, the deposition rate and root-mean-square(RMS) decrease, while the content of N and sheet resistance of the TaNx thin-films increase, and the diffusion barrier properties of TaNx thin-films is improved. TaN1.09 can prevent interdiffusion between Cu and Si effectively after annealing up to 650 ℃ for 60 s. The failure of TaNx is mainly attributed to the formation of Cu3Si on TaN/Si interface, which results from Cu diffusion along the grain boundaries of polycrystalline TaN.

  11. Properties and Technology for Quasi-Composite Blanket Using Natural Reinforcement of the Metal by Strain Affected Areas

    Directory of Open Access Journals (Sweden)

    A. Kirichek

    2013-12-01

    Full Text Available Techniques for making materials with advanced performance attributes at the expense of blanket heterogeneous strengthening are considered. A new trend is defined in a multiple increase of performance attributes in metal materials by natural reinforcement with nanostructural and ultra-fine-grained fragments. The application of a wave strain hardening technique is substantiated for obtaining a heterogeneous structure in wide-area listed full-size products including bulky ones. A high carrying capacity of heavy-loaded material with a deep-strengthened blanket is determined.

  12. Growth and Holographic Storage Properties of Fe:LiTaO3 Crystal

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Using Si-Mo bar as heater and doping Fe2O3 in LiTaO3, Fe∶LiTaO3 crystal was grown by Czochralski method. The curie temperature of the crystal was measured by thermal analyze method. The lattice constants of the crystal were calculated by measuring of X-ray spectra. The response time, exponential gain coefficient and diffraction efficiency of Fe:LiTaO3 were obtained by two wave coupled technique. Compared with Fe∶LiNbO3, the response time of Fe:LiTaO3 is six times shorter, the storage time of Fe:LiTaO3 is ten times longer and the photo scattering resistance ability of Fe:LiTaO3 is four times higher. Fe:LiTaO3 is an excellent holographic storage material.

  13. Synthesis and Optical Properties of NuTaN2: Potential Solar Cell Applications

    Energy Technology Data Exchange (ETDEWEB)

    Yang, M.; Zakutayev, A.; Zhang, X.; Ginley, D.; DiSalvo, F.

    2013-01-01

    Layered CuTaN2 was synthesized by an ion exchange reaction of CuI and NaTaN2 as previously reported. Based on the results of EDX analysis, the Cu:Ta ratio of the CuTaN2 sample was 1:1 within the overall errors when examining powders of +/-10% and no Na was detected. The crystal structure and thermal stability of CuTaN2 was accurately determined by Rietveld analysis of the powder X-ray Diffraction profile and by TGA analysis, respectively. CuTaN2 crystallizes in a rhombohedral structure with space group R-3mH as shown in [figure 1]. CuTaN2 possesses a band gap of 1.53(x) eV, which is in reasonable agreement with density functional theory calculations of Cu containing nitrides. Similar materials may be even better suited for solar cell application.

  14. The suitability of large area drift chambers as the technology choice for the Cosmic Ray Inspection and Passive Tomography (CRIPT) project

    Energy Technology Data Exchange (ETDEWEB)

    Anghel, V. [Atomic Energy Canada Ltd., Chalk River, ON K0J 1J0 (Canada); Armitage, J. [Carleton Univ., Ottawa, ON (Canada); Botte, J.; Boudjemline, K. [Carleton Univ., Ottawa, ON (Canada); Bryman, D.; Bueno, J. [Advanced Applied Physics Solutions, Vancouver, BC (Canada); Charles, E. [Canadian Border Services Agency, Ottawa, ON K1A 0L8 (Canada); Cousins, T. [International Safety Research, Ottawa, ON K2E 7J6 (Canada); Erlandson, A. [Carleton Univ., Ottawa, ON (Canada); Gallant, G. [Canadian Border Services Agency, Ottawa, ON K1A 0L8 (Canada); Jewett, C.; Jonkmans, G. [Atomic Energy Canada Ltd., Chalk River, ON K0J 1J0 (Canada); Liu, Z. [Advanced Applied Physics Solutions, Vancouver, BC (Canada); Noel, S. [International Safety Research, Ottawa, ON K2E 7J6 (Canada); Oakham, F. G. [Carleton Univ., Ottawa, ON (Canada); Stocki, T. J. [Health Canada, Ottawa, ON K1A 0K9 (Canada); Thompson, M. [Atomic Energy Canada Ltd., Chalk River, ON K0J 1J0 (Canada); Waller, D. [Defence Research Development Canada, Ottawa, ON K1A 0Z4 (Canada)

    2011-07-01

    The CRIPT project brings together several Canadian institutions, concerned with the detection of Special Nuclear Materials (SNM), addressing a requirement at ports-of-entry for detection of SNM in the many thousands of containers that flow into and out of Canada every day, while at the same time providing a way of monitoring the contents of nuclear waste storage containers, for waste management and non-proliferation reasons. The scale of these applications is large - typically tens of cubic metres, requiring detectors that can cover a large area at a minimum cost. The CRIPT project considered drift chambers adapted from high energy physics experience, as one of its technology choices. We report here on the performance of a full scale prototype, which covers an area of 2.4 m x 1.2 m with only 6 readout channels, and provides a 2D data point with accuracies (in x and z) of around 2 mm. (authors)

  15. Independent mis-splicing mutations in TaPHS1 causing loss of preharvest sprouting (PHS) resistance during wheat domestication.

    Science.gov (United States)

    Liu, Shubing; Sehgal, Sunish K; Lin, Meng; Li, Jiarui; Trick, Harold N; Gill, Bikram S; Bai, Guihua

    2015-11-01

    Preharvest sprouting (PHS) is one of the major constraints of wheat production in areas where prolonged rainfall occurs during harvest. TaPHS1 is a gene that regulates PHS resistance on chromosome 3A of wheat, and two causal mutations in the positions +646 and +666 of the TaPHS1 coding region result in wheat PHS susceptibility. Three competitive allele-specific PCR (KASP) markers were developed based on the two mutations in the coding region and one in the promoter region and validated in 82 wheat cultivars with known genotypes. These markers can be used to transfer TaPHS1 in breeding through marker-assisted selection. Screening of 327 accessions of wheat A genome progenitors using the three KASP markers identified different haplotypes in both diploid and tetraploid wheats. Only one Triticum monococcum accession, however, carries both causal mutations in the TaPHS1 coding region and shows PHS susceptibility. Five of 249 common wheat landraces collected from the Fertile Crescent and surrounding areas carried the mutation (C) in the promoter (-222), and one landrace carries both the causal mutations in the TaPHS1 coding region, indicating that the mis-splicing (+646) mutation occurred during common wheat domestication. PHS assay of wheat progenitor accessions demonstrated that the wild-types were highly PHS-resistant, whereas the domesticated type showed increased PHS susceptibility. The mis-splicing TaPHS1 mutation for PHS susceptibility was involved in wheat domestication and might arise independently between T. monococcum and Triticum aestivum. No claim to original US government works New Phytologist © 2015 New Phytologist Trust.

