WorldWideScience

Sample records for systemische fibrose nsf

  1. Nephrogenic systemic fibrosis after application of gadolinium-based contrast agents - a status paper; Nephrogene systemische Fibrose nach Anwendung gadoliniumhaltiger Kontrastmittel - ein Statuspapier zum aktuellen Stand des Wissens

    Energy Technology Data Exchange (ETDEWEB)

    Heinrich, M.; Uder, M. [Erlangen-Nuernberg Univ., Erlangen (Germany). Inst. fuer Radiologie

    2007-06-15

    Recently the association of a rare disease named ''nephrogenic systemic fibrosis'' (NSF) with the administration of gadolinium-containing contrast media, especially gadodiamide (Omniscan, GE-Healthcare), was described. NSF is a scleroderma-like disease characterised by widespread tissue fibrosis. Until now, NSF cases were observed only in patients with kidney disease. Almost all patients were suffering from chronic renal insufficiency, 90 % of them required renal replacement therapy. The true incidence of the disease is unknown. First retrospective analyses of selected collectives of patients with end-stage renal disease showed 2 - 5 % cases of NSF after administration of Gadolinium-containing contrast agents with an odds ratio of 20 - 50 in comparison to non-exposed controls. NSF is a serious adverse reaction, which may result in severe disabilities and even death. Therefore all radiologists applying gadolinium-based contrast agents should be informed about this disease and the recent recommendations for its prevention. On the basis of the published data, Omniscan should not be used in patients with severe renal impairment (GFR < 30 ml/min/1.73 m{sup 2}) and those who have had or are undergoing liver transplantation. In neonates and infants up to 1 year of age, Omniscan should only be used after careful consideration. Also the other gadolinium-based contrast agents should be used in high-risk patients only after careful consideration using the lowest dose possible.

  2. Autoantibodies in cryptogenic fibrosing alveolitis

    Directory of Open Access Journals (Sweden)

    du Bois Ron

    2001-02-01

    Full Text Available Abstract The pathogenesis of cryptogenic fibrosing alveolitis (CFA involves injury, an immune/inflammatory response and fibrosis. The cause of the injury is unknown, but the identification of serum autoantibodies makes an autoimmune aetiology attractive. The core study on which this commentary is based used novel cloning and serum screening technologies in order to identify new public and private autoantibodies in sera from 12 patients with CFA. Largely negative conclusions were drawn from that study. However, we suggest that the prevalence of autoantibodies may have been underestimated, that the study was timely and that this approach is worth pursuing further.

  3. Frontal fibrosing alopecia treatment options.

    Science.gov (United States)

    Fertig, Raymond; Tosti, Antonella

    2016-11-01

    Frontal fibrosing alopecia (FFA) is a rare dermatologic disease that causes scarring and hair loss and is increasing in prevalence worldwide. FFA patients typically present with hair loss in the frontal scalp region and eyebrows which may be associated with sensations of itching or burning. FFA is a clinically distinct variant of lichen planopilaris (LPP) that affects predominantly postmenopausal women, although men and premenopausal women may also be affected. Early diagnosis and prompt treatment are necessary to prevent definitive scarring and permanent hair loss. Data from retrospective studies indicate that 5-alpha-reductase inhibitors (5aRIs) are effective in stabilizing the disease. In our clinical experience, we have seen optimal results treating FFA patients with oral finasteride in conjunction with hydroxychloroquine, topical calcineurin inhibitors (tacrolimus) and excimer laser in patients with signs of active inflammation.

  4. Molecular Targets for the Treatment of Fibrosing Cholangiopathies

    NARCIS (Netherlands)

    Maillette de Buy Wenniger, L. J.; Oude Elferink, R. P.; Beuers, U.

    2012-01-01

    Emerging pathophysiologic insights are leading to novel approaches to treating fibrosing cholangiopathies. The current treatment, using ursodeoxycholic acid (UDCA), may slow the progression of some chronic cholangiopathies but cannot heal them. Apart from immunosuppressive interventions aimed at

  5. Tuberculosis-associated Fibrosing Mediastinitis: Case Report and Literature Review

    Directory of Open Access Journals (Sweden)

    Ronald Tan

    2016-01-01

    Full Text Available Fibrosing mediastinitis is a rare condition defined by the presence of fibrotic mediastinal infiltrates that obliterate normal fat planes. It is a late complication of a previous granulomatous infection, such as histoplasmosis or tuberculosis (TB. Due to its rarity, fibrosing mediastinitis is often under-recognized, and the clinical presentation is variable and dependent on the extent of infiltration or encasement of structures within the mediastinum. We present a case of fibrosing mediastinitis in a man with a prior history of TB, who presented with progressive dyspnea and was found to have chronic mediastinal soft tissue opacities and pulmonary hypertension. His diagnosis was delayed due to the lack of recognition of this clinical/radiographic entity. Fibrosing mediastinitis is a rare entity usually caused by granulomatous disease. Most cases develop as a late complication of histoplasmosis or TB. The presence of calcified mediastinal soft tissue infiltrates on advanced chest imaging can be diagnostic of fibrosing mediastinitis in patients with a prior history of a granulomatous infection once active processes such as malignancy are excluded.

  6. Tuberculosis-associated Fibrosing Mediastinitis: Case Report and Literature Review.

    Science.gov (United States)

    Tan, Ronald; Martires, Joanne; Kamangar, Nader

    2016-01-01

    Fibrosing mediastinitis is a rare condition defined by the presence of fibrotic mediastinal infiltrates that obliterate normal fat planes. It is a late complication of a previous granulomatous infection, such as histoplasmosis or tuberculosis (TB). Due to its rarity, fibrosing mediastinitis is often under-recognized, and the clinical presentation is variable and dependent on the extent of infiltration or encasement of structures within the mediastinum. We present a case of fibrosing mediastinitis in a man with a prior history of TB, who presented with progressive dyspnea and was found to have chronic mediastinal soft tissue opacities and pulmonary hypertension. His diagnosis was delayed due to the lack of recognition of this clinical/radiographic entity. Fibrosing mediastinitis is a rare entity usually caused by granulomatous disease. Most cases develop as a late complication of histoplasmosis or TB. The presence of calcified mediastinal soft tissue infiltrates on advanced chest imaging can be diagnostic of fibrosing mediastinitis in patients with a prior history of a granulomatous infection once active processes such as malignancy are excluded.

  7. Genetics Home Reference: hereditary fibrosing poikiloderma with tendon contractures, myopathy, and pulmonary fibrosis

    Science.gov (United States)

    ... Hereditary fibrosing poikiloderma with tendon contractures, myopathy, and pulmonary fibrosis Printable PDF Open All Close All Enable Javascript ... Fibrosing Poikiloderma with Tendon Contractures, Myopathy, and Pulmonary ... Lung, and Blood Institute (NHLBI): Pulmonary Function Tests National ...

  8. Fibrosing Mediastinitis: Successful Stenting of the Pulmonary Artery

    Directory of Open Access Journals (Sweden)

    Rennae Thiessen

    2008-01-01

    Full Text Available Fibrosing mediastinitis is a rare benign condition, which can cause compression of the pulmonary or systemic vessels, tracheobronchial tree, coronary arteries or esophagus, leading to disabling clinical symptoms and even death. The case of a 26-year-old woman who presented with dyspnea is described. She was found to have 80% stenosis of the right pulmonary artery secondary to fibrosing mediastinitis. The stenosis was managed successfully with an endovascular Palmaz-Schatz stent, and the patient remains symptom-free 10 years later.

  9. Idiopathic fibrosing pancreatitis: A cause of obstructive jaundice in childhood

    International Nuclear Information System (INIS)

    Atkinson, G.O. Jr.; Wyly, J.B.; Gay, B.B. Jr.; Ball, T.I.; Winn, K.J.

    1988-01-01

    Idiopathic fibrosing pancreatitis is a chronic process of unknown etiology characterized by extensive infiltration of the pancreatic parenchyma by fibrous tissue. This disease process is uncommon in the pediatric patient and is consequently rarely considered in the differential diagnosis of abdominal pain and jaundice in the child. The sonographic demonstration of a dilated biliary tree and common bile duct compressed by an enlarged pancreas may be the first suggestion of this entity. Two patients with idiopathic fibrosing pancreatitis and obstructive jaundice are reported with a review of the clinical, radiographic, and pathologic findings. (orig.)

  10. Idiopathic fibrosing pancreatitis: A cause of obstructive jaundice in childhood

    Energy Technology Data Exchange (ETDEWEB)

    Atkinson, G.O. Jr.; Wyly, J.B.; Gay, B.B. Jr.; Ball, T.I.; Winn, K.J.

    1988-01-01

    Idiopathic fibrosing pancreatitis is a chronic process of unknown etiology characterized by extensive infiltration of the pancreatic parenchyma by fibrous tissue. This disease process is uncommon in the pediatric patient and is consequently rarely considered in the differential diagnosis of abdominal pain and jaundice in the child. The sonographic demonstration of a dilated biliary tree and common bile duct compressed by an enlarged pancreas may be the first suggestion of this entity. Two patients with idiopathic fibrosing pancreatitis and obstructive jaundice are reported with a review of the clinical, radiographic, and pathologic findings.

  11. Localization fibrosing mediastinitis causing pulmonary infraction: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Sur, Young Keun; Kim, Eun Young; Kang, Doo Kyoung; Park, Kyung Joo; Koh, Young Wha; Sun, Joo Sung [Ajou University School of Medicine, Suwon (Korea, Republic of)

    2016-06-15

    A 44-year-old female patient visited our emergency room for hemoptysis and refractory chest wall pain of 2 months duration. She had no history of smoking or other medical conditions. Chest CT scan showed homogenously enhancing soft tissue mass without calcification at the left pulmonary hilum. Encasing and compression of the left lower pulmonary artery by the mass had resulted in pulmonary infarction in the left lower lobe. Laboratory tests for tuberculosis, fungus, and vasculitis were all negative. The patient underwent surgical biopsy and resection of infarcted left lower lobe that was histopathologically confirmed as fibrosing mediastinitis. Herein, we reported a rare case of surgically confirmed and treated localized fibrosing mediastinitis causing pulmonary infarction.

  12. NSF-CBMS Regional Conference

    CERN Document Server

    Rubenfeld, Lester

    1981-01-01

    The articles of these proceedings arise from a NSF-CBMS regional conference on the mathematical modeling of the hearing process, that was held at Rensselaer Polytechnic Institute in the summer of 1980. To put the a=ticles in perspective, it is best to briefly review the history of suc~ modeling. It has proceeded, more or less, in three stages. The first was initiated by Herman Helmholtz in the 1880's, whose theories dominated the subject for years. However, because of his lack of accurate experimental data and his heuristic arguments it became apparent that his models needed revision. Accordingly, based on the experimental observations of von Bekesy, the "long wave" theories were developed in the 1950's by investigators such as Zwislocki, Peterson, and Bogert. However, as the ex?eri~ents became more refined (such as Rhode's ~wssbauer Measurements) even these models came into question. This has brought on a flurry of 'activity in recent years into how to extend the models to account for these more recent eXT. ...

  13. Opportunities for Funding at NSF

    Science.gov (United States)

    Kafafi, Zakya H.

    2009-03-01

    lead to a better quality of life and improved economic development for people all over the world will also be given. As science is becoming increasingly global, DMR is particularly interested in preparing students to be agile thinkers in this universal environment and in forging collaborations and cooperation among scientists and engineers around the world. Free movement of knowledge without any obstacles can only be achieved through a more coordinated approach for international collaboration. Following the presentation there will be a question-and-answer period. For additional information, visit the DMR Web page at www.nsf.gov/materials

  14. Ventilation perfusion radionuclide imaging in cryptogenic fibrosing alveolitis

    International Nuclear Information System (INIS)

    Bourke, S.J.; Hawkins, T.; Keavey, P.M.; Gascoigne, A.D.; Corris, P.A.

    1993-01-01

    There is increasing interest in ventilation perfusion (V/Q) imaging in cryptogenic fibrosing alveolitis because of the data these scans provide on the dynamic V/Q relationships in such patients undergoing single lung transplantation. We analysed the V/Q scans of 45 consecutive patients with advanced cryptogenic fibrosing alveolitis being considered for single lung transplantation. Scans were classified according to the presence, severity and degree of matching of defects in ventilation and perfusion images and the results were compared with the data obtained from lung function tests. Ventilation images showed defects in 13 (29%) and ''washout delay'' in 15 (33%) patients; 10 (22%) patients had asymmetric distribution of ventilation with one lung receiving >60% of total ventilation. Perfusion images showed normal perfusion in 8 (18%), mild defects in 18 (40%) and major defects in 19 (42%) patients. The distribution of perfusion between lungs was significantly asymmetric in 20 (45%) patients. V/Q images were matched in 15 (33%), mildly mismatched in 15 (33%) and severely mismatched in 15 (33%) patients, but the degree of V/Q mismatch did not show a relationship to KCO, PaO 2 or A-aO 2 gradient. The appearances were atypical of pulmonary embolism in eight patients. (Author)

  15. NSF's Career-Life Balance Initiative and the NSF Astronomy and Astrophysics Postdoctoral Fellowships

    Science.gov (United States)

    Ajhar, Edward A.

    2013-01-01

    In the fall of 2011, the National Science Foundation (NSF) began the Career-Life Balance Initiative to support graduate students, postdoctoral students, and early-career researchers in STEM fields. NSF is focusing first on its most prestigious programs for early-career scientists---the CAREER program and the postdoctoral programs, including the NSF Astronomy and Astrophysics Postdoctoral Fellowships (AAPF)---where career-life balance opportunities can help retain a significant fraction of early career talent. Subject to budget constraints, NSF plans to further integrate and enhance career-life balance opportunities over time through other programs, like the Graduate Research Fellowships Program and ADVANCE, and subsequently through the broader portfolio of NSF activities. In addition, to comply with Title IX, NSF has regulations to ensure that educational programs that receive NSF funds are free of gender discrimination and harassment. A primary goal of this presentation is to put facts about NSF into the hands of students, faculty, staff, administrators and other policy makers to benefit the advancement of career-life balance in the astronomical community. The presentation focus areas will (1) address common misconceptions about NSF rules regarding parental leave; (2) discuss benefits already available through the AAPF program, Graduate Research Fellowships, and other programs; and (3) listen to community concerns and issues to bring these back to the foundation for consideration. Did you know that NSF allows paid parental leave under many circumstances? For example, the AAPF program currently allows two months of paid parental leave during the fellow's tenure. What are the rules for NSF Graduate Research Fellowships? Come to the session and find out; the answers to such questions might surprise you.

  16. Cryptogenic fibrosing alveolitis and lung cancer: the BTS study.

    Science.gov (United States)

    Harris, J M; Johnston, I D A; Rudd, R; Taylor, A J Newman; Cullinan, P

    2010-01-01

    The risk of lung cancer is often reported to be increased for patients with cryptogenic fibrosing alveolitis (CFA). Vital status was sought for all 588 members of the British Thoracic Society (BTS) cryptogenic fibrosing alveolitis (CFA) study 11 years after entry to the cohort. Observed deaths due to lung cancer were compared with expected deaths using age-, sex- and period-adjusted national rates. The roles of reported asbestos exposure and smoking were also investigated. 488 cohort members (83%) had died; 46 (9%) were certified to lung cancer (ICD9 162). The standardised mortality ratio (SMR) was 7.4 (95% CI 5.4 to 9.9). Stratified analysis showed increased lung cancer mortality among younger subjects, men and ever smokers. Using an independent expert panel, 25 cohort members (4%) were considered to have at least moderate exposure to asbestos; the risk of lung cancer was increased for these subjects (SMR 13.1 (95% CI 3.6 to 33.6)) vs 7.2 (95% CI 5.2 to 9.7) for those with less or no asbestos exposure). Ever smoking was reported by 448 (73%) of the cohort and was considerably higher in men than in women (92% vs 49%; p<0.001). Most persons who died from lung cancer were male (87%), and all but two (96%) had ever smoked. Ever smokers presented at a younger age (mean 67 vs 70 years; p<0.001) and with less breathlessness (12% smokers reported no breathlessness vs 5% never smokers; p = 0.02). These findings confirm an association between CFA and lung cancer although this relationship may not be causal. The high rate of smoking and evidence that smokers present for medical attention earlier than non-smokers suggest that smoking could be confounding this association.

  17. POCA Update: An NSF PAARE Project

    Science.gov (United States)

    Walter, Donald K.; Brittain, S. D.; Cash, J. L.; Hartmann, D. H.; Howell, S. B.; King, J. R.; Leising, M. D.; Mayo, E. A.; Mighell, K. J.; Smith, D. M., Jr.

    2011-01-01

    We report on the status of "A Partnership in Observational and Computational Astronomy (POCA)” under the NSF's "Partnerships in Astronomy and Astrophysics Research and Education (PAARE)" program. This partnership includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) and the National Optical Astronomy Observatory. We have reached the midpoint of this 5-year award and discuss the successes, challenges and obstacles encountered to date. Included is a summary of our summer REU program, the POCA graduate fellowship program, faculty research capacity building, outreach activities, increased use of NSF facilities and shared resources. Additional POCA research presentations by the authors are described elsewhere in these proceedings. Support for this work was provided by the NSF PAARE program to South Carolina State University under award AST-0750814 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory.

  18. Aerobic fitness in patients with fibrositis. A controlled study of respiratory gas exchange and 133-xenon clearance from exercising muscle

    International Nuclear Information System (INIS)

    Bennett, R.M.; Clark, S.R.; Goldberg, L.; Nelson, D.; Bonafede, R.P.; Porter, J.; Specht, D.

    1989-01-01

    Aerobic fitness was evaluated in 25 women with fibrositis, by having them exercise to volitional exhaustion on an electronically braked cycle ergometer. Compared with published standards, greater than 80% of the fibrositis patients were not physically fit, as assessed by maximal oxygen uptake. Compared with matched sedentary controls, fibrositis patients accurately perceived their level of exertion in relation to oxygen consumption and attained a similar level of lactic acidosis, as assessed by their respiratory quotient and ventilatory threshold. Exercising muscle blood flow was estimated by 133-xenon clearance in a subgroup of 16 fibrositis patients and compared with that in 16 matched sedentary controls; the fibrositis patients exhibited reduced 133-xenon clearance. These results indicate a need to include aerobic fitness as a matched variable in future controlled studies of fibrositis and suggest that the detraining phenomenon may be of relevance to the etiopathogenesis of the disease

  19. PET scanning of macrophages in patients with scleroderma fibrosing alveolitis

    Energy Technology Data Exchange (ETDEWEB)

    Branley, Howard M. [Imperial College London, Hammersmith Campus, London (United Kingdom)], E-mail: Howard.Branley@whittington.nhs.uk; Bois, Roland M. du; Wells, Athol U. [Royal Brompton Hospital, London (United Kingdom); Jones, Hazel A. [Imperial College London, Hammersmith Campus, London (United Kingdom)

    2008-11-15

    Rationale: Assessment of disease activity in fibrosing alveolitis due to systemic sclerosis (FASSc) is difficult without using invasive investigation. A repeatable noninvasive method of assessing disease at a cellular level such as with positron emission tomography (PET) could be of great value in evaluating high-resolution changes in the pathological process. Objectives: To investigate whether the level of inflammatory cell traffic and lung density in FASSc, imaged in vivo by PET, is different to controls and whether they are associated with changes in pulmonary function indices. Methods: We used PET to measure lung density and tissue uptake of {sup 11}C-[R]-PK11195, a ligand that binds to receptors found in abundance in macrophages. Fifteen patients with FASSc were compared to seven controls. Results: A trend of reduced uptake of {sup 11}C-[R]-PK11195 was observed in FASSc patients (P=.09) and correlated inversely with lung density (r=-.62; P<.05), which was significantly elevated in FASSc [0.35{+-}0.02 vs. 0.23{+-}0.02 g/cc (mean{+-}S.E.M.); P<.005]. Conclusion: These results demonstrate that inflammatory cell traffic and lung density can be imaged in vivo in FASSc using PET, and that this approach might be of potential value in understanding, in situ, components of pathogenesis that may have value for prognosis.

  20. PET scanning of macrophages in patients with scleroderma fibrosing alveolitis

    International Nuclear Information System (INIS)

    Branley, Howard M.; Bois, Roland M. du; Wells, Athol U.; Jones, Hazel A.

    2008-01-01

    Rationale: Assessment of disease activity in fibrosing alveolitis due to systemic sclerosis (FASSc) is difficult without using invasive investigation. A repeatable noninvasive method of assessing disease at a cellular level such as with positron emission tomography (PET) could be of great value in evaluating high-resolution changes in the pathological process. Objectives: To investigate whether the level of inflammatory cell traffic and lung density in FASSc, imaged in vivo by PET, is different to controls and whether they are associated with changes in pulmonary function indices. Methods: We used PET to measure lung density and tissue uptake of 11 C-[R]-PK11195, a ligand that binds to receptors found in abundance in macrophages. Fifteen patients with FASSc were compared to seven controls. Results: A trend of reduced uptake of 11 C-[R]-PK11195 was observed in FASSc patients (P=.09) and correlated inversely with lung density (r=-.62; P<.05), which was significantly elevated in FASSc [0.35±0.02 vs. 0.23±0.02 g/cc (mean±S.E.M.); P<.005]. Conclusion: These results demonstrate that inflammatory cell traffic and lung density can be imaged in vivo in FASSc using PET, and that this approach might be of potential value in understanding, in situ, components of pathogenesis that may have value for prognosis

  1. Prevalence of asymptomatic coronary disease in fibrosing idiopathic interstitial pneumonias

    International Nuclear Information System (INIS)

    Cassagnes, Lucie; Gaillard, Vianney; Monge, Emmanuel; Faivre, Jean-Baptiste; Delhaye, Cédric; Molinari, Francesco; Petyt, Grégory; Hossein-Foucher, Claude; Wallaert, Benoit; Duhamel, Alain; Remy, Jacques; Remy-Jardin, Martine

    2015-01-01

    Background: Because of growing body of interest on the association between fibrosing idiopathic interstitial pneumonias (f-IIP) and ischaemic heart disease, we initiated this prospective study to evaluate the prevalence of asymptomatic coronary artery disease (CAD) in patients with f-IIP. Methods: Forty-two patients with f-IIP underwent noninvasive screening for CAD that included (a) a chest CT examination enabling calculation of the coronary artery calcium (CAC) score, then depiction of coronary artery stenosis; and (b) stress myocardial perfusion scintigraphy (MPS). Patients with significant coronary abnormalities, defined by a CAC score >400 or coronary artery stenosis >50% at CT and/or perfusion defect >5% at MPS, were referred to the cardiologist. Coronary angiography was indicated in presence of a perfusion defect >10% at MPS or significant left main or proximal left anterior descending stenosis whatever MPS findings. Results: Combining CT and MPS, significant abnormalities were detected in 32/42 patients (76%). The cardiologist: (a) did not consider further investigation in 21 patients (CT abnormalities but no ischaemia at MPS: 12/21; false-positive findings at MPS: 3/21; poor respiratory condition: 6/21); (b) proceeded to coronary angiography in 11 patients which confirmed significant stenoses in 5 patients (5/42; 12%). In the worst-case-scenario (i.e., inclusion of 6 patients with significant coronary artery abnormalities who were not investigated due to poor respiratory condition), the prevalence of CAD reached 26% (11/42). Conclusion: In the studied population of patients with f-IIP, asymptomatic CAD ranged between 12% and 26%

  2. Measures of the inflammatory response in cryptogenic fibrosing alveolitis

    International Nuclear Information System (INIS)

    Pantin, C.F.; Valind, S.O.; Sweatman, M.; Lawrence, R.; Rhodes, C.G.; Brudin, L.; Britten, A.; Hughes, J.M.; Turner-Warwick, M.

    1988-01-01

    Cryptogenic fibrosing alveolitis (CFA) is characterized by interstitial fibrosis and parenchymal inflammation. Eleven patients with CFA (10 proved by lung biopsy) were followed over 2 yr using clinical symptoms, radiographic change, and pulmonary function tests to adjust their treatment. Lung lavage, positron camera (PET) measurements of regional extravascular lung density (Dev), pulmonary blood volume (Vb), and the metabolic rate for 18F-deoxyglucose (MRglc), clearance of 99mTc-diethylenetriaminepentacetate (99mTc-DTPA) aerosol, and lung uptake of 67Ga were measured initially and at the end of the first year to give a profile of the inflammatory response. Compared with normal subjects, there was an increased percentage of neutrophils and eosinophils in the lung lavage, increased Dev (p less than 0.002) with no significant difference in Vb, increased MRglc (p less than 0.02), 99mTc-DTPA clearance (p less than 0.002), and 67Ga uptake (p less than 0.02). The smallest increases in Dev were seen in the two patients with most destruction shown by lung biopsy. There were inverse correlations between Dev and both FVC and TLC, but a direct correlation between Vb and transfer factor. 99mTc-DTPA clearance changed concordantly with clinical status and radiographic and respiratory function changes during the first year. If glucose utilization (MRglc) remained in the normal range between the initial and first yearly assessment, the patient improved or remained stable during the second year as shown by clinical status and radiographic and respiratory function measurements. If it rose or remained high, the patient's condition deteriorated

  3. Cicatricial organising pneumonia mimicking a fibrosing interstitial pneumonia.

    Science.gov (United States)

    Churg, Andrew; Wright, Joanne L; Bilawich, AnaMaria

    2018-04-01

    Organising pneumonia (OP) is composed of loose granulation tissue plugs in distal airspaces; these disappear with steroid treatment. Recently a variant labelled 'cicatricial' OP has been described in which the granulation tissue organised to much denser fibrous tissue but still retained the usual pattern of OP. Here we report 10 patients thought to have an interstitial lung disease, and who on biopsy had a variant of cicatricial OP characterised by linear bands or small nodular masses of dense fibrous tissue that does not resemble ordinary OP. The bands/nodules were usually distributed randomly but occasionally resembled fibrotic non-specific interstitial pneumonia in local areas. Small foci of loose granulation tissue at the edge of the fibrotic bands sometimes mimicked fibroblast foci. Recognisable conventional OP was always present, but often in very small amounts. Four cases, including one patient with Ehlers-Danlos syndrome, showed formation of bone in the fibrotic bands and nodules. On computerised tomography (CT) scan of the chest some cases looked like typical OP, but some demonstrated only irregularly distributed linear opacities, sometimes with associated calcification. Follow-up imaging on six cases showed that the process either markedly improved or remained stable over time; no case had progressive disease. Cicatricial OP with this pathological pattern represents an uncommon form of OP that appears to be a generally benign process which may have persisting linear opacities on CT scan but that does not progress; however, it can be confused on biopsy and CT with a fibrosing interstitial pneumonia. © 2017 John Wiley & Sons Ltd.

  4. Prevalence of asymptomatic coronary disease in fibrosing idiopathic interstitial pneumonias

    Energy Technology Data Exchange (ETDEWEB)

    Cassagnes, Lucie; Gaillard, Vianney [Department of Thoracic Imaging (EA 2694), Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Monge, Emmanuel [Department of Pulmonology, Center of Competence for Rare Pulmonary Diseases, Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Faivre, Jean-Baptiste [Department of Thoracic Imaging (EA 2694), Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Delhaye, Cédric [Department of Cardiology, Cardiology Hospital, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Molinari, Francesco [Department of Thoracic Imaging (EA 2694), Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Petyt, Grégory; Hossein-Foucher, Claude [Department of Nuclear Medicine, Hospital Salengro, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Wallaert, Benoit [Department of Pulmonology, Center of Competence for Rare Pulmonary Diseases, Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Duhamel, Alain [Department of Medical Statistics (EA 2694), Univ Lille Nord de France, F-59000 Lille (France); Remy, Jacques [Department of Thoracic Imaging (EA 2694), Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France); Remy-Jardin, Martine, E-mail: martine.remy@chru-lille.fr [Department of Thoracic Imaging (EA 2694), Hospital Calmette, CHRU and Univ Lille 2 Nord de France, F-59000 Lille (France)

    2015-01-15

    Background: Because of growing body of interest on the association between fibrosing idiopathic interstitial pneumonias (f-IIP) and ischaemic heart disease, we initiated this prospective study to evaluate the prevalence of asymptomatic coronary artery disease (CAD) in patients with f-IIP. Methods: Forty-two patients with f-IIP underwent noninvasive screening for CAD that included (a) a chest CT examination enabling calculation of the coronary artery calcium (CAC) score, then depiction of coronary artery stenosis; and (b) stress myocardial perfusion scintigraphy (MPS). Patients with significant coronary abnormalities, defined by a CAC score >400 or coronary artery stenosis >50% at CT and/or perfusion defect >5% at MPS, were referred to the cardiologist. Coronary angiography was indicated in presence of a perfusion defect >10% at MPS or significant left main or proximal left anterior descending stenosis whatever MPS findings. Results: Combining CT and MPS, significant abnormalities were detected in 32/42 patients (76%). The cardiologist: (a) did not consider further investigation in 21 patients (CT abnormalities but no ischaemia at MPS: 12/21; false-positive findings at MPS: 3/21; poor respiratory condition: 6/21); (b) proceeded to coronary angiography in 11 patients which confirmed significant stenoses in 5 patients (5/42; 12%). In the worst-case-scenario (i.e., inclusion of 6 patients with significant coronary artery abnormalities who were not investigated due to poor respiratory condition), the prevalence of CAD reached 26% (11/42). Conclusion: In the studied population of patients with f-IIP, asymptomatic CAD ranged between 12% and 26%.

  5. Frontal fibrosing alopecia and lichen planus pigmentosus: diagnosis and therapeutic challenge.

    Science.gov (United States)

    Mulinari-Brenner, Fabiane Andrade; Guilherme, Marina Riedi; Peretti, Murilo Calvo; Werner, Betina

    2017-01-01

    Frontal fibrosing alopecia is a variant of lichen planopilaris with marginal progressive hair loss on the scalp, eyebrows and axillae. We report a case of frontal fibrosing alopecia and lichen planus pigmentosus in a postmenopausal woman, that started with alopecia on the eyebrows and then on the frontoparietal region, with periocular and cervical hyperpigmentation of difficult management. The condition was controlled with systemic corticosteroid therapy and finasteride. Lichen planus pigmentosus is an uncommon variant of lichen planus frequently associated with frontal fibrosing alopecia in darker phototipes. It should be considered in patients affected by scarring alopecia with a pattern of lichen planopilaris and areas of skin hyperpigmentation revealing perifollicular hyperpigmentation refractory to multiple treatments. This case illustrates diagnostic and therapeutic challenge in face of scarring alopecia and perifollicular hyperpigmentation.

  6. Controvérsias na fibrose cística: do pediatra ao especialista

    Directory of Open Access Journals (Sweden)

    Ribeiro Jose Dirceu

    2002-01-01

    Full Text Available Objetivos: nos últimos 70 anos, a fibrose cística emergiu da obscuridade para o reconhecimento como a mais importante doença hereditária, potencialmente letal, incidente na raça branca. Embora seja uma doença genética, na qual o defeito básico acomete células de vários órgãos, nem todos os indivíduos expressam respostas clínicas na mesma intensidade. Várias manifestações clínicas, principalmente pulmonares e digestivas, podem ocorrer durante a vida dos pacientes fibrocísticos. O objetivo deste artigo é propiciar ao pediatra geral uma visão atualizada dos principais assuntos referentes à fibrose cística. Fontes dos dados: revisão sistemática e atualizada em fonte de dados oficial (Medline. Síntese dos dados: foram revisados 79 artigos sobre fibrose cística, de periódicos internacionais, colocando, de modo atual e crítico, os principais eventos relacionados com a incidência, a fisiopatogenia, as manifestações clínicas, o diagnóstico e o tratamento da fibrose cística. Conclusões: apesar de não existir cura para essa doença, muitos conhecimentos novos sobre a etiologia e a fisiopatologia, adquiridos nas duas últimas décadas, propiciaram uma nova abordagem para o tratamento da fibrose cística. A compreensão dos mecanismos básicos da doença pulmonar, bem como das manifestações digestivas na fibrose cística, decorrente dos conhecimentos de pesquisas recentes, tem sido a chave para o aumento da sobrevida e a melhora da qualidade de vida dos pacientes.

  7. Idiopathic fibrosing pancreatitis: a rare cause of chronic obstructive jaundice in childhood

    International Nuclear Information System (INIS)

    Park, Hye Seong; Kim, Hyun Sook; Kim, Hack Hee; Kim, Ok Hwa; Kim, Choon Yul; Bahk, Yong Whee

    1992-01-01

    We report a 14-months-old infant who had obstructive jaundice caused by idiopathic fibrosing pancreatitis. Ultrasonography and abdominal computed tomography showed dilatation of the intrahepatic ducts, common bile duct, and the pancreatic duct. Diffuse swelling of the pancreas was also noted on CT. At laparotomy, the head portion of the pancreas revealed a stony hard consistency, and proliferation of fibrotic tissue was confirmed pathologically. Idiopathic fibrosing pancreatitis is a very rare disease entity in childhood, but should be considered in the differential diagnosis of obstructive jaundice in children who demonstrate bile duct and pancreatic duct dilatation and/or diffuse pancreas swelling

  8. Successful Treatment of Fibrosing Organising Pneumonia Causing Respiratory Failure with Mycophenolic Acid.

    Science.gov (United States)

    Paul, Christina; Lin-Shaw, Ammy; Joseph, Mariamma; Kwan, Keith; Sergiacomi, Gianluigi; Mura, Marco

    2016-01-01

    Organising pneumonia (OP) is usually promptly responsive to corticosteroid treatment. We describe a series of 3 cases of severe, progressive, biopsy-proven fibrosing OP causing respiratory failure. All cases presented with peribronchial and subpleural consolidations, had a fibro-inflammatory infiltrative component in the alveolar septa, and only had a partial and unsatisfactory response to corticosteroids. However, they responded to mycophenolic acid (MPA) treatment with resolution of respiratory failure as well as clinical and functional improvement. MPA as an additional treatment option for aggressive forms of fibrosing OP and interstitial lung disease needs to be further explored. © 2016 S. Karger AG, Basel.