  16. Preparasi dan karakterisasi fotokatalis NaTaO3 didoping ion lantanum (La/NaTaO3 dengan metode sol-gel

    Directory of Open Access Journals (Sweden)

    Husni Husin

    2011-12-01

    Full Text Available Crystalline sodium tantalate doped with La3+ ions (La/NaTaO3 has been successfully synthesized by sol-gel technique. The photocatalysts have been prepared by mixing of TaCl5, NaOH, and La(NO33.2H2O in the aqueous solution of H2O2. The resulting materials are characterized by X-ray diffraction (XRD, Brunauer-Emmett-Teller (BET, and transmission electron microscopy (TEM to provide useful information about crystallinity and morphology. All samples are exactly indexed as the pure NaTaO3 orthorhombic structure with the space group Pcmn. The XRD spectra displayed a single-phase NaTaO3 structure without any impurity phase, suggesting that lanthanum is uniformly incorporated into the NaTaO3 lattice. TEM images indicates that the particle sizes of the La-doped NaTaO3 powders are approximately 30-80 nm, while the particle sizes of the non-doped NaTaO3 are around 80-250 nm. Doping lanthanum in the NaTaO3 is able to prevent agglomeration, result in particle size, and better crystallinity. The La/NaTaO3 crystal structures reveal that a certain amount of lattice distortion due to the La3+ ions occupying the Na+ sites results in the increase of crystallite size. Powder formation mechanisms for both non-doped NaTaO3 and La-doped NaTaO3 are proposed based on the experimental results. Keywords: La-doped sodium tantalum oxide, photocatalyst, sol-gel, perovskite, orthorhombic

  17. Gold nanoparticles embedded in Ta 2 O 5 /Ta 3 N 5 as active visible-light plasmonic photocatalysts for solar hydrogen evolution

    KAUST Repository

    Luo, Yujing

    2014-07-10

    Here, we demonstrate a new recreating photocatalytic activity of a Nano Au/Ta2O5 composite for hydrogen evolution from water as a visible-light-responsive plasmonic photocatalyst by embedding Au nanoparticles in a Ta2O5 host lattice. The Nano Au/Ta2O 5 composite samples were prepared through a simple Pechini-type sol-gel process. Further nitridating Nano Au/Ta2O5 composite samples in ammonia flow at 1123 K yielded Nano Au/Ta3N 5 composite samples. The obtained Nano Au/Ta3N5 composite exhibited a significantly enhanced photocatalytic activity in the visible region for hydrogen evolution from water compared with blank Ta 3N5 nanoparticles. UV-visible diffuse reflectance spectra and photocatalytic activity measurements indicated that the excitation of surface plasmon resonance of Au nanoparticles is responsible for the new recreating photocatalytic activity of the Nano Au/Ta2O5 composite and significantly enhanced photocatalytic activity of the Nano Au/Ta3N5 composite for hydrogen evolution in the visible region, which might be ascribed to the charge transfer effect in Nano Au/Ta 2O5 composite and the synergetic effect of charge transfer and near-field electromagnetic effect in Nano Au/Ta3N5 composite induced by surface plasmon resonance of embedded Au nanoparticles. The current study could provide a new paradigm for designing plasmonic metal/semiconductor composite systems for photocatalytic, photovoltaic and other optoelectronic devices. © the Partner Organisations 2014.

  18. The geothermal potential of the Campania volcanic district and new heat exchanger technologies for exploitation of highly urbanised areas.

    Science.gov (United States)

    Carlino, S.; Somma, R.; Troiano, A.; Di Giuseppe, M. G.; Troise, C.; De Natale, G.

    2012-04-01

    The geothermal research in Campania region (Italy), started since the 1930, and continued until the '80 by the SAFEN, ENEL and AGIP companies. Such exploration activity highlighted that most of the volcanic districts of the Campania Region have a very high geothermal gradient and heat flow. In particular, inside the Campi Flegrei caldera and at Ischia island the geothermal gradient measured inside the deep wells reaches temperatures above 100° C between few tens and few hundreds of metres of depth, while the heat flow varies between 120-160 mWm-2 at Agnano and Mofete (Campi Flegrei main drill sites) to more than 500 mWm-2 at Ischia island (south-western sector). A general review of the available literature data (temperature at depth, stratigraphic sections, logs etc.) of the deep wells (down to 3 km b.s.l.) allowed us to quantify the geothermal potential (thermal and electric) of such district. The geothermal potential is about 6 GWy for the Campi Flegrei (Mofete and S. Vito sectors) and 11 GWy for the Ischia island (south-western sector) showing a geothermal reservoir with water and vapour dominant respectively. This results in strong potential interest for economic exploitation of the geothermal resource, both in the range of low-medium enthalpy at few hundreds of meters depth and of high enthalpy at depths of 1-2 km. In this study we try to model the effectiveness of new technologies of boreholes heat exchangers, which would allow to avoid fluid withdrawal, then strongly decreasing the environmental impact. The proposed technology consists of a double-pipe placed in a borehole heat exchange that can work coupled with an ORC. The two pipes, one inside the other, are located in the well in order to transfer the thermal energy to the working fluid during the descent in the external pipe and then go back through the internal pipe properly isolated. We propose a complete design of the borehole heat exchangers. The design activity is performed on a theoretical basis

  19. Facile and efficient synthesis of the surface tantalum hydride (≡SiO)2TaIIIH and tris-siloxy tantalum (≡SiO)3TaIII starting from novel tantalum surface species (≡SiO)TaMe4 and (≡SiO)2TaMe 3

    KAUST Repository

    Chen, Yin

    2014-03-10

    By grafting of TaMe5 (1) on the surface of silica partially dehydroxylated at 500 C (silica500), a mixture of (≡SiO)TaMe4 (2a; major, 65 ± 5%) and (≡SiO) 2TaMe3 (2b; minor, 35 ± 5%) was produced, which has been characterized by microanalysis, IR, and SS NMR (1H, 13C, 1H-13C HETCOR, proton double and triple quantum). After grafting, these surface organometallic compounds are more stable than the precursor TaMe5. Treatment of 2a,b with water and H 2 resulted in the formation of methane in amount of 3.6 ± 0.2 and 3.4 ± 0.2 mol/grafted Ta, respectively. 2a,b react with H2 (800 mbar) to form (≡SiO)2TaH. After (≡SiO) 2TaH was heated to 500 C under hydrogen or vacuum, [(≡SiO) 3Ta][≡SiH] was produced, and the structure was confirmed by IR, NMR, and EXAFS. Considering the difficulty of the previous preparation method, these syntheses represent a facile and convenient way to prepare tantalum surface species (≡SiO)2TaH and (≡SiO)3Ta via the intermediate of the new surface organometallic precursors: (≡SiO)TaMe4/(≡SiO)2TaMe3. (≡SiO)2TaH and (≡SiO)3Ta exhibit equal reactivities in alkane metathesis and ethylene polymerization in comparison to those in previous reports. © 2014 American Chemical Society.

  20. Superelastic and shape memory properties of TixNb3Zr2Ta alloys.

    Science.gov (United States)

    Zhu, Yongfeng; Wang, Liqiang; Wang, Minmin; Liu, Zhongtang; Qin, Jining; Zhang, Di; Lu, Weijie

    2012-08-01

    The microstructure and phase constitutions of TixNb3Zr2Ta alloys (x=35, 31, 27, 23) (wt%) were studied. With a lower niobium content the grain size of β phase in TixNb3Zr2Ta alloys increased significantly, and the TixNb3Zr2Ta system was more likely to form α″ phase and even α phase. Tensile tests showed that UTS of TixNb3Zr2Ta alloys improved as the Nb content was decreased. Cyclic loading-unloading tensile tests were carried on TixNb3Zr2Ta alloys. Ti23Nb3Zr2Ta and Ti27Nb3Zr2Ta alloys featured the best superelasticity among the alloys studied. The pseudoelastic strain ratio of Ti35Nb3Zr2Ta alloy decreased a lot as the cycle number increased. Ti31Nb3Zr2Ta alloy showed only minimum superelasticity. This is because Ti23Nb3Zr2Ta and Ti27Nb3Zr2Ta alloys had higher yield strength than Ti31Nb3Zr2Ta did, which allowed martensite phase to be induced. On the contrary, Ti31Nb3Zr2Ta alloy exhibited better shape memory property than Ti27Nb3Zr2Ta, Ti23Nb3Zr2Ta and Ti35Nb3Zr2Ta titanium alloys. β phase, α phase and α″ phase were found in Ti23Nb3Zr2Ta alloy by TEM observation. The dislocation density of α phase was much lower than that of β phase due to their crystal structure difference. This may explained why Ti23Nb3Zr2Ta with α phase possessed higher tensile strength. The incomplete shape recovery of Ti23Nb3Zr2Ta alloy after unloading resulted from two sources. Plastic deformation occurred in β phase, α phase and even α″ phase under dislocation slip mechanism, and incomplete decomposition of α″ martensitic phase resulted in unrecovered strain as well. Copyright © 2012 Elsevier Ltd. All rights reserved.

  1. Long-term indigenous soil conservation technology in the Chencha area, southern Ethiopia: origin, characteristics, and sustainability.

    Science.gov (United States)

    Engdawork, Assefa; Bork, Hans-Rudolf

    2014-11-01

    The purpose of this study is to examine the origin, development, and characteristics of terraces (kella), plus their potentials and determinants for sustainable use in the Chencha-Dorze Belle area of southern Ethiopia. Field surveys were conducted to determine the various parameters of the indigenous terraces and in order to collect samples for radiocarbon dating. To identify farmers' views of the terrace systems, semi-structured interviews and group discussions were also carried out. Terraces were built and used-as radiocarbon dating proves-at least over the last 800 years. The long-term continued usage of the indigenous terraces is the result of social commitments, the structural features of the terraces, and the farmers' responses to the dynamics of social and cultural circumstances. We dubbed that the terraces are a success story of fruitful environmental management over generations. Thus, a strong need is to preserve and develop this important cultural heritage and example of sustainable land use.

  2. Resistance to He{sup 2+} irradiation damage in metallic glass Ta{sub 38}Ni{sub 62}

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Wenjing [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams (Dalian University of Technology), Ministry of Education, Dalian 116024 (China); Mei, Xianxiu, E-mail: xxmei@dlut.edu.cn [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams (Dalian University of Technology), Ministry of Education, Dalian 116024 (China); Zhang, Xiaonan; Wang, Yingmin; Qiang, Jianbing [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams (Dalian University of Technology), Ministry of Education, Dalian 116024 (China); Sun, Jianrong [Institute of Modern Physics, The Chinese Academy of Sciences, Lanzhou 730000 (China); Wang, Younian [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams (Dalian University of Technology), Ministry of Education, Dalian 116024 (China)

    2016-10-15

    Highlights: • Metallic glass Ta{sub 38}Ni{sub 62} irradiated by different fluence of He{sup 2+} remained amorphous. • The helium bubble layer appeared at the end of ion range 1.01 μm away from surface. • Helium bubbles were larger in the layer center and reduced to top and bottom sides. • No significant damage appeared in the surface of metallic glass Ta{sub 38}Ni{sub 62}. • Ta{sub 38}Ni{sub 62} better resisted to He{sup 2+} irradiation than W and V{sub 87.5}Cr{sub 4.17}Ti{sub 4.17}Nb{sub 4.17}. - Abstract: Metallic glass Ta{sub 38}Ni{sub 62} strips, metallic W, and V{sub 87.5}Cr{sub 4.17}Ti{sub 4.17}Nb{sub 4.17} alloy were irradiated using a 500 keV He{sup 2+} ion beam at different fluence to compare the metallic glass resistance to irradiation. Metallic glass Ta{sub 38}Ni{sub 62} remained amorphous at different He{sup 2+} irradiation fluence. Transmission electron microscopy analysis revealed the presence of helium bubbles at the end of the range of helium ions in the metallic glass. No significant damage resulted in the metallic glass surface, and the root mean square roughness increased nonlinearly with the increase in fluence. At 1 × 10{sup 18} ions/cm{sup 2}, metallic W appeared in larger sunken areas on the surface and V{sub 87.5}Cr{sub 4.17}Ti{sub 4.17}Nb{sub 4.17} alloy experienced multi-layer flaking. The metallic glass Ta{sub 38}Ni{sub 62} resistance to He{sup 2+} ion beam irradiation was better than that of metallic W, and that of the V{sub 87.5}Cr{sub 4.17}Ti{sub 4.17}Nb{sub 4.17} alloy was the poorest.

  3. MICROSTRUCTURE CHARACTERISATION OF PROTRUSIONS BY ELECTRON BEAM SURFI-SCULPT ON THE SURFACE OF TA15 Ti ALLOY%TA15钛合金表面电子束毛化处理的组织特征

    Institute of Scientific and Technical Information of China (English)

    许恒栋; 赵海燕; 孟令瑶; 王西昌; 巩水利; 白秉哲

    2012-01-01

    利用电子束毛化技术在TA15薄板(Ti-6A1-2Zr-1Mo-1V)表面生成“毛刺”,通过OM,SEM,EDS和XRD分析了“毛刺”的组织、元素成分和性能.研究发现,“毛刺”组织可分为边缘区、中心区、热影响区、基体;边缘区为粗大晶粒和大量片状马氏体,硬度最低;中心区为大晶粒和规则排列的片状马氏体,硬度次低;热影响区晶粒较小,晶界为α相,晶内为平行排列的片状马氏体组织,硬度最高;不同区域的A1含量有明显差异.“毛刺”不同区域的硬度主要取决于A1含量和晶粒尺寸.%Electron beam surfi-sculpt is a novel surface processing technology, in which electron beam is controlled by magnetic field and deflected quickly over a substrate surface to displace materials in a settled manner, thus producing customized textured surface consisting of an array of protrusions above the original surface and a corresponding array of cavities in the substrate. This technology could be used in dissimilar materials connection between metals and composites, as the protrusions on metal surface would increase the interface area, which results in great improvements in both strength and absorbed energy. It could also be applied to improve the surface coating quality by tailor-making protrusions throughout a component surface so as to enhance the adhesive capacity between coating and substrate, as well as to optimize the stress distribution that occurs in coating process. The application performance of textured surface depends on the microstructure characterisation of protrusions, while the investigation on the microstructures and mechanical properties of the protrusion is lack. In this work, electron beam surfi-sculpt was carried out to produce protrusions on TA15 (Ti-6Al-2Zr-1Mo-1V) surface through multi-beam technique. The microstructure features of protrusions were investigated by OM, SEM and XR.D, and the weight percentages of alloy elements were analyzed by EDS. In

  4. High Yield Cultivation Technology of Smallanthus Sonchifolius in Benxi Area%本溪地区雪莲果高产栽培技术

    Institute of Scientific and Technical Information of China (English)

    崔超

    2013-01-01

    以本溪县连财中药材种苗专业合作社为试验基地,探索适合本溪地区的雪莲果高产栽培技术。从产地环境、种球(苗)选用及处理、选地与整地、育苗、移栽、田间管理、虫害防治及收获等环节,介绍雪莲果高产栽培技术操作要点,为提高雪莲果产量提供参考。%Taking Benxi County Liancai traditional Chinese medicinal seeds and seedlings cooperatives as the test base, we explored the yacon high-yield cultivation technology in Benxi area. This article expounds on the operation points of cultivation technology of Smallan-thus sonchifolius from the perspectives of the environment of producing areas, seedball (seedlings) selection and processing, selection and preparation of ground, seedling, transplanting, field management, pest control and harvesting process to provide reference for improving yacon fruit yield.

  5. Research on strobe prevent freezing engineering technology of cold areas%寒冷地区闸门防冰冻工程技术的研究

    Institute of Scientific and Technical Information of China (English)

    李祥波

    2011-01-01

    针对寒冷地区引水渠道和水利枢纽工程的闸门,统计了冰冻对闸门的危害,阐述了闸门防冰冻工程技术的现状,通过对闸门冰冻的分析,提出了寒冷地区闸门在冬季处于运行工况时采取的有效防冰冻工程技术方案,以保证闸门在冬季的正常运行,保障水工建筑物的安全。%Aiming at the strobe of diversion channel and water conservancy hub project of cold areas, this paper statisticed the harm of freezing to strobe, elaborated the status of strobe prevent freezing engineering technology, through the analysis of strobe frozen, put forward the effective prevent freezing engineering technology scheme in winter operation condition of cold areas, in order to ensure the normal operation of the strobe in winter, ensured the safety of hydraulic structures.