  9. Fibrose quística em adultos

    Directory of Open Access Journals (Sweden)

    C. Damas

    2007-05-01

    Full Text Available Resumo: Os autores efectuaram uma revisão de doentes adultos com fibrose quística (FQ, seguidos na consulta de Pneumologia no período de 1994-2004 (n=8: cinco mulheres e três homens, com idades compreendidas entre 20 e 34 anos (mediana=27 anos, cuja idade de diagnóstico variou entre os 18 meses e os 31 anos. O diagnóstico foi obtido por prova de suor (positiva em seis doentes e estudo genético (homozigotia para a mutação ΔF508 em quatro doentes. O atingimento respiratório traduziu-se por sinusite e bronquiectasias, acompanhando-se o envolvimento pulmonar por alterações funcionais e também gaso-métricas na maioria dos doentes, ainda que de gravidade variável e não relacionada com a idade de diagnóstico. Verificou-se colonização da árvore brônquica em cinco doentes: Pseudomonas aeruginosa em quatro e Staphilococcus aureus em quatro (verificando-se coloni-zação concomitante por estes agentes em três. As principais causas de exacerbação foram infecções res-piratórias e hemoptises. Quanto ao atingimento não respiratório, quatro doentes apresentavam envolvimento digestivo (com cirrose hepática num caso, um insuficiência renal em hemo-diálise, e em apenas um foi efectuado espermograma para documentação de infertilidade. Quatro doentes tinham osteopenia documentada por densitometria óssea. As medidas terapêuticas mais utilizadas foram a cine-siterapia, os broncodilatadores, a alfa-dornase, muco-líticos, suplementos vitamínicos e enzimáticos, antibio-terapia e oxigenoterapia. Relativamente à evolução, uma doente abandonou a consulta, uma doente faleceu, um doente aguardava transplante pulmonar e os restantes mantiveram as suas características clínicas habituais. Neste grupo, a gravidade da doença pulmonar não se relacionou com o diagnóstico mais tardio, o que se pode dever à diversidade de apresenta

  10. NSF-RANN Trace Contaminants Program directory

    International Nuclear Information System (INIS)

    Purnell, P.A.; Smith, S.K.; Wilkes, C.F.

    1976-10-01

    This directory is designed to aid effective communication throughout the National Science Foundation's Trace Contaminants Program, Research Applied to National Needs. The majority of the participants in the Program are represented by name, address, telephone number, and a very brief description of research interest. The directory has five major divisions to facilitate its use. Section I contains a listing of the program managers associated with the NSF-RANN Trace Contaminants Program. Section II lists the principal investigators, co-principal investigators, and coordinators of each of the research grants in the Program. Section III lists the personnel by individual projects. Section IV contains a total alphabetic listing complete with project titles and Section V contains a keyword index. This directory is maintained by the Toxic Materials Information Center as part of the Environmental Resource Center of the Information Center Complex, Information Division, Oak Ridge National Laboratory

  11. Incidence and prevalence of cryptogenic fibrosing alveolitis in a Norwegian community

    DEFF Research Database (Denmark)

    von Plessen, C; Grinde, O; Gulsvik, A

    2003-01-01

    This study assesses the incidence and prevalence of cryptogenic fibrosing alveolitis (CFA) in a well-defined and stable Norwegian population of 250,000 inhabitants during a period of 15 years. We conducted a file survey of all patients (n = 376) aged 16 years or older with a clinician's diagnosis...

  12. The SC State NSF PAARE Program

    Science.gov (United States)

    Walter, Donald; Ajello, Marco; Brittain, Sean; Cash, Jennifer; Fogle, Bryan; Hartmann, Dieter; Ho, Shirley; Howell, Steve; King, Jeremy; Leising, Mark; Smith, Daniel

    2018-01-01

    We report on the activities of our NSF PAARE program during Year 3 of the project. Our partnership under this award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) and individual investigators at NASA Ames and elsewhere. Our partnership with the Citizen CATE Experiment and involvement in the total solar eclipse which passed through our campus on August 21, 2017, will be discussed. The PAARE project continues to strengthen our partnership with Clemson. We are close to completing a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Additionally, we have worked together under the Citizen CATE project and through other research activities. SC State is a member of the National Astronomy Consortium (NAC) and participates through its faculty and undergraduates, one of whom (Wesley Red) is reporting on his summer internship at this conference. We also served as the state coordinator for South Carolina for the Citizen CATE Experiment. The August 21st path of totality crossed through our campus and the campus of our partner Clemson University. Additional colleges, universities and citizen scientist groups partnered with us to provide 7 sites of coverage across South Carolina from the foothills of the Appalachian mountains to the Atlantic Ocean near the site of departure of the shadow from the continental U.S. Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  13. Dispneia expiratória restritiva em um gato com fibrose pulmonar idiopática: relato de caso

    OpenAIRE

    Pereira, C.O.; Costa, F.V.A.; Gomes, D.C.; Kasper, P.N.; Vieira, A.B.; Driemeier, D.

    2017-01-01

    RESUMO As doenças pulmonares intersticiais constituem um grupo de doenças difusas do parênquima pulmonar, no qual a fibrose pulmonar intersticial está incluída. Histologicamente, esta se caracteriza por hiperplasia de pneumócitos tipo II, hiperplasia ou hipertrofia de músculo liso e fibrose. Embora a patogenia da fibrose pulmonar intersticial não esteja bem elucidada, devido às semelhanças microscópicas encontradas nos pneumócitos tipo II em felinos e na forma familiar da doença em humanos, a...

  14. NSF Funding Rate History By State and Organization

    Data.gov (United States)

    National Science Foundation — Contains FY 2006-FY 2015 National Science Foundation (NSF) funding rates for competitive research proposals by organizational unit. The funding rate is calculated by...

  15. Failure to wean caused by cryptogenic fibrosing pleuritis and bilateral lung trapping: case report Falência do desmame em paciente com fibrose pleural idiopática e trapping pulmonar bilateral: relato de caso

    Directory of Open Access Journals (Sweden)

    Elsemiek Verweel

    2007-12-01

    Full Text Available BACKGROUND AND OBJECTIVES: Cryptogenic fibrosing pleuritis is an extremely rare disease, which can affect both lungs from a very young age. The most common finding is severe lung restriction resulting in both hypoxemic and ventilatory failure. CASE REPORT: Male patient, 26 year old with acute deterioration of chronic respiratory failure. Following admission prolonged mechanical ventilation was necessary. An atypical clinical presentation made the diagnosis difficult, but eventually cryptogenic fibrosing pleuritis and lung fibrosis were established. CONCLUSIONS: The prognostic outcome of patients with the final diagnosis of cryptogenic fibrosing pleuritis is extremely poor, especially in an advanced phase of this disease. We recommend early treatment with corticosteroids or surgical pleural decortication.JUSTIFICATIVA E OBJETIVOS: Fibrose pleural idiopática é uma doença rara e pode afetar ambos pulmões já desde uma idade precoce. O achado mais comum na fibrose pleural idiopática é uma restrição pulmonar grave que pode levar a um quadro de falência respiratória e hipoxemia. RELATO DO CASO: Paciente do sexo masculino, 26 anos, internado com reagudização de insuficiência respiratória crônica e submetido à ventilação mecânica prolongada. Após intensa investigação e uma apresentação clínica atípica, foi estabelecido o diagnóstico de fibrose pleural idiopática associado à fibrose pulmonar. CONCLUSÕES: O prognóstico de pacientes com fibrose pleural idiopática é extremamente ruim, particularmente em fase avançada da doença. Recomenda-se o tratamento precoce com corticosteróides ou decorticação pleural cirúrgica.

  16. NSF celebrates half a century with big plans

    CERN Multimedia

    MacIlwain, C

    1999-01-01

    The future looks good for the NSF as it approaches its 50th birthday. The Clinton administration has proposed a $675 million budget increase for the agency next year. The NSF has also been asked to lead most of the government's recent science initiatives such as those in nanotechnology and computing (1 page).

  17. 48 CFR 2515.215-70 - NSF negotiation authorities.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Negotiation Authorities 2515.215-70 NSF negotiation authorities. (a) Authorities. Citation: 42 U.S.C. 1870(c). (b) Application. When an NSF contract... international cooperation or national security.” Contracts or their modifications entered into under this...

  18. News Focus: NSF Director Erich Bloch Discusses Foundation's Problems, Outlook.

    Science.gov (United States)

    Chemical and Engineering News, 1987

    1987-01-01

    Relates the comments offered in an interview with Erich Bloch, the National Science Foundation (NSF) Director. Discusses issues related to NSF and its funding, engineering research centers, involvement with industry, concern for science education, computer centers, and its affiliation with the social sciences. (ML)

  19. 48 CFR 2527.7002 - NSF patent policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NSF patent policy. 2527... CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Disposition of Rights in Inventions 2527.7002 NSF patent policy. As authorized by the National Science Board at its 230th meeting, October 15-16, 1981, the...

  20. Cyberinfrastructure for the NSF Ocean Observatories Initiative

    Science.gov (United States)

    Orcutt, J. A.; Vernon, F. L.; Arrott, M.; Chave, A.; Krueger, I.; Schofield, O.; Glenn, S.; Peach, C.; Nayak, A.

    2007-12-01

    The Internet today is vastly different than the Internet that we knew even five years ago and the changes that will be evident five years from now, when the NSF Ocean Observatories Initiative (OOI) prototype has been installed, are nearly unpredictable. Much of this progress is based on the exponential growth in capabilities of consumer electronics and information technology; the reality of this exponential behavior is rarely appreciated. For example, the number of transistors on a square cm of silicon will continue to double every 18 months, the density of disk storage will double every year, and network bandwidth will double every eight months. Today's desktop 2TB RAID will be 64TB and the 10Gbps Regional Scale Network fiber optical connection will be running at 1.8Tbps. The same exponential behavior characterizes the future of genome sequencing. The first two sequences of composites of individuals' genes cost tens of millions of dollars in 2001. Dr. Craig Venter just published a more accurate complete human genome (his own) at a cost on the order of 100,000. The J. Craig Venter Institute has provided support for the X Prize for Genomics offering 10M to the first successful sequencing of a human genome for $1,000. It's anticipated that the prize will be won within five years. Major advances in technology that are broadly viewed as disruptive or revolutionary rather than evolutionary will often depend upon the exploitation of exponential expansions in capability. Applications of these ideas to the OOI will be discussed. Specifically, the agile ability to scale cyberinfrastructure commensurate with the exponential growth of sensors, networks and computational capability and demand will be described.

  1. ESO and NSF Sign Agreement on ALMA

    Science.gov (United States)

    2003-02-01

    Green Light for World's Most Powerful Radio Observatory On February 25, 2003, the European Southern Observatory (ESO) and the US National Science Foundation (NSF) are signing a historic agreement to construct and operate the world's largest and most powerful radio telescope, operating at millimeter and sub-millimeter wavelength. The Director General of ESO, Dr. Catherine Cesarsky, and the Director of the NSF, Dr. Rita Colwell, act for their respective organizations. Known as the Atacama Large Millimeter Array (ALMA), the future facility will encompass sixty-four interconnected 12-meter antennae at a unique, high-altitude site at Chajnantor in the Atacama region of northern Chile. ALMA is a joint project between Europe and North America. In Europe, ESO is leading on behalf of its ten member countries and Spain. In North America, the NSF also acts for the National Research Council of Canada and executes the project through the National Radio Astronomy Observatory (NRAO) operated by Associated Universities, Inc. (AUI). The conclusion of the ESO-NSF Agreement now gives the final green light for the ALMA project. The total cost of approximately 650 million Euro (or US Dollars) is shared equally between the two partners. Dr. Cesarsky is excited: "This agreement signifies the start of a great project of contemporary astronomy and astrophysics. Representing Europe, and in collaboration with many laboratories and institutes on this continent, we together look forward towards wonderful research projects. With ALMA we may learn how the earliest galaxies in the Universe really looked like, to mention but one of the many eagerly awaited opportunities with this marvellous facility". "With this agreement, we usher in a new age of research in astronomy" says Dr. Colwell. "By working together in this truly global partnership, the international astronomy community will be able to ensure the research capabilities needed to meet the long-term demands of our scientific enterprise, and

  2. NSF Obligations for Top 200 Institutions by Fiscal Year

    Data.gov (United States)

    National Science Foundation — An text/xml file containing FY 2001 through FY 2015 National Science Foundation (NSF) obligations by institution for the top 200 recipients defined in terms of total...

  3. The NSF and the geosciences community: Rotating program officers

    Science.gov (United States)

    Batiza, Rodey; Rea, David K.; Rumble, Douglas, III

    The National Science Foundation (NSF) is a federal agency charged with the care and feeding of basic scientific research in U.S. colleges and universities. NSF is a major contributor toward the support of research in Earth, ocean, and atmospheric sciences, disciplines of great importance to AGU members.NSF makes a regular practice of employing scientists from universities, nonprofit research organizations, industry, and state or local governments as temporary program officers (“rotators”) with terms of service from 1 to 2 years. There are several reasons for the use of rotators: It brings to NSF people who have firsthand, recent knowledge of "what it is really like" beyond the Washington, D.C. beltway. Knowledge of new ideas, recent graduates, and a fresh look at the system are worth considerably more than the problems that arise owing to inexperienced program officers.It sheds some sunshine on internal NSF procedures when the rotator returns with his tales to his home institution.It provides NSF management with considerable flexibility in coping with changing staff requirements.

  4. Prática fisioterapêutica no tratamento da fibrose cística

    Directory of Open Access Journals (Sweden)

    Carolina Lazzarim de Conto

    2014-08-01

    Full Text Available A fibrose cística (FC, denominada também de mucoviscidose, é uma doença genética do tipo autossômica recessiva que acomete principalmente crianças e indivíduos de raça branca. O objetivo deste estudo foi propiciar uma visão sobre a FC, assim como as possíveis formas de tratamento fisioterapêutico. A pesquisa da literatura foi realizada nas bases de dados SciELO e PubMed, no período de abril de 2002 a março de 2013, através da seleção de artigos científicos referentes à FC, utilizando como palavras-chave: “fibrose cística”, “fisioterapia em fibrose cística” e “fisioterapia respiratória”. Por meio desta revisão, pôde-se observar que, apesar da complexidade da doença, a prática fisioterapêutica, com o uso das técnicas: tapotagem, vibração, drenagem postural (DP, huffing, oscilação oral de alta frequência (OOAF, drenagem autógena (DA e o ciclo ativo da respiração (CAR, apresenta eficácia tanto no tratamento como na manutenção da qualidade de vida dos pacientes com FC.

  5. Isometric and isokinetic muscle strength in patients with fibrositis syndrome. New characteristics for a difficult definable category of patients

    DEFF Research Database (Denmark)

    Jacobsen, Søren; Danneskiold-Samsøe, B

    1987-01-01

    A common complaint among patients with fibrositis syndrome is exhaustion and fatique. It was therefore felt desirable to evaluate the muscle strength of these patients compared with normal subjects. Maximum isometric and isokinetic strength of knee extension was measured in 15 patients and 15...... healthy matched subjects, using an isokinetic dynamometer (Cybex II). Maximum isometric strength at various knee extension angles (90 degrees, 60 degrees and 30 degrees degrees) was significantly (p less than 0.001) lower in the fibrositis group than in controls, a reduction of approximately 58......-66%. Maximum isokinetic strength at various knee extension velocities (30-240 degrees per second) was also significantly (p less than 0.01) lower in the fibrositis group than in controls, the reduction being approximately 41-51%. In conclusion, isometric and isokinetic muscle strength is found to be lower...

  6. O perfil dos cuidadores de pacientes pediátricos com fibrose cística

    OpenAIRE

    Alves, Stella Pegoraro; Bueno, Denise

    2018-01-01

    Resumo O objetivo desse estudo foi identificar o perfil do cuidador principal de pacientes pediátricos com Fibrose Cística (FC). Estudo transversal, descritivo e prospectivo, no qual foi realizado, durante consulta farmacêutica, entrevista com cuidadores de pacientes fibrocísticos acompanhados em um centro de referência de um Hospital Universitário do Sul do Brasil. Foram obtidas informações gerais sobre os cuidadores, sobre o entendimento da doença, os medicamentos em uso do paciente e a din...

  7. Fibrosing mediastinitis and thrombosis of superior vena cava associated with Behcet's disease

    International Nuclear Information System (INIS)

    Harman, Mustafa; Sayarlioglu, Mehmet; Arslan, Halil; Ayakta, Hayati; Harman, Ece

    2003-01-01

    We present CT, MRI and venography findings in 13-year boy with mediastinal fibrosis and superior vena cava (SVC) thrombosis associated with Behcet's disease. Fibrosing mediastinitis is an excessive fibrotic reaction that occurs in the mediastinum and may lead to compression of mediastinal structures (especially vascular). This condition is usually idiopathic, though many (and perhaps most) cases in the USA are thought to be caused by an abnormal immunologic response to Histoplasma capsulatum infection. SVC syndrome secondary to extrinsic compression by mediastinal fibrosis combined with Behcet's disease has rarely been described. Radiological investigations of this syndrome are necessary to avoid a useless anticoagulant therapy

  8. Lethal fibrosing mediastinitis in a child possibly due to Mycobacterium tuberculosis.

    Science.gov (United States)

    Goussard, Pierre; Gie, Robert P; Janson, Jacque

    2018-04-10

    Fibrosing mediastinitis (FM) is a rare benign disease resulting from an excessive fibro-inflammatory reaction in the mediastinum that can compress and occlude mediastinal structures. There is a granulomatous and a diffuse non-granulomatous form of FM. We present a case of granulomatous FM following possible tuberculosis in a young child who presented with severe compression of the airways, pulmonary artery and the superior vena cava (SVC), unresponsive to treatment, resulting in death. Bronchoscopic findings included concentric narrowing and mucosal hyperaemia of the tracheobronchial airways. This case raises awareness of this rare complication and the limited treatment options available. © 2018 Wiley Periodicals, Inc.

  9. Congressional hearing reviews NSF major research and facilities projects

    Science.gov (United States)

    Showstack, Randy

    2012-03-01

    An 8 March congressional hearing about the U.S. National Science Foundation's Major Research Equipment and Facilities Construction (NSF MREFC) account focused on fiscal management and accountability of projects in that account and reviewed concerns raised by NSF's Office of Inspector General (OIG). NSF established the MREFC account in 1995 to better plan and manage investments in major equipment and facilities projects, which can cost from tens of millions to hundreds of millions of dollars, and the foundation has funded 17 MREFC projects since then. The Obama administration's proposed fiscal year (FY) 2013 budget includes funding for four MREFC projects: Advanced Laser Gravitational-Wave Observatory (AdvLIGO), Advanced Technology Solar Telescope (ATST), National Ecological Observatory (NEON), and Ocean Observatories Initiative (OOI). The hearing, held by a subcommittee of the House of Representatives' Committee on Science, Space, and Technology, reviewed management oversight throughout the life cycles of MREFC projects and concerns raised in recent OIG reports about the use of budget contingency funds. NSF's February 2012 manual called "Risk management guide for large facilities" states that cost contingency is "that portion of the project budget required to cover `known unknowns,'" such as planning and estimating errors and omissions, minor labor or material price fluctuations, and design developments and changes within the project scope. Committee members acknowledged measures that NSF has made to improve the MREFC oversight process, but they also urged the agency to continue to take steps to ensure better project management.

  10. MRI of the fingers in patients with systemic scleroderma. Early results of contrast-enhanced examinations on a dedicated MRI system; MRT der Finger bei systemischer Sklerodermie. Erste Ergebnisse mit kontrastverstaerkten Untersuchungen an einem dedizierten MRT-System

    Energy Technology Data Exchange (ETDEWEB)

    Bonel, H.; Seemann, M.; Reiser, M. [Inst. fuer Radiologische Diagnostik, Klinikum Grosshadern, Univ. Muenchen (Germany); Messer, G.; Walchner, M.; Roecken, M. [Dermatologische Klinik und Poliklinik, Univ. Muenchen (Germany)

    1997-10-01

    Purpose. To estimate disease activity in patients with systemic sclerosis using contrast-enhanced MRI of the skin. Material and Methods. In a pre-study, sequences of a low-field (0.2 T) scanner (Artoscan, Esaote, Genova, Italy) were optimized for detection of intravenous contrast (0.1 mmol/l Gd-DTPA) in six patients with the autoimmune disease systemic scleroderma. Based on the results of the pre-study, 17 patients with scleroderma (7 sclerotic/10 active inflammatory disease) were scanned using gradient-spoiled 3D GRE sequences (FA 90 , TR 100 ms, TE 18 ms), which had been established as most sensitive for intravenous contrast. Contrast enhancement of the skin was determined quantitatively by contrast-to-noise ratios (CNR), comparing post- to pre-contrast and dynamic scans (for 6 min, 1 acquisition/min). Patients in the chronic state with sclerodactylia and active inflammation of the hands were considered separately and compared to a control group (n=10) matched according to age. Results. CNR increase after intravenous contrast was significantly higher in patients with active disease (86{+-}16% increase) than sclerosing disease (29{+-}3%, p<0.05) and the control group (4{+-}2%, p<0.05). The dynamic examination showed a significantly slower decrease after the peak rise in the first minute in patients with active disease (CNR 15.4{+-}0.7 to 14.2{+-}1.4) than in those with chronic disease (14.1{+-}0.5 to 11.3{+-}0.9, p<0.05). (orig.) [Deutsch] Zielsetzung der Arbeit war die Quantifizierung der Entzuendungsreaktion der Haut bei an systemischer Sklerodermie erkrankten Patienten mittels kontrastverstaerkter MRT. Material und Methoden. In einer Vorstudie mit 6 Patienten wurden die Sequenzen eines dedizierten Niederfeldmagnetresonanztomographen (Artoscan, Esaote, Genua, Italien) fuer den Kontrastmittelnachweis (0,1 mmol/l Gd-DTPA i.v.) optimiert. Basierend auf dieser Sequenzoptimierung wurden 17 Patienten mit systemischer Sklerodermie (7 Patienten mit sklerosierender, 10

  11. Nephrogenic systemic fibrosis (NSF) and gadolinium-based contrast ...

    African Journals Online (AJOL)

    Nephrogenic systemic fibrosis (NSF), unknown before March 1997 and first described in 2000, is a systemic disorder characterised by widespread tissue fibrosis. The first known case occurred in 1997, after the use of gadolinium-based contrast agents (GBCAs) at high doses in patients with renal failure had become routine.

  12. The design of a switchyard for the NSF isotope separator

    International Nuclear Information System (INIS)

    Malcolm, I.C.; Grant, I.S.

    1982-01-01

    In examining design requirements for the optics of the NSF isotope separator, first-order considerations, voltage requirements, second-order considerations, and shim coil design are discussed. The results are given of a computer study of the system comprising of quadrupole triplet, magnetic and electrostatic sectors. The effects of the accuracy in the fabrication of the electrostatic sector are considered. (U.K.)

  13. Bilateral Breast Enlargement: An Unusual Presentation of Superior Vena Cava Obstruction in a Hemodialysis Patient with Fibrosing Mediastinitis

    International Nuclear Information System (INIS)

    Goo, Dong Erk; Kim, Yong Jae; Choi, Deuk Lin; Kwon, Kui Hyang; Yang, Seung Boo

    2011-01-01

    A 67-year-old woman with end-stage renal disease presented with profound edema of both breasts. The presence of a patent hemodialysis basilic transposition fistula and superior vena cava obstruction (SVC), due to fibrosing mediastinitis, was demonstrated by the use of fistulography. Endovascular treatment with a balloon and stent caused immediate resolution of the breast edema.

  14. NSF-Sponsored Biological and Chemical Oceanography Data Management Office

    Science.gov (United States)

    Allison, M. D.; Chandler, C. L.; Copley, N.; Galvarino, C.; Gegg, S. R.; Glover, D. M.; Groman, R. C.; Wiebe, P. H.; Work, T. T.; Biological; Chemical Oceanography Data Management Office

    2010-12-01

    Ocean biogeochemistry and marine ecosystem research projects are inherently interdisciplinary and benefit from improved access to well-documented data. Improved data sharing practices are important to the continued exploration of research themes that are a central focus of the ocean science community and are essential to interdisciplinary and international collaborations that address complex, global research themes. In 2006, the National Science Foundation Division of Ocean Sciences (NSF OCE) funded the Biological and Chemical Oceanography Data Management Office (BCO-DMO) to serve the data management requirements of scientific investigators funded by the National Science Foundation’s Biological and Chemical Oceanography Sections. BCO-DMO staff members work with investigators to manage marine biogeochemical, ecological, and oceanographic data and information developed in the course of scientific research. These valuable data sets are documented, stored, disseminated, and protected over short and intermediate time frames. One of the goals of the BCO-DMO is to facilitate regional, national, and international data and information exchange through improved data discovery, access, display, downloading, and interoperability. In May 2010, NSF released a statement to the effect that in October 2010, it is planning to require that all proposals include a data management plan in the form of a two-page supplementary document. The data management plan would be an element of the merit review process. NSF has long been committed to making data from NSF-funded research publicly available and the new policy will strengthen this commitment. BCO-DMO is poised to assist in creating the data management plans and in ultimately serving the data and information resulting from NSF OCE funded research. We will present an overview of the data management system capabilities including: geospatial and text-based data discovery and access systems; recent enhancements to data search tools; data

  15. Multifocal fibrosing thyroiditis: report of 55 cases of a poorly recognized entity.

    Science.gov (United States)

    Fellegara, Giovanni; Rosai, Juan

    2015-03-01

    During the course of our consultation activity, we have recognized a peculiar form of thyroiditis in which multiple foci of fibrosis, most of which were associated with reactive atypia of the surrounding follicles, are present. We have referred to this condition, both in our consultation reports and in the third series of A.F.I.P. Fascicle on Tumors of the Thyroid Gland, as "multifocal fibrosing thyroiditis" or (less frequently) "multifocal sclerosing thyroiditis," which are descriptive terms that highlight the benign/inflammatory nature of the process, its multiplicity, and its unknown pathogenesis. The aim of this study is to better define the morphologic features of this process and correlate it with some clinical data. With this purpose, the consultation files of one of the authors (J.R.) were searched for cases coded as multifocal fibrosing thyroiditis or multifocal sclerosing thyroiditis in a 20-year period ranging from January 1989 to December 2009. A total of 55 cases were identified that displayed the above-listed features. There were 51 (93%) female and 4 (7%) male patients (F/M=12.75), with ages ranging between 15 and 71 years (mean age, 47.03 y; median age, 44.5 y). Microscopically, multiple foci of fibrosis were identified in all cases, their number ranging from 2 to 51 per case (mean number, 16), with a mean diameter of 3 mm (range: 0.36 to 15.1 mm). Although heterogenous in shape and size, the individual foci were rather similar to each other in composition, being characterized by a fibrotic poorly cellular center that merged with a cellular peripheral zone. Some of the follicular structures present at the periphery of the scar and-to a lesser extent-those entrapped inside it underwent complex reactive and regenerative (atypical) changes that simulated malignancy. We discuss the differential diagnosis with other benign and malignant thyroid conditions and speculate about its pathogenesis and possible relationship with papillary thyroid microcarcinoma.

  16. 21st Century Kinematics : The 2012 NSF Workshop

    CERN Document Server

    2013-01-01

    21st Century Kinematics focuses on algebraic problems in the analysis and synthesis of mechanisms and robots, compliant mechanisms, cable-driven systems and protein kinematics. The specialist contributors provide the background for a series of presentations at the 2012 NSF Workshop. The text shows how the analysis and design of innovative mechanical systems yield increasingly complex systems of polynomials, characteristic of those systems. In doing so, takes advantage of increasingly sophisticated computational tools developed for numerical algebraic geometry and demonstrates the now routine derivation of polynomial systems dwarfing the landmark problems of even the recent past. The 21st Century Kinematics workshop echoes the NSF-supported 1963 Yale Mechanisms Teachers Conference that taught a generation of university educators the fundamental principles of kinematic theory. As such these proceedings will be provide admirable supporting theory for a graduate course in modern kinematics and should be of consid...

  17. NSF's Perspective on Space Weather Research for Building Forecasting Capabilities

    Science.gov (United States)

    Bisi, M. M.; Pulkkinen, A. A.; Bisi, M. M.; Pulkkinen, A. A.; Webb, D. F.; Oughton, E. J.; Azeem, S. I.

    2017-12-01

    Space weather research at the National Science Foundation (NSF) is focused on scientific discovery and on deepening knowledge of the Sun-Geospace system. The process of maturation of knowledge base is a requirement for the development of improved space weather forecast models and for the accurate assessment of potential mitigation strategies. Progress in space weather forecasting requires advancing in-depth understanding of the underlying physical processes, developing better instrumentation and measurement techniques, and capturing the advancements in understanding in large-scale physics based models that span the entire chain of events from the Sun to the Earth. This presentation will provide an overview of current and planned programs pertaining to space weather research at NSF and discuss the recommendations of the Geospace Section portfolio review panel within the context of space weather forecasting capabilities.

  18. Extracellular Gd-CA: Differences in prevalence of NSF

    International Nuclear Information System (INIS)

    Thomsen, Henrik S.; Marckmann, Peter

    2008-01-01

    Until recently it was believed that extracellular gadolinium-based contrast agents were safe for both the kidneys and all other organs within the dose range up to 0.3 mmol/kg body weight. However, in 2006, it was demonstrated that some gadolinium-based contrast agents may trig the development of nephrogenic systemic fibrosis, a generalized fibrotic disorder, in renal failure patients. As no prospective studies can be performed we must rely on retrospective data. From those data it is obvious that the prevalence of NSF is significantly higher after the unstable agent gadodiamide than after any other gadolinium-based agent (3-7% versus 0-1% per injection) in patients with reduced renal function. Prevalence after exposure to two gadodiamide injections is as high as 36% in patients with chronic kidney disease (CKD) stage 5. No report of NSF after the most stable agents has been reported in the peer-reviewed literature documenting that there is a difference between the various agents regarding triggering NSF

  19. Exacerbação aguda da fibrose pulmonar idiopática

    Directory of Open Access Journals (Sweden)

    Natália Melo

    2009-03-01

    Full Text Available Resumo: Alguns doentes com fibrose pulmonar idiopática (FPI apresentam durante a sua evolução fases de agravamento clínico sem causa conhecida, designadas como “exacerbação aguda” ou “fase acelerada” da doença (EA. Caracterizam-se pelo agravamento marcado da dispneia, hipoxemia e pelo aparecimento de novas opacidades pulmonares ou pelo agravamento das já existentes no estudo imagiológico. Os achados histológicos típicos são o dano alveolar difuso (DAD sobreposto a alterações de pneumonia intersticial usual (UIP. Esta entidade clínica associa-se a uma mortalidade elevada, não havendo até ao momento nenhuma terapêutica de comprovada eficácia.Os autores descrevem os casos clínicos de cinco doentes que apresentaram alterações clínicas, funcionais e radiológicas sugestivas de EA-FPI, assim como o tratamento efectuado e a evolução observada, enquadrando-os na discussão das características normalmente apresentadas por esta entidade. Abstract: Some patients with Idiopathic Pulmonary Fibrosis (IPF have disease accelerated deterioration without identifiable cause referred as “acute exacerbation” or “accelerated stage”. It is characterized by severe worsening of dyspnea, hypoxemia and new or progressive opacities on imaging studies. The typical histological findings are diffuse alveolar damage in addition to the features of usual interstitial pneumonia pattern. Mortality in this clinical entity is very high and no efficacious therapeutic have been described.The authors describe the clinical, functional and radiological features, treatment and evolution of five patients with IPF acute exacerbation. A discussion will be carry out concerning the IPF acute exacerbation usual features comparing with the alterations noticed in those patients. Palavras-chave: Fibrose pulmonar idiopática, exacerbação aguda, Key words: Idiopathic

  20. Fibrose quística: Revisão

    Directory of Open Access Journals (Sweden)

    C. Damas

    2008-01-01

    Full Text Available Resumo: A fibrose quística (FQ é a doença autossómica recessiva mais frequente na raça caucasiana. Caracteriza-se por mutações na CFTR, uma proteína transmembranar responsável pelo transporte de cloretos. Esta proteína tem uma ampla distribuição epitelial, o que dá um carácter sistémico a esta doença e consequentemente múltiplas manifestações clínicas de gravidade variável. A melhoria dos cuidados de saúde, associada ao desenvolvimento do arsenal terapêutico, permitiu um aumento da sobrevida destes doentes, de tal forma que a FQ já não pode ser abordada como doença da idade pediátrica. Também a evolução técnica na transplantação abriu novas perspectivas quanto ao tratamento desta afecção.Assim, cada vez mais esta patologia implica um envolvimento multidisciplinar no qual a pneumologia tem uma parte preponderante. Abstract: Cystic Fibrosis (CF is the recessive autossomic disease more frequent in the caucasian race. The main characteristic is a mutation in CFTR, a trans-membranar protein, responsible for chlorates transportation. This protein has a diffuse epithelial distribution, which gives a multissistemic involvement to this disease, with clinical manifestations with variable degrees of severity. The development of better health care associated with new therapeutic options became responsible for an increase of survival, so CF is no longer a paediatric disease. Lung transplantation also has an important role, bringing new treatment perspectives.So, this pathology has an increased multi-disciplinary involvement in which the pulmonologist have a preponderant role. Palavras-chave: Fibrose quística, revisão, Key-words: Cystic fibrosis, review

  1. Traction bronchiectasis in cryptogenic fibrosing alveolitis: associated computed tomographic features and physiological significance

    International Nuclear Information System (INIS)

    Desai, Sujal R.; Wells, Athol U.; Bois, Roland M. du; Rubens, Michael B.; Hansell, David M.

    2003-01-01

    Our objective was to evaluate the associated CT features and physiological consequences of traction bronchiectasis in patients with cryptogenic fibrosing alveolitis (CFA). The CT scans of 212 patients with CFA (158 men, 54 women; mean age 62.2±10.6 years) were evaluated independently by two observers. The extent of fibrosis, the proportions of a reticular pattern and ground-glass opacification and the extent of emphysema were scored at five levels. The predominant CT pattern, coarseness of a reticular pattern and severity of traction bronchiectasis were graded semiquantitatively. Physiological indices were correlated with CT features. There was traction bronchiectasis on CT in 202 of 212 (95%) patients. Increasingly severe traction bronchiectasis was independently associated with increasingly extensive CFA (p CO (p 2 (p<0.0005), but not indices of air-flow obstruction. In CFA, traction bronchiectasis increases with more extensive disease, a lower proportion of ground-glass opacification and a coarser reticular pattern, but it decreases with concurrent emphysema. Increasingly severe traction bronchiectasis is associated with additional physiological impairment for a given extent of pulmonary fibrosis and emphysema. (orig.)

  2. Multifocal fibrosing thyroiditis and its association with papillary thyroid carcinoma using BRAF pyrosequencing.

    Science.gov (United States)

    Frank, Renee; Baloch, Zubair W; Gentile, Caren; Watt, Christopher D; LiVolsi, Virginia A

    2014-09-01

    Multifocal fibrosing thyroiditis (MFT) is characterized by numerous foci of fibrosis in a stellate configuration with fibroelastotic and fibroblastic centers entrapping epithelial structures. MFT has been proposed as a risk factor for papillary thyroid carcinoma (PTC) development. We attempted to identify whether MFT showed such molecular changes and could possibly be related to PTC. We identified seven cases of PTC with MFT in our institutional pathology database and personal consult service of one of the authors (VAL) for the years 1999 to 2012. Areas of PTC, MFT, and normal tissue were selected for BRAF analysis. Macro-dissection, DNA extraction and PCR amplification, and pyrosequencing were performed to detect BRAF mutations in codon 600. All of the MFT lesions and normal thyroid tissue were negative for BRAF mutations. Of the seven PTCs analyzed, five (71 %) were negative for BRAF mutations, while two cases were positive. In our study, none of the MFT lesions harbored BRAF mutations, whereas 29 % (two of seven) PTCs in the same gland were positive. Hence, in this small study, we found no evidence that the MFT lesion is a direct precursor to PTC. It is likely an incidental bystander in the process and a reflection of the background thyroiditis.