  6. Application Progress of Inkjet Printing Technology in the Area of Ceramic Tile in China%浅析附着式振动器的技术特点

    Institute of Scientific and Technical Information of China (English)

    蒋章方; 邓堪谊

    2012-01-01

    Inkjet printing technology was developing rapidly in the area of China's ceramic tile companies. It can be predicted, there will more than 1000 inkjet printing machines to be came into use in the near future. The decorative technology of the ceramic tiles are happening a 'revolution'. Standardized ceramic ink will have 7.5-16 billion RMB market each year and the inkjet printing equipment will have 3-6 bil-lion RMB market each year. Inkjet printing technology was changing traditional 'format and coloring match' development and production's mode, which will bring 4-64 billion RMB added value to the China's ceramic tile enterprise.%附着式振动器由于偏心块、附着重量、物料属性等的存在,将其电机设计问题复杂化。笔者结合多年的工作体会,就激振力与电机额定功率的关系、附着式振动器总体设计特点、温升计算要点、滚动轴承可靠性计算等问题进行了介绍。

  7. Synthesis of SrBi{sub 2}Ta{sub 2}O{sub 9} by combustion synthesis; Obtencao do SrBi{sub 2}Ta{sub 2}O{sub 9} utilizando a sintese por combustao

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, F.F.; Bergmann, C.P. [Universidade Federal do Rio Grande do Sul (LACER/UFRGS), Porto Alegre, RS (Brazil). Dept. de Materiais. Lab. de Materiais Ceramicos; Sousa, V.C. [Universidade Federal do Rio Grande do Sul (LABIOMAT/UFRGS), Porto Alegre, RS (Brazil). Dept. de Materiais. Lab. de Materiais de Biomateriais

    2009-07-01

    The combustion synthesis is a low cost technique for obtaining homogeneous nanostructured compounds with high purity. The ferroelectric memory devices have been widely studied by the electronics industry by presenting high-speed recording, read and rewrite. The PZT, in the form of thin films, is the ceramic materials most used for this purpose, but it presents ferroelectric fatigue. The SrBi{sub 2}Ta{sub 2}O{sub 9} has a high cycle enables the recording which is good applicability in the PZT. Therefore, this work aims to obtain the SrBi{sub 2}Ta{sub 2}O{sub 9} using the combustion synthesis and urea as a reducing agent. The characterization of the powder was realized used the technique of x-ray diffraction (XRD) to determine the phases present and to evaluate surface area by the BET method. The powder obtained after synthesis showed low crystallinity presenting just the BiOCl like the crystalline phase present, but heat treatment at 800 deg C for 2 hours was sufficient for the formation of SrBi{sub 2}Ta{sub 2}O{sub 9} . (author)

  8. Retention Model of TaO/HfO x and TaO/AlO x RRAM with Self-Rectifying Switch Characteristics

    Science.gov (United States)

    Lin, Yu-De; Chen, Pang-Shiu; Lee, Heng-Yuan; Chen, Yu-Sheng; Rahaman, Sk. Ziaur; Tsai, Kan-Hsueh; Hsu, Chien-Hua; Chen, Wei-Su; Wang, Pei-Hua; King, Ya-Chin; Lin, Chrong Jung

    2017-06-01

    A retention behavior model for self-rectifying TaO/HfO x - and TaO/AlO x -based resistive random-access memory (RRAM) is proposed. Trapping-type RRAM can have a high resistance state (HRS) and a low resistance state (LRS); the degradation in a LRS is usually more severe than that in a HRS, because the LRS during the SET process is limited by the internal resistor layer. However, if TaO/AlO x elements are stacked in layers, the LRS retention can be improved. The LRS retention time estimated by extrapolation method is more than 5 years at room temperature. Both TaO/HfO x - and TaO/AlO x -based RRAM structures have the same capping layer of TaO, and the activation energy levels of both types of structures are 0.38 eV. Moreover, the additional AlO x switching layer of a TaO/AlO x structure creates a higher O diffusion barrier that can substantially enhance retention, and the TaO/AlO x structure also shows a quite stable LRS under biased conditions.

  9. From Ba3Ta5O14N to LaBa2Ta5O13N2: Decreasing the optical band gap of a photocatalyst

    Science.gov (United States)

    Anke, B.; Bredow, T.; Pilarski, M.; Wark, M.; Lerch, M.

    2017-02-01

    Yellow LaBa2Ta5O13N2 was successfully synthesized as phase-pure material crystallizing isostructurally to previously reported Ba3Ta5O14N and mixed-valence Ba3TaV4TaIVO15. The electronic structure of LaBa2Ta5O13N2 was studied theoretically with the range-separated hybrid method HSE06. The most stable structure was obtained when lanthanum was placed on 2a and nitrogen on 4h sites confirming Pauling's second rule. By incorporating nitrogen, the measured band gap decreases from ∼3.8 eV for the oxide via 2.74 eV for Ba3Ta5O14N to 2.63 eV for the new oxide nitride, giving rise to an absorption band well in the visible-light region. Calculated fundamental band gaps confirm the experimental trend. The atom-projected density of states has large contributions from N2p orbitals close to the valence band edge. These are responsible for the observed band gap reduction. Photocatalytic hydrogen formation was investigated and compared with that of Ba3Ta5O14N revealing significantly higher activity for LaBa2Ta5O13N2 under UV-light.

  10. Opinions from teachers in the Fresno area of Central California regarding the influence of mobile technology on their students’ learning

    Directory of Open Access Journals (Sweden)

    Navaridas, Fermín

    2013-10-01

    Full Text Available This paper presents the most relevant results of a study in which opinions of the teachers in the area of Fresno (Central California, USA about the effects of the integration of mobile devices into the teaching-learning process. Among other objectives, this study has tried to analyze the influence of mobile learning over three very important learning factors: affective-emotional (motivation, ethic-social (social skills and the cognitive one (cognitive skills. In order to carry out this study, a descriptive methodological approach was adopted, using the survey technique as the most adequate method to collect teachers´ opinions in a relatively fast and precise way. Obtained results show a widespread agreement among teachers about the pedagogical potential of mobile devices as a tool to improve learning quality. In general terms, conclusions suggest an improvement in the students’ interest on educational tasks, an increase during study activities, a better collaborative work, as well as an improvement of creativity and information acquisition.

  11. The Application of Internet of Things Technology on Industrial Areas%物联网传感器技术在工业领域的应用

    Institute of Scientific and Technical Information of China (English)

    肖惠云; 张虎

    2014-01-01

    Internet of Things(IoT) technology has been officially listed as one of the five emerging strategic industry technologies and attracted great attention of the whole society in China. How to seize the opportunities, overcome technical bottlenecks, and use the IoT technology in each aspect of industrial areas has become the focus of engineers. IoT technology can significantly improve manufacturing efficiency and product quality, and reduce production costs and resource consumption. Firstly, the paper introduces the status quo of IoT sensors at home and abroad, then introduces the principles and characteristics of IoT, as well as IoT applications in the industrial field, and finally gives much more details on IoT neurons sensors, the wireless sensor characteristics and applications.%物联网已正式列为国家五大新兴战略性产业之一,在中国受到全社会极大关注。如何抓住机遇,突破技术瓶颈,将物联网传感器技术广泛应用于工业生产各环节中,可大幅提高制造效率、产品质量,降低生产成本和资源消耗。本文首先介绍了国内外物联网传感器现状,然后介绍了物联网原理及特点和在工业领域的应用。详细介绍了物联网神经元件-传感器,并列举了无线传感器的特点及应用。

  12. PLANNING BY USING DIGITAL TECHNOLOGY IN THE RECONSTRUCTION OF CULTURAL HERITAGE SITES – A CASE STUDY OF QIONG-LIN SETTLEMENT IN KINMEN AREA

    Directory of Open Access Journals (Sweden)