  3. Traction bronchiectasis in cryptogenic fibrosing alveolitis: associated computed tomographic features and physiological significance

    Energy Technology Data Exchange (ETDEWEB)

    Desai, Sujal R. [Department of Radiology, King' s College Hospital, Denmark Hill, SE5 9RS, London (United Kingdom); Wells, Athol U.; Bois, Roland M. du [Interstitial Lung Disease Unit, Royal Brompton Hospital, Emmanuel Kaye Building, Manresa Road, Fulham, SW6 6LR, London (United Kingdom); Rubens, Michael B.; Hansell, David M. [Department of Radiology, Royal Brompton Hospital, Sydney Street, SW3 6NP, London (United Kingdom)

    2003-08-01

    Our objective was to evaluate the associated CT features and physiological consequences of traction bronchiectasis in patients with cryptogenic fibrosing alveolitis (CFA). The CT scans of 212 patients with CFA (158 men, 54 women; mean age 62.2{+-}10.6 years) were evaluated independently by two observers. The extent of fibrosis, the proportions of a reticular pattern and ground-glass opacification and the extent of emphysema were scored at five levels. The predominant CT pattern, coarseness of a reticular pattern and severity of traction bronchiectasis were graded semiquantitatively. Physiological indices were correlated with CT features. There was traction bronchiectasis on CT in 202 of 212 (95%) patients. Increasingly severe traction bronchiectasis was independently associated with increasingly extensive CFA (p<0.0005), a coarser reticular pattern (p<0.001), a lower proportion of ground-glass opacification (p<0.005) and less extensive emphysema (p<0.0005). Increasingly severe traction bronchiectasis was independently related to depression of DL{sub CO} (p<0.005), FVC (p=0.02) and pO{sub 2} (p<0.0005), but not indices of air-flow obstruction. In CFA, traction bronchiectasis increases with more extensive disease, a lower proportion of ground-glass opacification and a coarser reticular pattern, but it decreases with concurrent emphysema. Increasingly severe traction bronchiectasis is associated with additional physiological impairment for a given extent of pulmonary fibrosis and emphysema. (orig.)

  4. NSF-RANN Trace Contaminants Program directory. [Personnel directory

    Energy Technology Data Exchange (ETDEWEB)

    Purnell, P.A.; Smith, S.K.; Wilkes, C.F.

    1976-10-01

    This directory is designed to aid effective communication throughout the National Science Foundation's Trace Contaminants Program, Research Applied to National Needs. The majority of the participants in the Program are represented by name, address, telephone number, and a very brief description of research interest. The directory has five major divisions to facilitate its use. Section I contains a listing of the program managers associated with the NSF-RANN Trace Contaminants Program. Section II lists the principal investigators, co-principal investigators, and coordinators of each of the research grants in the Program. Section III lists the personnel by individual projects. Section IV contains a total alphabetic listing complete with project titles and Section V contains a keyword index. This directory is maintained by the Toxic Materials Information Center as part of the Environmental Resource Center of the Information Center Complex, Information Division, Oak Ridge National Laboratory.

  5. Geoscience Workforce Development at UNAVCO: Leveraging the NSF GAGE Facility

    Science.gov (United States)

    Morris, A. R.; Charlevoix, D. J.; Miller, M.

    2013-12-01

    Global economic development demands that the United States remain competitive in the STEM fields, and developing a forward-looking and well-trained geoscience workforce is imperative. According to the Bureau of Labor Statistics, the geosciences will experience a growth of 19% by 2016. Fifty percent of the current geoscience workforce is within 10-15 years of retirement, and as a result, the U.S. is facing a gap between the supply of prepared geoscientists and the demand for well-trained labor. Barring aggressive intervention, the imbalance in the geoscience workforce will continue to grow, leaving the increased demand unmet. UNAVCO, Inc. is well situated to prepare undergraduate students for placement in geoscience technical positions and advanced graduate study. UNAVCO is a university-governed consortium facilitating research and education in the geosciences and in addition UNAVCO manages the NSF Geodesy Advancing Geosciences and EarthScope (GAGE) facility. The GAGE facility supports many facets of geoscience research including instrumentation and infrastructure, data analysis, cyberinfrastructure, and broader impacts. UNAVCO supports the Research Experiences in the Solid Earth Sciences for Students (RESESS), an NSF-funded multiyear geoscience research internship, community support, and professional development program. The primary goal of the RESESS program is to increase the number of historically underrepresented students entering graduate school in the geosciences. RESESS has met with high success in the first 9 years of the program, as more than 75% of RESESS alumni are currently in Master's and PhD programs across the U.S. Building upon the successes of RESESS, UNAVCO is launching a comprehensive workforce development program that will network underrepresented groups in the geosciences to research and opportunities throughout the geosciences. This presentation will focus on the successes of the RESESS program and plans to expand on this success with broader

  6. Update on the NSF PAARE Program at SC State

    Science.gov (United States)

    Walter, Donald K.; Ajello, Marco; Brittain, Sean D.; Cash, Jennifer; Hartmann, Dieter; Ho, Shirley; Howell, Steve B.; King, Jeremy R.; Leising, Mark D.; Smith, Daniel M.

    2017-01-01

    We report on results from our NSF PAARE program during Year 2 of the project. Our partnership under this PAARE award includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) as well as individual investigators at NASA Ames and Carnegie Mellon University. Our recent work on variable and peculiar stars, work with the Kepler Observatory and our educational products in cosmology for non-STEM majors will be presented. We have successfully piloted sharing our teaching resources by offering an upper-level astrophysics course taught at Clemson via video conferencing , allowing a graduating senior from SC State to take a course not available through his home institution. Additionally, we are working on a memorandum of agreement between the two institutions that will allow for the seamless transfer of an undergraduate from SC State to Clemson’s graduate program in physics and astronomy. Our curriculum work includes new web-based cosmology activities and laboratory experiments. SC State undergraduates are reporting at this conference on their work with the light curves of semiregular variables using Kepler data. Additionally, we are heavily involved in the Citizen CATE Experiment. A PAARE scholarship student from SC State and the PAARE PI traveled to Indonesia for the March 2016 solar eclipse. Their results are also being presented elsewhere at this conference (see Myles McKay’s poster). Support for this work includes our NSF PAARE award AST-1358913 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Additional support has been provided by the South Carolina Space Grant Consortium and from NASA to SC State under awards NNX11AB82G and NNX13AC24G. CATE work has been supported by NASA SMD award NNX16AB92A to the National Solar Observatory. Additional details can be found at: http://physics.scsu.edu

  7. Demonstration of differential quantitative requirements for NSF among multiple vesicle fusion pathways of GLUT4 using a dominant-negative ATPase-deficient NSF

    International Nuclear Information System (INIS)

    Chen Xiaoli; Matsumoto, Hideko; Hinck, Cynthia S.; Al-Hasani, Hadi; St-Denis, Jean-Francois; Whiteheart, Sidney W.; Cushman, Samuel W.

    2005-01-01

    In this study, we investigated the relative participation of N-ethylmaleimide-sensitive factor (NSF) in vivo in a complex multistep vesicle trafficking system, the translocation response of GLUT4 to insulin in rat adipose cells. Transfections of rat adipose cells demonstrate that over-expression of wild-type NSF has no effect on total, or basal and insulin-stimulated cell-surface expression of HA-tagged GLUT4. In contrast, a dominant-negative NSF (NSF-D1EQ) can be expressed at a low enough level that it has little effect on total HA-GLUT4, but does reduce both basal and insulin-stimulated cell-surface HA-GLUT4 by ∼50% without affecting the GLUT4 fold-translocation response to insulin. However, high expression levels of NSF-D1EQ decrease total HA-GLUT4. The inhibitory effect of NSF-D1EQ on cell-surface HA-GLUT4 is reversed when endocytosis is inhibited by co-expression of a dominant-negative dynamin (dynamin-K44A). Moreover, NSF-D1EQ does not affect cell-surface levels of constitutively recycling GLUT1 and TfR, suggesting a predominant effect of low-level NSF-D1EQ on the trafficking of GLUT4 from the endocytic recycling compared to the intracellular GLUT4-specific compartment. Thus, our data demonstrate that the multiple fusion steps in GLUT4 trafficking have differential quantitative requirements for NSF activity. This indicates that the rates of plasma and intracellular membrane fusion reactions vary, leading to differential needs for the turnover of the SNARE proteins

  8. Histopathologic Overlap between Fibrosing Mediastinitis and IgG4-Related Disease

    Directory of Open Access Journals (Sweden)

    Tobias Peikert

    2012-01-01

    Full Text Available Fibrosing mediastinitis (FM and IgG4-related disease (IgG4-RD are two fibroinflammatory disorders with potentially overlapping clinical and radiological features. In this paper, we looked for histopathologic features of IgG4-RD and enumerated infiltrating IgG4-positive plasma cells within mediastinal tissue biopsies from FM patients. We identified 15 consecutive FM surgical mediastinal tissue biopsies between 1985 and 2006. All patients satisfied the clinical and radiological diagnostic criteria for FM. All patients had either serological or radiological evidence of prior histoplasmosis or granulomatous disease, respectively. Formalin-fixed paraffin-embedded tissue sections of all patients were stained for H&E, IgG, and IgG4. Three samples met the predefined diagnostic criteria for IgG4-RD. In addition, characteristic histopathologic changes of IgG4-RD in the absence of diagnostic numbers of tissue infiltrating IgG4-positive plasma cells were seen in a number of additional cases (storiform cell-rich fibrosis in 11 cases, lymphoplasmacytic infiltrate in 7 cases, and obliterative phlebitis/arteritis in 2 cases. We conclude that up to one-third of histoplasmosis or granulomatous-disease-associated FM cases demonstrate histopathological features of IgG4-RD spectrum. Whether these changes occur as the host immune response against Histoplasma or represent a manifestation of IgG4-RD remains to be determined. Studies to prospectively identify these cases and evaluate their therapeutic responses to glucocorticoids and/or other immunosuppressive agents such as rituximab are warranted.

  9. Morphologic and molecular study of lung cancers associated with idiopathic pulmonary fibrosis and other pulmonary fibroses.

    Science.gov (United States)

    Guyard, Alice; Danel, Claire; Théou-Anton, Nathalie; Debray, Marie-Pierre; Gibault, Laure; Mordant, Pierre; Castier, Yves; Crestani, Bruno; Zalcman, Gérard; Blons, Hélène; Cazes, Aurélie

    2017-06-15

    Primitive lung cancers developed on lung fibroses are both diagnostic and therapeutic challenges. Their incidence may increase with new more efficient lung fibrosis treatments. Our aim was to describe a cohort of lung cancers associated with idiopathic pulmonary fibrosis (IPF) and other lung fibrotic disorders (non-IPF), and to characterize their molecular alterations using immunohistochemistry and next-generation sequencing (NGS). Thirty-one cancer samples were collected from 2001 to 2016 in two French reference centers for pulmonary fibrosis - 18 for IPF group and 13 for non-IPF group. NGS was performed using an ampliseq panel to analyze hotspots and targeted regions in 22 cancer-associated genes. ALK, ROS1 and PD-L1 expressions were assessed by immunohistochemistry. Squamous cell carcinoma was the most frequent histologic subtype in the IPF group (44%), adenocarcinoma was the most frequent subtype in the non-IPF group (62%). Forty-one mutations in 13 genes and one EGFR amplification were identified in 25 samples. Two samples had no mutation in the selected panel. Mutations were identified in TP53 (n = 20), MET (n = 4), BRAF (n = 3), FGFR3, PIK3CA, PTEN, STK11 (n = 2), SMAD4, CTNNB1, DDR2, ERBB4, FBXW7 and KRAS (n = 1) genes. No ALK and ROS1 expressions were identified. PD-L1 was expressed in 10 cases (62%) with only one (6%) case >50%. This extensive characterization of lung fibrosis-associated cancers evidenced molecular alterations which could represent either potential therapeutic targets either clues to the pathophysiology of these particular tumors. These findings support the relevance of large molecular characterization of every lung fibrosis-associated cancer.

  10. Fibrosing variant of Hashimoto thyroiditis is an IgG4 related disease.

    Science.gov (United States)

    Deshpande, Vikram; Huck, Amelia; Ooi, Esther; Stone, John H; Faquin, William C; Nielsen, G Petur

    2012-08-01

    Hashimoto thyroiditis (HT) and the fibrosing variant of Hashimoto thyroiditis (FVHT) are immune-mediated tumefactive lesions of the thyroid. Immunoglobulin G4-related disease (IgG4-RD) is now a widely recognised multi-organ system disease characterised by elevated serum and tissue concentrations of IgG4. In this study, the authors address several unresolved questions pertaining to the relationship between HT and FVHT, and the association of each of these diseases with IgG4-RD. The authors evaluated 28 consecutive cases of HT and nine cases of FVHT. The clinical, demographic and serological data were recorded. The slides were stained immunohistochemically using antibodies to IgG4 and IgG and the quantitative analysis was recorded. Data on thyroid function tests were available on seven cases of FVHT and 14 cases of HT. Based on the availability of data, hypothyroidism was noted in 62% (9/14) of HT and 86% of FVHT (6/7). FVHT demonstrated an exaggerated lobular pattern with lobules separated by cellular storiform-type fibrosis, resembling fibrosis seen in other forms of IgG-RD. The median IgG4 counts per high power field (×40) in HT and FVHT were 2.3 and 22, respectively. The median IgG4:IgG ratios in HT and FVHT were 0.11 and 0.58, respectively. The authors propose that FVHT belongs to the spectrum of IgG4-RD. Although a proportion of cases of HT show elevated numbers of IgG4 positive plasma cells, these cases lack the histological features typically associated with IgG4-RD, and thus the relationship between HT and IgG4-RD remains unproven.

  11. ESTUDO BIOQUÍMICO DO POTENCIAL DA MEMBRANA AMNIÓTICA NA FIBROSE HEPÁTICA INDUZIDA EM RATOS

    Directory of Open Access Journals (Sweden)

    Shaine Silva Maciel

    2016-11-01

    Full Text Available A fibrose hepática causada por obstrução do ducto biliar induz alterações tanto na estrutura como na função do fígado, e pode levar a cirrose e insuficiência hepática, quando não tradada. A membrana amniótica humana (MA devido às suas propriedades anti-inflamatórias e anti-fibróticas pode ser uma terapia alternativa. A proposta desse trabalho é analisar as alterações nos níveis séricos das principais enzimas celulares e da albumina, na fibrose hepática induzida pela ligadura do ducto biliar (LDB e após o tratamento com a MA. Dez ratos foram divididos nos grupos LDB e LDB+MA, e eutanasiados após 9 semanas da LDB. As amostras de sangue foram processadas bioquimicamente para análise da albumina (ALB, fosfatase alcalina (FA e transaminases (TGP e TGO.  Comparando os grupos experimentais verificou-se que no grupo LDB+MA houve a diminuição da ALB e TGP e no grupo LDB houve a diminuição da FA e TGO, entretanto sem apresentar diferença significante entre os grupos. Conclui-se que a MA, quando aplicada ao fígado no mesmo momento da indução da fibrose, parece não ter exercido efeito significativo na função hepática.

  12. Fibrose idiopática do mediastino: A propósito de um caso clínico

    Directory of Open Access Journals (Sweden)

    Maria João Canotilho

    2005-03-01

    Full Text Available Resumo: Descreve-se o caso clínico de um doente do sexo masculino com uma massa mediastínica de crescimento lento. Após terem-se efectuado vários exames complementares, foi através de cirurgia que se confirmou o diagnóstico de fibrose idiopática do mediastino. A remoção parcial da massa permitiu uma estabilização transitória das suas dimensões. Cerca de quatro anos depois, verificou-se um crescimento marcado com repercurssões importantes, através da inevitável compressão de estruturas vitais, que conduziram a hipertensão pulmonar grave. A fibrose idiopática do mediastino é uma entidade extremamente rara, estando descritas associações a outras patologias, mais frequentemente às auto-imunes, mas apresenta sempre um curso fatal quando não é possível a cirurgia.Rev Port Pneumol 2005; XI (2: 155-163 Abstract: We herein report a case of a male patient, who presented a mediastinal mass that had a slow growth over the years. After surgery, that made the diagnosis of idiopathic mediastinal fibrosis, the growth stabilized. Four years latter it was observed a substantial increase which lead to the inevitable compression of vital structures which, in turn, led to pulmonary hypertension. Idiopathic mediastinal fibrosis is an extremely rare pathology. There are same cases in which it is associated with other pathologies but has always a fatal prognosis when surgery is not an option.Rev Port Pneumol 2005; XI (2: 155-163 Palavras-chave: Fibrose do mediastino, síndroma da veia cava superior, hipertensão pulmonar, mediastinite fibrosante, Key words: Mediastinal fibrosis, superior vena cava syndrome, pulmonary hypertension, fibrosis mediastinites

  13. Síndrome mieloproliferativa transitória associada à trissomia do 21 e fibrose hepática

    Directory of Open Access Journals (Sweden)

    Sant'Anna Anna L.

    2002-01-01

    Full Text Available Recém-nascidos com Síndrome de Down (SD podem apresentar uma proliferação transitória de células imaturas no sangue periférico e medula óssea. A leucometria pode estar muito elevada, impossibilitando o diagnóstico diferencial com leucemia mielóide aguda (LMA. Em contraste com a LMA, a SMT regride espontaneamente em quatro a oito semanas. Objetivo: Apresentar uma criança com SD, SMT e fibrose hepática, que resultou num prognóstico desfavorável. Relato do Caso: D.M.S., masculino, estigmas da SD, hepatoesplenomegalia, sopro sistólico. Hemograma: 95.000 leucócitos/mm³, 19% blastos, 170.000 plaquetas/mm³, hemoglobina 16,2g/dL. Bilirrubina total 35,86 mg/dL, GOT 184 UI, GPT 122 UI. Ecocardiograma: canal átrio-ventricular total, hipertensão pulmonar, persistência do canal arterial. Sorologias negativas. Biópsia hepática: colestase, fibrose portal e sinusoidal, elementos mielóides imaturos. Após normalização da leucometria, manteve plaquetopenia e disfunção hepática. No 50º dia de vida, quimioterapia com Daunoblastina e Citarabina. Evoluiu com pneumonia e insuficiência renal. Óbito no 61ºdia. Comentários: A história natural da SMT gera questões intrigantes a respeito de sua origem, evolução e desenvolvimento de leucemia subseqüente. A disfunção hepática e a fibrose têm impacto prognóstico. Em relato anterior, de cada oito casos de SMT com disfunção hepática, seis evoluíram para óbito, sendo que fibrose hepática difusa, associada a eritropoese extra-medular, foi encontrada em quatro casos. Acredita-se que a lesão hepática resulta da produção de citocinas pelos megacariócitos, por ser o fígado o segundo órgão hematopoético de células anormais, após a medula óssea.

  14. NRAO Response to NSF Senior Review of Astronomy Facilities

    Science.gov (United States)

    2006-11-01

    The National Science Foundation's (NSF) Astronomy Senior Review Committee report (pdf file), released today, made major recommendations for restructuring the NSF's ground-based astronomy efforts, including significant changes for the National Radio Astronomy Observatory (NRAO). The committee's report urged that leadership in radio astronomy, including millimeter- and submillimeter-wave observatories, "remain centered at NRAO as it is, by far, the largest radio astronomy organization in the world." The report praised the record of management of NRAO and the scientific capabilities of the Atacama Large Millimeter/submillimeter Array (ALMA), the Expanded Very Large Array (EVLA), the Robert C. Byrd Green Bank Telescope (GBT), and the Very Long Baseline Array (VLBA). However, the report also recommended that some reductions and changes occur at the NRAO by 2011. Specifically, the report recommended that: (a) VLBA operations make a transition to a significant reliance on international funding or risk closure; (b) GBT operations costs be reduced; and (c) NRAO scientific staff costs be reduced. "The Senior Review Committee had the very difficult task of reconciling the needs of current facilities and funding new facilities for the future of astronomy. We appreciate their efforts and look forward to working with the NSF to ensure that the valuable and unique research capabilities of our NRAO telescopes continue to serve the astronomical community," said Dr. Fred K.Y. Lo, NRAO Director. The VLBA provides the greatest angular resolution, or ability to see fine detail, of any telescope in the world, greatly exceeding the capabilities of the Hubble Space Telescope and the future Square Kilometre Array. The committee recognized that, "if the VLBA is closed, a unique capability would likely be lost for decades." "The VLBA is used by scientists from around the world because of its unique capabilities. It has produced landmark research milestones and the committee recognized in its

  15. Measurements on the NSF injector and analysing magnets

    International Nuclear Information System (INIS)

    Armitage, S.A.; Barker, D.; Eastham, D.A.; Kivlin, F.J.; Tait, N.R.S.

    1979-08-01

    Two 90 0 uniform field magnets are to be installed in the Nuclear Structure Facility (NSF). Their purpose and design are summarized. The effects of various field errors on the performance of a 90 0 double focusing magnet were investigated using a beam optics programme. The results were used to draw up the specification for the magnets. Subsequent checks were made on the angles β of the effective field boundaries with and without the field clamps in place and of the uniformity of the field along the beam orbit in the orbit plane. Checks were also made on radial uniformity in the orbit plane. In order to ensure reliability of calibration of the magnetic field in terms of the field at the NMR probe, reproducibility of field distributions for various excitation cycles was studied. Finally the performance of the magnets was checked directly using high quality α-sources located at the object point, detecting the image at the image point using a position sensitive surface barrier detector. The results of studies on the inflector magnet have been published. (author)

  16. 45 CFR 689.5 - Initial NSF handling of misconduct matters.

    Science.gov (United States)

    2010-10-01

    ... regulation. (c) If OIG determines that alleged research misconduct involves potential civil or criminal... FOUNDATION RESEARCH MISCONDUCT § 689.5 Initial NSF handling of misconduct matters. (a) NSF staff who learn of... awardee institution of the alleged research misconduct and encourage it to undertake an inquiry; (2) Defer...

  17. 78 FR 69839 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2013-11-21

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). The Federal Advisory Committee Act (Pub. L. 92-463, 86... CONTACT: John Kogut, Executive Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy...

  18. 75 FR 57463 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2010-09-21

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). Federal Advisory Committee Act (Pub. L. 92-463, 86... Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy; SC-25/ Germantown Building, 1000...

  19. 77 FR 4027 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2012-01-26

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). The Federal Advisory Committee Act (Pub. L. 92-463, 86... Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy; SC-25/ Germantown Building, 1000...

  20. 76 FR 41234 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2011-07-13

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). The Federal Advisory Committee Act (Pub. L. 92-463, 86... Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy; SC-25/ Germantown Building, 1000...

  1. 76 FR 19986 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2011-04-11

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). The Federal Advisory Committee Act (Pub. L. 92-463, 86... FURTHER INFORMATION CONTACT: John Kogut, Executive Secretary; High Energy Physics Advisory Panel; U.S...

  2. 75 FR 63450 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2010-10-15

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). Federal Advisory Committee Act (Pub. L. 92-463, 86... 20852. FOR FURTHER INFORMATION CONTACT: John Kogut, Executive Secretary; High Energy Physics Advisory...

  3. 76 FR 8358 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2011-02-14

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy.../NSF High Energy Physics Advisory Panel (HEPAP). Federal Advisory Committee Act (Pub. L. 92-463, 86... Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy; SC-25/ Germantown Building, 1000...

  4. 45 CFR 680.11 - Staff involvement with NSF proposals and awards.

    Science.gov (United States)

    2010-10-01

    ... teaching careers to spend a year or two at NSF and then return to research and teaching, usually at the... SCIENCE FOUNDATION NATIONAL SCIENCE FOUNDATION RULES OF PRACTICE AND STATUTORY CONFLICT-OF-INTEREST EXEMPTIONS Rules of Practice for the National Science Foundation § 680.11 Staff involvement with NSF...

  5. Fibrose cística: uma abordagem clínica e nutricional Cystic fibrosis: a clinical and nutritional approach

    Directory of Open Access Journals (Sweden)

    Fernanda Ribeiro Rosa

    2008-12-01

    Full Text Available A fibrose cística é a doença genética letal mais comum em populações caucasianas e é caracterizada por infecções crônicas e recorrentes do pulmão, insuficiência pancreática e elevados níveis de cloro no suor. É uma doença de herança autossômica recessiva causada pela mutação no gene do Regulador da Condutância Transmembrana da Fibrose Cística, que induz o organismo a produzir secreções espessas e viscosas que obstruem os pulmões, o pâncreas e o ducto biliar. Muitos pacientes apresentam insuficiência pancreática, que leva a má-absorção de nutrientes especialmente de proteínas e lipídeos e a complicações gastrintestinais tais como prolapso retal, síndrome da obstrução intestinal, constipação e cirrose hepática. A fibrose cística normalmente é diagnosticada na infância, pelos programas de triagem neonatal ou pelo teste do suor. Devido aos vários sistemas envolvidos e à variabilidade e cronicidade da doença, uma abordagem multidisciplinar é essencial para auxiliar o paciente e sua família a compreenderem a doença e aderirem ao tratamento. A terapia atual da fibrose cística inclui a manutenção do estado nutricional, a remoção das secreções das vias aéreas com fisioterapia e mucolíticos, o uso de antibióticos para prevenção e tratamento de infecções, a prescrição de suplementos energéticos, dietas hiperlípidicas e hiperprotéicas, bem como a suplementação de minerais e vitaminas lipossolúveis. O objetivo deste trabalho foi realizar breve revisão de literatura sobre os aspectos clínicos e nutricionais da fibrose cística.Cystic fibrosis is the most common, lethal, genetic disease in Caucasian populations and is characterized by chronic and recurrent lung infections, pancreatic insufficiency and high sweat chloride levels. It is an autosomal recessive hereditary disease caused by a mutation in the cystic fibrosis transmembrane conductance regulator gene which induces the body to

  6. Fibrose pulmonar idiopática: uma década de progressos Idiopathic pulmonary fibrosis: a decade of progress

    Directory of Open Access Journals (Sweden)

    Jeffrey J. Swigris

    2006-06-01

    Full Text Available Embora diagnósticos de fibrose pulmonar idiopática continuem sendo devastadores, avanços recentes têm melhorado nossa compreensão a respeito de muitas das facetas desta doença. Estas descobertas, juntamente com o aumento da disponibilidade geral de ensaios terapêuticos, encerram a promessa de um futuro mais promissor para pacientes com fibrose pulmonar idiopática. Por exemplo, nós temos agora uma compreensão mais abrangente a respeito dos critérios diagnósticos e da história natural da doença. Vários estudos têm mostrado que a mensuração simples da fisiologia pulmonar ou troca gasosa pode ser usada para prever a sobrevida do paciente. Através da identificação de várias vias moleculares que têm papéis importantes na patogênese da fibrose pulmonar idiopática, os pesquisadores têm produzido uma lista crescente de possíveis novos alvos terapêuticos para a doença. Vários ensaios terapêuticos prospectivos e controlados têm sido realizados. Outros estão em andamento ou ainda estão em fase de planejamento. Estes esforços têm avançado nosso conhecimento atual sobre fibrose pulmonar idiopática e levantado novas questões importantes, assim como têm gerado o interesse e o impulso necessários para avançar terreno na luta contra esta doença desafiadora. Este artigo oferece ao leitor um panorama dos avanços recentes nas pesquisas sobre fibrose pulmonar idiopática, tendo como foco a história natural, patogênese e tratamento.Although idiopathic pulmonary fibrosis remains a devastating diagnosis, recent advances have improved our understanding of many facets of this disease. These breakthroughs, combined with the increased general availability of therapeutic trials, hold the promise of a brighter future for idiopathic pulmonary fibrosis patients. For example, we now have a more comprehensive understanding of the diagnostic criteria and natural history of the disease. Several studies have shown that simple

  7. C14. Um caso de polimiosite, fibrose pulmonar e cancro do pulmão

    Directory of Open Access Journals (Sweden)

    Carlos Lopes

    2003-11-01

    Full Text Available Os autores apresentam o caso clínico de um doente do sexo masculino, de 67 anos, fumador (50 UMA. Trabalhou na marinha durante 30 anos, onde esteve exposto a fibras de asbestos.Aparentemente estável até aos 62 anos, altura em que refere início de quadro clínico de dispneia de esforço, de agravamento progressivo. Um ano depois episódio de febre, tosse produtiva e mialgias.Ao exame objectivo eram evidentes hipocratismo digital e fervores subcrepitantes em ambas as bases, na auscultação torácica.Os aspectos vizualizados na TC Torácica eram compatíveis com Pneumonia Intersticial Usual e o lavado broncoalveolar excluiu outras doenças.O estudo da função respiratória mostrou um síndrome restritivo com diminuição da capacidade de difusão do CO.Foi administrada terapêutica com Deflazacort, acetilcisteína e azatioprina. Devido a agravamento clínico e funcional, azatioprina foi substituída por ciclofosfamida. Dois anos depois foi iniciada terapêutica com Interferão Gamma 1b, com melhoria clínica e funcional, durante um ano.Foi então feito o diagnóstico de Polimiosite e recebeu terapêutica com imunoglobulina.Doze meses depois foi internado com quadro clínico de febre intermitente, tosse seca, dispneia de esforço de agravamento progressivo e mialgias. A TC Torácica revelou pulmão em favo e bronquiectasias. No lobo inferior esquerdo foi detectado um nódulo periférico. O doente foi submetido a biópsia aspirativa transtorácica, o padrão imunohistoquímico do tecido revelou Cancro do Pulmão de Pequenas Células. No estadiamento foram identificadas adenopatias hilares e mediastínicas e múltiplas metástases hepáticas. Apenas foi efectuada uma administração de quimioterapia (carboplatinum e etoposido, sem qualquer tipo de resposta. O doente faleceu duas semanas depois.Está documentada a associação de Polimiosite com várias Neoplasias, neste caso clínico, o doente desenvolveu fibrose pulmonar antes de ter sido feito

  8. Two different trichoscopic patterns of mid-frontal scalp in patients with frontal fibrosing alopecia and clinical features of androgenetic alopecia

    Directory of Open Access Journals (Sweden)

    Adriana Rakowska

    2017-03-01

    Full Text Available Introduction . Frontal fibrosing alopecia is a primary lymphocytic cicatricial alopecia with progressive frontotemporal hairline recession. In some cases, hair loss in the mid-frontal scalp, similar to female pattern hair loss, may be observed. Objective. Assessment of the trichoscopic pattern of mid-frontal scalp hair loss in patients diagnosed with frontal fibrosing alopecia. Material and methods. The retrospective analysis included 31 women diagnosed with frontal fibrosing alopecia and hair loss in the mid-frontal scalp and 36 women diagnosed with female pattern hair loss. Results . In patients with frontal fibrosing alopecia two different trichoscopic patterns in the mid-frontal scalp were identified. In 68% of patients (21/31 we observed a diffuse fibrotic pattern. It was characterized by irregular arrangement of follicular units with small areas with loss of follicular units, an increased percentage of follicular units with one hair and a decreased percentage of follicular units with three hairs, normal hair shaft thickness and presence of mild perifollicular scaling. The androgenetic alopecia pattern was present in 32% of patients (10/31. It was characterized by hair shaft thickness diversity (20% or more, a percentage of vellus hairs higher than 10%, presence of yellow dots, an increased percentage of follicular units with one hair and a decreased percentage of follicular units with three hairs. Conclusions. In patients with frontal fibrosing alopecia and coexisting mid-frontal scalp hair loss, we identified two different patterns of this area in trichoscopy: the diffuse fibrotic pattern (more common and the androgenetic alopecia pattern. This observation may have therapeutic and prognostic implications.

  9. Brokering technologies to realize the hydrology scenario in NSF BCube

    Science.gov (United States)

    Boldrini, Enrico; Easton, Zachary; Fuka, Daniel; Pearlman, Jay; Nativi, Stefano

    2015-04-01

    In the National Science Foundation (NSF) BCube project an international team composed of cyber infrastructure experts, geoscientists, social scientists and educators are working together to explore the use of brokering technologies, initially focusing on four domains: hydrology, oceans, polar, and weather. In the hydrology domain, environmental models are fundamental to understand the behaviour of hydrological systems. A specific model usually requires datasets coming from different disciplines for its initialization (e.g. elevation models from Earth observation, weather data from Atmospheric sciences, etc.). Scientific datasets are usually available on heterogeneous publishing services, such as inventory and access services (e.g. OGC Web Coverage Service, THREDDS Data Server, etc.). Indeed, datasets are published according to different protocols, moreover they usually come in different formats, resolutions, Coordinate Reference Systems (CRSs): in short different grid environments depending on the original data and the publishing service processing capabilities. Scientists can thus be impeded by the burden of discovery, access and normalize the desired datasets to the grid environment required by the model. These technological tasks of course divert scientists from their main, scientific goals. The use of GI-axe brokering framework has been experimented in a hydrology scenario where scientists needed to compare a particular hydrological model with two different input datasets (digital elevation models): - the Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) dataset, v.2. - the Shuttle Radar Topography Mission (SRTM) dataset, v.3. These datasets were published by means of Hyrax Server technology, which can provide NetCDF files at their original resolution and CRS. Scientists had their model running on ArcGIS, so the main goal was to import the datasets using the available ArcPy library and have EPSG:4326 with the same resolution grid as the

  10. Fibrose quística em adultos Cystic fibrosis in adults

    Directory of Open Access Journals (Sweden)

    C Damas

    2007-05-01

    Full Text Available Os autores efectuaram uma revisão de doentes adultos com fibrose quística (FQ, seguidos na consulta de Pneumologia no período de 1994-2004 (n=8: cinco mulheres e três homens, com idades compreendidas entre 20 e 34 anos (mediana = 27 anos, cuja idade de diagnóstico variou entre os 18 meses e os 31 anos. O diagnóstico foi obtido por prova de suor (positiva em seis doentes e estudo genético (homozigotia para a mutação ÄF508 em quatro doentes. O atingimento respiratório traduziu-se por sinusite e bronquiectasias, acompanhando-se o envolvimento pulmonar por alterações funcionais e também gasométricas na maioria dos doentes, ainda que de gravidade variável e não relacionada com a idade de diagnóstico. Verificou-se colonização da árvore brônquica em cinco doentes: Pseudomonas aeruginosa em quatro e Staphilococcus aureus em quatro (verificando-se colonização concomitante por estes agentes em três. As principais causas de exacerbação foram infecções respiratórias e hemoptises. Quanto ao atingimento não respiratório, quatro doentes apresentavam envolvimento digestivo (com cirrose hepática num caso, um insuficiência renal em hemodiálise, e em apenas um foi efectuado espermograma para documentação de infertilidade. Quatro doentes tinham osteopenia documentada por densitometria óssea. As medidas terapêuticas mais utilizadas foram a cinesiterapia, os broncodilatadores, a alfa-dornase, mucolíticos, suplementos vitamínicos e enzimáticos, antibioterapia e oxigenoterapia. Relativamente à evolução, uma doente abandonou a consulta, uma doente faleceu, um doente aguardava transplante pulmonar e os restantes mantiveram as suas características clínicas habituais. Neste grupo, a gravidade da doença pulmonar não se relacionou com o diagnóstico mais tardio, o que se pode dever à diversidade de apresentação fenotípica da FQ na idade adulta.The authors reviewed adult cystic fibrosis patients followed in the Pulmonology

  11. Estado nutricional em pacientes atendidos por um programa de adultos para fibrose cística

    Directory of Open Access Journals (Sweden)

    Bruna Ziegler

    2008-02-01

    Full Text Available Introdução: Na fibrose cística (FC, o estado nutricional está associado com o crescimento, função pulmonar e índices de so-brevida. Objetivo: Avaliar o estado nutricional em adultos com FC e correlacionar com escore clínico, escore radiológico, pressões respiratórias estáticas máximas, capacidade submáxima de exercício e função pulmonar. Metodologia: O estudo realizado foi transver-sal e prospectivo, em pacientes (16 anos ou mais, atendidos em um programa para adultos com FC. Os pacientes foram submetidos a uma avaliação nutricional e clínica, ao teste de caminhada de seis minutos (TC6, à medida das pressões respiratórias máximas, a espirometria e exame radiológico do tórax. Resultados: O estudo incluiu 41 pacientes com media de idade de 23,7 ± 6,5 anos e média de índice de massa corporal (IMC de 20,2 ± 2,2 Kg/m2. Vinte e seis pacientes (63,4% foram classificados como bem nutridos (IMC = 21,7 ± 2,0 Kg/m2, 6 (14,6% como risco nutricional (IMC = 19,4 ± 0,5 Kg/m2 e 9 (22% como desnutridos (IMC = 17,6 ± 0,8 Kg/m2. Não houve correlação significativa entre IMC e a idade (r = 0,24; P = 0,13, idade do diagnóstico (r = -0,04; P = 0,81, escore clínico (r = 0,13; P = 0,40 e radiográfico (r = -0,22; P = 0,17, distância percorrida no TC6 (r = 0,20; P = 0,20, VEF1 % (r = 0,11; P = 0,50 e CVF % (r = 0,06; P = 0,72. Também não houve associação entre o declínio do estado nutricional e essas variáveis. Conclusão: Este estudo mos-trou que a maioria dos pacientes com FC (16 anos ou mais tem um adequado estado nutricional (63,4%, mas uma porcentagem signi-ficante (36,6% tem depleção nutricional. Não houve associação entre o estado nutricional e a função pulmonar, pressões respiratórias máximas, escore clínico e radiográfico e a capacidade submáxima de exercício.

  12. Uterine prolapse with endometrial eversion in association with an unusual diffuse, polypoid, fibrosing perimetritis and parametritis in a cat.

    Science.gov (United States)

    Valentine, Matthew J; Porter, Susan; Chapwanya, Aspinas; Callanan, John J

    2016-01-01

    This case describes a young non-pregnant cat that presented with uterine prolapse in association with an unusual diffuse, polypoid, fibrosing perimetritis and parametritis. Following ovariohysterectomy the cat recovered fully. No intra-abdominal complications were seen on ultrasound examination 3 months postsurgery. At the time of writing, the cat remains healthy. Uterine prolapse in the cat is relatively rare and usually associated with the periparturient period. Inflammatory polypoid perimetritis and parametritis have not previously been documented in cats, and in dogs have only been reported in association with the administration of oestrogenic compounds. The polypoid inflammation affecting the uterus and parametrium may have contributed to increased laxity of the uterine ligaments and predisposed to the development of uterine prolapse.

  13. Recurrent Pneumonia due to Fibrosing Mediastinitis in a Teenage Girl: A Case Report with Long-Term Follow-Up

    Directory of Open Access Journals (Sweden)

    Avigdor Hevroni

    2018-01-01

    Full Text Available A teenage girl was evaluated for recurrent right pneumonia. The evaluation revealed a calcified mediastinal mass that compressed the right intermediate and middle lobar bronchi, as well as the right pulmonary artery and veins. The clinical picture together with imaging studies and borderline positive serology testing suggested a diagnosis of fibrosing mediastinitis associated with histoplasmosis. This rare condition is characterized by the local proliferation of invasive fibrous tissue within the mediastinum due to a hyperimmune reaction to Histoplasma capsulatum. Antifungal and anti-inflammatory therapies are usually ineffective, and surgical intervention contains a high morbidity risk. Palliative surgery and stenting of the compressed airway have been suggested. In the past, the prognosis was thought to be poor, but recent studies demonstrate a more positive outcome. Our patient had been radiologically and functionally stable under follow-up for over thirteen years and has married and delivered two healthy children, both following an uneventful pregnancy.

  14. Using curriculum vitae to compare some impacts of NSF research grants with research center funding

    OpenAIRE

    Monica Gaughan; Barry Bozeman

    2002-01-01

    While traditional grants remain central in US federal support of academic scientists and engineers, the role of multidisciplinary NSF Centers is growing. Little is known about how funding through these Centers affects scientific output or (as is an NSF aim) increases academic collaboration with industry. This paper tests the use of CVs to examine how Center funding affects researchers' publication rates and their obtaining industry grants. Copyright , Beech Tree Publishing.

  15. Relação entre Fibrose e Arritmias Ventriculares na Cardiopatia Chagásica sem Disfunção Ventricular

    OpenAIRE

    Eduardo Marinho Tassi; Marcelo Abramoff Continentino; Emília Matos do Nascimento; Basílio de Bragança Pereira; Roberto Coury Pedrosa

    2014-01-01

    Fundamento: Pacientes com doença de Chagas com alteração segmentar apresentam pior prognóstico independentemente da fração de ejeção ventricular esquerda. A ressonância magnética cardíaca é atualmente o melhor método para detecção de alteração segmentar e para avaliação de fibrose miocárdica. Objetivo: Quantificar a fibrose, por meio do realce tardio, pela ressonância magnética cardíaca, em pacientes com doença de Chagas com fração de ejeção ventricular esquerda preservada ou minimamente ...

  16. O luto pela perda da saúde: vivências de ser mãe de uma criança com Fibrose Cística

    OpenAIRE

    ALMEIDA, Nancy Limeira de

    2012-01-01

    Este estudo tem por objetivo compreender como as mães da criança com Fibrose Cística (FC) vivenciam o luto pela perda da saúde do seu filho, considerando que esta ocorrência representa uma ameaça de morte continua à vida da criança, quando da ausência da adesão do tratamento. A Fibrose Cística é uma doença crônica, genética, sem cura e potencialmente letal, com prognóstico reservado, que demanda tratamento de alto impacto e intenso cuidado. A estratégia metodológica fundamen...

  17. Diabetes melito: uma importante co-morbidade da fibrose cística Diabetes mellitus in patients with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Crésio de Aragão Dantas Alves

    2007-04-01

    Full Text Available Diabetes melito relacionado à fibrose cística (DMFC é a principal complicação extrapulmonar da fibrose cística. Atualmente, ele afeta 15-30% dos adultos com fibrose cística e sua prevalência tende a aumentar com o aumento da expectativa de vida desses pacientes. Esse trabalho tem por objetivo rever a fisiopatologia, morbidade, manifestações clínicas, diagnóstico e tratamento do DMFC. Uma pesquisa bibliográfica utilizou os bancos de dados Medline e Literatura Latino-Americana e do Caribe em Ciências da Saúde, selecionando artigos publicados nos últimos vinte anos. A insulinopenia secundária à destruição de células beta pancreáticas é o principal mecanismo causal, embora a resistência insulínica também possa estar presente. O DMFC apresenta características do diabetes melito tipo 1 e tipo 2 e tem início, em média, aos 20 anos de idade. Ele pode cursar com hiperglicemia em jejum, pós-prandial ou intermitente. As alterações do metabolismo glicêmico agravam o estado nutricional, aumentam a morbidade, diminuem a sobrevida e pioram a função pulmonar. As complicações microvasculares estão presentes, porém raramente observam-se as macrovasculares. A triagem para o DMFC deve ser anual, a partir dos 10 anos de idade, através do teste de tolerância oral à glicose e, em qualquer faixa etária, se houver perda ponderal inexplicada ou sintomatologia de diabetes. Pacientes hospitalizados também devem ser investigados e receber terapia insulínica se a hiperglicemia em jejum persistir além de 48 h. A insulina é o tratamento de escolha para o diabetes com hiperglicemia em jejum. Não existe consenso quanto ao tratamento do diabetes intermitente ou sem hiperglicemia de jejum. Não há orientações de restrições alimentares. O acompanhamento deve ser multidisciplinar.Cystic fibrosis-related diabetes (CFRD is the principal extra-pulmonary complication of cystic fibrosis, occurring in 15-30% of adult cystic fibrosis

  18. Connecting NSF funding to patent innovation in nanotechnology (2001-2004)

    International Nuclear Information System (INIS)

    Huang Zan; Chen Hsinchun; Li Xin; Roco, Mihail C.

    2006-01-01

    Nanotechnology research has experienced growth rapid in knowledge and innovations; it also attracted significant public funding in recent years. Several countries have recognized nanotechnology as a critical research domain that promises to revolutionize a wide range of fields of applications. In this paper, we present an analysis of the funding for nanoscale science and engineering (NSE) at the National Science Foundation (NSF) and its implications on technological innovation (number of patents) in this field from 2001 to 2004. Using a combination of basic bibliometric analysis and content visualization tools, we identify growth trends, research topic distribution, and the evolution in NSF funding and commercial patenting activities recorded at the United States Patent Office (USPTO). The patent citations are used to compare the impact of the NSF-funded research on nanotechnology development with research supported by other sources in the United States and abroad. The analysis shows that the NSF-funded researchers and patents authored by them have significantly higher impact based on patent citation measures in the four-year period than other comparison groups. The NSF-authored patent impact is growing faster with the lifetime of a patent, indicating the long-term importance of fundamental research

  19. The NSF Cybersecurity Center of Excellence: Translating Identity Management and Cybersecurity into Scientific Collaboration

    Science.gov (United States)

    Welch, V.

    2016-12-01

    Scientists care deeply about their collaborations: who is a member, who can access, produce, and correct data, and manager instruments critical to their science missions. The communities of cybersecurity and identity management professionals develop tools to support collaborations and the undertaking of trustworthy science, but there are large cultural and linguistic gaps between these communities and the scientists they service. The National Science Foundation has recently funded a NSF Cybersecurity Center of Excellence to help its community of projects by providing leadership and addressing the challenges of trustworthy science. A key goal of this NSF Center has been translating between the goals of the science community into requirements and risks understood by identity management and cybersecurity communities. This talk will give an update on the Center's efforts and other services it provides to the NSF community to bridge these cultures.

  20. CAREER opportunities at the Condensed Matter Physics Program, NSF/DMR

    Science.gov (United States)

    Durakiewicz, Tomasz

    The Faculty Early Career Development (CAREER) Program is a Foundation-wide activity, offering prestigious awards in support of junior faculty. Awards are expected to build the careers of teacher-scholars through outstanding research, excellent education and the integration of education and research. Condensed Matter Physics Program receives between 35 and 45 CAREER proposals each year, in areas related to fundamental research of phenomena exhibited by condensed matter systems. Proposal processing, merit review process, funding levels and success rates will be discussed in the presentation. NSF encourages submission of CAREER proposals from junior faculty members from CAREER-eligible organizations and encourages women, members of underrepresented minority groups, and persons with disabilities to apply. NSF/DMR/CMP homepage: https://www.nsf.gov/funding/pgm_summ.jsp?pims_id=5666

  1. Relação entre Fibrose e Arritmias Ventriculares na Cardiopatia Chagásica sem Disfunção Ventricular

    Directory of Open Access Journals (Sweden)

    Eduardo Marinho Tassi

    2014-06-01

    Full Text Available Fundamento: Pacientes com doença de Chagas com alteração segmentar apresentam pior prognóstico independentemente da fração de ejeção ventricular esquerda. A ressonância magnética cardíaca é atualmente o melhor método para detecção de alteração segmentar e para avaliação de fibrose miocárdica. Objetivo: Quantificar a fibrose, por meio do realce tardio, pela ressonância magnética cardíaca, em pacientes com doença de Chagas com fração de ejeção ventricular esquerda preservada ou minimamente comprometida (> 45% e detectar padrões de dependência entre fibrose, alteração segmentar e fração de ejeção ventricular esquerda na presença de arritmia ventricular. Métodos: Foram realizados eletrocardiograma, teste ergométrico, Holter e ressonância magnética cardíaca em 61 pacientes, separados em três grupos: (1 eletrocardiograma normal e ressonância magnética cardíaca sem alteração segmentar; (2 eletrocardiograma alterado e ressonância magnética cardíaca sem alteração segmentar; e (3 ressonância magnética cardíaca com alteração segmentar independentemente de alteração no eletrocardiograma. Resultados: O número de pacientes com arritmia ventricular em relação ao número total de pacientes em cada grupo, a porcentagem de fibrose e a fração de ejeção ventricular esquerda foram, respectivamente: no primeiro grupo, 4/26, 0,74% e 74,34%; no segundo grupo, 4/16, 3,96% e 68,5%; e no terceiro grupo, 11/19, 14,07% e 55,59%. Arritmia ventricular foi encontrada em 31,1% dos pacientes. Aqueles com e sem arritmia ventricular apresentaram fração de ejeção ventricular esquerda média de 59,87% e 70,18%, respectivamente, e fibrose de 11,03% e 3,01%, respectivamente. Das variáveis alteração segmentar, grupos, idade, fração de ejeção ventricular esquerda e fibrose, a última foi a única significativa para a presença de arritmia ventricular, com ponto de corte de 11,78% para massa fibrosada (p < 0

  2. NSF Support for Physics at the Undergraduate Level: A View from Inside

    Science.gov (United States)

    McBride, Duncan

    2015-03-01

    NSF has supported a wide range of projects in physics that involve undergraduate students. These projects include NSF research grants in which undergraduates participate; Research Experiences for Undergraduates (REU) centers and supplements; and education grants that range from upper-division labs that may include research, to curriculum development for upper- and lower-level courses and labs, to courses for non-majors, to Physics Education Research (PER). The NSF Divisions of Physics, Materials Research, and Astronomy provide most of the disciplinary research support, with some from other parts of NSF. I recently retired as the permanent physicist in NSF's Division of Undergraduate Education (DUE), which supports the education grants. I was responsible for a majority of DUE's physics grants and was involved with others overseen by a series of physics rotators. There I worked in programs entitled Instrumentation and Laboratory Improvement (ILI); Course and Curriculum Development (CCD); Course, Curriculum, and Laboratory Improvement (CCLI); Transforming Undergraduate STEM Education (TUES); and Improving Undergraduate STEM Education (IUSE). NSF support has enabled physics Principal Investigators to change and improve substantially the way physics is taught and the way students learn physics. The most important changes are increased undergraduate participation in physics research; more teaching using interactive engagement methods in classes; and growth of PER as a legitimate field of physics research as well as outcomes from PER that guide physics teaching. In turn these have led, along with other factors, to students who are better-prepared for graduate school and work, and to increases in the number of undergraduate physics majors. In addition, students in disciplines that physics directly supports, notably engineering and chemistry, and increasingly biology, are better and more broadly prepared to use their physics education in these fields. I will describe NSF

  3. Frontal fibrosing alopecia: possible association with leave-on facial skin care products and sunscreens; a questionnaire study.

    Science.gov (United States)

    Aldoori, N; Dobson, K; Holden, C R; McDonagh, A J; Harries, M; Messenger, A G

    2016-10-01

    Since its first description in 1994, frontal fibrosing alopecia (FFA) has become increasingly common, suggesting that environmental factors are involved in the aetiology. To identify possible causative environmental factors in FFA. A questionnaire enquiring about exposure to a wide range of lifestyle, social and medical factors was completed by 105 women with FFA and 100 age- and sex-matched control subjects. A subcohort of women with FFA was patch tested to an extended British standard series of allergens. The use of sunscreens was significantly greater in the FFA group compared with controls. Subjects with FFA also showed a trend towards more frequent use of facial moisturizers and foundations but, compared with controls, the difference in frequencies just failed to reach statistical significance. The frequency of hair shampooing, oral contraceptive use, hair colouring and facial hair removal were significantly lower in the FFA group than in controls. Thyroid disease was more common in subjects with FFA than controls and there was a high frequency of positive patch tests in women with FFA, mainly to fragrances. Our findings suggest an association between FFA and the use of facial skin care products. The high frequency of sunscreen use in patients with FFA, and the fact that many facial skin care products now contain sunscreens, raises the possibility of a causative role for sunscreen chemicals. The high frequency of positive patch tests in women with FFA and the association with thyroid disease may indicate a predisposition to immune-mediated disease. © 2016 British Association of Dermatologists.

  4. A intersubjetividade no contexto da família de pessoas com fibrose cística

    Directory of Open Access Journals (Sweden)

    Geisa Santos Luz

    2012-04-01

    Full Text Available Trata-se de uma investigação qualitativa, com aproximação fenomenológica, que objetivou desvelar os processos intersubjetivos no contexto da família de pessoas com Fibrose Cística (FC. Desenvolveu-se entrevista com 14 famílias com portadores de FC, cadastrados na Associação Paranaense de Assistência à Mucoviscidose (AAMPR, residentes nas regiões Norte e Noroeste do estado do Paraná (PR, Brasil. Das suas falas foram apreendidas unidades de significado, agrupadas em três categorias: Família, portador de FC e o outro; Aspectos religiosos na vivência da FC na família; Portador de FC na vida escolar, afetiva e profissional. Os resultados evidenciaram que a experiência das famílias compartilhada com o outro foi crucial para o enfrentamento da doença. Conhecer os processos intersubjetivos que perpassam o âmago da família de pessoas acometidas pela FC possibilita um novo modo de atuar em Enfermagem.

  5. Prevalence of NSF following intravenous gadolinium-contrast media administration in dialysis patients with endstage renal disease

    Energy Technology Data Exchange (ETDEWEB)

    Heinz-Peer, Gertraud, E-mail: gertraud.heinz@meduniwien.ac.a [Department of Radiology, Medical University of Vienna (Austria); Neruda, Anita [Department of Radiology, Medical University of Vienna (Austria); Watschinger, Bruno; Vychytil, Andreas [Department of Nephrology, Medical University of Vienna (Austria); Geusau, Alexandra [Department of Dermatology, Medical University of Vienna (Austria); Haumer, Markus [Department of Internal Medicine II, Medical University of Vienna (Austria); Weber, Michael [Department of Radiology, Medical University of Vienna (Austria)

    2010-10-15

    Purpose: To evaluate the prevalence of nephrogenic systemic fibrosis (NSF) in a patient population being at highest risk for developing this disease and to evaluate possible risk factors. Materials and methods: The radiological records of 552 patients with ESRD being on hemodialysis (HD) or peritoneal dialysis (PD) were retrospectively reviewed to identify whether the patients underwent MR-examinations with or without intravenous administration of GBCA. In case of exposure to GBCA, the number of contrast injections, the benchmark and the cumulative doses of GBCA, and possible cofactors regarding pathogenesis of NSF were recorded. Diagnosis of NSF was confirmed either by deep skin biopsy or by review of medical and histopathological records. Data of NSF patients were compared with data of dialysis patients who did not develop NSF after MR-examinations. Results: 146 dialysis patients underwent MRI without i.v.-administration of GBCA. No case of NSF was observed in this patient population. 195/552 patients proved to have a total number of 325 well-documented exposures to GBCA. Seven different types of GBCA were used during these MR-examinations. NSF prevalence rate was 1.6%. One patient died of NSF. Three different types of GBCA were involved in 6 NSF cases. 4/6 proved to be confounded cases. The cumulative dose of GBCA, history of thrombosis, recent surgery, and the combination of HD and PD proved to be significant cofactors for the development of NSF (p < .05). No significant difference regarding residual renal clearance (p = .898) and residual urine volume (p = .083) was found between NSF and non-NSF patients. Conclusion: The prevalence of NSF proved to be much lower in this high risk patient group being exposed to GBCA compared to the literature. NSF was not observed in ESRD patients undergoing MRI without administration of GBCA. Our data support a positive association between cumulative dose of GBCA and development of NSF. No positive association was found

  6. Dr. Tulga Ersal at NSF Workshop Accessible Remote Testbeds ART'15

    Science.gov (United States)

    Event Archives Dr. Tulga Ersal at NSF Workshop Accessible Remote Testbeds ART'15 On November 12th, Dr Workshop on Accessible Remote Testbeds (ART'15) at Georgia Tech. From the event website: The rationale behind the ART'15 workshop is that remote-access testbeds could, if done right, significantly change how

  7. 78 FR 58569 - Notice of Meeting; NSF Synchrotron Subcommittee of the Advisory Committee for Mathematical and...

    Science.gov (United States)

    2013-09-24

    ... report findings--Murray Gibson, Northeastern University 2. Importance of materials research facilities...--Patricia Dehmer, DOE 3. Biology/biomaterials talk--importance of materials research facilities--Pupa... Materials Research on its facilities portfolio including the role it and NSF should play in synchrotron...

  8. 77 FR 64799 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2012-10-23

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Department of Energy... Physics Advisory Panel (HEPAP). Federal Advisory Committee Act (Pub. L. 92-463, 86 Stat. 770) requires... Kogut, Executive Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy; SC-25...

  9. 78 FR 46330 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2013-07-31

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Office of Science... High Energy Physics Advisory Panel (HEPAP). Federal Advisory Committee Act (Pub. L. 92-463, 86 Stat... CONTACT: John Kogut, Executive Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy...

  10. 78 FR 12043 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2013-02-21

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Office of Science... High Energy Physics Advisory Panel (HEPAP). The Federal Advisory Committee Act (Pub. L. 92-463, 86 Stat... INFORMATION CONTACT: John Kogut, Executive Secretary; High Energy Physics Advisory Panel; U.S. Department of...

  11. Development of a Consensus Standard for School Equipment: NSF/NSSEA 380

    Science.gov (United States)

    Breitner, Ashlee

    2011-01-01

    For many years, the school supplies and equipment industry has investigated methods to ensure product safety and compliance across all its product categories. In early 2010, NSF International and the National School Supply and Equipment Association (NSSEA) came together to develop quality standards for products and equipment designed for use in…

  12. 77 FR 33449 - DOE/NSF High Energy Physics Advisory Panel

    Science.gov (United States)

    2012-06-06

    ... DEPARTMENT OF ENERGY DOE/NSF High Energy Physics Advisory Panel AGENCY: Office of Science... High Energy Physics Advisory Panel (HEPAP). The Federal Advisory Committee Act (Pub. L. 92-463, 86 Stat..., Executive Secretary; High Energy Physics Advisory Panel; U.S. Department of Energy; SC-25/ Germantown...

  13. Linking the GLOBE Program With NASA and NSF Large-Scale Experiments

    Science.gov (United States)

    Filmer, P. E.

    2005-12-01

    NASA and the NSF, the sponsoring Federal agencies for the GLOBE Program, are seeking the participation of science teams who are working at the cutting edge of Earth systems science in large integrated Earth systems science programs. Connecting the GLOBE concept and structure with NASA and NSF's leading Earth systems science programs will give GLOBE schools and students access to top scientists, and expose them to programs that have been designated as scientific priorities. Students, teachers, parents, and their communities will be able to see how scientists of many disciplines work together to learn about the Earth system. The GLOBE solicitation released by the NSF targets partnerships between GLOBE and NSF/NASA-funded integrated Earth systems science programs. This presentation will focus on the goals and requirements of the NSF solicitation. Proponents will be expected to provide ways for the GLOBE community to interact with a group of scientists from their science programs as part of a wider joint Earth systems science educational strategy (the sponsoring agencies', GLOBE's, and the proposing programs'). Teams proposing to this solicitation must demonstrate: - A focus on direct connections with major NSF Geosciences and/or Polar Programs and/or NASA Earth-Sun research programs that are related to Earth systems science; - A demonstrable benefit to GLOBE and to NSF Geosciences and/or Polar Programs or NASA Earth-Sun education goals (providing access to program researchers and data, working with GLOBE in setting up campaigns where possible, using tested GLOBE or non-GLOBE protocols to the greatest extent possible, actively participating in the wider GLOBE community including schools, among other goals); - An international component; - How the existing educational efforts of the large science program will coordinate with GLOBE; - An Earth systems science education focus, rather than a GLOBE protocol-support focus; - A rigorous evaluation and assessment component

  14. Global nanotechnology development from 1991 to 2012: patents, scientific publications, and effect of NSF funding

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Hsinchun [The University of Arizona, Department of Management Information Systems (United States); Roco, Mihail C. [National Science Foundation (United States); Son, Jaebong; Jiang, Shan, E-mail: jiangs@email.arizona.edu; Larson, Catherine A.; Gao, Qiang [The University of Arizona, Department of Management Information Systems (United States)

    2013-09-15

    In a relatively short interval for an emerging technology, nanotechnology has made a significant economic impact in numerous sectors including semiconductor manufacturing, catalysts, medicine, agriculture, and energy production. A part of the United States (US) government investment in basic research has been realized in the last two decades through the National Science Foundation (NSF), beginning with the nanoparticle research initiative in 1991 and continuing with support from the National Nanotechnology Initiative after fiscal year 2001. This paper has two main goals: (a) present a longitudinal analysis of the global nanotechnology development as reflected in the United States Patent and Trade Office (USPTO) patents and Web of Science (WoS) publications in nanoscale science and engineering (NSE) for the interval 1991-2012; and (b) identify the effect of basic research funded by NSF on both indicators. The interval has been separated into three parts for comparison purposes: 1991-2000, 2001-2010, and 2011-2012. The global trends of patents and scientific publications are presented. Bibliometric analysis, topic analysis, and citation network analysis methods are used to rank countries, institutions, technology subfields, and inventors contributing to nanotechnology development. We then, examined how these entities were affected by NSF funding and how they evolved over the past two decades. Results show that dedicated NSF funding used to support nanotechnology R and D was followed by an increased number of relevant patents and scientific publications, a greater diversity of technology topics, and a significant increase of citations. The NSF played important roles in the inventor community and served as a major contributor to numerous nanotechnology subfields.

  15. Global nanotechnology development from 1991 to 2012: patents, scientific publications, and effect of NSF funding

    International Nuclear Information System (INIS)

    Chen, Hsinchun; Roco, Mihail C.; Son, Jaebong; Jiang, Shan; Larson, Catherine A.; Gao, Qiang

    2013-01-01

    In a relatively short interval for an emerging technology, nanotechnology has made a significant economic impact in numerous sectors including semiconductor manufacturing, catalysts, medicine, agriculture, and energy production. A part of the United States (US) government investment in basic research has been realized in the last two decades through the National Science Foundation (NSF), beginning with the nanoparticle research initiative in 1991 and continuing with support from the National Nanotechnology Initiative after fiscal year 2001. This paper has two main goals: (a) present a longitudinal analysis of the global nanotechnology development as reflected in the United States Patent and Trade Office (USPTO) patents and Web of Science (WoS) publications in nanoscale science and engineering (NSE) for the interval 1991–2012; and (b) identify the effect of basic research funded by NSF on both indicators. The interval has been separated into three parts for comparison purposes: 1991–2000, 2001–2010, and 2011–2012. The global trends of patents and scientific publications are presented. Bibliometric analysis, topic analysis, and citation network analysis methods are used to rank countries, institutions, technology subfields, and inventors contributing to nanotechnology development. We then, examined how these entities were affected by NSF funding and how they evolved over the past two decades. Results show that dedicated NSF funding used to support nanotechnology R and D was followed by an increased number of relevant patents and scientific publications, a greater diversity of technology topics, and a significant increase of citations. The NSF played important roles in the inventor community and served as a major contributor to numerous nanotechnology subfields

  16. O impacto da fibrose cística no perfil imunológico de pacientes pediátricos

    Directory of Open Access Journals (Sweden)

    Daniela M. Bernardi

    2013-02-01

    Full Text Available OBJETIVO: Comparar o estado imunológico de 44 pacientes pediátricos com fibrose cística (FCa umgrupo-controle formado por 16 indivíduos saudáveis. MÉTODOS: Foram selecionados para o estudo pacientes com FC com idade entre 3 e 12 anos, apresentando um escore clínico moderado e bom. Foram avaliados a glutationa eritrocitária, a produção de espécies reativas de oxigênio, citocinas (TNF-α, IFN-γ, IL-8, IL-6, IL-10 em culturas de células mononucleares do sangue periférico em condições espontâneas e estimuladas por BCG ou PHA, a concentração sérica de TGF-β2, IgA, IgG, IgM, IgE e IgA salivar. RESULTADOS :A produção espontânea de TNF-α, IL-6 e IL-10, a produção de IL-6 estimulada por PHA e TGF-β2, IgA e IgG séricas aumentaram em amostras de pacientes com FC. Indivíduos saudáveis tiveram uma produção mais elevada de TNF-α em resposta a BCG. CONCLUSÃO: Apesar de os pacientes com FC parecerem clinicamente estáveis, os resultados de seus exames de sangue periférico mostraram que houve um impacto sobre o sistema imunológico.

  17. Exacerbação aguda da fibrose pulmonar idiopática Acute exacerbation of idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    Natália Melo

    2009-03-01

    Full Text Available Alguns doentes com fibrose pulmonar idiopática (FPI apresentam durante a sua evolução fases deagravamento clínico sem causa conhecida, designadas como “exacerbação aguda” ou “fase acelerada” da doença (EA. Caracterizam -se pelo agravamento marcado da dispneia, hipoxemia e pelo aparecimento de novas opacidades pulmonares ou pelo agravamento das já existentes no estudo imagiológico. Os achados histológicos típicos são o dano alveolar difuso (DAD sobreposto a alterações de pneumonia intersticial usual (UIP. Esta entidade clínica associa -se a uma mortalidade elevada, não havendo até ao momento nenhuma terapêutica de comprovada eficácia. Os autores descrevem os casos clínicos de cinco doentes que apresentaram alterações clínicas, funcionais e radiológicas sugestivas de EA-FPI, assim como o tratamento efectuado e a evolução observada, enquadrando-os na discussão das características normalmente apresentadas por esta entidade.Some patients with Idiopathic Pulmonary Fibrosis (IPF have disease accelerated deterioration without identifiable cause referred as “acute exacerbation” or “accelerated stage”. It is characterized by severe worsening of dyspnea, hypoxemia and new or progressive opacities on imaging studies. The typical histological findings are diffuse alveolar damage in addition to the features of usual interstitial pneumonia pattern. Mortality in this clinical entity is very high and no efficacious therapeutic have been described. The authors describe the clinical, functional and radiological features, treatment and evolution of five patients with IPF acute exacerbation. A discussion will be carry out concerning the IPF acute exacerbation usual features comparing with the alterations noticed in those patients.

  18. Advancing Capabilities for Understanding the Earth System Through Intelligent Systems, the NSF Perspective

    Science.gov (United States)

    Gil, Y.; Zanzerkia, E. E.; Munoz-Avila, H.

    2015-12-01

    The National Science Foundation (NSF) Directorate for Geosciences (GEO) and Directorate for Computer and Information Science (CISE) acknowledge the significant scientific challenges required to understand the fundamental processes of the Earth system, within the atmospheric and geospace, Earth, ocean and polar sciences, and across those boundaries. A broad view of the opportunities and directions for GEO are described in the report "Dynamic Earth: GEO imperative and Frontiers 2015-2020." Many of the aspects of geosciences research, highlighted both in this document and other community grand challenges, pose novel problems for researchers in intelligent systems. Geosciences research will require solutions for data-intensive science, advanced computational capabilities, and transformative concepts for visualizing, using, analyzing and understanding geo phenomena and data. Opportunities for the scientific community to engage in addressing these challenges are available and being developed through NSF's portfolio of investments and activities. The NSF-wide initiative, Cyberinfrastructure Framework for 21st Century Science and Engineering (CIF21), looks to accelerate research and education through new capabilities in data, computation, software and other aspects of cyberinfrastructure. EarthCube, a joint program between GEO and the Advanced Cyberinfrastructure Division, aims to create a well-connected and facile environment to share data and knowledge in an open, transparent, and inclusive manner, thus accelerating our ability to understand and predict the Earth system. EarthCube's mission opens an opportunity for collaborative research on novel information systems enhancing and supporting geosciences research efforts. NSF encourages true, collaborative partnerships between scientists in computer sciences and the geosciences to meet these challenges.

  19. Supporting "The Best and Brightest" in Science and Engineering: NSF Graduate Research Fellowships

    OpenAIRE

    Richard B. Freeman; Tanwin Chang; Hanley Chiang

    2005-01-01

    The National Science Foundation's (NSF) Graduate Research Fellowship (GRF) is a highly prestigious award for science and engineering (S&E) graduate students. This paper uses data from 1952 to 2004 on the population of over 200,000 applicants to the GRF to examine the determinants of the number and characteristics of applicants and the characteristics of awardees. In the early years of the program, GRF awards went largely to physical science and mathematics students and disproportionately to w...

  20. US Global Change Research Program Distributed Cost Budget Interagency Funds Transfer from DOE to NSF

    Energy Technology Data Exchange (ETDEWEB)

    Uhle, Maria [National Science Foundation (NSF), Washington, DC (United States)

    2016-09-22

    These funds were transferred from DOE to NSF as DOE's contribution to the U.S. Global Change Research Program in support of 4 internationalnactivities/programs as approved by the U.S. Global Change Research Program on 14 March 2014. The programs are the International Geosphere-Biosphere Programme, the DIVERSITAS programme, and the World Climate Research Program. All program awards ended as of 09-23-2015.

  1. Condutividade e teste quantitativo coulométrico na triagem neonatal para fibrose cística

    Directory of Open Access Journals (Sweden)

    Mouseline Torquato Domingos

    2015-12-01

    Full Text Available Resumo Objetivo Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém0nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos O teste do suor foi feito simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60 mmol/L. Resultados Fizeram o teste do suor por condutividade e dosagem coulométrica simultaneamente 444 RN sem FC (185 do sexo masculino, 234 do feminino e 24 não informado e obtiveram resultado mediano de 32 mmol/L e 12 mmol/L respectivamente. Para os noventa RN com FC os valores medianos de condutividade e dosagem coulométrica foram 108 mmol/L e 97 mmol/L respectivamente. O índice de falso positivo para condutividade foi de 16,7% e em todos os pacientes FC foi superior a 50 mmol/L, o que confere ao método 100% de sensibilidade (IC 95% = 93,8 a 97,8, especificidade de 96,2% (IC 95% = 93,8 a 97,8, valor preditivo positivo 83,3 (IC 95% = 74,4 a 91,1, valor preditivo negativo 100% (IC 95% = 90,5 a 109,4 e acurácia 9,8%. A correlação entre os métodos foi de r = 0,97 (p > 0,001.O melhor valor de corte sugerido foi de 69,0 mmol/L, coeficiente de kappa = 0,89. Conclusão O teste da condutividade apresentou excelente correlação com o quantitativo coulométrico, alta sensibilidade e especificidade e pode ser usado no diagnóstico da FC em crianças detectadas pela triagem neonatal.