    W. B. Yang

    2017-08-01

    Full Text Available ICOMOS Florence Declaration in 2014, encourages an in-depth reflection on human values through cultural heritage and landscapes, which emphasizes the importance of historical heritage sites, in order to achieve the application of cultural heritage records through the public participation, sharing new technology platform and facilitation tools for knowledge diffusion, for instance. Nikos adopted digitized intangible cultural heritage within i-Treasures project to create a novel digital platform in 2016. Nowadays, the display platform developed based on geographic information system has been gradually accepted and widely used to distribute cultural heritage information, aiming to combine geography, time, events, issues, trends with the interactive maps to show the context of data changes from the consideration of planarity; for example, Burnaby City in Canada has cooperated with the Columbia University to create a navigation platform for guidance of tangible cultural heritage based on story maps in order to provide public recognition function. In this study, Qiong-Lin Settlement in Kinmen Area was taken as an example to illustrate the developing process of an overall planning framework for reappearing the glory of historic settlements of cultural heritage sites with digital technology, which included tangible and intangible cultural heritage preservation and transmission planning, community participation and digital navigation programs. The digital technology with the GIS-based digital platform can provide more diverse and interesting information while using an intuitive, graphical user story mapping interface. So that tangible cultural heritage can be effectively understood, interpreted and preserved with the value-added methods, and also intangible cultural heritage can be continuously transmitted to establish a complete system of cultural heritage preservation. The main contents include several navigation technologies, such as 3D laser scanning

  13. Planning by Using Digital Technology in the Reconstruction of Cultural Heritage Sites - a Case Study of Qiong-Lin Settlement in Kinmen Area

    Science.gov (United States)

    Yang, W. B.; Ye, Y. N.

    2017-08-01

    ICOMOS Florence Declaration in 2014, encourages an in-depth reflection on human values through cultural heritage and landscapes, which emphasizes the importance of historical heritage sites, in order to achieve the application of cultural heritage records through the public participation, sharing new technology platform and facilitation tools for knowledge diffusion, for instance. Nikos adopted digitized intangible cultural heritage within i-Treasures project to create a novel digital platform in 2016. Nowadays, the display platform developed based on geographic information system has been gradually accepted and widely used to distribute cultural heritage information, aiming to combine geography, time, events, issues, trends with the interactive maps to show the context of data changes from the consideration of planarity; for example, Burnaby City in Canada has cooperated with the Columbia University to create a navigation platform for guidance of tangible cultural heritage based on story maps in order to provide public recognition function. In this study, Qiong-Lin Settlement in Kinmen Area was taken as an example to illustrate the developing process of an overall planning framework for reappearing the glory of historic settlements of cultural heritage sites with digital technology, which included tangible and intangible cultural heritage preservation and transmission planning, community participation and digital navigation programs. The digital technology with the GIS-based digital platform can provide more diverse and interesting information while using an intuitive, graphical user story mapping interface. So that tangible cultural heritage can be effectively understood, interpreted and preserved with the value-added methods, and also intangible cultural heritage can be continuously transmitted to establish a complete system of cultural heritage preservation. The main contents include several navigation technologies, such as 3D laser scanning, UAV images

  14. Partitioning and Hydrolysis of Nb and Ta and Their Implications with Regard to Mineralization

    Institute of Scientific and Technical Information of China (English)

    王玉荣; 顾复; 等

    1993-01-01

    K2NbOF5·H2O and K2TaF7 were prepared through melting Nb2O5 and Ta2O5 respectively with FHF2·2H2O, followed by recrystallizing .The hydrolysis properties of K2NbOF5 and K2TaF7 were determined again by using a rapidly quench vessel.As temperature (from 250 to 550℃) and pressure (from 500 to 1500 bars) increase, the degree of hydrolysis of both K2NbOF5 and K2TaF7 will increase.Nb- and Ta-fluorine complex compounds are instable in supercritical aqueous fluids.The degree of hydrolysis of both K2NbOF5 and K2TaF7 decreases with increasing concentra-tion of HF, independent of the concentration of NaF .The partition coefficients of Nb and Ta between granitic melt and fluid phase are less than 0.15,ie., most of Nb and Ta are left in granitic melt.The partition coefficient of Ta is more dependent on the concentration of HF than that of Nb.The significance of hydrolysis in Nb-ans Ta mineralization is also discussed in the present paper.

  15. [Cl5Ta(μ-O)TaCl3{(i)PrS(CH2)2S(i)Pr}] and [(TaCl4)2(μ-O)(μ-Me2Se2)]: two chalcogenoether complexes of Ta2OCl8 with very different geometries.

    Science.gov (United States)

    Benjamin, Sophie L; Hyslop, Alison; Levason, William; Webster, Michael

    2011-07-01

    The title compounds, [1,2-bis(isopropylsulfanyl)ethane-2κ(2)S,S']octachlorido-1κ(5)Cl,2κ(3)Cl-μ-oxido-ditantalum(V), [Ta(2)Cl(8)O(C(8)H(18)S(2))], (I), and μ-dimethyldiselane-κ(2)Se:Se'-μ-oxido-bis[tetrachloridotantalum(V)], [Ta(2)Cl(8)O(C(2)H(6)Se(2))], (II), contain six-coordinate Ta(V) centres linked by a nonlinear oxide bridge. Compound (I) contains one Ta(V) centre bonded to a chelating dithioether and three terminal chloride ligands, with the second Ta(V) centre bonded to five terminal chloride ligands. In (II), two tetrachloridotantalum(V) residues are bridged by the diselenide, giving a puckered five-membered Ta/O/Ta/Se/Se ring. The Ta-O distances in the bridges are short in both compounds, indicating that significant multiple-bond character is retained despite the deviation from linearity, and the bond lengths reveal a clear trans influence order of O > Cl > S > Se on the hard Ta(V) centre. The structures are compared with the [Ta(2)Cl(10)O](2-) anion, which contains a linear oxide bridge.

  16. Removal of organic matter from H2TaF7 solution by adsorption

    Institute of Scientific and Technical Information of China (English)

    LI Qing-gang; ZHOU Kang-gen; ZHANG Qi-xiu

    2005-01-01

    The removal of organic matter from H2TaF7 solution by adsorption was investigated in order to reduce the carbon content in the K2TaF7 crystal. Three kinds of adsorbent, LSA-5 resin, LSA-20 resin and active carbon were applied in the fixed bed respectively. Experimental results indicate that LAS-5 resin, LAS-20 resin, the mixture of LAS-5 resin and LAS-20 resin(with volume ratio of 1∶1), and the active carbon can all reduce chemical oxygen demand(COD) value of the H2TaF7 solution, and reduce consequently carbon content of K2TaF7 crystal to 0.001 0%0.001 5% from 0.002 5%0.003 0%. Comparing with the others, the active carbon is an approved adsorbent whose bed volumes of effluent reaches 70. In addition, there is a linear relationship between the COD value of H2TaF7 solution and the carbon content in K2TaF7 crystal, and the carbon content in K2TaF7 crystal decreases with the decreasing of COD value of H2TaF7 solution. When the COD value of H2TaF7 solution is lower than 7 mg/L, the carbon content in K2TaF7 crystal would decrease to less than 0.001 5%.

  17. The Scientific and Technological area of the Programs of Curricular Diversification. Critical analysis of the available materials and a case study in Segovia province

    Science.gov (United States)

    Leal Insua, Maria Pilar

    Diversity, Didactics of Experimental Sciences, Programs of curricular diversification, Scientific Technological Area

  18. 17 May 2013 - Honourable Minister of Communications, Science and Technology of the Kingdom of Lesotho T. Mokhosi visiting the ATLAS experimental area with CERN International Adviser for Turkey R. Voss.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    17 May 2013 - Honourable Minister of Communications, Science and Technology of the Kingdom of Lesotho T. Mokhosi visiting the ATLAS experimental area with CERN International Adviser for Turkey R. Voss.

  19. 28 June 2012 - Members of the European Brain Council led by President Mary Baker visiting the LHC tunnel at Point 5 with Technology Department Group Leader L. Bottura and CMS experimental area with Run Coordinator M. Chamizo-Llatas.