  2. Stigma and cystic fibrosis Estigma y fibrosis cística Estigma e fibrose c��stica

    Directory of Open Access Journals (Sweden)

    Tainá Maues Peluci Pizzignacco

    2010-02-01

    Full Text Available Cystic Fibrosis (CF, also known as Mucoviscidosis, is a chronic disease of autosomal recessive origin and so far incurable. This analysis considers some characteristics of patients and family members that indicate it is a stigmatizing disease. The CF stigma’s impact on the lives of children and adolescents can affect treatment adherence, socialization, family relationships and the formation of their life histories, with direct consequences on their quality of life.La fibrosis cística (FC, también conocida como mucoviscidosis, es una enfermedad crónica de origen autosómica recesiva y, hasta el momento, incurable. La presente reflexión presenta consideraciones a respecto de algunas características que acompañan a pacientes y familiares, permitiendo comprenderla como enfermedad que estigmatiza. Las repercusiones del estigma en la vida de niños y adolescentes con FC pueden interferir en la adhesión al tratamiento, en el proceso de socialización, en la relación con los familiares y en la formación de su biografía, con reflejo directo en la calidad de vida.A fibrose cística (FC, também conhecida como mucoviscidose, é doença crônica de origem autossômica recessiva e, até o momento, incurável. A presente reflexão traz considerações a respeito de algumas características que acompanham pacientes e familiares, permitindo compreendê-la como doença estigmatizante. As repercussões do estigma na vida de crianças e adolescentes com FC podem implicar na adesão ao tratamento, no processo de socialização, na relação com os familiares e na formação de sua biografia, com reflexo direto em sua qualidade de vida.

  3. Fibrose cardíaca associada à intoxicação por Amorimia septentrionalis em bovinos

    Directory of Open Access Journals (Sweden)

    Samuel S.C. Albuquerque

    2014-05-01

    Full Text Available Amorimia septentrionalis contém monofluoracetato de sódio e quando consumida por ruminantes provoca morte súbita. Este estudo teve o objetivo de relatar a epidemiologia, os sinais clínicos e patológicos de surtos de morte súbita em bovinos provocadas por Amorimia septentrionalis nos Estados de Pernambuco e Paraíba. Para isso, realizaram-se visitas técnicas em diversas propriedades nas Microrregiões do Médio Capibaribe/PE e Itabaiana/PB. Oito bovinos foram necropsiados. Coletaram-se tecidos das cavidades abdominal e torácica, além do encéfalo e medula espinhal. As alterações clínicas consistiram em lentidão, decúbito esternal prolongado, relutância em se movimentar quando em estação, cansaço, taquipneia, taquicardia e pulso venoso positivo. Os bovinos que foram forçados a se movimentar apresentaram instabilidade, tremores musculares e queda repentina seguida de vocalizações, movimentos de pedalagem e morte súbita em cerca de 5 a 7 minutos. As principais alterações macroscópicas consistiram em edema pulmonar, coração com aspecto globular com áreas esbranquiçadas, petéquias e equimoses no epicárdio, miocárdio e músculos papilares. À microscopia observou-se aumento da eosinofilia do citoplasma dos cardiomiócitos, núcleos picnóticos, cariorrexia, cariólise, perda das estriações, edema intersticial, infiltrado inflamatório intersticial mononuclear e áreas multifocais de fibrose cardíaca. Nos rins, constatou-se degeneração hidrópico vacuolar e necrose das células epiteliais em túbulos contorcidos. Os sinais clínicos foram semelhantes aos sinais clínicos já descritos em bovinos por plantas que contém MFA. As lesões macro e microscópicas descritas no coração e rins são de grande valor diagnóstico. A. septentrionalis é a principal planta tóxica de interesse pecuário nas microrregiões do Médio Capibaribe e Itabaiana devido às perdas econômicas diretas e indiretas que provoca na pecu

  4. Fibrose Cística: Análise da Coorte de 10 Anos de um Programa para Adultos

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso Roth Dalcin

    2011-07-01

    Full Text Available Introdução: A fibrose cística (FC que já foi considerada doença da criança é agora doença do adulto e requer programa para adultos. Objetivo: definir características clínicas de uma coorte de 10 anos de um programa para adultos com FC e determinar as características associadas com desfechos clínicos. Métodos: coorte retrospectiva de pacientes com FC (idade ≥ 10 anos atendida pelo Programa para Adultos do Hospital de Clínicas de Porto Alegre, de outubro de 1998 a outubro de 2008. Foram coletados dados demográficos, dados clínicos, status nutricional, função pulmonar, testes laboratoriais e microbiologia do escarro. Foram definidos como desfechos clínicos: sobrevivência, sobrevivência com transplante pulmonar e óbito. Resultados: foram atendidos 94 pacientes pelo programa para adultos. A média de idade foi 24,0±7,4 anos e a média do volume expiratório forçado no primeiro segundo (VEF1 foi 56,4±28,8%. Setenta e sete pacientes foram sobreviventes, 6 sobreviventes com transplante pulmonar e 11 morreram. Na análise univariada, etnia caucasiana (p=0,016, mutação F508del (p=0,04, escore clínico (p<0,001, índice de massa corporal (p<0,001,  oxigenoterapia (p<0,001, capacidade vital forçada (p=0,023 e VEF1 (p<0,001 se associaram com os desfechos clínicos. A análise de regressão logística identificou fatores associados com desfecho precário: VEF1 (RC=0,.72, ICI=0,54-0,94, p=0,017 e escore clínico  (RC = 0,70, IC=0,50-0,97, p = 0,034. Insuficiência respiratória crônica exacerbada por infecção respiratória aguda foi causa imediata de morte na maioria dos casos. Conclusão: Este estudo descreveu uma coorte de 94 pacientes com FC atendidos por um programa de adultos. VEF1 e escore clinico se associaram com os desfechos clínicos.

  5. Fibrose cística no adulto: aspectos diagnósticos e terapêuticos Cystic fibrosis in adults: diagnostic and therapeutic aspects

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso Roth Dalcin

    2008-02-01

    Full Text Available A fibrose cística, que já foi considerada uma doença da infância, é agora também uma doença do adulto. O aumento da longevidade resultou em mais problemas médicos relacionados com a idade e com a própria doença. O crescente número de adultos com fibrose cística resultou em aumento da necessidade de cuidados médicos. Essa necessidade tem sido suprida por um crescente número de pneumologistas de adultos e outros especialistas. O objetivo dessa revisão é sumarizar o conhecimento corrente sobre o diagnóstico e tratamento no adulto com fibrose cística. Na maioria dos casos, o diagnóstico é sugerido por manifestações de doença sinopulmonar crônica e insuficiência pancreática exócrina, e, então, confirmado por um teste do suor positivo. Pacientes adultos podem, entretanto, apresentar suficiência pancreática e características clínicas atípicas, às vezes, associadas com teste do suor normal ou limítrofe. Em tais casos, a possibilidade de realizar pesquisa de mutações para fibrose cística e de medir a diferença de potencial nasal pode ser de utilidade diagnóstica. A abordagem terapêutica padrão para a doença pulmonar inclui: antibióticos, higiene das vias aéreas, exercício, mucolíticos, broncodilatadores, oxigênio, agentes anti-inflamatórios e suporte nutricional. A utilização adequada dessas terapias resulta em mais pacientes com fibrose cística sobrevivendo na vida adulta com uma aceitável qualidade de vida.Once considered a childhood disease, cystic fibrosis is now also a disease of adults. Increased longevity has resulted in the aging of the cystic fibrosis population. The consequent age-related medical problems among adults with cystic fibrosis have increased medical care needs. These needs are being met by a growing number of non-pediatric pulmonologists and other non-pediatric specialists. The objective of this review was to summarize the current knowledge about diagnosis and treatment in adult

  6. Republished: Fibrosing organising pneumonia.

    Science.gov (United States)

    Beardsley, Brooke; Rassl, Doris

    2014-08-01

    Organising pneumonia (otherwise referred to as bronchiolitis obliterans organising pneumonia) is characterised histologically by plugs of granulation tissue, which are present predominantly within small airways, alveolar ducts and peri-bronchiolar alveoli. This pattern is not specific for any disorder or cause, but is one type of inflammatory response to pulmonary injury, which may be seen in a wide variety of clinical conditions. Typically, organising pneumonia responds very well to corticosteroid treatment; however, a small percentage of patients appear to develop progressive fibrosis. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  7. Fibrosing organising pneumonia.

    Science.gov (United States)

    Beardsley, Brooke; Rassl, Doris

    2013-10-01

    Organising pneumonia (otherwise referred to as bronchiolitis obliterans organising pneumonia) is characterised histologically by plugs of granulation tissue, which are present predominantly within small airways, alveolar ducts and peri-bronchiolar alveoli. This pattern is not specific for any disorder or cause, but is one type of inflammatory response to pulmonary injury, which may be seen in a wide variety of clinical conditions. Typically, organising pneumonia responds very well to corticosteroid treatment; however, a small percentage of patients appear to develop progressive fibrosis.

  8. NSF Lower Atmospheric Observing Facilities (LAOF) in support of science and education

    Science.gov (United States)

    Baeuerle, B.; Rockwell, A.

    2012-12-01

    Researchers, students and teachers who want to understand and describe the Earth System require high quality observations of the atmosphere, ocean, and biosphere. Making these observations requires state-of-the-art instruments and systems, often carried on highly capable research platforms. To support this need of the geosciences community, the National Science Foundation's (NSF) Division of Atmospheric and Geospace Sciences (AGS) provides multi-user national facilities through its Lower Atmospheric Observing Facilities (LAOF) Program at no cost to the investigator. These facilities, which include research aircraft, radars, lidars, and surface and sounding systems, receive NSF financial support and are eligible for deployment funding. The facilities are managed and operated by five LAOF partner organizations: the National Center for Atmospheric Research (NCAR); Colorado State University (CSU); the University of Wyoming (UWY); the Center for Severe Weather Research (CSWR); and the Center for Interdisciplinary Remotely-Piloted Aircraft Studies (CIRPAS). These observational facilities are available on a competitive basis to all qualified researchers from US universities, requiring the platforms and associated services to carry out various research objectives. The deployment of all facilities is driven by scientific merit, capabilities of a specific facility to carry out the proposed observations, and scheduling for the requested time. The process for considering requests and setting priorities is determined on the basis of the complexity of a field campaign. The poster will describe available observing facilities and associated services, and explain the request process researchers have to follow to secure access to these platforms for scientific as well as educational deployments. NSF/NCAR GV Aircraft

  9. Acroqueratodermia aquagénica associada a uma mutação do gene da fibrose quística

    Directory of Open Access Journals (Sweden)

    V. Coelho-Macias

    2013-05-01

    Full Text Available Resumo: Descrita em 1996, a acroqueratodermia aquagénica é uma entidade rara, caracterizada pelo aparecimento de pápulas edematosas palmares após contacto com água. Múltiplas associações foram enumeradas mas, recentemente, a associação a mutações do gene da fibrose quística foi demonstrada.Descreve-se o caso de uma mulher de 18 anos, saudável, com prurido e edema palmar após imersão em água. O exame objetivo inicial não mostrava alterações mas, 5 min após imersão em água, observavam-se múltiplas pápulas esbranquiçadas palmares. O estudo do gene da fibrose quística (CFTR revelou uma mutação F508del num dos alelos. A doente negava outras queixas ou história familiar relevante.A acroqueratodermia aquagénica é uma entidade provavelmente subdiagnosticada que poderá constituir uma manifestação de mutações do gene CFTR, o que possibilitaria a identificação de portadores e aconselhamento genético. Abstract: Reported for the first time in 1996, aquagenic keratoderma is a rare condition which is characterized by edematous flat-topped papules appearing on palmar skin after water immersion. Multiple anecdotal associations have been described but, recently, the association with cystic fibrosis gene mutations (CFTR has been highlighted.The authors describe an 18 year-old female, with one-month complaints of pruritus and swelling of palmar skin after water immersion. On examination, palmar skin was unremarkable but, 5 minutes after water immersion, multiple whitish papules became apparent. CFTR genotype study showed a F508del mutation in one alelle. She had no other symptoms and no relevant family history.Aquagenic keratoderma is probably an under-diagnosed entity that might represent a manifestation of CFTR mutations, making carrier state identification and genetic counseling possible. Palavras-chave: Acroqueratodermia aquagénica, Fibrose quística, Aconselhamento genético, Keywords: Aquagenic keratoderma, Cystic

  10. Achados histológicos e sobrevida na fibrose pulmonar idiopática Histological features and survival in idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    Ester Nei Aparecida Martins Coletta

    2003-12-01

    Full Text Available INTRODUÇÃO: A fibrose pulmonar idiopática foi recentemente redefinida como pneumonia intersticial usual de etiologia desconhecida. O valor prognóstico dos achados histológicos deve ser reavaliado. OBJETIVO: Neste estudo foram correlacionados os achados histológicos e alguns dados clínicos e funcionais (duração dos sintomas, capacidade vital forçada, idade, sexo, hábito de fumar com a sobrevida. MÉTODO: Foram estudados 51 pacientes portadores de fibrose pulmonar idiopática. A média de idade foi de 66 ± 8 anos. Vinte e um pacientes eram do sexo feminino; 26 eram fumantes ou ex-fumantes. Todos apresentavam quadro de pneumonia intersticial usual na histologia. Grau de faveolamento, fibrose estabelecida, descamação, celularidade, espessamento vascular miointimal e focos fibroblásticos foram graduados por método semiquantitativo. RESULTADOS: A mediana do tempo de sintomas foi de 12 meses e a capacidade vital forçada inicial foi de 72 ± 21%. Por análise de risco proporcional de Cox, a sobrevida correlacionou-se, de maneira significativa (p BACKGROUND: Idiopathic pulmonary fibrosis was recently redefined as usual interstitial pneumonia of unknown etiology. Consequently, the prognostic value of histological findings needs to be reassessed. OBJECTIVE: To correlate clinical, functional and histological findings with survival in patients with idiopathic pulmonary fibrosis. METHOD: Patients (n = 51; mean age: 66 ± 8 years; gender: 21 females/30 males were evaluated. Of the 51, 26 were smokers or ex-smokers. Duration of symptoms, forced vital capacity and smoking habits were recorded. All patients presented usual interstitial pneumonia verified through histology. Degree of honeycombing, established fibrosis, desquamation, cellularity, myointimal thickening of blood vessels and number of fibroblastic foci were graded according to the semiquantitative method. RESULTS: Median duration of symptoms was 12 months and initial forced vital

  11. Photoelastic examination of borosilicate glass discs used in the insulating legs for the NSF tandem

    International Nuclear Information System (INIS)

    Acton, W.J.; Cundy, D.

    1981-04-01

    The results are presented of a photoelastic stress analysis carried out to establish the effect of re-annealing borosilicate glass discs used in the insulating legs of the 30 MV tandem van de Graaff accelerator of the NSF. The results show that re-annealing of the glass discs has no measurable effect on reducing the high stress at inclusions and re-emphasise the need to exercise great care in selecting suitable discs for use in the insulating legs. (U.K.)

  12. Fatores prognósticos em fibrose pulmonar idiopática Prognostic factors in idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    ADALBERTO SPERB RUBIN

    2000-09-01

    Full Text Available Com o objetivo de avaliar quais fatores prognósticos são significativos na sobrevida de pacientes com fibrose pulmonar idiopática (FPI, foram estudados 117 casos com comprovação histológica da doença, internados no Pavilhão Pereira Filho entre 1970 e 1996. Todos os pacientes realizaram radiologia convencional de tórax, espirometria e preencheram um questionário padronizado no momento da internação. Foram também realizados medida da difusão (34 casos, capacidade pulmonar total (28, gasometria (106, lavado broncoalveolar (39, provas reumatismais (45 e tomografia computadorizada de tórax (24. Para uma análise mais específica, os pacientes foram dividos em dois grupos: grupo A (sobrevida até dois anos - 55 pacientes e grupo B (sobrevida maior que cinco anos - 24 pacientes, sendo estas características também analisadas de acordo com a significância em relação à sobrevida. Foram considerados fatores indicativos de pior prognóstico a idade avançada, a duração prolongada de sintomas, a gravidade da dispnéia, a redução da CVF, da DCO, da PaO2 e da SaO2, a intensidade do faveolamento e o grau de profusão do padrão reticular na TCAR. Estiveram também associados à menor sobrevida os valores menores de VEF1 e CPT. A utilização destes critérios de gravidade que apresentaram significância estatística, quando utilizados em conjunto, pode determinar uma avaliação prognóstica mais apurada em pacientes portadores de FPI, com implicações terapêuticas e sociais relevantes para seu manejo e acompanhamento.In order to evaluate which prognostic factors were significant to the survival of patients with idiopathic pulmonary fibrosis (IPF, 121 histologically confirmed cases of the disease were studied at the Pereira Filho Hospital from 1970 to 1996. All patients were submitted to a standard thorax X-ray and spirometry and answered a standardized questionnaire when admitted to hospital. They also underwent diffusion tests (34

  13. Systemic cancer multistep therapy; Systemische Krebs-Mehrschritt-Therapie

    Energy Technology Data Exchange (ETDEWEB)

    Weigang-Koehler, K. [Medizinische Klinik 5, Arbeitsgruppe Biologische Krebstherapie, Staedtisches Klinikum Nuernberg (Germany); Kaiser, G. [Medizinische Klinik 5, Arbeitsgruppe Biologische Krebstherapie, Staedtisches Klinikum Nuernberg (Germany); Gallmeier, W.M. [Medizinische Klinik 5, Arbeitsgruppe Biologische Krebstherapie, Staedtisches Klinikum Nuernberg (Germany)

    1997-04-11

    To get an insight into the claimed efficacy of `systemic cancer multistep therapy` (sKMT) with hyperglycemia, whole-body hyperthermia and hyperoxemia, we conducted a best case analysis with 20 patients who had received sKMT alone (9 patients) or in combination with chemo- or radiotherapy (11 patients). There was no complete remission or an unquestionable partial remission when sKMT was used alone. When sKMT was combined with classical effective therapies like chemo- and radiotherapy, 1 patient had questionable complete remission and 3 patients had partial remission. In these three patients sKMT had been combined with a newly applied chemotherapy: Therefore, it remains unclear which method was effective in causing the remission. (orig.) [Deutsch] Um eine Ueberblick ueber die behauptete Wirksamkeit der systemischen Krebs-Mehrschritt-Therapie (sKMT) nach von Ardenne zu erlangen, fuehrten wir eine Best-case-Analyse bei 20 Patienten durch, die die sKMT ohne Chemotherapie (9 Patienten) und in Kombination mit Chemo- bzw. Strahlentherapie (11 Patienten) erhalten hatten. sKMT allein hatte zu keiner kompletten Remission oder sicheren partiellen Remission gefuehrt. Bei der Kombination von sKMT mit klassischen Therapieverfahren wie Chemotherapie und Bestrahlung trat bei einem Patienten eine fragliche komplette Remission ein sowie bei 3 Patienten eine partielle Remission. Im letzteren Fall war jeweils eine fuer den Patienten neue Chemotherapie mit der sKMT kombiniert worden, so dass unklar bleibt, was die Verbesserung herbeifuehrte. (orig.)

  14. Taxis als Konzept der systemisch funktionalen Linguistik (SFL)

    DEFF Research Database (Denmark)

    Holsting, Alexandra Emilie Møller

    På baggrund af den systemisk funktionelle lingvistiks behandling af "hypotaktiske ekspansionssætninger" (det der traditionelt betegnes og betragtes som adverbialsætninger) foreslås en alternativ inddeling der kan tage højde for de grammatiske forskelle som ikke kan forklares med udgangspunkt i de...

  15. Parodontitis en systemische ziekten - van wetenschap naar praktijk

    NARCIS (Netherlands)

    Thomas, R Z; Loos, B G; Teeuw, W; Kunnen, A; van Winkelhoff, A J; Abbas, F

    2015-01-01

    The evidence for an association between systemic diseases and periodontitis is strongest with diabetes mellitus type 2 and cardiovascular disease. There is a moderate association of periodontitis with adverse pregnancy outcomes and rheumatoid arthritis. Periodontal treatment has, on average, a

  16. Expanding the clinical spectrum of hereditary fibrosing poikiloderma with tendon contractures, myopathy and pulmonary fibrosis due to FAM111B mutations.

    Science.gov (United States)

    Mercier, Sandra; Küry, Sébastien; Salort-Campana, Emmanuelle; Magot, Armelle; Agbim, Uchenna; Besnard, Thomas; Bodak, Nathalie; Bou-Hanna, Chantal; Bréhéret, Flora; Brunelle, Perrine; Caillon, Florence; Chabrol, Brigitte; Cormier-Daire, Valérie; David, Albert; Eymard, Bruno; Faivre, Laurence; Figarella-Branger, Dominique; Fleurence, Emmanuelle; Ganapathi, Mythily; Gherardi, Romain; Goldenberg, Alice; Hamel, Antoine; Igual, Jeanine; Irvine, Alan D; Israël-Biet, Dominique; Kannengiesser, Caroline; Laboisse, Christian; Le Caignec, Cédric; Mahé, Jean-Yves; Mallet, Stéphanie; MacGowan, Stuart; McAleer, Maeve A; McLean, Irwin; Méni, Cécile; Munnich, Arnold; Mussini, Jean-Marie; Nagy, Peter L; Odel, Jeffrey; O'Regan, Grainne M; Péréon, Yann; Perrier, Julie; Piard, Juliette; Puzenat, Eve; Sampson, Jacinda B; Smith, Frances; Soufir, Nadem; Tanji, Kurenai; Thauvin, Christel; Ulane, Christina; Watson, Rosemarie M; Khumalo, Nonhlanhla P; Mayosi, Bongani M; Barbarot, Sébastien; Bézieau, Stéphane

    2015-10-15

    Hereditary Fibrosing Poikiloderma (HFP) with tendon contractures, myopathy and pulmonary fibrosis (POIKTMP [MIM 615704]) is a very recently described entity of syndromic inherited poikiloderma. Previously by using whole exome sequencing in five families, we identified the causative gene, FAM111B (NM_198947.3), the function of which is still unknown. Our objective in this study was to better define the specific features of POIKTMP through a larger series of patients. Clinical and molecular data of two families and eight independent sporadic cases, including six new cases, were collected. Key features consist of: (i) early-onset poikiloderma, hypotrichosis and hypohidrosis; (ii) multiple contractures, in particular triceps surae muscle contractures; (iii) diffuse progressive muscular weakness; (iv) pulmonary fibrosis in adulthood and (v) other features including exocrine pancreatic insufficiency, liver impairment and growth retardation. Muscle magnetic resonance imaging was informative and showed muscle atrophy and fatty infiltration. Histological examination of skeletal muscle revealed extensive fibroadipose tissue infiltration. Microscopy of the skin showed a scleroderma-like aspect with fibrosis and alterations of the elastic network. FAM111B gene analysis identified five different missense variants (two recurrent mutations were found respectively in three and four independent families). All the mutations were predicted to localize in the trypsin-like cysteine/serine peptidase domain of the protein. We suggest gain-of-function or dominant-negative mutations resulting in FAM111B enzymatic activity changes. HFP with tendon contractures, myopathy and pulmonary fibrosis, is a multisystemic disorder due to autosomal dominant FAM111B mutations. Future functional studies will help in understanding the specific pathological process of this fibrosing disorder.

  17. Estado nutricional e distribuição de gordura corporal em crianças e adolescentes com Fibrose Cística

    Directory of Open Access Journals (Sweden)

    Célia Regina Moutinho de Miranda Chaves

    2015-11-01

    Full Text Available O objetivo deste estudo é avaliar o estado nutricional e a distribuição da gordura corporal em crianças e adolescentes com fibrose cística. Foram realizadas avaliação da distribuição de gordura corporal por meio da absorciometria de duplo feixe de energia, do estado nutricional por estatura/idade e índice de massa corporal/idade e a ingestão dietética pelo recordatório alimentar de 24horas, em 56 pacientes com idade entre 8 e 18 anos. Aproximadamente 50% da amostra apresentou estado nutricional adequado. A maioria apresentou a ingestão calórica e de lipídios inadequadas. O IMC/I foi o indicador nutricional que melhor evidenciou o aumento do percentual de gordura do tronco, razão androide/ginecoide e razão gordura tronco/gordura total. Os pacientes com Insuficiência Pancreática e os eutróficos apresentaram razão mediana androide/ginecoide maior. O aumento da adiposidade abdominal foi evidenciado pela DXA. O IMC/I não identificou a diminuição da massa magra corporal, mas quando aumentado foi significativo para adiposidade abdominal. Pacientes com fibrose cística devem associar a avaliação antropométrica à composição corporal e à distribuição de gordura corporal para um diagnóstico mais precoce de desnutrição e fatores de risco cardiometabólico.

  18. Application of water quality indices NSF, DINIUS and BMWP to Ayura Creek, Antioquia, Colombia

    International Nuclear Information System (INIS)

    Gonzalez Melendez, Viky; Caicedo Quintero, Orlando; Aguirre Ramirez, Nestor

    2013-01-01

    This investigation evaluates the quality of water in the creek The Ayura (municipality of Envigado, Antioquia, Colombia), through application of the National Sanitation Foundation (NSF) and Dinius quality indexes, and the biotic index BMWP/Col. the estimate of these indexes was conducted with data collected in three sites and three moments. Physicochemical and microbiological variables were determinate; we also performed a qualitative and quantitative sampling of aquatic macroinvertebrates. Using this methodology the behavior of physical-chemical and biological community in the different sites was studied. The physicochemical and aquatic macroinvertebrate indexes results showed that site 1 provides a good quality of water and the sites 2 and 3 a middle deteriorated water quality.

  19. Structural analysis of wind turbine rotors for NSF-NASA Mod-0 wind power system

    Science.gov (United States)

    Spera, D. A.

    1976-01-01

    Preliminary estimates are presented of vibratory loads and stresses in hingeless and teetering rotors for the proposed NSF-NASA Mod-0 wind power system. Preliminary blade design utilizes a tapered tubular aluminum spar which supports nonstructural aluminum ribs and skin and is joined to the rotor hub by a steel shank tube. Stresses in the shank of the blade are calculated for static, rated, and overload operating conditions. Blade vibrations were limited to the fundamental flapping modes, which were elastic cantilever bending for hingeless rotor blades and rigid-body rotation for teetering rotor blades. The MOSTAB-C computer code was used to calculate aerodynamic and mechanical loads. The teetering rotor has substantial advantages over the hingeless rotor with respect to shank stresses, fatigue life, and tower loading. The hingeless rotor analyzed does not appear to be structurally stable during overloads.

  20. Proceedings: Joint DOE/NSF Workshop on flow of particulates and fluids

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-31

    These proceedings are the result of the Fifth DOR-NSF Workshop on fundamental research in the area of particulate two-phase flow and granular flow. The present collection of twenty contributions from universities and national laboratories is based on research projects sponsored by either the Department of Energy or the National Science Foundation. These papers illustrate some of the latest advances in theory, simulations, and experiments. The papers from the Workshop held September 29--October 1, 1993 have been separated into three basic areas: experiments, theory, and numerical simulations. A list of attendees at the workshop is included at the end of the proceedings. Selected papers have been indexed separately for inclusion in the Energy Science and Technology Database.

  1. Monitoring the consequences of decreased ozone protection: The NSF ultraviolet radiation monitoring network

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    The effects of decreased protection from ultraviolet radiation are as troubling as the continuing depletion of stratospheric ozone. Evidence exists to clearly link ozone depletion to changes in the antarctic marine environment. Results of two 1992 papers are summarized here. Enhanced exposure to mid-range UV radiation was found to be affecting marine ecosystems with a recorded 6-12 percent reduction in primary productivity directly related to the ozone layer depletion. In another experiment, a model was developed indicating that the ozone hole could reduce near-surface photosynthesis by as much as 12-15 percent. The NSF UV monitoring system in place for these and other experiments uses a spectroradiometer, making hourly, high-resolution measurements of the distribution of UV surface irradiance

  2. Preparing Scientists for Scientific Careers: Broader Impacts from an NSF CAREER Award

    Science.gov (United States)

    Crosby, Alfred

    2008-03-01

    The scientific focus of my NSF CAREER Award is the impact of patterns, topographical and surface chemical in design, on the adhesion of soft polymer interfaces. Although this topic has provided a strong foundation for the mentoring and training of graduate students, the primary broader impacts of my award have focused on the development of ``soft'' skills in graduate and post-doctoral researchers in STEM disciplines. I have developed a course on ``Scientific and Engineering Management,'' which provides an open forum for students to explore the skills that, in many ways, define successful careers for many scientists. Topics include: leadership, proposal writing, group management, communication in diverse environments, and ethics. In this presentation, I highlight the primary phases of this program, how it meshes with scientific goals, and general statements about the mission of education outreach within STEM disciplines.

  3. Improving Science Teacher Preparation through the APS PhysTEC and NSF Noyce Programs

    Science.gov (United States)

    Williams, Tasha; Tyler, Micheal; van Duzor, Andrea; Sabella, Mel

    2013-03-01

    Central to the recruitment of students into science teaching at a school like CSU, is a focus on the professional nature of teaching. The purpose of this focus is twofold: it serves to change student perceptions about teaching and it prepares students to become teachers who value continued professional development and value the science education research literature. The Noyce and PhysTEC programs at CSU place the professional nature of teaching front and center by involving students in education research projects, paid internships, attendance at conferences, and participation in a new Teacher Immersion Institute and a Science Education Journal Reading Class. This poster will focus on specific components of our teacher preparation program that were developed through these two programs. In addition we will describe how these new components provide students with diverse experiences in the teaching of science to students in the urban school district. Supported by the NSF Noyce Program (0833251) and the APS PhysTEC Program.

  4. Unmet needs for analyzing biological big data: A survey of 704 NSF principal investigators.

    Directory of Open Access Journals (Sweden)

    Lindsay Barone

    2017-10-01

    Full Text Available In a 2016 survey of 704 National Science Foundation (NSF Biological Sciences Directorate principal investigators (BIO PIs, nearly 90% indicated they are currently or will soon be analyzing large data sets. BIO PIs considered a range of computational needs important to their work, including high performance computing (HPC, bioinformatics support, multistep workflows, updated analysis software, and the ability to store, share, and publish data. Previous studies in the United States and Canada emphasized infrastructure needs. However, BIO PIs said the most pressing unmet needs are training in data integration, data management, and scaling analyses for HPC-acknowledging that data science skills will be required to build a deeper understanding of life. This portends a growing data knowledge gap in biology and challenges institutions and funding agencies to redouble their support for computational training in biology.

  5. Unmet needs for analyzing biological big data: A survey of 704 NSF principal investigators.

    Science.gov (United States)

    Barone, Lindsay; Williams, Jason; Micklos, David

    2017-10-01

    In a 2016 survey of 704 National Science Foundation (NSF) Biological Sciences Directorate principal investigators (BIO PIs), nearly 90% indicated they are currently or will soon be analyzing large data sets. BIO PIs considered a range of computational needs important to their work, including high performance computing (HPC), bioinformatics support, multistep workflows, updated analysis software, and the ability to store, share, and publish data. Previous studies in the United States and Canada emphasized infrastructure needs. However, BIO PIs said the most pressing unmet needs are training in data integration, data management, and scaling analyses for HPC-acknowledging that data science skills will be required to build a deeper understanding of life. This portends a growing data knowledge gap in biology and challenges institutions and funding agencies to redouble their support for computational training in biology.

  6. Year 4 Of The NSF-funded PAARE Project At SC State

    Science.gov (United States)

    Walter, Donald K.; Brittain, S. D.; Cash, J. L.; Hartmann, D. H.; Howell, S. B.; King, J. R.; Leising, M. D.; Mayo, E. A.; Mighell, K. J.; Smith, D. M.

    2012-01-01

    We summarize the progress made through Year 4 of "A Partnership in Observational and Computational Astronomy (POCA)". This NSF-funded project is part of the "Partnerships in Astronomy and Astrophysics Research and Education (PAARE)" program. Our partnership includes South Carolina State University (a Historically Black College/University), Clemson University (a Ph.D. granting institution) and the National Optical Astronomy Observatory. Fellowships provided by POCA as well as recruitment efforts on the national level have resulted in enrolling a total of four underrepresented minorities into the Ph.D. program in astronomy at Clemson. We report on the success and challenges to recruiting students into the undergraduate physics major with astronomy option at SC State. Our summer REU program under POCA includes underrepresented students from across the country conducting research at each of our three institutions. Examples are given of our inquiry-based, laboratory exercises and web- based activities related to cosmology that have been developed with PAARE funding. We discuss our ground-based photometric and spectroscopic study of RV Tauri and Semi-Regular variables which has been expanded to include successful Cycle 2 Kepler observations of a dozen of these objects reported elsewhere at this conference (see D.K. Walter, et.al.). Support for the POCA project is provided by the NSF PAARE program to South Carolina State University under award AST-0750814 as well as resources and support provided by Clemson University and the National Optical Astronomy Observatory. Support for the Kepler observations is provided by NASA to South Carolina State University under award NNX11AB82G.

  7. Building A Drought Science Learning Community: Education and Engagement in an NSF CAREER Grant

    Science.gov (United States)

    Quiring, S. M.

    2011-12-01

    This paper describes the education and engagement plan of the NSF CAREER award that I received in 2011 (Role of Soil Moisture in Seasonal to Interannual Climate Variability in the U.S. Great Plains; NSF Award #1056796). A key component of this plan is the development of a Drought Science Learning Community. A learning community is a program of courses and activities, which may include social and academic activities outside the classroom, that form a single program of instruction. Learning communities serve to increase faculty-student and student-student interaction, improve active and collaborative learning, and develop curricular coherence. The goal of a learning community is to encourage integration of learning across courses and to involve students with one of the grand challenges facing society. Students will be recruited from a Freshman Year Seminar (FYS) that I teach every Fall. Students who belong to the learning community will participate in the Water Management and Hydrological Sciences Seminar Series, relevant field trips, and monthly brown bag lunch meetings where students and faculty will discuss their current research projects and recently published scientific articles. Students who participate in learning community activities will benefit from a common intellectual experience that will help them to develop linkages between courses, regular interactions with faculty mentors, and the opportunity to contribute to faculty research. All students will be encouraged to complete an undergraduate thesis as the capstone experience of their participation in the learning community. In addition to describing the organization of the education and engagement plan, I will also discuss expected outcomes, best practices and lessons learned.

  8. Fibrose cística em adultos: aspectos clínicos e espirométricos Cystic fibrosis in adults clinical and spirometric aspects

    Directory of Open Access Journals (Sweden)

    Antônio Carlos M. Lemos

    2004-02-01

    Full Text Available INTRODUÇÃO: A fibrose cística é diagnosticada usualmente na infância. No Brasil, poucos estudos abordam seu diagnóstico na idade adulta. OBJETIVO: Descrever as características demográficas, clínicas e os achados de espirometria dos pacientes com fibrose cística diagnosticados na idade adulta, na Bahia (Brasil. MÉTODO: Foram avaliados 28 pacientes com fibrose cística diagnosticada na idade adulta no Centro de Referência de Fibrose Cística do Estado da Bahia. As variáveis de interesse foram: idade, gênero, cor, índice de massa corpórea (IMC, cultivo do escarro, porcentagem do previsto da capacidade vital forçada (% CVF, porcentagem do previsto do volume expiratório forçado no primeiro segundo (% VEF1 e resposta ao broncodilatador. RESULTADOS: A média de idade dos pacientes foi de 31,1±12,4 anos. A proporção de negros e mulatos foi de 53,7%, e a média de IMC foi 18,7±3,0Kg/m2. Em doze pacientes (43% foi confirmada P. aeruginosa no escarro. As médias ±DP dos percentuais do previsto da CVF e do VEF1 foram de 58,9±21,6% e 44,1±23% respectivamente. No grupo colonizado por P. aeruginosa as médias dos parâmetros espirométricos foram inferiores às do grupo não colonizado. Entretanto, somente em relação à CVF esta diferença alcançou significância estatística (p= 0,007. CONCLUSÃO: Concordante com a literatura, este estudo reforça que o diagnóstico de fibrose cística deve ser investigado em pacientes com infecções respiratórias de repetição, sinusite e bronquiectasias, mesmo na idade adulta. Os valores dos percentuais da CVF e VEF1 em relação ao previsto foram menores nos pacientes colonizados por P aeruginosa, evidenciando uma maior deterioração da função pulmonar.INTRODUCTION: Cystic Fibrosis is usually diagnosed in childhood. In Brazil, few studies have approached CF diagnosed in adulthood. OBJECTIVE: The aim of this study was to describe demographic and clinical characteristics and spirometric

  9. A longitudinal study of whole body, tissue, and cellular physiology in a mouse model of fibrosing NASH with high fidelity to the human condition.

    Science.gov (United States)

    Krishnan, Anuradha; Abdullah, Tasduq Sheikh; Mounajjed, Taofic; Hartono, Stella; McConico, Andrea; White, Thomas; LeBrasseur, Nathan; Lanza, Ian; Nair, Sreekumaran; Gores, Gregory; Charlton, Michael

    2017-06-01

    The sequence of events that lead to inflammation and fibrosing nonalcoholic steatohepatitis (NASH) is incompletely understood. Hence, we investigated the chronology of whole body, tissue, and cellular events that occur during the evolution of diet-induced NASH. Male C57Bl/6 mice were assigned to a fast-food (FF; high calorie, high cholesterol, high fructose) or standard-chow (SC) diet over a period of 36 wk. Liver histology, body composition, mitochondrial respiration, metabolic rate, gene expression, and hepatic lipid content were analyzed. Insulin resistance [homeostasis model assessment-insulin resistance (HOMA-IR)] increased 10-fold after 4 wk. Fibrosing NASH was fully established by 16 wk. Total hepatic lipids increased by 4 wk and remained two- to threefold increased throughout. Hepatic triglycerides declined from sixfold increase at 8 wk to threefold increase by 36 wk. In contrast, hepatic cholesterol levels steadily increased from baseline at 8 wk to twofold by 36 wk. The hepatic immune cell population altered over time with macrophages persisting beyond 16 wk. Mitochondrial oxygen flux rates of FF mice diet were uniformly lower with all the tested substrates (13-276 pmol·s -1 ·ml -1 per unit citrate synthase) than SC mice (17-394 pmol·s -1 ·ml -1 per unit citrate synthase) and was accompanied by decreased mitochondrial:nuclear gene copy number ratios after 4 wk. Metabolic rate was lower in FF mice. Mitochondrial glutathione was significantly decreased at 24 wk in FF mice. Expression of dismutases and catalase was also decreased in FF mice. The evolution of NASH in the FF diet-induced model is multiphasic, particularly in terms of hepatic lipid composition. Insulin resistance precedes hepatic inflammation and fibrosis. Mitochondrial dysfunction and depletion occur after the histological features of NASH are apparent. Collectively, these observations provide a unique overview of the sequence of changes that coevolve with the histological evolution of

  10. Exploration of NSF-ATE Projects Approaches in the Integration of Technology and Engineering Education at the K-12 Levels

    Science.gov (United States)

    Strobel, Johannes; Mendoza Díaz, Noemi V.

    2012-01-01

    Access to post-secondary education, specifically in the technical, two-year institution area, is a topic of growing interest in the country. Funding agencies, such as NSF, via the Advanced Technological Education Program (ATE), are supporting initiatives and research aimed at increasing the number of technicians and engineers and improving…

  11. Cryptosporidium sebagai Indikator Biologi dan Indeks Nsf-Wqi untuk Mengevaluasi Kualitas Air (Studi Kasus: Hulu Sungai Citarum, Kabupaten Bandung

    Directory of Open Access Journals (Sweden)

    Tastaptyani Kurnia Nufutomo

    2017-11-01

    Full Text Available Kualitas air yang menurun di Hulu Sungai Citarum dapat disebabkan oleh banyak faktor. Faktor-faktor tersebut dapat diketahui dari parameter fisika, kimia dan biologi. Parameter biologi yang digunakan untuk mengevaluasi kualitas air adalah  mikroorganisme patogen yang menimbulkan penyakit di sistem pencernaan seperti diare akut, yaitu Coliform dan Cryptosporidium. Tujuan penelitian ini adalah untuk mengetahui status kualitas air di Hulu Sungai Citarum dengan indeks kualitas air NSF-WQI, mengetahui hubungan dan pengaruh parameter fisik dan kimia air terhadap parameter biologi, menentukan faktor utama dari parameter air yang paling berpengaruh dan mengetahui hubungan serta pengaruh faktor utama tersebut terhadap Cryptosporidium. Metode yang digunakan adalah  mengambil sampel di tiap stasiun dengan composite, mengidentifikasi dan analisis Coliform dengan MPN dan identifikasi Crytosporidium dengan Ziehl Neelsen staining, kemudian menganalisis parameter kimia dan fisika dengan indeks NSF-WQI, lalu data tersebut diolah menggunakan metode statistik PCA. Hasil pengukuran kualitas air berdasarkan NSF-WQI adalah kualitas air di Hulu Sungai Citarum termasuk kategori buruk dan medium. Keberadaan Cryptosporidium di Hulu Sungai Citarum disebabkan oleh 2 (dua faktor utama, yaitu faktor pertama terdiri dari DO, turbiditas, NO2, NH4 dan total Colifom, sedangkan faktor kedua terdiri dari TSS, COD dan PO4. Kedua faktor tersebut tidak signifikan dengan keberadaan Cryptosporidium di Hulu Sungai Citarum. Kata kunci: Cryptosporidium, Hulu Sungai Citarum, Indeks NSF-WQI, Kualitas Air

  12. Year-Long Peer Mentoring Activity to Enhance the Retention of Freshmen STEM Students in a NSF Scholarship Program

    Science.gov (United States)

    Cutright, Teresa J.; Evans, Edward

    2016-01-01

    The last year of a National Science Foundation (NSF) funded scholarship program was used to provide pseudo-formal peer mentoring activities to engineering, mathematics, and science undergraduates. A one-credit class was used to afford time for peer mentors and mentees to interact. During the fall semester, seniors augmented each week's topics with…

  13. Evaluation of NSF's Program of Grants and Vertical Integration of Research and Education in the Mathematical Sciences (VIGRE)

    Science.gov (United States)

    National Academies Press, 2009

    2009-01-01

    In 1998, the National Science Foundation (NSF) launched a program of Grants for Vertical Integration of Research and Education in the Mathematical Sciences (VIGRE). These grants were designed for institutions with PhD-granting departments in the mathematical sciences, for the purpose of developing high-quality education programs, at all levels,…

  14. The U.S. NSF Ocean Observatories Initiative: A Modern Virtual Observatory

    Science.gov (United States)

    Orcutt, John; Vernon, Frank; Peach, Cheryl; Arrott, Matthew; Graybeal, John; Farcas, Claudiu; Farcas, Emilia; Krueger, Ingolf; Meisinger, Michael; Chave, Alan

    2010-05-01

    The NSF Ocean Observatories Initiative (OOI) began a five-year construction period in October 2009. The Consortium on Ocean Leadership (COL) manages the overall program with Implementing Organizations for Coastal/Global Scale Nodes (CGSN) at Woods Hole, Oregon State and Scripps; the Regional Cabled Network (RCN) at U of Washington and Cyberinfrastructure (CI) at UCSD and more than ten subcontractors. The NSF has made a commitment to support the observatory operations and maintenance for a 30-year period; a minimal period of time to measure physical, chemical and biological data over a length of time possibly sufficient to measure secular changes associated with climate and geodesy. The CI component is a substantial departure from previous approaches to data distribution and management. These innovations include the availability of data in near-real-time with latencies of seconds, open access to all data, analysis of the data stream for detection and modeling, use of the derived knowledge to modify the network with minimal or no human interaction and maintenance of data provenance through time as new versions of the data are created through QA/QC processes. The network architecture is designed to be scalable so that addition of new sensors is straightforward and inexpensive with costs increasing linearly at worst. Rather than building new computer infrastructure (disk farms and computer clusters), we are presently exploiting Amazon's Extensible Computing Cloud (EC2) and Simple Storage System (S3) to reduce long-term commitments to hardware and maintenance in order to minimize operations and maintenance costs. The OOI CI is actively partnering with other organizations (e.g. NOAA's IOOS) to integrate existing data systems using many of the same technologies to improve broad access to existing and planned observing systems, including those that provide critical climate data. Because seasonal and annual variability of most measureable parameters is so large, the

  15. Professional Development for Graduate Students through Internships at Federal Labs: an NSF/USGS Collaboration

    Science.gov (United States)

    Snow, E.; Jones, E.; Patino, L. C.; Wasserman, E.; Isern, A. R.; Davies, T.

    2016-12-01

    In 2013 the White House initiated an effort to coordinate STEM education initiatives across federal agencies. This idea spawned several important collaborations, one of which is a set of National Science Foundation programs designed to place graduate students in federal labs for 2-12 months of their Ph.D. training. The Graduate Research Internship Program (GRIP) and the Graduate Student Preparedness program (GSP) each have the goal of exposing PhD students to the federal work environment while expanding their research tools and mentoring networks. Students apply for supplementary support to their Graduate Research Fellowship (GRIP) or their advisor's NSF award (GSP). These programs are available at several federal agencies; the USGS is one partner. At the U.S. Geological Survey, scientists propose projects, which students can find online by searching USGS GRIP, or students and USGS scientists can work together to develop a research project. At NSF, projects are evaluated on both the scientific merit and the professional development opportunities they afford the student. The career development extends beyond the science (new techniques, data, mentors) into the professional activity of writing the proposal, managing the budget, and working in a new and different environment. The USGS currently has 18 GRIP scholars, including Madeline Foster-Martinez, a UC Berkeley student who spent her summer as a GRIP fellow at the USGS Pacific Coastal and Marine Science Center working with USGS scientist Jessica Lacy. Madeline's Ph.D. work is on salt marshes and she has studied geomorphology, accretion, and gas transport using a variety of research methods. Her GRIP fellowship allowed her to apply new data-gathering tools to the question of sediment delivery to the marsh, and build and test a model for sediment delivery along marsh edges. In addition, she gained professional skills by collaborating with a new team of scientists, running a large-scale field deployment, and

  16. Calibration and Field Deployment of the NSF G-V VCSEL Hygrometer

    Science.gov (United States)

    DiGangi, J. P.; O'Brien, A.; Diao, M.; Hamm, C.; Zhang, Q.; Beaton, S. P.; Zondlo, M. A.

    2012-12-01

    Cloud formation and dynamics have a significant influence on the Earth's radiative forcing budget, which illustrates the importance of clouds with respect to global climate. Therefore, an accurate understanding of the microscale processes dictating cloud formation is crucial for accurate computer modeling of global climate change. A critical tool for understanding these processes from an airborne platform is an instrument capable of measuring water vapor with both high accuracy and time, thus spatial, resolution. Our work focuses on an open-path, compact, vertical-cavity surface-emitting laser (VCSEL) absorption-based hygrometer, capable of 25 Hz temporal resolution, deployed on the NSF/NCAR Gulfstream-V aircraft platform. The open path nature of our instrument also helps to minimize sampling artifacts. We will discuss our efforts toward achieving within 5% accuracy over 5 orders of magnitude of water vapor concentrations. This involves an intercomparison of five independent calibration methods: ice surface saturators using an oil temperature bath, solvent slush baths (e.g. chloroform/LN2, water/ice), a research-grade frost point hygrometer, static pressure experiments, and Pt catalyzed hydrogen gas. This wide variety of available tools allows us to accurately constrain the calibrant water vapor concentrations both before and after the VCSEL hygrometer sampling chamber. For example, the mixing ratio as measured by research-grade frost point hygrometer after the VCSEL hygrometer agreed within 2% of the mixing ration expected from the water/ice bubbler source before the VCSEL over the temperature range -50°C to 20°C. Finally, due to the compact nature of our instrument, we are able to perform these calibrations simultaneously at the same temperatures (-80°C to 30°C) and pressures (150 mbar to 760 mbar) as sampled ambient air during a flight. This higher accuracy can significantly influence the science utilizing this data, which we will illustrate using

  17. An Analysis of NSF Geosciences Research Experience for Undergraduate Site Programs from 2009 through 2011

    Science.gov (United States)

    Rom, E. L.; Patino, L. C.; Weiler, S.; Sanchez, S. C.; Colon, Y.; Antell, L.

    2011-12-01

    The Research Experience for Undergraduate (REU) Program at the U.S. National Science Foundation (NSF) provides U.S. undergraduate students from any college or university the opportunity to conduct research at a different institution and gain a better understanding of research career pathways. The Geosciences REU Sites foster research opportunities in areas closely aligned with geoscience programs, particularly those related to earth, atmospheric and ocean sciences. The aim of this paper is to provide an overview of the Geosciences REU Site programs run in 2009 through 2011. A survey requesting information on recruitment methods, student demographics, enrichment activities, and fields of research was sent to the Principal Investigators of each of the active REU Sites. Over 70% of the surveys were returned with the requested information from about 50 to 60 sites each year. The internet is the most widely used mechanism to recruit participants, with personal communication as the second most important recruiting tool. The admissions rate for REU Sites in Geosciences varies from less than 10% to 50%, with the majority of participants being rising seniors and juniors. Many of the participants come from non-PhD granting institutions. Among the participants, gender distribution varies by discipline, with ocean sciences having a large majority of women and earth sciences having a majority of men. Regarding ethnic diversity, the REU Sites reflect the difficulty of attracting diverse students into Geosciences as a discipline; a large majority of participants are Caucasian and Asian students. Furthermore, participants from minority-serving institutions and community colleges constitute a small percentage of those taking part in these research experiences. The enrichment activities are very similar across the REU Sites, and mimic activities common to the scientific community, including intellectual exchange of ideas (lab meetings, seminars, and professional meetings

  18. Avaliação do uso do captopril na fibrose peritoneal induzida em ratos pelo uso de solução de glicose a 4,25%

    Directory of Open Access Journals (Sweden)

    Adriana Fátima Menegat Schuinski

    2013-12-01

    Full Text Available INTRODUÇÃO: A Insuficiência Renal Crônica (IRC tem incidência alarmante neste século. A diálise peritoneal, uma das modalidades de terapia renal pode ter complicações, e entre estas a fibrose peritoneal, que ocorre com o decorrer dos anos nestes pacientes. Sua forma mais grave é a chamada peritonite esclerosante encapsulante, levando à mudança de terapia dialítica. OBJETIVO: Estudar a influência do uso do captopril na fibrose peritoneal induzida em ratos pelo uso de solução de glicose a 4,25 %. MÉTODOS: Estudo prospectivo controlado, em ratos Wistar não urêmicos. Foram estudados 20 animais. Os animais foram submetidos diariamente à punção abdominal, sendo infundida solução de diálise peritoneal com glicose a 4,25% na dose de 10 ml/100 g de peso. Os animais foram divididos em 2 grupos: experimental e controle. O grupo experimental recebeu captopril na dose de 30 mg/kg/dia por gavagem. O grupo controle não recebeu nenhuma droga. Foram acompanhados por 21 e 49 dias. Ao final do período foram submetidos à procedimento cirúrgico para retirada de peritônio parietal e visceral. As amostras obtidas foram analisadas histologicamente, usando-se coloração Hematoxilina - Eosina e Sirius Red, para avaliação do grau de fibrose. RESULTADOS: A análise mostrou que a intensidade da fibrose, a espessura do peritônio e o número de células não atingiram diferença estatisticamente significante entre os grupos experimental e controle. CONCLUSÃO: O estudo mostrou que o uso do captopril não foi capaz de alterar a intensidade da fibrose peritoneal induzida pelo uso de solução de diálise em ratos.

  19. Genetic modifiers of comatose mutations in Drosophila: insights into neuronal NSF (N-ethylmaleimide-sensitive fusion factor) functions.

    Science.gov (United States)

    Sanyal, Subhabrata; Krishnan, K S

    2012-09-01

    By the middle of the 20th century, development of powerful genetic approaches had ensured that the fruit fly would remain a model organism of choice for genetic and developmental studies. But in the 1970s, a few pioneering groups turned their attention to the prospect of using the fly for neurophysiological experiments. They proposed that in a poikilothermic organism such as Drosophila, temperature-sensitive or "ts" mutations in proteins that controlled nerve function would translate to a "ts" paralytic phenotype. This was by no means an obvious or even a likely assumption. However, following directed screens these groups soon reported dramatic demonstrations of reversible ts paralysis in fly mutants. Resultantly, these "simple" experiments led to the isolation of a number of conditional mutations including shibire, paralytic, and comatose. All have since been cloned and have enabled deep mechanistic insights into synaptic transmission and nerve conduction. comatose (comt) mutations, for example, were found to map to missense changes in dNSF1, a neuron-specific fly homolog of mammalian NSF (N-ethylmaleimide-sensitive fusion factor). Studies on comt were also some of the first to discriminate between nuanced models of NSF function during presynaptic transmitter release that have since been borne out by experiments in multiple preparations. Here, the authors present an overview of NSF function as it is understood today, with an emphasis on contributions from Drosophila beginning with experiments carried out by Obaid Siddiqi in the Benzer laboratory. The authors also outline initial results from a genetic screen for phenotypic modifiers of comt that hold the promise of further elucidating NSF function at the synapse. Over the years, the neuromuscular system of Drosophila has served as a uniquely accessible model to unravel mechanisms underlying synaptic transmission. To this day, ts paralysis remains one of the most emphatic demonstrations of nerve function in an

  20. Expression and distribution of connexin 32 in rat liver with experimentally induced fibrosis Expressão e distribuição da conexina 32 em fígados de ratos com fibrose induzida experimentalmente

    Directory of Open Access Journals (Sweden)

    Alexandro dos S. Rodrigues

    2009-04-01

    Full Text Available The connexin 32 (Cx32 is a protein that forms the channels that promote the gap junction intercellular communication (GJIC in the liver, allowing the diffusion of small molecules through cytosol from cell-to-cell. Hepatic fibrosis is characterized by a disruption of normal tissue architeture by cellular lesions, and may alter the GJIC. This work aimed to study the expression and distribution of Cx32 in liver fibrosis induced by the oral administration of dimethylnitrosamine in female Wistar rats. The necropsy of the rats was carried out after five weeks of drug administration. They presented a hepatic fibrosis state. Sections from livers with fibrosis and from control livers were submitted to immunohistochemical, Real Time-PCR and Western-Blot analysis to Cx32. In fibrotic livers the Cxs were diffusely scattered in the cytoplasm, contrasting with the control livers, where the Cx32 formed junction plaques at the cell membrane. Also it was found a decrease in the gene expression of Cx32 without reduction in the protein quantity when compared with controls. These results suggest that there the mechanism of intercellular communication between hepatocytes was reduced by the fibrotic process, which may predispose to the occurrence of a neoplastic process, taken in account that connexins are considered tumor suppressing genes.A conexina 32 (Cx32 é uma proteína que constitui os canais que promovem as comunicações intercelulares via junções comunicantes (CIJC no fígado, permitindo difusão de pequenas moléculas citoplasmáticas de uma célula à outra. A fibrose hepática caracteriza-se pela alteração da arquitetura normal do fígado e podem alterar as CIJCs. O objetivo deste trabalho foi estudar a expressão e distribuição de Cx32 na fibrose hepática. O objetivo do presente trabalho foi estudar a expressão e distribuição da Cx32 em fígados com fibrose induzida pela administração oral de dimetilnitrosamina em fêmeas de ratos Wistar. A

  1. Perfil de citocinas da polipose nasossinusal na Fibrose Cística comparado com indivíduos sem doenças nasossinusais Cytokine profile in subjects with Cystic Fibrosis and nasal polyposis compared to patients with no nasal disorders

    Directory of Open Access Journals (Sweden)

    Flávio Barbosa Nunes

    2010-02-01

    Full Text Available Embora o perfil das citocinas na polipose nasossinusal seja bem documentado, pouco se sabe sobre estas proteínas quando associadas à Fibrose Cística. OBJETIVOS: Avaliar a expressão das citocinas IL¬4, IL¬5, IL¬6, IL¬8, GM¬C-SF e IFN--y analisada pela RT¬-PCR, nos pólipos de pacientes com Fibrose Cística. MATERIAL E MÉTODO: Estudo transversal, prospectivo, de 24 pacientes, 13 com Fibrose Cística e polipose nasossinusal (Grupo Fibrose Cística e 11 com exame otorrinolaringológico normal (Grupo Controle. A média de idade foi de 21 anos (3¬-57, 12 eram do sexo masculino e 12 do sexo feminino. O perfil das citocinas foi pesquisado nos fragmentos de mucosa (Grupo Controle ou pólipo nasal (Grupo Fibrose Cística através da RT-¬PCR. Foram estudadas as transcrições para as citocinas IL¬4, IL¬5, IL¬6, IL¬8, IFN¬y e GM¬-CSF ajustadas pelo valor da β¬ actina. RESULTADOS: As interleucinas 5, 6, 8 e GM¬-CSF foram semelhantes nos dois grupos (p>0,05. Menores valores de IFNy¬ (p=0,03 e forte tendência de aumento de IL¬4 (p=0,06 foram observados no grupo Fibrose Cística. CONCLUSÃO: As células inflamatórias e estruturais podem produzir RNA mensageiro para IL¬4, bloqueando a produção de outras citocinas com IFN-y¬, sugerindo a participação destes mecanismos na formação dos pólipos da Fibrose Cística.Although the cytokine profile in nasal polyposis is well documented, little is known about cytokines associated to cystic fibrosis. AIM: Assess the expression of cytokines IL¬4, IL¬5, IL¬6, IL¬8, GM¬-CSF and IFN¬-y, analyzed through RT-PCR, in the polyps of patients with cystic fibrosis. MATERIALS AND METHODS: A cross-sectional, prospective study was carried out with 24 patients, 13 of whom had cystic fibrosis and nasal polyposis (Cystic Fibrosis Group and 11 had normal otorhinolaryngological exams (Control Group. The average age was 21 years (3¬57; 12 participants were males and 12 were females. The cytokine

  2. International perspective on nanotechnology papers, patents, and NSF awards (2000-2016)

    Science.gov (United States)

    Zhu, Hongyi; Jiang, Shan; Chen, Hsinchun; Roco, Mihail C.

    2017-11-01

    This paper presents the development of nanotechnology between 2000 and 2016 as reflected in the Web of Science papers, United States Patent and Trademark Office (USPTO), World International Property Organization (WIPO) patents, and National Science Foundation (NSF) awards, with a special reference to the United States (US), European Union (EU27), P.R. China, Japan, and South Korea. The field of nanotechnology is branching out into novel scientific and technology platforms, and it is increasingly difficult to separate foundational nanoscale components from divergent application areas. The average global growth rate has been sustained at about 15% for both papers and patents in the selected interval. The growth rates among regions are non-uniform. P.R. China and South Korea have increased faster in both the numbers and quality of their scientific publications, and currently P.R. China has the largest volume of nanotechnology publications and South Korea the most publications per capita in the field of nanotechnology. The US, EU27, and Japan are maintaining leadership in the upstream, better cited, conceptual components of nanotechnology research and development.

  3. Cybersecurity Implications for Industry, Academia, and Parents: A Qualitative Case Study in NSF STEM Education

    Science.gov (United States)

    Stevenson, Gregory V.

    Rationale: Former President Barack Obama's 3.9 trillion for the 2015 fiscal year budget request included a 2.9 billion investment in Science, Technology, Engineering and Math (STEM) education. Research then showed that the national spending for cybersecurity has exceeded $10.7 billion in the 2015 fiscal year. Nonetheless, the number of cyberattacks has risen year after year since 2012, potentially due to the lack of education and training in cybersecurity. Methodology: A qualitative case study research was conducted to explore and investigate the lived professional experiences of experts from San Antonio Texas whose efforts were aligned to increase the number of qualified cybersecurity professionals. To qualify the organizational needs for cybersecurity professionals, the study gathered expert opinions by surveying human resource managers pertaining to the needs of cybersecurity education. To refine and further validate data collection efforts, the study involved researcher observations and a survey of a narrow cohort to perform analytic induction to eliminate bias and exhaust the exploratory research (Maxwell, 2005). Result: The findings of the case study will: 1) help augment the importance of cybersecurity education in pre-kindergarten through 12th grade, 2) be utilized as a single guide for school leaders in the process of developing cybersecurity education strategies, and 3) in the longer term, be used by the National Sciences Foundation (NSF) as an effective model to institute cybersecurity education practices nationwide and thereby reduce the existing trouble of the nation by criminal cyber actors.

  4. Sustaining professional development gains after the NSF-CCLI grant ends

    Science.gov (United States)

    Grove, K.; Dekens, P. S.; Dempsey, D. P.

    2012-12-01

    At San Francisco State University we aimed to transform our freshman-level courses in geology, oceanography, and meteorology using funding from a NSF-CCLI grant—"Creating an academic community to foster curiosity and discovery in introductory Geoscience classes" (2010-2012). In addition to creating a new laboratory space and new laboratory materials, we focused on the professional development of graduate teaching assistants (GTAs) and other departmental instructors. Previously, GTAs were given little support to gain teaching skills and present interesting labs, and there was little communication among the various instructors of the introductory courses. We aimed to change the tenor of the department by infusing discussions about effective teaching practices into the daily academic lives of faculty and GTAs and by creating institutional structures to ensure that innovations continued beyond the life of the NSF grant. We entitled this function of the department a Teaching and Learning Community (TLC). An essential element of the TLC, and the institutionalization of project activities, was to create a new graduate seminar course—"Our Dynamic Classroom"—that is offered every semester. This course was created to provide a mechanism for instructors to meet each week to discuss aspects of teaching pedagogy and to share classroom experiences. Each week a GTA or faculty member leads the discussion. Typical weekly topics include: what is inquiry-based learning, understanding students' misconceptions, teaching quantitative skills, what is the affective domain, improving students' writing skills. In response to participant feedback, the course now focuses more on the needs of specific instructors teaching specific courses. For example, in Spring 2012, seminar participants identified several issues GTAs were encountering, such as students failing to read instructions for labs before executing them, and some members of small collaborative groups not actively participating

  5. The ASM-NSF Biology Scholars Program: An Evidence-Based Model for Faculty Development.

    Science.gov (United States)

    Chang, Amy L; Pribbenow, Christine M

    2016-05-01

    The American Society for Microbiology (ASM) established its ASM-NSF (National Science Foundation) Biology Scholars Program (BSP) to promote undergraduate education reform by 1) supporting biologists to implement evidence-based teaching practices, 2) engaging life science professional societies to facilitate biologists' leadership in scholarly teaching within the discipline, and 3) participating in a teaching community that fosters disciplinary-level science, technology, engineering, and mathematics (STEM) reform. Since 2005, the program has utilized year-long residency training to provide a continuum of learning and practice centered on principles from the scholarship of teaching and learning (SoTL) to more than 270 participants ("scholars") from biology and multiple other disciplines. Additionally, the program has recruited 11 life science professional societies to support faculty development in SoTL and discipline-based education research (DBER). To identify the BSP's long-term outcomes and impacts, ASM engaged an external evaluator to conduct a study of the program's 2010-2014 scholars (n = 127) and society partners. The study methods included online surveys, focus groups, participant observation, and analysis of various documents. Study participants indicate that the program achieved its proposed goals relative to scholarship, professional society impact, leadership, community, and faculty professional development. Although participants also identified barriers that hindered elements of their BSP participation, findings suggest that the program was essential to their development as faculty and provides evidence of the BSP as a model for other societies seeking to advance undergraduate science education reform. The BSP is the longest-standing faculty development program sponsored by a collective group of life science societies. This collaboration promotes success across a fragmented system of more than 80 societies representing the life sciences and helps

  6. Internships and UNAVCO: Training the Future Geoscience Workforce Through the NSF GAGE Facility

    Science.gov (United States)

    Morris, A. R.; MacPherson-Krutsky, C. C.; Charlevoix, D. J.; Bartel, B. A.

    2015-12-01

    Facilities are uniquely positioned to both serve a broad, national audience and provide unique workforce experience to students and recent graduates. Intentional efforts dedicated to broadening participation in the future geoscience workforce at the NSF GAGE (Geodesy Advancing Geosciences and EarthScope) Facility operated by UNAVCO, are designed to meet the needs of the next generation of students and professionals. As a university-governed consortium facilitating research and education in the geosciences, UNAVCO is well-situated to both prepare students for geoscience technical careers and advanced research positions. Since 1998, UNAVCO has offered over 165 student assistant or intern positions including engineering, data services, education and outreach, and business support. UNAVCO offers three formal programs: the UNAVCO Student Internship Program (USIP), Research Experiences in Solid Earth Science for Students (RESESS), and the Geo-Launchpad (GLP) internship program. Interns range from community college students up through graduate students and recent Masters graduates. USIP interns gain real-world work experience in a professional setting, collaborate with teams toward a common mission, and contribute their knowledge, skills, and abilities to the UNAVCO community. RESESS interns conduct authentic research with a scientist in the Front Range area as well as participate in a structured professional development series. GLP students are in their first 2 years of higher education and work alongside UNAVCO technical staff gaining valuable work experience and insight into the logistics of supporting scientific research. UNAVCO's efforts in preparing the next generation of scientists largely focuses on increasing diversity in the geosciences, whether continuing academic studies or moving into the workforce. To date, well over half of our interns and student assistants come from backgrounds historically underrepresented in the geosciences. Over 80% of former interns

  7. The ASM-NSF Biology Scholars Program: An Evidence-Based Model for Faculty Development

    Directory of Open Access Journals (Sweden)

    Amy L. Chang

    2016-05-01

    Full Text Available The American Society for Microbiology (ASM established its ASM-NSF (National Science Foundation Biology Scholars Program (BSP to promote undergraduate education reform by 1 supporting biologists to implement evidence-based teaching practices, 2 engaging life science professional societies to facilitate biologists’ leadership in scholarly teaching within the discipline, and 3 participating in a teaching community that fosters disciplinary-level science, technology, engineering, and mathematics (STEM reform. Since 2005, the program has utilized year-long residency training to provide a continuum of learning and practice centered on principles from the scholarship of teaching and learning (SoTL to more than 270 participants (“scholars” from biology and multiple other disciplines. Additionally, the program has recruited 11 life science professional societies to support faculty development in SoTL and discipline-based education research (DBER. To identify the BSP’s long-term outcomes and impacts, ASM engaged an external evaluator to conduct a study of the program’s 2010­–2014 scholars (n = 127 and society partners. The study methods included online surveys, focus groups, participant observation, and analysis of various documents. Study participants indicate that the program achieved its proposed goals relative to scholarship, professional society impact, leadership, community, and faculty professional development. Although participants also identified barriers that hindered elements of their BSP participation, findings suggest that the program was essential to their development as faculty and provides evidence of the BSP as a model for other societies seeking to advance undergraduate science education reform. The BSP is the longest-standing faculty development program sponsored by a collective group of life science societies. This collaboration promotes success across a fragmented system of more than 80 societies representing the life

  8. NSF-Sponsored Summit on the Future of Undergraduate Geoscience Education: outcomes

    Science.gov (United States)

    Mosher, S.

    2014-12-01

    The NSF-sponsored Summit on the Future of Undergraduate Geoscience Education made major progress toward developing a collective community vision for the geosciences. A broad spectrum of the geoscience education community, ~200 educators from research universities/four and two year colleges, focused on preparation of undergraduates for graduate school and future geoscience careers, pedagogy, use of technology, broadening participation/retention of underrepresented groups, and preparation of K-12 science teachers. Participants agreed that key concepts, competencies and skills learned throughout the curriculum were more important than specific courses. Concepts included understanding Earth as complex, dynamic system, deep time, evolution of life, natural resources, energy, hazards, hydrogeology, surface processes, Earth materials and structure, and climate change. Skills/competencies included ability to think spatially and temporally, reason inductively and deductively, make and use indirect observations, engage in complex open, coupled systems thinking, and work with uncertainty, non-uniqueness, and incompleteness, as well as critical thinking, problem solving, communication, and ability to think like a scientist and continue to learn. Successful ways of developing these include collaborative, integrative projects involving teams, interdisciplinary projects, fieldwork and research experiences, as well as flipped classrooms and integration and interactive use of technology, including visualization, simulation, modeling and analysis of real data. Wider adoption of proven, effective best practices is our communities' main pedagogical challenge, and we focused on identifying implementation barriers. Preparation of future teachers in introductory and general geoscience courses by incorporating Next Generation Science Standards and using other sciences/math to solve real world geoscience problems should help increase diversity and number of future geoscientists and

  9. Transforming Research in Oceanography through Education, Ethnography and Rapidly Evolving Technologies: An NSF-INSPIRE project.

    Science.gov (United States)

    German, C. R.; Croff Bell, K. L.; Pallant, A.; Mirmalek, Z.; Jasanoff, S.; Rajan, K.