    CERN Multimedia

    Jean-Claude Gadmer

    2012-01-01

    28 June 2012 - Members of the European Brain Council led by President Mary Baker visiting the LHC tunnel at Point 5 with Technology Department Group Leader L. Bottura and CMS experimental area with Run Coordinator M. Chamizo-Llatas.

  20. Information technology -- Local and metropolitan area networks -- Token ring access method and physical layer specifications -- Recommended practice for use of unshielded twisted pair cable (UTP) for token ring data transmission at 4-Mbit/s

    CERN Document Server

    International Organization for Standardization. Geneva

    1993-01-01

    Information technology -- Local and metropolitan area networks -- Token ring access method and physical layer specifications -- Recommended practice for use of unshielded twisted pair cable (UTP) for token ring data transmission at 4-Mbit/s

  1. Low-technology cooling box for storage of malaria RDTs and other medical supplies in remote areas

    Directory of Open Access Journals (Sweden)

    Tsuyuoka Reiko

    2010-01-01

    Full Text Available Abstract Background With the increase in use of point-of-care diagnostic tests for malaria and other diseases comes the necessity of storing the diagnostic kits and the drugs required for subsequent management, in remote areas, where temperatures are high and electricity supply is unreliable or unavailable. Methods To address the lack of temperature-controlled storage during the introduction of community-based malaria management in Cambodia, the Cambodian National Centre for Parasitology, Entomology and Malaria Control (CNM developed prototype evaporative cooling boxes (Cambodian Cooler Boxes - CCBs for storage of perishable medical commodities in remote clinics. The performance of these CCBs for maintaining suitable storage temperatures was evaluated over two phases in 2005 and 2006-7, comparing conditions in CCBs using water as designed, CCBs with no water for evaporation, and ambient storage room temperatures. Temperature and humidity was monitored, together with the capacity of the RDTs recommended for storage between 2 to 30 degree Celsius to detect low-density malaria parasite samples after storage under these conditions. Results Significant differences were recorded between the proportion of temperatures within the recommended RDT storage conditions in the CCBs with water and the temperatures in the storage room (p Discussion and Conclusions The CCB was an effective tool for storage of RDTs at optimal conditions, and extended the effective life-span of the tests. The concept of evaporative cooling has potential to greatly enhance access to perishable diagnostics and medicines in remote communities, as it allows prolonged storage at low cost using locally-available materials, in the absence of electricity.

  2. Microstructure evolution mechanism in adiabatic shear band in TA2

    Institute of Scientific and Technical Information of China (English)

    杨扬; 熊俊; 杨续跃

    2004-01-01

    The micro structure evolution mechanism in adiabatic shear band in commercial pure titanium (TA2) at high strain rates(γ≈105 - 106/s) were studied. The nanosized recrystallized grains (about 50 nm in diameter) within the center of adiabatic shear band (ASB) were observed by means of transmission electronic microscope (TEM). A Rotational Dynamic Recrystallization (RDR) mechanism can explain the microstructure evolution (i. e. nanosized grains were formed within 5 - 10μs) in ASB. Kinetics calculations indicate that the recrystallized small grains are formed during the deformation and don't undergo significant growth by grain boundary migration after deformation.

  3. TaC Studios New Construction Test House

    Energy Technology Data Exchange (ETDEWEB)

    Butler, T. [NAHB Research Center Industry Partnership, Upper Marlboro, MD (United States); Curtis, O. [NAHB Research Center Industry Partnership, Upper Marlboro, MD (United States); Kim, E. [NAHB Research Center Industry Partnership, Upper Marlboro, MD (United States); Roberts, S. [NAHB Research Center Industry Partnership, Upper Marlboro, MD (United States); Stephenson, R. [NAHB Research Center Industry Partnership, Upper Marlboro, MD (United States)

    2013-03-01

    As part of the NAHB Research Center Industry Partnership, Southface partnered with TaC Studios, an Atlanta based architecture firm specializing in residential and light commercial design, on the construction of a new test home in Atlanta, GA, in the mixed humid climate zone. This home will serve as a model home for the builder partner and addresses Building America energy savings targets through the planning and implementation of a design package will serve as a basis of design for the builder partner’s future homes. As a BA test house, this home will be evaluated to detail whole house energy use, end use loads, and HVAC and hot water efficiency.

  4. The cross-border project between France and Italy MARS+. Sub-project - Innovative technologies for the mechanization of the areas hard to reach

    Directory of Open Access Journals (Sweden)

    G. Tirrò

    2013-09-01

    Full Text Available The care and protection of the mountain areas and their traditional crops were some of the reasons that led regional governments of Liguria and Tuscany to participate in the strategic project “Sea, Countryside and Land: potentiate the strategic unitarily” (MARS +. This project has also involved the participation of the four cross-border regions: Tuscany (leader, Sardinia, Liguria and Corsica. The aim was to promote the development of the innovations and entrepreneurship in the rural areas in order to increase competitiveness. In particular, the subproject SC has provided the transfer of innovations to facilitate the processes of mechanization in vineyards and olive orchards in contexts defined as “heroic”, areas of high landscape and environmental value in which the typical cultures has been always carried out, generally, on terraces or slopes. These conditions require a great effort by the farmers and result in high production costs. The transfer of the innovations has provided the organization of demonstration days in which the technological solutions for the management of the farming operations in vineyards and olive orchards were proposed and tested. During these events, the participative process was fundamentally reconfirmed, not only as a means to expand the knowledge of innovative products, but also as an opportunity for farmers, retailers, manufacturers, researchers, and local administrators to interact and facilitate the development of other technologies. The parameters that led to the innovative solutions included: the small size, user-friendliness, agility, and the ability of operating on systems not easily accessible. These products must also ensure the ergonomics and safety of workers performing all the growing operations. A thorough research of the available technologies and prototypes, still under development, affirms the presence of many innovations. These innovations not only allow the execution of all the field

  5. Lasers technology

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    The Lasers Technology Program of IPEN is committed to the development of new lasers based on the research of optical materials and new technologies, as well to laser applications in several areas: Nuclear, Medicine, Dentistry, Industry, Environment and Advanced Research. The Program is basically divided into two main areas: Material and Laser Development and Laser Applications.

  6. Experimental investigation of phase equilibria in the Nb-Si-Ta ternary system

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jian; Wang, Cuiping; Yao, Jun; Yang, Shuiyuan; Zhan Shi; Liu, Xingjun [Xiamen Univ. (China). Dept. of Materials Science and Engineering; Xiamen Univ. (China). Fujian Provincial Key Laboratory of Materials Genome; Kang, Yongwang [Beijing Institute of Aeronautical Materials (China). Science and Technology on Advanced High Temperature Structural Materials Lab.

    2016-12-15

    The phase equilibria in the Nb-Si-Ta ternary system at 1 373 K, 1 473 K and 1 573 K were investigated by means of back-scattered electron imaging, electron probe microanalysis and X-ray diffraction. The isothermal sections at 1 373 K, 1 473 K and 1 573 K consist of two three-phase regions and seven two-phase regions, without any ternary compounds. The compounds of NbSi{sub 2} and TaSi{sub 2}, αNb{sub 5}Si{sub 3} and αTa{sub 5}Si{sub 3} form continuous solid solutions, respectively. The solubilities of Nb in Ta{sub 3}Si and Ta{sub 2}Si phases are extremely large, whereas the solubility of Si in the β(Nb, Ta) phase is relatively small.