    2014-12-01

    This paper will discuss a new NSF-INSPIRE project that brings together research conducted in the fields of Ocean Sciences, Education & Human Resources and Computer and Information Science & Engineering. Specifically, our objective is to investigate new methods by which telepresence can be used to conduct cutting edge research and provide authentic educational experiences to undergraduate students, remotely. We choose to conduct this research in an Oceanographic context for two reasons: first with the move toward smaller research ships in the national Oceanographic research fleet, we anticipate that access to berth space at sea will continue to be at a premium. Any component of traditional oceanographic research that can be ported to shore without loss of effectiveness would be of immediate benefit to the Ocean Sciences. Equally, however, we argue that any improvements to work place and/or education practices that we can identify while delivering research and education from the bottom of the deep ocean should be readily mappable to any other scientific or engineering activities that seek to make use of telepresence in less extreme remote environments. Work on our TREET project, to-date, has included recruitment of 6 early career scientists keen to take advantage of the research opportunity provided, together with two senior science mentors with experience using Telepresence and a cohort of undergraduate students at three of the ECS partner Universities, spanning 4 time zones across the continental US. Following a 12-week synchronous on-line seminar series taught in Spring-Summer 2014, the entire team joined together at the Inner Space Center in Sept-Oct 2014 to participate, virtually, in a cruise of research and exploration to the Kick'Em Jenny underwater volcano and adjacent cold seep sites, conducted by the Ocean Exploration Trust's ROV Hercules aboard the Exploration Vessel Nautilus. Our presentation will include preliminary results from that cruise.

  10. Institutional transformation: An analysis of change initiatives at NSF ADVANCE institutions

    Science.gov (United States)

    Plummer, Ellen W.

    The purpose of this study was to examine how institutional culture promoted or impeded the implementation of round one and two NSF ADVANCE initiatives designed to improve academic climates for women in science and engineering. This study was conducted in two phases. In phase one, 35 participants from 18 institutions were interviewed to answer three research questions. Participants identified a policy, process, or program designed to improve academic cultures for women in science and engineering fields. Participants also identified strategies that promoted the implementation of these efforts, and discussed factors that impeded these efforts. In phase two, site visits were conducted at two institutions to answer a fourth research question. How did institutional culture shape the design and implementation of faculty search processes? Policies, processes, and programs were implemented by participants at the institutional, departmental, and individual levels and included family friendly and dual career policies at the institutional level, improved departmental faculty search and climate improvement processes, and mentoring programs and training for department heads at the individual level. Communication and leadership strategies were key to the successful implementation of policies, processes, and programs designed to achieve institutional transformation. Communication strategies involved shaping change messages to reach varied audiences often with the argument that change efforts would improve the climate for everyone not just women faculty members. Administrative and faculty leaders from multiple levels proved important to change efforts. Institutional Transformation Institutional culture shaped initiatives to improve faculty search processes. Faculty leaders in both settings used data to persuade faculty members of the need for change. At one site, data that included national availability information was critical to advancing the change agenda. At the other site

  11. Volcanic Surface Deformation in Dominica From GPS Geodesy: Results From the 2007 NSF- REU Site

    Science.gov (United States)

    Murphy, R.; James, S.; Styron, R. H.; Turner, H. L.; Ashlock, A.; Cavness, C.; Collier, X.; Fauria, K.; Feinstein, R.; Staisch, L.; Williams, B.; Mattioli, G. S.; Jansma, P. E.; Cothren, J.

    2007-12-01

    GPS measurements have been collected on the island of Dominica in the Lesser Antilles between 2001 and 2007, with five month-long campaigns completed in June of each year supported in part by a NSF REU Site award for the past two years. All GPS data were collected using dual-frequency, code-phase receivers and geodetic-quality antenna, primarily choke rings. Three consecutive 24 hr observation days were normally obtained for each site. Precise station positions were estimated with GIPSY-OASISII using an absolute point positioning strategy and final, precise orbits, clocks, earth orientation parameters, and x-files. All position estimates were updated to ITRF05 and a revised Caribbean Euler pole was used to place our observations in a CAR-fixed frame. Time series were created to determine the velocity of each station. Forward and inverse elastic half-space models with planar (i.e. dike) and Mogi (i.e. point) sources were investigated. Inverse modeling was completed using a downhill simplex method of function minimization. Selected site velocities were used to create appropriate models for specific regions of Dominica, which correspond to known centers of pre-historic volcanic or recent shallow, seismic activity. Because of the current distribution of GPS sites with robust velocity estimates, we limit our models to possible magmatic activity in the northern, proximal to the volcanic centers of Morne Diablotins and Morne aux Diables, and southern, proximal to volcanic centers of Soufriere and Morne Plat Pays, regions of the island. Surface deformation data from the northernmost sites may be fit with the development of a several km-long dike trending approximately northeast- southwest. Activity in the southern volcanic centers is best modeled by an expanding point source at approximately 1 km depth.

  12. Associação entre postura, função pulmonar e capacidade funcional na fibrose quística

    Directory of Open Access Journals (Sweden)

    J.T.S. Penafortes

    2013-01-01

    Full Text Available Resumo: Objetivos: Avaliar as correlações entre função pulmonar, capacidade funcional e postura em pacientes adultos portadores de fibrose quística (FQ. Como segundo objetivo, avaliar a correlação entre a qualidade de vida e as variáveis obtidas na avaliação postural destes pacientes. Métodos: Foi realizado um estudo transversal em que 14 portadores de FQ se submeteram à avaliação da análise postural (software de avaliação postural e provas de função pulmonar (espirometria, pletismografia de corpo inteiro e medição da capacidade de difusão do CO e capacidade funcional (teste da caminhada de 6 min. Todos os pacientes responderam ao Questionário de Fibrose Quística com Versão Revisada (QFQ-R. Resultados: A maioria dos pacientes era do sexo masculino (57%, com mediana da idade de 24,5 anos (22-34 anos. Foram observadas correlações significantes de volume expiratório máximo no primeiro segundo, distância da caminhada dos 6 min, capacidade pulmonar total e resistência de vias aéreas com o alinhamento vertical do tronco (ρ = −0,57, p < 0,05; ρ = −0,65, p < 0,01; ρ = 0,54, p < 0,05; e ρ = 0,67, p < 0,01, respetivamente. Foram observadas correlações estatisticamente significantes entre o domínio «físico» do QFQ-R e o alinhamento vertical do tórax (ρ = −0,74, p < 0,01, e entre o domínio «limitações» do QFQ-R e o ângulo do quadril (ρ = −0,55, p < 0,05. Conclusões: O presente trabalho mostra que as anormalidades na função pulmonar e na capacidade funcional se associam às alterações posturais em adultos portadores de FQ. Entretanto, a gravidade das anormalidades posturais não influenciam negativamente os domínios do QFQ-R. Abstract: Aim: The purpose of this study was to evaluate the

  13. Seguimento nutricional de pacientes com fibrose cística: papel do aconselhamento nutricional Nutritional follow-up of cystic fibrosis patients: the role of nutrition education

    Directory of Open Access Journals (Sweden)

    Fabíola V. Adde

    2004-12-01

    Full Text Available OBJETIVO: Avaliar o estado nutricional de um grupo de pacientes com fibrose cística e analisar a repercussão do aconselhamento nutricional através de um estudo comparativo pré- e pós-intervenção. MÉTODOS: Todos os pacientes com fibrose cística em seguimento regular no ambulatório de pneumologia do Instituto da Criança no período de 1996-99 foram prospectivamente acompanhados durante 3,5 anos. Em quatro etapas (I = inicial, II = 7 meses, III = 13 meses, IV = 43 meses, foi realizada uma avaliação nutricional que consistia de medidas de peso, estatura/comprimento, circunferência do braço e pregas cutâneas, e cálculos de escores z para peso/idade, estatura/idade, peso/estatura, circunferência do braço e da prega cutânea tricipital, porcentagem de peso/estatura e porcentagem de gordura corpórea. Era feita verificação do uso das enzimas pancreáticas e do uso de suplementos nutricionais. Aconselhamento nutricional verbal e através de uma cartilha explicativa foi realizado em todos os pacientes. RESULTADOS: Foram avaliados 74 pacientes, 38 do sexo feminino e 36 do masculino, com idades de 6 meses a 18,4 anos. Na etapa inicial, os dados antropométricos revelaram: porcentagem de peso/estatura = 94±13, porcentagem de gordura corpórea = 15±7,1, escore z peso/idade = -1,13±1,3, escore z estatura/idade = -0,94±1,2, escore z peso/estatura = -0,69±,1, escore z circunferência do braço = -1,35±1,3, escore z prega cutânea tricipital = -0,74±0,9. A aderência ao uso de enzimas e suplementos melhorou durante o estudo. Houve um aumento significativo no escore z de peso/idade e da prega tricipital e na porcentagem de gordura corpórea durante todo o período de estudo. Dividindo-se os pacientes em três grupos etários, a melhora antropométrica só foi significativa nos menores de 5 anos. CONCLUSÕES: Desnutrição leve estava presente nesse grupo de pacientes com fibrose cística. O aconselhamento nutricional realizado

  14. Fibrose quística – Caracterização clínica de uma amostra de doentes portugueses

    Directory of Open Access Journals (Sweden)

    Micaela Guardiano

    2005-07-01

    Full Text Available Resumo: Apesar dos rápidos avanços na compreensão dos determinantes moleculares da fibrose quística, esta continua a ser uma das doenças recessivas letais mais comuns na população caucasiana em todo o mundo. A realidade dos doentes portugueses continua a ser pouco conhecida, pela escassez de trabalhos publicados referentes à nossa população.Este trabalho tem como objectivos: fazer uma avaliação clínica de um grupo de doentes portugueses com fibrose quística, com 2 mutações identificadas e comparar a apresentação clínica de um grupo de doentes homozigóticos para a mutação F508del com doentes não homozigóticos para esta mutação.Para tal, seleccionou-se um grupo de doentes em seguimento na Consulta de Pneumologia Pediátrica do HSJ que foram caracterizados do ponto de vista fenotípico e classificados de acordo com critérios de gravidade.Todos os doentes desta amostra apresentaram mutações de classe I e/ou II, que se associam, classicamente, a fenótipo mais grave. Em conformidade com a gravidade genotípica, todos os doentes apresentaram um fenótipo de insuficiência pancreática mas com maior variabilidade de manifestações pulmonares.Não se encontraram variações significativas em termos de idade de diagnóstico, formas de apresentação e gravidade da doença entre doentes homozigóticos F508del e restantes doentes. Em contrapartida, doentes com o mesmo genótipo (homozigóticos F508del apresentaram diferentes espectros de manifestações clínicas e de gravidade fenotípica. Tanto ou mais do que a caracterização genotípica, o tempo de evolução da doença e os factores externos (nomeadamente a sujeição a estímulos infecciosos deverão interferir na gravidade do fenótipo num dado momento.Rev Port Pneumol 2005; XI (4: 381-406 Abstract: Even though there have been rapid advances in

  15. NSF GK-12 Fellows as Mentors for K-12 Teachers Participating in Field Research Experiences

    Science.gov (United States)

    Ellins, K.; Perry, E.

    2005-12-01

    by the GK-12 Fellows was important in helping teachers transfer components of a challenging field research experience to their students. Participating research scientists were able to convey the importance of their science to a wider audience. NSF GK-12 Fellows gained valuable experience in communicating scientific knowledge and field skills to K-12 teachers and students, became more knowledgeable about K-12 science education and were exposed to advances in pedagogy.

  16. NSF Workshop Report: Discovering General Principles of Nervous System Organization by Comparing Brain Maps across Species

    Science.gov (United States)

    Striedter, Georg F.; Belgard, T. Grant; Chen, Chun-Chun; Davis, Fred P.; Finlay, Barbara L.; Güntürkün, Onur; Hale, Melina E.; Harris, Julie A.; Hecht, Erin E.; Hof, Patrick R.; Hofmann, Hans A.; Holland, Linda Z.; Iwaniuk, Andrew N.; Jarvis, Erich D.; Karten, Harvey J.; Katz, Paul S.; Kristan, William B.; Macagno, Eduardo R.; Mitra, Partha P.; Moroz, Leonid L.; Preuss, Todd M.; Ragsdale, Clifton W.; Sherwood, Chet C.; Stevens, Charles F.; Stüttgen, Maik C.; Tsumoto, Tadaharu; Wilczynski, Walter

    2014-01-01

    supported, at least in part, through existing mechanisms at NSF, NIH, and other agencies. It will also be important to develop new integrated software and database systems for cross-species data analyses. Multidisciplinary efforts to develop such analytical tools should be supported financially. Finally, training opportunities should be created to stimulate multidisciplinary, integrative research into brain structure, function, and evolution. PMID:24603302

  17. The Arctic Cooperative Data and Information System: Data Management Support for the NSF Arctic Research Program (Invited)

    Science.gov (United States)

    Moore, J.; Serreze, M. C.; Middleton, D.; Ramamurthy, M. K.; Yarmey, L.

    2013-12-01

    The NSF funds the Advanced Cooperative Arctic Data and Information System (ACADIS), url: (http://www.aoncadis.org/). It serves the growing and increasingly diverse data management needs of NSF's arctic research community. The ACADIS investigator team combines experienced data managers, curators and software engineers from the NSIDC, UCAR and NCAR. ACADIS fosters scientific synthesis and discovery by providing a secure long-term data archive to NSF investigators. The system provides discovery and access to arctic related data from this and other archives. This paper updates the technical components of ACADIS, the implementation of best practices, the value of ACADIS to the community and the major challenges facing this archive for the future in handling the diverse data coming from NSF Arctic investigators. ACADIS provides sustainable data management, data stewardship services and leadership for the NSF Arctic research community through open data sharing, adherence to best practices and standards, capitalizing on appropriate evolving technologies, community support and engagement. ACADIS leverages other pertinent projects, capitalizing on appropriate emerging technologies and participating in emerging cyberinfrastructure initiatives. The key elements of ACADIS user services to the NSF Arctic community include: data and metadata upload; support for datasets with special requirements; metadata and documentation generation; interoperability and initiatives with other archives; and science support to investigators and the community. Providing a self-service data publishing platform requiring minimal curation oversight while maintaining rich metadata for discovery, access and preservation is challenging. Implementing metadata standards are a first step towards consistent content. The ACADIS Gateway and ADE offer users choices for data discovery and access with the clear objective of increasing discovery and use of all Arctic data especially for analysis activities

  18. Management and Stewardship of Airborne Observational Data for the NSF/NCAR HIAPER (GV) and NSF/NCAR C-130 at the National Center for Atmospheric Research (NCAR) Earth Observing Laboratory (EOL)

    Science.gov (United States)

    Aquino, J.

    2014-12-01

    The National Science Foundation (NSF) provides the National Center for Atmospheric Research (NCAR) Earth Observing Laboratory (EOL) funding for the operation, maintenance and upgrade of two research aircraft: the NSF/NCAR High-performance Instrumented Airborne Platform for Environmental Research (HIAPER) Gulfstream V and the NSF/NCAR Hercules C-130. A suite of in-situ and remote sensing airborne instruments housed at the EOL Research Aviation Facility (RAF) provide a basic set of measurements that are typically deployed on most airborne field campaigns. In addition, instruments to address more specific research requirements are provided by collaborating participants from universities, industry, NASA, NOAA or other agencies. The data collected are an important legacy of these field campaigns. A comprehensive metadata database and integrated cyber-infrastructure, along with a robust data workflow that begins during the field phase and extends to long-term archival (current aircraft data holdings go back to 1967), assures that: all data and associated software are safeguarded throughout the data handling process; community standards of practice for data stewardship and software version control are followed; simple and timely community access to collected data and associated software tools are provided; and the quality of the collected data is preserved, with the ultimate goal of supporting research and the reproducibility of published results. The components of this data system to be presented include: robust, searchable web access to data holdings; reliable, redundant data storage; web-based tools and scripts for efficient creation, maintenance and update of data holdings; access to supplemental data and documentation; storage of data in standardized data formats; comprehensive metadata collection; mature version control; human-discernable storage practices; and procedures to inform users of changes. In addition, lessons learned, shortcomings, and desired upgrades

  19. NSF- and SNARE-mediated membrane fusion is required for nuclear envelope formation and completion of nuclear pore complex assembly in Xenopus laevis egg extracts.

    Science.gov (United States)

    Baur, Tina; Ramadan, Kristijan; Schlundt, Andreas; Kartenbeck, Jürgen; Meyer, Hemmo H

    2007-08-15

    Despite the progress in understanding nuclear envelope (NE) reformation after mitosis, it has remained unclear what drives the required membrane fusion and how exactly this is coordinated with nuclear pore complex (NPC) assembly. Here, we show that, like other intracellular fusion reactions, NE fusion in Xenopus laevis egg extracts is mediated by SNARE proteins that require activation by NSF. Antibodies against Xenopus NSF, depletion of NSF or the dominant-negative NSF(E329Q) variant specifically inhibited NE formation. Staging experiments further revealed that NSF was required until sealing of the envelope was completed. Moreover, excess exogenous alpha-SNAP that blocks SNARE function prevented membrane fusion and caused accumulation of non-flattened vesicles on the chromatin surface. Under these conditions, the nucleoporins Nup107 and gp210 were fully recruited, whereas assembly of FxFG-repeat-containing nucleoporins was blocked. Together, we define NSF- and SNARE-mediated membrane fusion events as essential steps during NE formation downstream of Nup107 recruitment, and upstream of membrane flattening and completion of NPC assembly.

  20. Capnografia volumétrica como meio de detectar obstrução pulmonar periférica precoce em pacientes com fibrose cística

    Directory of Open Access Journals (Sweden)

    Maria Ângela G. O. Ribeiro

    2012-12-01

    Full Text Available OBJETIVO: Comparar a espirometria e a capnografia volumétrica (CapV para determinar se os valores amostrados pela capnografia acrescentam informações sobre doenças pulmonares precoces em pacientes com fibrose cística (FC. MÉTODOS: Este foi um estudo do tipo corte transversal envolvendo pacientes com FC: Grupo I (42 pacientes, 6-12 anos de idade e Grupo II (22 pacientes, 13-20 anos de idade. Os grupos controle correspondentes eram formados por 30 e 50 indivíduos saudáveis, respectivamente. A capacidade vital forçada (CVF, o volume expiratório forçado no primeiro segundo (VEF1 e a relação VEF1/CVF foram determinados pela espirometria. Através da CapV, medimos a saturação periférica de oxigênio (SpO2, a frequência respiratória (FR, o tempo inspiratório (TI, o tempo expiratório (TE e o slope da fase III normalizado pelo volume corrente (slope da fase III/Vc. RESULTADOS: Em comparação com os grupos controle, todos os pacientes com FC apresentaram valores de slope da fase III/Vc (p < 0,001 mais altos independentemente do estágio de doença pulmonar. O slope da fase III/Vc foi significantemente mais alto nos 24 pacientes que tiveram resultados normais de espirometria (p = 0,018. Os pacientes do Grupo II apresentaram valores de CVF, VEF1, VEF1/CVF (p < 0,05 e SpO2 (p < 0,001 mais baixos que os pacientes do Grupo I. Os pacientes do Grupo II, comparados com os do Grupo Controle II, apresentaram FR (p < 0,001 mais alta e valores de TI e TE (p < 0,001 mais baixos. CONCLUSÕES: Todos os pacientes com FC mostraram ter valores mais altos de slope da fase III/Vc quando comparados com os pacientes dos grupos controle. A CapV identificou a heterogeneidade da distribuição da ventilação nas vias aéreas periféricas dos pacientes com FC que apresentaram espirometria normal.

  1. Colonização por Staphylococcus aureus resistente à meticilina: Que impacto na morbilidade de doentes pediátricos com fibrose quística?

    Directory of Open Access Journals (Sweden)

    Joana Fermeiro

    2010-07-01

    Full Text Available Resumo: Introdução: Ao Staphylococcus aureus resistente à meticilina (MRSA é classicamente reconhecido um papel patogénico no âmbito da fibrose quística (FQ.Objectivos: Avaliação da evolução da prevalência e incidência da colonização por MRSA, impacto clínico no ano após o primeiro isolamento, factores de risco e padrão de resistência antimicrobiana.Métodos: Estudo retrospectivo dos doentes pediátricos colonizados por MRSA seguidos no centro de FQ do Hospital de Santa Maria de 2003 a 2007.Resultados: O MRSA foi isolado em secreções respiratórias de 12 dos 60 doentes seguidos durante este período (colonização crónica em 3 doentes. A idade média à data do primeiro isolamento foi de 9 anos e 10 meses e o tempo médio entre o diagnóstico de FQ e a aquisição de MRSA de 5 anos e 7 meses.Verificou-se um aumento da prevalência e incidência de colonização por MRSA, com um máximo atingido em 2007 (prevalência 14,3% e incidência 8,9%. Quatro doentes cumpriram antibioticoterapia profiláctica antiestafilocócica com flucloxacilina.No ano após o primeiro isolamento de MRSA, constatou-se um aumento do número de dias de internamento em 4 doentes (2 com colonização crónica e deterioração da função pulmonar em 5, incluindo a totalidade dos doentes com colonização crónica. Apenas um doente apresentou diminuição de percentil de índice de massa corporal.As resistências mais frequentemente encontradas foram à rifampicina e à clindamicina.Conclusões: Este estudo revelou ocorrência de deterioração clínica relevante em doentes com colonização crónica por MRSA, reforçando a importância da implementação de estratégias eficazes e precoces de erradicação.Rev Port Pneumol 2010; XVI (4: 527-542 Abstract: Background: Methicillin-resistant Staphylococcus aureus (MRSA plays a well-recognised pathogenic role in cystic fibrosis (CF.Aims: To evaluate the prevalence and incidence of colonisation by MRSA

  2. High-Resolution Digitization of the Film Archive of SPRI/NSF/TUD Radar Sounding of the Antarctic Ice Sheet

    Science.gov (United States)

    Schroeder, D. M.; Dowdeswell, J. A.; Mackie, E. J.; Vega, K. I.; Emmons, J. R.; Winstein, K.; Bingham, R. G.; Benham, T. J.

    2017-12-01

    The airborne radio echo sounding data collected during the SPRI/NSF/TUD surveys of the Antarctic Ice Sheet in the late nineteen sixties and early seventies were recorded on a combination of 35mm and super-8 mm black-and-white optical film. These data represent the oldest extant continent-scale geophysical observations of ice thickness, internal layering and conditions beneath the Antarctic Ice Sheet. As such, when compared with modern radar sounding observations, they offer a unique opportunity to investigate temporal changes in ice sheet conditions across half a century. However, the storage of these data on film, paper-prints, and scans of those prints have made such comparison at the full radiometric and geometric resolution of the data difficult. To address this challenge, we utilized a state-of-the-art high-resolution Hollywood film scanning system to digitize the entire SPRI/NSF/TUD optical film archive. This has resulted in over two million digital images with information at the full spatial and brightness-level resolution of the original film. We present the process and results of this scanning as well as the current progress in formatting, registering, and positioning these data for release and use by the wider radio glaciological community. We also discuss the glaciological insights enabled by this effort.

  3. Increasing Access for Economically Disadvantaged Students: The NSF/CSEM & S-STEM Programs at Louisiana State University

    Science.gov (United States)

    Wilson, Zakiya S.; Iyengar, Sitharama S.; Pang, Su-Seng; Warner, Isiah M.; Luces, Candace A.

    2012-10-01

    Increasing college degree attainment for students from disadvantaged backgrounds is a prominent component of numerous state and federal legislation focused on higher education. In 1999, the National Science Foundation (NSF) instituted the "Computer Science, Engineering, and Mathematics Scholarships" (CSEMS) program; this initiative was designed to provide greater access and support to academically talented students from economically disadvantaged backgrounds. Originally intended to provide financial support to lower income students, this NSF program also advocated that additional professional development and advising would be strategies to increase undergraduate persistence to graduation. This innovative program for economically disadvantaged students was extended in 2004 to include students from other disciplines including the physical and life sciences as well as the technology fields, and the new name of the program was Scholarships for Science, Technology, Engineering and Mathematics (S-STEM). The implementation of these two programs in Louisiana State University (LSU) has shown significant and measurable success since 2000, making LSU a Model University in providing support to economically disadvantaged students within the STEM disciplines. The achievement of these programs is evidenced by the graduation rates of its participants. This report provides details on the educational model employed through the CSEMS/S-STEM projects at LSU and provides a path to success for increasing student retention rates in STEM disciplines. While the LSU's experience is presented as a case study, the potential relevance of this innovative mentoring program in conjunction with the financial support system is discussed in detail.

  4. Application of extracellular gadolinium-based MRI contrast agents and the risk of nephrogenic systemic fibrosis; Anwendung von extrazellulaeren gadoliniumhaltigen MR-Kontrastmitteln und Risiko der Nephrogenen Systemischen Fibrose

    Energy Technology Data Exchange (ETDEWEB)

    Heverhagen, J.T. [Univ. Hospital Bern (Switzerland). Inst. of Diagnostic, Interventional and Pediatric Radiology, Inselspital; Krombach, G.A. [Justus Liebig Univ. Hopsital Giessen (Germany). Diagnostic and Interventional Radiology; Gizewski, E. [Medical Univ. Innsbruck (Austria). Dept. of Neuroradiology

    2014-07-15

    Nephrogenic systemic fibrosis (NSF) is a serious, sometimes fatal disease. Findings in recent years have shown that a causal association between gadolinium containing contrast media and NSF is most likely. Therefore, the regulatory authorities have issued guidelines on the use of gadolinium-containing contrast media which have reduced the number of new cases of NSF to almost zero. However, it is for precisely this reason that the greatest care must still be taken to ensure that these guidelines are complied with. The most important factors are renal function, the quantity of gadolinium administered and coexisting diseases such as inflammation. All of these factors crucially influence the quantity of gadolinium released from the chelat in the body. This free gadolinium is thought to be the trigger for NSF. Other important factors are the stability of the gadolinium complex and furthermore the route of its elimination from the body. Partial elimination via the liver might be an additional protective mechanism. In conclusion, despite the NSF risk, contrast-enhanced MRI is a safe diagnostic procedure which can be used reliably and safely even in patients with severe renal failure, and does not necessarily have to be replaced by other methods.

  5. LRRK2 phosphorylates pre-synaptic N-ethylmaleimide sensitive fusion (NSF) protein enhancing its ATPase activity and SNARE complex disassembling rate.

    Science.gov (United States)

    Belluzzi, Elisa; Gonnelli, Adriano; Cirnaru, Maria-Daniela; Marte, Antonella; Plotegher, Nicoletta; Russo, Isabella; Civiero, Laura; Cogo, Susanna; Carrion, Maria Perèz; Franchin, Cinzia; Arrigoni, Giorgio; Beltramini, Mariano; Bubacco, Luigi; Onofri, Franco; Piccoli, Giovanni; Greggio, Elisa

    2016-01-13

    Lrrk2, a gene linked to Parkinson's disease, encodes a large scaffolding protein with kinase and GTPase activities implicated in vesicle and cytoskeletal-related processes. At the presynaptic site, LRRK2 associates with synaptic vesicles through interaction with a panel of presynaptic proteins. Here, we show that LRRK2 kinase activity influences the dynamics of synaptic vesicle fusion. We therefore investigated whether LRRK2 phosphorylates component(s) of the exo/endocytosis machinery. We have previously observed that LRRK2 interacts with NSF, a hexameric AAA+ ATPase that couples ATP hydrolysis to the disassembling of SNARE proteins allowing them to enter another fusion cycle during synaptic exocytosis. Here, we demonstrate that NSF is a substrate of LRRK2 kinase activity. LRRK2 phosphorylates full-length NSF at threonine 645 in the ATP binding pocket of D2 domain. Functionally, NSF phosphorylated by LRRK2 displays enhanced ATPase activity and increased rate of SNARE complex disassembling. Substitution of threonine 645 with alanine abrogates LRRK2-mediated increased ATPase activity. Given that the most common Parkinson's disease LRRK2 G2019S mutation displays increased kinase activity, our results suggest that mutant LRRK2 may impair synaptic vesicle dynamics via aberrant phosphorylation of NSF.

  6. From the NSF: The National Science Foundation’s Investments in Broadening Participation in Science, Technology, Engineering, and Mathematics Education through Research and Capacity Building

    Science.gov (United States)

    James, Sylvia M.; Singer, Susan R.

    2016-01-01

    The National Science Foundation (NSF) has a long history of investment in broadening participation (BP) in science, technology, engineering, and mathematics (STEM) education. A review of past NSF BP efforts provides insights into how the portfolio of programs and activities has evolved and the broad array of innovative strategies that has been used to increase the participation of groups underrepresented in STEM, including women, minorities, and persons with disabilities. While many are familiar with these long-standing programmatic efforts, BP is also a key component of NSF’s strategic plans, has been highlighted in National Science Board reports, and is the focus of ongoing outreach efforts. The majority of familiar BP programs, such as the Louis Stokes Alliances for Minority Participation (now 25 years old), are housed in the Directorate for Education and Human Resources. However, fellowship programs such as the Graduate Research Fellowships and Postdoctoral Research Fellowships under the Directorate for Biological Sciences (and parallel directorates in other STEM disciplines) are frequently used to address underrepresentation in STEM disciplines. The FY2016 and FY2017 budget requests incorporate funding for NSF INCLUDES, a new cross-agency BP initiative that will build on prior successes while addressing national BP challenges. NSF INCLUDES invites the use of innovative approaches for taking evidence-based best practices to scale, ushering in a new era in NSF BP advancement. PMID:27587853

  7. A musculatura epaxial e a fibrose epidural na compressão medular em cães submetidos à laminectomia dorsal modificada

    Directory of Open Access Journals (Sweden)

    Diego V. Beckmann

    2010-02-01

    Full Text Available O objetivo deste experimento foi isolar a musculatura epaxial da medula espinhal de cães submetidos à laminectomia dorsal modificada (LDM e averiguar se os músculos influenciaram na formação da fibrose epidural, na compressão medular e no aparecimento dos sinais neurológicos. Para isso, dez cães hígidos foram submetidos à LDM entre as vértebras T13 e L1 e distribuídos aleatoriamente em dois grupos denominados controle (I onde a medula espinhal permaneceu exposta sem a presença de implante, e tratado (IIonde foi colocado um im-plante a base de alumínio entre a musculatura epaxial adjacente e a medula espinhal exposta pela LDM. As avaliações constaram de exames neurológicos diários até 180 dias de pós-operatório (PO; mielografia, decorridos 15, 30 e 60 dias de PO; e avaliação macroscópica mediante a reintervenção cirúrgica. Não houve diferença durante as avaliações neurológicas. Aos 15 dias de PO, foi verificado na mielografia, que o grau de compressão da linha de contraste foi maior no grupo tratado (PThe purpose of this study was to isolate the adjacent epaxial musculature from exposed spinal cord by modified dorsal laminectomy in dogs with aluminum implant and to verify whether the muscles contribute to form epidural fibrosis, spinal cord compression, and development of neurological signs. Ten dogs were submitted to modified dorsal laminectomy between T13 and L1 and then distributed along two groups. Dogs in the group 1 remained with the spinal cord exposed without the implant; dogs in the group 2 had an aluminum implant inserted between the epaxial muscles and the exposed spinal cord. Neurological examination was daily performed until 180 days post surgery. Additionally, myelography at 15, 30, and 60 days post surgery and macroscopic evaluation of the implant at six months post surgery were done. There was no difference between groups in the neurological examination. A statistical difference in the degree of

  8. Estado de Nutrição, Hábitos Alimentares e Dispêndio Energético em Crianças com Fibrose Quística

    OpenAIRE

    Guerra, Paula; Almeida, João; Rego, Carla; Nunes, Teresa; G. Vaz, Luisa; Silva, Diana; Lourenço, Susana; Ribeiro, Laura; M. Guerra, António J.

    2014-01-01

    O presente trabalho tem como objectivo avaliar o estado de nutrição, a composição corporal e a função respiratória de um grupo de crianças com fibrose quística sem evidência clínica ou laboratorial de infecção recente, assim como o de conhecer os seus hábitos alimentares e determinar o valor do dispêndio energético de repouso medido por calorimetria indirecta e o avaliado pelas equações de Schofield, da Organização Mundial de Saúde e de Fleish.População e métodos: a população é constituída po...