  7. Carrier dynamics of a visible-light-responsive Ta3N5 photoanode for water oxidation

    KAUST Repository

    Ziani, Ahmed

    2015-01-01

    The physicochemical properties of a tantalum nitride (Ta3N5) photoanode were investigated in detail to understand the fundamental aspects associated with the photoelectrochemical (PEC) water oxidation. The Ta3N5 thin films were synthesized using DC magnetron sputtering followed by annealing in air and nitridation under ammonia (NH3). A polycrystalline structure with a dense morphology of the monoclinic Ta3N5 films was obtained. A relatively low absorption coefficient (104 to 105 cm-1) in the visible light range was measured for Ta3N5, consistent with the nature of the indirect band-gap. Ultra-fast spectroscopic measurements revealed that the Ta3N5 with different thicknesses films possess low transport properties and fast carrier recombination (<10 ps). These critical kinetic properties of Ta3N5 as a photoanode may necessitate high overpotentials to achieve appreciable photocurrents for water oxidation (onset ∼0.6 V vs. RHE). This journal is

  8. High-density formation of Ta nanodot induced by remote hydrogen plasma

    Science.gov (United States)

    Wang, Yaping; Takeuchi, Daichi; Ohta, Akio; Ikeda, Mitsuhisa; Makihara, Katsunori; Miyazaki, Seiichi

    2017-01-01

    We have studied the formation of Ta nanodots (NDs) on thermally grown SiO2/Si by exposing a thin metal layer to a remote H2 plasma (H2-RP) without external heating. Atomic force microscopy (AFM) analyses show that a combination of a Ge (˜30.0 nm)/Ta (˜2.0 nm) bilayer stack with subsequent H2-RP exposure is effective for forming electrically isolated Ta NDs with an areal dot density as high as ˜1011 cm-2, where the Ge layer plays an important role as a barrier layer against the oxidation of the ultrathin Ta layer surface. The change in the chemical structure of the Ge/Ta bilayer stack on SiO2/Si upon Ta ND formation by H2-RP exposure is investigated by hard X-ray photoemission spectroscopy (HAXPES) and X-ray photoelectron spectroscopy (XPS).

  9. Supporting data for senary refractory high-entropy alloy CrxMoNbTaVW

    Directory of Open Access Journals (Sweden)

    B. Zhang

    2015-12-01

    Full Text Available This data article is related to the research paper entitled “senary refractory high-entropy alloy CrxMoNbTaVW [1]”. In this data article, the pseudo-binary Cr-MoNbTaVW phase diagram is presented to show the impact of Cr content to the senary Cr-MoNbTaVW alloy system; the sub-lattice site fractions are presented to show the disordered property of the Cr-MoNbTaVW BCC structures; the equilibrium and Scheil solidification results with the actual sample elemental compositions are presented to show the thermodynamic information of the melted/solidified CrxMoNbTaVW samples; and the raw EDS scan data of the arc-melted CrxMoNbTaVW samples are also provided.

  10. TaN interface properties and electric field cycling effects on ferroelectric Si-doped HfO2 thin films

    Science.gov (United States)

    Lomenzo, Patrick D.; Takmeel, Qanit; Zhou, Chuanzhen; Fancher, Chris M.; Lambers, Eric; Rudawski, Nicholas G.; Jones, Jacob L.; Moghaddam, Saeed; Nishida, Toshikazu

    2015-04-01

    Ferroelectric HfO2-based thin films, which can exhibit ferroelectric properties down to sub-10 nm thicknesses, are a promising candidate for emerging high density memory technologies. As the ferroelectric thickness continues to shrink, the electrode-ferroelectric interface properties play an increasingly important role. We investigate the TaN interface properties on 10 nm thick Si-doped HfO2 thin films fabricated in a TaN metal-ferroelectric-metal stack which exhibit highly asymmetric ferroelectric characteristics. To understand the asymmetric behavior of the ferroelectric characteristics of the Si-doped HfO2 thin films, the chemical interface properties of sputtered TaN bottom and top electrodes are probed with x-ray photoelectron spectroscopy. Ta-O bonds at the bottom electrode interface and a significant presence of Hf-N bonds at both electrode interfaces are identified. It is shown that the chemical heterogeneity of the bottom and top electrode interfaces gives rise to an internal electric field, which causes the as-grown ferroelectric domains to preferentially polarize to screen positively charged oxygen vacancies aggregated at the oxidized bottom electrode interface. Electric field cycling is shown to reduce the internal electric field with a concomitant increase in remanent polarization and decrease in relative permittivity. Through an analysis of pulsed transient switching currents, back-switching is observed in Si-doped HfO2 thin films with pinched hysteresis loops and is shown to be influenced by the internal electric field.

  11. Study on ( n,t) Reactions of Zr, Nb and Ta Nuclei

    Science.gov (United States)

    Tel, E.; Yiğit, M.; Tanır, G.

    2012-04-01

    The world faces serious energy shortages in the near future. To meet the world energy demand, the nuclear fusion with safety, environmentally acceptability and economic is the best suited. Fusion is attractive as an energy source because of the virtually inexhaustible supply of fuel, the promise of minimal adverse environmental impact, and its inherent safety. Fusion will not produce CO2 or SO2 and thus will not contribute to global warming or acid rain. Furthermore, there are not radioactive nuclear waste problems in the fusion reactors. Although there have been significant research and development studies on the inertial and magnetic fusion reactor technology, there is still a long way to go to penetrate commercial fusion reactors to the energy market. Because, tritium self-sufficiency must be maintained for a commercial power plant. For self-sustaining (D-T) fusion driver tritium breeding ratio should be greater than 1.05. And also, the success of fusion power system is dependent on performance of the first wall, blanket or divertor systems. So, the performance of structural materials for fusion power systems, understanding nuclear properties systematic and working out of ( n,t) reaction cross sections are very important. Zirconium (Zr), Niobium (Nb) and Tantal (Ta) containing alloys are important structural materials for fusion reactors, accelerator-driven systems, and many other fields. In this study, ( n,t) reactions for some structural fusion materials such as 88,90,92,94,96Zr, 93,94,95Nb and 179,181Ta have been investigated. The calculated results are discussed andcompared with the experimental data taken from the literature.

  12. Agile machining and inspection thrust area team-on-machine probing / compatibility assessment of Parametric Technology Corporation (PTC) pro/CMM DMIS with Zeiss DMISEngine.

    Energy Technology Data Exchange (ETDEWEB)

    Wade, James Rokwel; Tomlinson, Kurt; Bryce, Edwin Anthony

    2008-09-01

    The charter goal of the Agile Machining and Inspection Thrust Area Team is to identify technical requirements, within the nuclear weapons complex (NWC), for Agile Machining and Inspection capabilities. During FY 2008, the team identified Parametric Technology Corporation (PTC) Pro/CMM as a software tool for use in off-line programming of probing routines--used for measurement--for machining and turning centers. The probing routine would be used for in-process verification of part geometry. The same Pro/CMM program used on the machine tool could also be employed for program validation / part verification using a coordinate measuring machine (CMM). Funding was provided to determine the compatibility of the Pro/CMM probing program with CMM software (Zeiss DMISEngine).

  13. Collective flows of protons and $\\pi^-$ mesons in $^{2}$H + C, Ta and He plus C, Ta collisions at 3.4 GeV/nucleon

    CERN Document Server

    Chkhaidze, L; Djobava, T; Kladnitskaya, E; Kharkhelauri, L; Uzhinsky, V

    2011-01-01

    Collective flows of protons and negative pions have been studied in (2)H + C, Ta and He + C, Ta collisions at an energy of 3.4 GeV/nucleon. The data have been obtained by the 2-m Propane Bubble Chamber (PBC-500) at JINR. It is found that the directed flow of protons and pi(-) mesons characterized by d /d(y) increases with increase of the mass numbers of colliding nucleus pairs; the elliptic proton flow points out of the reaction plane and also strengthens as the system mass increases; the negative pion directed flow is in the same reaction plane as the proton flow for the lighter (2H + C, He + C) systems and in the opposite direction for the heavier ((2)H + Ta, He + Ta) systems. In (2)H + C, He + C, C + C, C + Ne, (2)H + Ta, He + Ta, C + Cu, and C + Ta collisions, the linear dependence of directed and elliptic flow parameters from mass numbers of projectile and target nuclei, (A(P).A(T))(1/2), is similar for protons while for pi(-) mesons the dependence of directed flow parameters is stronger. The ultrarelati...

  14. Study on Luminescence Properties of High-Density Phosphors BiTaO4∶Pr3+ and BiTaO4

    Institute of Scientific and Technical Information of China (English)

    张庆礼; 郭常新; 施朝淑; 刘波

    2003-01-01

    The photoluminescence properties of BiTaO4∶Pr3+ and BiTaO4 at room temperature were studied, and the infrared transmission and diffusion reflection spectra of BiTaO4 were measured. The photoluminescence spectrum of BiTaO4 peaks at about 420, 440 and 465 nm. There has an obvious excitation band from 330 to 370 nm. The photoluminescence spectrum of BiTaO4∶Pr3+ consists of the characteristic emission of Pr3+, and its main peak is at 606 nm from 3P0→3H6 transition of Pr3+. Its excitation spectrum consists of the wide band with maximum at 325 nm, the wide band in the range of 375~430 nm, and the characteristic excitation of Pr3+. The bands at 325 nm and 375~430 nm may be from the absorption of the charge transfer transition of the tantalate group and defect energy levels in its forbidden band, respectively. There is energy transfer from host to Pr3+. Because both the host density and photoluminescence peak intensity of BiTaO4∶Pr3+ are superior to PbWO4, BiTaO4∶Pr3+ may be a potential heavy scintillator.

  15. Oxidation of TaSi2 thin films on polycrystalline Si

    Science.gov (United States)

    Nguyen Tan, T. A.; Guerfi, N.; Veuillen, J. Y.; Derrien, J.

    1990-01-01

    XPS and UPS have been used for studying the oxidation of TaSi2 films formed by annealing, under ultrahigh-vacuum, of Ta deposits (≈70Å) on polycrystalline Si. Oxidation has been carried out at room-temperature and at 700°C with an oxygen pressure of 2×10-5 mbar. Both Ta and Si react with oxygen. At room-temperature, O chemisorbs on the surface giving a mixed phase of Si suboxides and Ta oxides (TaO, TaO2 and Ta2O5). At 700°C, a very thin Ta2O5 layer (<0.1 monolayer) is formed on top of the growing SiO2 layer. In comparison with Si(111), the oxidation kinetics of TaSi2 begins with a higher transitory rate and follows afterwards the same parabolic dependence of the SiO2 thickness as a function of oxidation time. UPS spectra indicate a higher density of interface states, in comparison with that of SiO2 on Si. The XPS valence band testifies that the electronic structure of the underlying TaSi2 is preserved after oxidation. Subsequent heating of the sample leads to the progressive decomposition of SiO2, at T ≳ 750°C, while the upper Ta2O5 layer is not affected. The results are discussed in relation to thermodynamic properties of Si and Ta oxides, and compared with existing results given by macroscopic methods.

  16. Density Measurement of Liquid Ni-Ta Alloys by a Modified Sessile Drop Method

    Institute of Scientific and Technical Information of China (English)

    FANG Liang; XIAO Feng; TAO Zainan; Kusuhiro Mukai

    2005-01-01

    The density of liquid Ni-Ta alloys was measured by using a modified sessile drop method. It is found that the density of the liquid Ni-Ta alloys decreases with the increasing temperature, but increases with the increase of tantalum concentration in the alloys. The molar volume of liquid Ni-Ta binary alloys increases with the increase of temperature and tantalum concentration.

  17. TaS2 nanosheet-based room-temperature dosage meter for nitric oxide

    Directory of Open Access Journals (Sweden)

    Qiyuan He

    2014-09-01

    Full Text Available A miniature dosage meter for toxic gas is developed based on TaS2 nanosheets, which is capable of indicating the toxic dosage of trace level NO at room temperature. The TaS2 film-based chemiresistor shows an irreversible current response against the exposure of NO. The unique non-recovery characteristic makes the TaS2 film-based device an ideal indicator of total dosage of chronicle exposure.

  18. Characterization of Ta-based barrier films on SiLK for Cu-metalization

    NARCIS (Netherlands)

    Bystrova, S.; Holleman, J.; Woerlee, P.H.; Wolters, R.A.M.

    2002-01-01

    Structures with Ta, TaxN1-x, Ta90C10, Ta95Si5 on SiLK were tested using in-situ 4- point probe resistance measurements during annealing up to 400oC. The change in normalized resistance by a factor of up to 2.58 was attributed to oxygen diffusion out of SiLK layer into the barriers. No direct chemica

  19. H2 evolution on Lanthanum and Carbon co-doped NaTaO3 Photocatalyst

    Directory of Open Access Journals (Sweden)

    Husni Husin

    2014-07-01

    Full Text Available We report a carbon-modify lanthanum doped sodium tantalum oxide powders (La-C-NaTaO3 by sol-gel process. The resultant materials are characterized by powder X-ray diffraction (XRD, scanning electron microscopy (SEM, and transmission electron microscopy (TEM. The X ray diffraction of La-C-NaTaO3 show a single phases with a good crystallinity and without any impurity. The samples is exactly indexed as NaTaO3 monoclinic structure with the space group P2/m. The SEM measurements give a smaller particle size of doped NaTaO3 than pure NaTaO3. The effect of dopant on the photocatalytic activity of La-C-NaTaO3 in the photocatalytic of hydrogen generation is studied and compared with pure NaTaO3. The results show that the rate of hydrogen evolution over La-C-NaTaO3 is higher as compared to that of pure NaTaO3. The enhancement of photocatalytic activity of La-C-NaTaO3 nanocrystalline is mainly due to their capability for reducing the electron hole pair recombination. The La-C-dopant is believed to play a key role in the enhancement of photocatalytic properties of La-C-NaTaO3 crystalline.Submitted: 28th September 2013; Revised: 16th February 2014; Accepted: 28th February 2014[How to Cite: Husin, H., Mahidin, M., Zuhra, Z., Hafita, F. (2014. H2 evolution on Lanthanum and Carbon co-doped NaTaO3 Photocatalyst . Bulletin of Chemical Reaction Engineering & Catalysis, 9 (2:81-86. (doi:10.9767/bcrec.9.2.5530.81-86][Permalink/DOI: http://dx.doi.org/10.9767/bcrec.9.2.5530.81-86] 

  20. New Technologies and Systems for High Quality Citrus Fruit Production, Labor-saving and Orchard Construction in Mountain Areas of Japan

    Institute of Scientific and Technical Information of China (English)

    Kunihisa MORINAGA; Osamu SUMIKAWA; Osamu KAWAMOTO; Hiroyasu YOSHIKAWA; Seiji NAKAO; Masahiko SHIMAZAKI; Shin-no-suke KUSABA; Norihiro HOSHI

    2005-01-01

    Novel technologies have been necessary for improving fruit quality and productivity of citrus,labor-saving and orchard conservation on steep slope lands since aging of growers and decrease in the number of successors is remarkable in mountain areas of southwestern Japan. The purpose of this paper is to introduce new technologies for improving citrus production that have been developed in recent years. A new fruit quality control system using drip irrigation and liquid fertilization technique combined with year-round plastic mulching was developed, and it enables high quality and stable citrus fruit production. Water and/or nutrient solution is automatically supplied through drip tubes that are laid under the mulching sheets to give adequate water stress, so as to improve sugar and acid content of fruit. A new transportation system for steep sloping citrus orchards, which is a combination of the monorail system and contour narrow paths, was suggested. A small walking cultivator was developed to explain the procedure of narrow path excavation. After introducing the narrow path, working hours for fertilizer and chemical herbicide application were reduced. Disaster prevention mapping of citrus orchards on slope lands was developed based on computer-aided seepage estimation and topographic data. The mapping can show zones of both ascending flow and descending flow of underground water during heavy rains in citrus orchards. The mapping is considered to be effective for the management of orchards and prevention of erosion on slope lands.