  9. Os pacientes invisíveis: transtorno de estresse pós-traumático em pais de pacientes com fibrose cística The invisible patients: posttraumatic stress disorder in parents of individuals with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Mariana Cabizuca

    2010-01-01

    Full Text Available CONTEXTO: Apesar do crescente reconhecimento da relevância do transtorno de estresse pós-traumático (TEPT secundário a doenças médicas, ainda não existem estudos em fibrose cística. OBJETIVO: Verificar a prevalência de TEPT e dos três grupos de sintomas de estresse pós-traumático em pais de pacientes com fibrose cística. MÉTODOS: Pais de pacientes com fibrose cística (idade média: 2 a 33 anos foram recrutados da Associação Carioca de Mucoviscidose. Neste estudo transversal, os pais preencheram um questionário sociodemográfico e foram entrevistados por meio do módulo de TEPT do Structured Clinical Interview for DSM-IV. RESULTADOS: A amostra era composta de 62 indivíduos (46 mães e 16 pais. A prevalência atual de TEPT foi 6,5% e de TEPT parcial, de 19,4%. Os pais com e sem sintomas de TEPT diferiram significativamente em dois aspectos psicossociais: os primeiros relataram mais problemas emocionais (p = 0,001 e reconheceram mais frequentemente a necessidade de tratamento psiquiátrico ou psicológico (p = 0,002 que os últimos. Entretanto, somente 6,3% dos pais com sintomas de TEPT estavam em tratamento psiquiátrico/psicológico. CONCLUSÕES: Este estudo preliminar demonstrou que a frequência dos sintomas de TEPT é bem elevada em pais de pacientes com fibrose cística e, apesar de esses pais reconheceram que tem problemas emocionais e precisam de tratamento psiquiátrico/psicológico, seu sofrimento permanece invisível para o sistema médico, levando ao subdiagnóstico e ao subtratamento.BACKGROUND: Besides the growing acknowledgment of the relevance of posttraumatic stress disorder (PTSD related to medical illness, there is no study in cystic fibrosis yet. OBJECTIVE: To assess the prevalence of PTSD and the three clusters of posttraumatic stress symptoms (PTSS in parents of patients with cystic fibrosis. METHODS: Parents of patients with cystic fibrosis (age range: 2 to 33 years were drawn from the Cystic Fibrosis

  10. Avaliação de parâmetros histológicos na pneumonia intersticial usual (fibrose pulmonar idiopática Evaluation of the histological parameters in usual interstitial pneumonia (idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    RIMARCS GOMES FERREIRA

    2000-12-01

    Full Text Available A fibrose pulmonar idiopática (alveolite fibrosante criptogênica é uma doença pulmonar intersticial progressiva de etiologia desconhecida, morfologicamente reconhecida como pneumonia intersticial usual. Desde a publicação de Hamman e Rich (1944 até os dias atuais, uma das grandes preocupações foi a tentativa de encontrar um marcador histológico para correlacionar com prognóstico e resposta terapêutica. A busca desta situação não tem sido muito alentadora, pois existem vários pontos duvidosos na patogênese desta doença. Admite-se que a resposta terapêutica desta entidade se relaciona com a celularidade e fibrose presentes no tecido. A proposta deste estudo é descrever os resultados de método semiquantitativo segundo a avaliação independente de dois patologistas, das alterações exsudativo-inflamatórias, reparativo-fibróticas e de vias aéreas, em 24 pacientes com diagnóstico de fibrose pulmonar idiopática, submetidos à biópsia a céu aberto. Foram analisados 14 parâmetros histológicos segundo escala de 0 a 5 para as alterações intersticiais e de 0 a 2 para o comprometimento de vias aéreas e de espaços aéreos. Da análise independente realizada pelos dois observadores constatou-se concordância significante em todas as variáveis histológicas com Kw (teste de Kappa indo de 0,47 a 0,92. Apenas na análise da intensidade da inflamação septal as discordâncias também foram significantes, sugerindo que para este parâmetro a percentagem de comprometimento tecidual deve ser previamente discutida entre os observadores. O método utilizado demonstrou ser rápido e eficiente.Idiopathic pulmonary fibrosis (cryptogenic fibrosing alveolitis is a progressive interstitial pulmonary disease of unknown etiology. Since Hamman's and Rich's (1944 reports, many studies have tried to find a histological marker for the correlation between prognosis and response to therapy. However, there are many doubts regarding pathogenesis

  11. The NSF Undergraduate ALFALFA Team: Partnering with Arecibo Observatory to Offer Undergraduate and Faculty Extragalactic Radio Astronomy Research Opportunities

    Science.gov (United States)

    Ribaudo, Joseph; Koopmann, Rebecca A.; Haynes, Martha P.; Balonek, Thomas J.; Cannon, John M.; Coble, Kimberly A.; Craig, David W.; Denn, Grant R.; Durbala, Adriana; Finn, Rose; Hallenbeck, Gregory L.; Hoffman, G. Lyle; Lebron, Mayra E.; Miller, Brendan P.; Crone-Odekon, Mary; O'Donoghue, Aileen A.; Olowin, Ronald Paul; Pantoja, Carmen; Pisano, Daniel J.; Rosenberg, Jessica L.; Troischt, Parker; Venkatesan, Aparna; Wilcots, Eric M.; ALFALFA Team

    2017-01-01

    The NSF-sponsored Undergraduate ALFALFA (Arecibo Legacy Fast ALFA) Team (UAT) is a consortium of 20 institutions across the US and Puerto Rico, founded to promote undergraduate research and faculty development within the extragalactic ALFALFA HI blind survey project and follow-up programs. The objective of the UAT is to provide opportunities for its members to develop expertise in the technical aspects of observational radio spectroscopy, its associated data analysis, and the motivating science. Partnering with Arecibo Observatory, the UAT has worked with more than 280 undergraduates and 26 faculty to date, offering 8 workshops onsite at Arecibo (148 undergraduates), observing runs at Arecibo (69 undergraduates), remote observing runs on campus, undergraduate research projects based on Arecibo science (120 academic year and 185 summer projects), and presentation of results at national meetings such as the AAS (at AAS229: Ball et al., Collova et al., Davis et al., Miazzo et al., Ruvolo et al, Singer et al., Cannon et al., Craig et al., Koopmann et al., O'Donoghue et al.). 40% of the students and 45% of the faculty participants have been women and members of underrepresented groups. More than 90% of student alumni are attending graduate school and/or pursuing a career in STEM. 42% of those pursuing graduate degrees in Physics or Astronomy are women.In this presentation, we summarize the UAT program and the current research efforts of UAT members based on Arecibo science, including multiwavelength followup observations of ALFALFA sources, the UAT Collaborative Groups Project, the Survey of HI in Extremely Low-mass Dwarfs (SHIELD), and the Arecibo Pisces-Perseus Supercluster Survey (APPSS). This work has been supported by NSF grants AST-0724918/0902211, AST-075267/0903394, AST-0725380, AST-121105, and AST-1637339.

  12. From the NSF: The National Science Foundation's Investments in Broadening Participation in Science, Technology, Engineering, and Mathematics Education through Research and Capacity Building.

    Science.gov (United States)

    James, Sylvia M; Singer, Susan R

    The National Science Foundation (NSF) has a long history of investment in broadening participation (BP) in science, technology, engineering, and mathematics (STEM) education. A review of past NSF BP efforts provides insights into how the portfolio of programs and activities has evolved and the broad array of innovative strategies that has been used to increase the participation of groups underrepresented in STEM, including women, minorities, and persons with disabilities. While many are familiar with these long-standing programmatic efforts, BP is also a key component of NSF's strategic plans, has been highlighted in National Science Board reports, and is the focus of ongoing outreach efforts. The majority of familiar BP programs, such as the Louis Stokes Alliances for Minority Participation (now 25 years old), are housed in the Directorate for Education and Human Resources. However, fellowship programs such as the Graduate Research Fellowships and Postdoctoral Research Fellowships under the Directorate for Biological Sciences (and parallel directorates in other STEM disciplines) are frequently used to address underrepresentation in STEM disciplines. The FY2016 and FY2017 budget requests incorporate funding for NSF INCLUDES, a new cross-agency BP initiative that will build on prior successes while addressing national BP challenges. NSF INCLUDES invites the use of innovative approaches for taking evidence-based best practices to scale, ushering in a new era in NSF BP advancement. © 2016 S. M. James and S. R. Singer. CBE—Life Sciences Education © 2016 The American Society for Cell Biology. This article is distributed by The American Society for Cell Biology under license from the author(s). It is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

  13. Fibrose pulmonar idiopática simultânea a enfisema em pacientes tabagistas Idiopathic pulmonary fibrosis and emphysema in smokers

    Directory of Open Access Journals (Sweden)

    Denise Rossato Silva

    2008-10-01

    Full Text Available OBJETIVO: Descrever os achados clínicos e funcionais de pacientes com enfisema em lobos superiores e fibrose pulmonar idiopática (FPI em lobos inferiores, recentemente descrita na literatura. MÉTODOS: Um grupo de 11 pacientes com a presença simultânea de enfisema e FPI foi identificado retrospectivamente. Todos os pacientes realizaram tomografia computadorizada de tórax com alta resolução e provas de função pulmonar. RESULTADOS: Entre os 11 pacientes identificados, havia 8 homens e 3 mulheres, com média de idade de 70,7 ± 7,2 anos (variação, 61-86 anos. Todos os pacientes eram tabagistas (carga tabágica, 61,5 ± 43,5 anos-maço. As médias da capacidade vital forçada (CVF, do volume expiratório forçado no primeiro segundo (VEF1 e da relação VEF1/CVF foram 72,1% ± 12,7%, 68,2% ± 11,9% e 74,4 ± 10,8, respectivamente. Os volumes pulmonares foram normais em 7 pacientes. Um padrão restritivo foi observado em 3 pacientes e hiperinsuflação estava presente em um. A capacidade de difusão pulmonar apresentou redução moderada a grave em todos os pacientes (média, 27,7% ± 12,9% do previsto. No teste da caminhada de seis minutos, realizado por 10 pacientes, a distância caminhada média foi de 358,4 ± 143,1 m, ocorrendo dessaturação >4% em 9 pacientes. Achados ecocardiográficos sugestivos de hipertensão pulmonar estavam presentes em 4 pacientes (média da pressão sistólica da artéria pulmonar, 61,8 mmHg; variação, 36-84 mmHg. CONCLUSÕES: A presença simultânea de enfisema e FPI causa alterações características nas provas de função pulmonar. O achado mais importante é a discrepância entre a capacidade de difusão e a espirometria.OBJECTIVE: To describe the clinical and functional findings recently reported in the medical literature for patients diagnosed with emphysema involving the upper lobes and idiopathic pulmonary fibrosis (IPF involving the lower lobes. METHODS: Eleven patients with emphysema and IPF

  14. ENVIRONMENTAL TECHNOLOGY VERIFICATION: JOINT (NSF-EPA) VERIFICATION STATEMENT AND REPORT HYDRO COMPLIANCE MANAGEMENT, INC. HYDRO-KLEEN FILTRATION SYSTEM, 03/07/WQPC-SWP, SEPTEMBER 2003

    Science.gov (United States)

    Verification testing of the Hydro-Kleen(TM) Filtration System, a catch-basin filter designed to reduce hydrocarbon, sediment, and metals contamination from surface water flows, was conducted at NSF International in Ann Arbor, Michigan. A Hydro-Kleen(TM) system was fitted into a ...

  15. Cornell's LEPP, CHESS research labs expected to get $124 million in NSF funding for elementary particle and X-ray research

    CERN Multimedia

    2003-01-01

    "Cornell University will be awarded up to $124 million over the next five years by the National Science Foundation (NSF) to support research at the Laboratory for Elementary-Particle Physics (LEPP) and the Cornell High Energy Synchrotron Source (CHESS), a national user facility" (1 page).

  16. Building a Community of Scholars: One University's Story of Students Engaged in Learning Science, Mathematics, and Engineering through a NSF S-STEM Grant--Part II

    Science.gov (United States)

    Kalevitch, Maria; Maurer, Cheryl; Badger, Paul; Holdan, Greg; Sirinterlikci, Arif

    2015-01-01

    The School of Engineering, Mathematics, and Science (SEMS) at Robert Morris University (RMU) was awarded a five-year grant from the National Science Foundation (NSF) to fund scholarships to 21 academically talented but financially challenged students majoring in the disciplines of science, technology, engineering, and mathematics (STEM). Each…

  17. Report on the SNL/NSF International Workshop on Joint Mechanics, Arlington, Virginia, 16-18 October 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Ewins, David J. (Imperial College, London England, UK); Bergman, Lawrence A. (University of Illinois, Urbana, IL); Segalman, Daniel Joseph

    2007-11-01

    The NSF/SNL joint mechanics workshop, held in Arlington, Virginia, 16-18 October, 2006, attempted to assess the current state of the art for modeling joint mechanics for the purpose of structural dynamics calculation, to identify the underlying physics issues that must be addressed to advance the field, and to propose a path forward. Distinguished participants from several countries representing research communities that focus on very different length and time scales identified multiple challenges in bridging those scales. Additionally, two complementary points of view were developed for addressing those challenges. The first approach - the 'bottom-up' perspective - attempts to bridge scales by starting from the smallest length scale and working up. The other approach starts at the length scale of application and attempts to deduce mechanics at smaller length scales through reconciliation with laboratory observation. Because interface physics is a limiting element of predictive simulation in defense and transportation, this issue will be of continuing importance for the foreseeable future.

  18. Valor preditivo de marcadores séricos de fibrose hepática em pacientes portadores de hepatite crônica viral C Predictive value of serum markers of hepatic fibrosis in patients with chronic hepatitis C

    Directory of Open Access Journals (Sweden)

    Leila Maria Soares Tojal de Barros Lima

    2008-06-01

    Full Text Available INTRODUÇÃO: Os marcadores séricos têm sido empregados na avaliação da fibrose hepática em pacientes portadores de hepatite crônica C (HCC. OBJETIVOS: Avaliar a capacidade do índice aspartato aminotransferase (AST/alanina aminotransferase (ALT, dos níveis séricos de gama-glutamiltransferase (GGT, contagem de plaquetas, do índice AST/plaquetas (APRI e do ácido hialurônico (AH em predizer a intensidade da fibrose hepática na HCC e a variação desses marcadores após tratamento com interferon. PACIENTES E MÉTODOS: Em 72 pacientes portadores de hepatite C determinamos no soro o índice AST/ALT, GGT, plaquetas, índice APRI (obtido pelo quociente AST/plaquetas e o AH, que foram comparados ao estadiamento histológico, segundo os critérios de METAVIR. Receberam tratamento com interferon e ribavirina 65 pacientes. Os indivíduos que concluíram o tratamento (n = 33 realizaram nova dosagem dos marcadores séricos de fibrose para comparar com os níveis pré-tratamento. RESULTADOS: Observamos que a GGT, a contagem de plaquetas, o índice APRI e o AH se correlacionaram com estádio de doença hepática (p INTRODUCTION: Serum markers have been used in the assessment of liver fibrosis in patients with chronic hepatitis C (CHC. AIMS: We evaluated the capacity of aspartate aminotransferase (AST/alanine aminotransferase (ALT ratio, gama-glutamyltransferase (GGT levels, platelet count, the AST to platelet ratio index (APRI and serum hyaluronic acid (HA to predict the intensity of hepatic fibrosis in patients with CHC and the variation of these markers after therapy with interferon. PATIENTS AND METHODS: In 72 patients with hepatitis C, AST/ALT ratio, GGT levels, platelet count, the APRI index (calculated as the ratio of AST to platelets and serum HA concentration were determined and compared to histological staging according to the scoring system of METAVIR. Sixty-five patients received interferon and ribavirin therapy. The individuals that

  19. Avaliação e recomendações nutricionais para crianças e adolescentes com fibrose cística Nutritional assessment and recommendations for children and adolescents with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Célia Regina M. M. Chaves

    2012-01-01

    Full Text Available OBJETIVO: Revisar e discutir evidências sobre a avaliação do estado nutricional e as recomendações para o tratamento nutricional de crianças e adolescentes com fibrose cística. FONTES DE DADOS: Bancos de dados MEDLINE (versão PubMed e Latin American and Caribbean Center on Health Sciences Information (LILACS, entre 1984 a 2009. Aplicou-se a combinação dos seguintes descritores: fibrose cística, estado nutricional, criança e adolescente - em inglês e português. SÍNTESE DOS DADOS: A fibrose cística é uma doença genética, de evolução crônica, progressiva e fatal. Resulta do defeito na proteína reguladora transmembrana que regula a condução de cloro e, consequentemente, o fluxo de sódio e água através da membrana apical das células epiteliais. Pacientes fibrocísticos são vulneráveis à desnutrição, que resulta do desequilíbrio entre ingestão alimentar, gasto e perdas energéticas. Novos conhecimentos sobre a fisiopatologia da doença, adquiridos nas últimas décadas, resultaram em mudanças significativas nas atuais recomendações energéticas e principalmente de lipídeos. A importância da nutrição no bem-estar e sobrevida dos fibrocísticos está bem estabelecida, assim como a associação entre a desnutrição e a deterioração da função pulmonar. Existem múltiplos fatores inter-relacionados que afetam o estado nutricional, tais como, mutação genética, insuficiência pancreática, ressecção intestinal, perda de sais e ácidos biliares, refluxo gastroesofágico, inflamação e infecções pulmonares, diabetes e condições emocionais. CONCLUSÕES: O monitoramento nutricional e o aconselhamento dietético são elementos chave no manejo de crianças e adolescentes com fibrose cística com o intuito de controlar a sintomatologia e a progressão da doença, proporcionando melhor qualidade de vida.OBJECTIVE: To review and discuss evidence on the nutritional status assessment and recommendations for

  20. Forma acelerada da fibrose pulmonar idiopática no pulmão nativo após transplante pulmonar unilateral Accelerated form of interstitial pulmonary fibrosis in the native lung after single lung transplantation

    Directory of Open Access Journals (Sweden)

    Rogério Rufino

    2007-12-01

    Full Text Available Relatamos o caso de um paciente de 56 anos submetido a transplante pulmonar unilateral esquerdo em decorrência de fibrose pulmonar idiopática (FPI. No pós-operatório imediato, sob intensa imunossupressão, houve progressão rápida da FPI no pulmão nativo direito, confirmada pela biópsia pulmonar videotoracoscópica, necessitando de ventilação mecânica durante 104 dias até a realização de outro transplante pulmonar à direita. Obteve alta hospitalar após o 26º dia do segundo pós-operatório.We report the case of a 56-year-old patient who underwent left single lung transplantation for idiopathic pulmonary fibrosis (IPF. Despite the high level of immunosuppression after the surgery, there was rapid progression to IPF in the native (right lung as demonstrated by thoracoscopic lung biopsy. After 104 days on mechanical ventilation (MV, the patient underwent right lung transplant and was discharged from the hospital on postoperative day 26.

  1. EVOLUÇÃO DA FIBROSE BILIAR SECUNDÁRIA EM RATOS TRATADOS MEDIANTE DERIVAÇÃO BÍLIO-DUODENAL OU BÍLIO-JEJUNAL COM AL��A DE ROUX MEDINDO 5, 10 E 15 CM

    Directory of Open Access Journals (Sweden)

    Pandolfi Jr. H.

    2001-01-01

    Full Text Available A modalidade de derivação bílio-digestiva empregada no tratamento da colestase extra-hepática crônica pode influenciar na reparação das lesões hepáticas. Avaliou-se o desempenho das derivações bílio-duodenal e bílio-jejunal em Y de Roux com alça exclusa de diferentes comprimentos na reparação das lesões morfológicas e funcionais do fígado de ratos com fibrose biliar secundária. Foram utilizados ratos Wistar, com 15 dias de obstrução biliar, alocados em 5 grupos de 6 animais. O grupo OB caracterizou as alterações da fibrose biliar. Os animais remanescentes foram tratados mediante derivação com o duodeno (grupo DBD, e com o jejuno, em alça exclusa de 5cm (grupo DBJ5, 10cm (grupo DBJ10 e 15cm (grupo DBJ15, sendo reavaliados 3 meses depois. Outros 6 animais foram submetidos à intervenção simulada e considerados grupo controle (IS. Todos animais foram submetidos à avaliação morfométrica do fígado, análise bioquímica do sangue e microbiológica da bile, estudo da função mitocondrial hepática e verificação do peso úmido do fígado e do baço. Na análise estatística adotou-se o nível de significância de 5%. Houve aumento significativo do peso estimado, em g/Kg de peso corporal, dos ductos biliares, da fibrose e dos hepatócitos nos animais do grupo OB (medianas de 1,30; 10,03 e 37,0 em relação aos animais controles (IS (medianas de 0,03; zero e 29,37. Após tratamento, ocorreu regressão significativa do peso estimado dos ductos biliares e da fibrose, com valores medianos de 0,22 e 0,22 para o grupo DBD, 0,45 e 3,31 para o grupo DBJ5 e 0,22 e 5,0 para o grupo DBJ15. Houve regressão significativa do peso estimado dos hepatócitos apenas nos grupos derivados com o jejuno, com valores medianos de 31,93; 24,46 e 28,52. Ocorreu aumento significativo do peso úmido do fígado e do baço no grupo OB (medianas em g/Kg de peso corporal de 49,85 e 5,71 em relação ao grupo IS (30,0 e 3,04. Houve regress

  2. Prevalência de doença mineral óssea em adolescentes com fibrose cística Prevalence of bone mineral disease among adolescents with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Reinaldo José do Amaral Caldeira

    2008-02-01

    Full Text Available OBJETIVO: Avaliar a prevalência de doença mineral óssea em adolescentes com fibrose cística e associar os achados com as variáveis estudadas. MÉTODOS: Foram selecionados 37 adolescentes, dos quais foram avaliados: estado nutricional pelos índices de altura/idade e massa corporal/idade; densidade mineral óssea da coluna lombar e corpo inteiro por densitometria com emissão de raio X de dupla energia; ingestão dietética diária pelo registro alimentar de 3 dias; e prova de função pulmonar pelo volume expiratório forçado no primeiro segundo. RESULTADOS: A média de idade foi de 13,2 (±2,8 anos. O estado nutricional adequado foi de 70,3 e 75,7% pelos índices de altura/idade e de massa corporal/idade, respectivamente; 54,1% dos pacientes apresentaram redução da densidade mineral óssea para coluna lombar e 32,5% para corpo inteiro. Houve correlação positiva entre densidade mineral óssea e índice de massa corporal (p = 0,04. A doença pulmonar e a insuficiência pancreática apresentaram correlação com a alteração da densidade mineral óssea. O inquérito alimentar revelou percentuais de adequação para o cálcio, fósforo e calorias, de acordo com a recomendação nutricional preconizada pelo Consenso Europeu de Fibrose Cística. Essas variáveis não se mostraram estatisticamente significantes na análise multivariada. CONCLUSÃO: A prevalência de doença mineral óssea é alta na adolescência. O estado nutricional adequado, a reposição de enzimas pancreáticas e o controle da doença pulmonar podem ter efeito protetor para a massa óssea.OBJECTIVE: To evaluate the prevalence of bone mineral disease among adolescents with cystic fibrosis and to relate the findings with the variables studied. METHODS: The study enrolled 37 adolescents who were assessed for: nutritional status according to height/age and body mass/age ratios; bone mineral density of the lumbar spine and entire body by densitometry with dual emission X

  3. Fibrose pulmonar secundária à amiodarona – A propósito de um caso clínico

    Directory of Open Access Journals (Sweden)

    Marta N. Silva

    2006-11-01

    Full Text Available Resumo: A amiodarona é um eficaz fármaco anti-arrítmico usado para tratar arritmias ventriculares e supra-ventriculares, mas não isento de reacções adversas. A toxicidade pulmonar é uma delas, relativamente rara (5 a 10% dos casos, e pode ser fatal. Há vários factores que aumentam a susceptibilidadade para esta toxicidade, tais como a idade avançada e a doença pulmonar preexistente.Apresentamos um caso clínico de toxicidade pulmonar induzida pela amiodarona (fibrose pulmonar num doente do sexo masculino, de 81 anos. Estava medicado com este fármaco, desde há 5 anos, com uma dose diária de 200 mg.Após a suspensão do fármaco e tratamento com corticosteróides sistémicos, houve melhoria clínica, funcional e radiológica.Este caso clínico realça a necessidade de uma monitorização e diagnóstico precoce dos efeitos adversos do tratamento com a amiodarona e a dificuldade no seu diagnóstico, devido à inespecificidade dos sintomas, das manifestações clínicas e dos resultados dos exames complementares de diagnóstico.Rev Port Pneumol 2006; XII (6: 725-730 Abstract: Amiodarone is an antiarrhytmic drug and it is used to treat supraventricular or ventricular rhythm disturbances. Nevertheless it is not free of side effects. Amiodarone-induced pulmonary toxicity is one of them and is relatively rare (5 to 10% of cases and can be fatal. There are several cumulative factors that may enhance susceptibility to pulmonary toxicity, such as advanced age and pre-existing pulmonary dysfunction.We present a case study of amiodarone-induced toxicity (pulmonary fibrosis in an 81-year-old man. The patient had been treated with amiodarone for five years in daily dose 200 mg/day.After withdrawing the drug and systemic corticoste-roid therapy, clinical, functional and radiological improvement was observed.This case confirms the needs of a vigilant monitoring and early diagnosis of

  4. Fibrose maciça progressiva em trabalhadores expostos à sílica: achados na tomografia computadorizada de alta resolução Progressive massive fibrosis in silica-exposed workers: high-resolution computed tomography findings

    Directory of Open Access Journals (Sweden)

    Ângela Santos Ferreira

    2006-12-01

    Full Text Available OBJETIVO: Avaliar as características radiológicas das massas conglomeradas pela tomografia computadorizada de alta resolução de tórax. MÉTODOS: Foram selecionados 75 pacientes silicóticos, a maioria jateadores de areia, portadores de fibrose maciça progressiva, atendidos no Hospital Universitário Antônio Pedro entre 1986 e 2004. Os pacientes foram submetidos a avaliação clínica, radiografia simples de tórax e tomografia computadorizada de alta resolução. RESULTADOS: Mais da metade dos pacientes com silicose complicada mostrou na radiografia de tórax grandes opacidades dos tipos B e C, denotando a gravidade da doença nesses pacientes. Dos 75 casos, apenas um apresentou massa unilateral simulando câncer de pulmão. Quarenta e quatro pacientes realizaram tomografia computadorizada de alta resolução do tórax. As massas predominaram nos terços superiores e posteriores (88,6%. Broncograma aéreo e calcificações no interior das massas foram observados em 70,4% e 63,8% dos casos, respectivamente. História de tuberculose foi relatada em 52% dos pacientes estudados. CONCLUSÃO: Na grande maioria dos casos as massas eram bilaterais, predominando nas regiões póstero-superiores dos pulmões, com broncogramas aéreos e calcificações de permeio. Associação com calcificações linfonodais foi um achado freqüente. A exposição a elevadas concentrações de poeira e a tuberculose foram consideradas fatores de risco para o desenvolvimento da fibrose maciça progressiva.OBJECTIVE: To evaluate the radiological characteristics of conglomerate masses using high-resolution computed tomography of the chest. METHODS: From among the patients treated between 1986 and 2004 at the Antonio Pedro University Hospital, 75 patients with silicosis and massive fibrosis, most working in the field of sandblasting, were selected for study. These patients were submitted to a clinical evaluation, chest X-ray and high-resolution computed tomography of

  5. Kwashiorkor e distúrbio de coagulação: apresentação atípica de fibrose cística Kwashiorkor and coagulation disturbance: atypical presentation of cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Michelle de Oliveira T. Sundell

    2012-01-01

    Full Text Available OBJETIVO: Enfatizar a apresentação clínica precoce da fibrose cística (FC em lactente com Kwashiorkor e distúrbio de coagulação, decorrente de hipovitaminose K. DESCRIÇÃO DO CASO: Paciente com três meses e meio, sexo feminino, nascida a termo, peso de 2655g, estatura de 46cm, foi encaminhada para investigação de lesões perineais associadas à monilíase de difícil controle, refratária a diversos antifúngicos e corticoides. Quadro geral caracterizado por baixo ganho ponderal, edema e diarreia. Admissão hospitalar para investigação com hipótese diagnóstica de Kwashiorkor de origem primária ou secundária. Paciente mantida em aleitamento materno exclusivo, sendo observadas perda ponderal e persistência da diarreia. Na internação, foi iniciado tratamento de infecção do trato urinário. A paciente evoluiu com hemorragia digestiva alta e sangramento pela flebotomia em safena direita, sendo identificada coagulopatia responsiva à vitamina K e plasma fresco congelado. Na evolução, foi confirmada esteatorreia e hipoalbuminemia; as sorologias para sífilis, toxoplasmose, mononucleose, citomegalovírus, rubéola, HIV e hepatite B, apresentaram resultado negativo e a pesquisa da mutação ∆F508 heterozigoto para FC foi positiva. A paciente apresentou piora do estado geral com sinais de sepse, evoluindo para óbito. O laudo necroscópico evidenciou elementos característicos de choque séptico com infecção pulmonar, sinais acentuados de desnutrição e fibrose cística do pâncreas. COMENTÁRIOS: A FC pode manifestar-se com quadro de Kwashiorkor e distúrbio de coagulação por deficiência de vitamina K. Os profissionais de saúde devem estar atentos à possibilidade de FC no diagnóstico diferencial dessa situação.OBJECTIVE: To address the clinical presentation of cystic fibrosis (CF in an infant presenting Kwashiorkor along with coagulation disturbance due to vitamin K deficiency. CASE DESCRIPTION: A female baby aged

  6. Nebulizadores: fonte de contaminação bacteriana em pacientes com fibrose cística? Nebulizers in cystic fibrosis: a source of bacterial contamination in cystic fibrosis patients?

    Directory of Open Access Journals (Sweden)

    Lorena Xavier Costa Brzezinski

    2011-06-01

    Full Text Available OBJETIVO: Determinar se os nebulizadores de pacientes com fibrose cística são fonte de contaminação microbiana e verificar se a técnica e a frequência de desinfecção dos nebulizadores é apropriada. MÉTODOS: Estudo de corte transversal observacional, sem grupo controle. Foram coletadas amostras de 28 pacientes com fibrose cística, no domicílio do paciente, sem aviso prévio sobre o motivo da visita. Foram colhidas três amostras por paciente: do reservatório do nebulizador, da máscara/bocal e do próprio paciente (swab da orofaringe/escarro. As amostras foram acondicionadas adequadamente e levadas para análise. Os pacientes, seus pais ou responsáveis preencheram um questionário sobre métodos de limpeza e desinfecção dos nebulizadores. RESULTADOS: Foram obtidas 84 amostras dos 28 pacientes. Destes, 15 (53,5% eram do gênero masculino. A mediana de idade foi de 11 anos (variação: 1-27 anos. Dos 28 pacientes, 15 apresentaram culturas de escarro/orofaringe positivas. As bactérias encontradas com maior frequencia foram Streptococcus aureus (8/15 e Pseudomonas aeruginosa (4/15. A cultura obtida dos nebulizadores identificou diversos patógenos, sem nenhum predominante. Não houve associações entre os resultados das culturas obtidas dos nebulizadores e aquelas dos pacientes em 27 casos (96,7%. A limpeza e a desinfecção não eram realizadas de forma adequada em 22 casos (78,6%. CONCLUSÕES: Nesta amostra de pacientes, apesar das técnicas de desinfecção inadequadas, os nebulizadores não foram uma fonte de contaminação microbianaOBJECTIVE: To determine whether nebulizers are a source of microbial contamination in patients with cystic fibrosis, as well as whether the technique and frequency of disinfection of these devices is appropriate. METHODS: This was a cross-sectional, uncontrolled observational study. Samples were collected from 28 patients with cystic fibrosis. Samples were collected at the homes of the patients, who

  7. Behandeling van pijn bij kanker met systemisch toegediende opioïden

    NARCIS (Netherlands)

    Enting, R H; van der Rijt, C C; Wilms, E B; Lieverse, P J; de Wit, R; Smitt, P A

    2001-01-01

    The World Health Organization guidelines for cancer pain relief have been proven efficacious in 90% of the patients with cancer pain. The patient's self-report of pain is the focus of treatment. When initiating treatment, controlled-release preparations of opioids are generally favoured, and are

  8. Estudo de mutações do gene CFTR e da concentração sérica da lectina ligante de manose (MBL) em crianças com fibrose cística identificadas pela triagem neonatal

    OpenAIRE

    Ribas, Danieli Isabel Romanovitch

    2014-01-01

    Orientador: Prof. Dr. Nelson Augusto Rosário Filho Co-orientadora: Profª. Drª. Lilian Pereira Ferrari Tese (doutorado) - Universidade Federal do Paraná, Setor de Ciências da Saúde, Programa de Pós-Graduação em Medicina Interna. Defesa : Curitiba, 19/12/2014 Inclui referências Resumo: A fibrose cística é uma doença hereditária autossômica recessiva, causada por mutações no gene CFTR (Cystic Fibrosis Transmembrane Conductance Regulator). Apresenta grande variação clínica, mesm...

  9. Undergraduate Research as a Process for STEM Teaching and Learning Systemic Change: Lessons Learned from the Council on Undergraduate Research NSF CCLI and TUES Projects

    Science.gov (United States)

    Ambos, E. L.; Havholm, K. G.; Malachowski, M.; Osborn, J.; Karukstis, K.

    2013-12-01

    For more than seven years, the Council on Undergraduate Research (CUR), the primary organization supporting programs, services, and advocacy for undergraduate research, has been working with support from the NSF's Division of Undergraduate Education (DUE) to enhance, sustain, and institutionalize undergraduate research in diverse STEM disciplines and higher education settings. The Council on Undergraduate Research comprises more than 9000 individual and 670 institutional members within a divisional structure that includes geosciences, as well as 11 other thematic areas. Through its most recent grant: 'Transformational Learning through Undergraduate Research: Comprehensive Support for Faculty, Institutions, State Systems and Consortia' (NSF DUE CCLI III Award #09-20275), CUR has been collaborating with six higher education systems, each selected after a rigorous national application process in 2010 and 2011. These six systems, which collectively represent 79 individual institutions, are the Council of Public Liberal Arts Colleges (COPLAC), University of Wisconsin System (UWS), California State University System (CSU), City University of New York (CUNY), Great Lakes Colleges Association (GLCA), and Pennsylvania State System of Higher Education (PASSHE). The more than 350 participants of faculty and senior-level administrators from the six systems are engaged in shared multi-faceted and multi-year professional development experiences. Teams from each system attended customized institutes facilitated by CUR experts in 2011-2012, during which the teams developed specific action plans focused on institutionalizing undergraduate research on their campus and within their system. The systems were reconvened as a group a year after the first institute, to chart progress toward achieving their goals. Based on interviews and surveys with participants, campus teams are making substantial progress toward implementation of robust undergraduate research programs, and are making

  10. Adapting and Bending the Portal to the Public: Evaluation of an NSF-Funded Science Communication Model for UNAVCO's Geoscience Summer Internships

    Science.gov (United States)

    Dutilly, E.; Charlevoix, D. J.; Bartel, B. A.

    2017-12-01

    UNAVCO is a National Science Foundation (NSF) facility specializing in geodesy. As part of its education and outreach work, it operates annual summer internships. In 2016, UNAVCO joined the Portal to the Public (PoP) network and the PoP model was adapted and bent to provide science communication professional development for summer interns. PoP is one way that UNAVCO invests in and trains future generations of geoscientists. The NSF-funded PoP initiative and its network, PoPNet, is a premier outreach framework connecting scientists and public audiences for over a decade. PoPNet is a network of sixty organizations committed to using the PoP method to engage the public in face-to-face interactions with practicing scientists. The PoP initiative provides professional development to scientists focused on best practices in science communication, helps them to develop an interactive exhibit consistent with their current research, and offers them a venue for interacting with the public. No other evaluation work to date has examined how summer internships can uptake the PoP model. This presentation focuses on evaluation findings from two cohorts of summer interns across two years. Three primary domains were assessed: how demographic composition across cohorts required changes to the original PoP framework, which of the PoP professional development trainings were valued (or not) by interns, and changes to intern knowledge, attitudes, and abilities to communicate science. Analyses via surveys and interviews revealed that level of intern geoscience knowledge was a major factor in deciding the focus of the work, specifically whether to create new hands-on exhibits or use existing ones. Regarding the use of PoP trainings, there was no obvious pattern in what interns preferred. Most growth and learning for interns occurred during and after the outreach activity. Results of this evaluation can be used to inform other applications of the PoP approach in summer internships.

  11. Chroni - an Android Application for Geochronologists to Access Archived Sample Analyses from the NSF-Funded Geochron.Org Data Repository.

    Science.gov (United States)

    Nettles, J. J.; Bowring, J. F.

    2014-12-01

    NSF requires data management plans as part of funding proposals and geochronologists, among other scientists, are archiving their data and results to the public cloud archives managed by the NSF-funded Integrated Earth Data Applications, or IEDA. GeoChron is a database for geochronology housed within IEDA. The software application U-Pb_Redux developed at the Cyber Infrastructure Research and Development Lab for the Earth Sciences (CIRDLES.org) at the College of Charleston provides seamless connectivity to GeoChron for uranium-lead (U-Pb) geochronologists to automatically upload and retrieve their data and results. U-Pb_Redux also manages publication-quality documents including report tables and graphs. CHRONI is a lightweight mobile application for Android devices that provides easy access to these archived data and results. With CHRONI, U-Pb geochronologists can view archived data and analyses downloaded from the Geochron database, or any other location, in a customizable format. CHRONI uses the same extensible markup language (XML) schema and documents used by U-Pb_Redux and GeoChron. Report Settings are special XML files that can be customized in U-Pb_Redux, stored in the cloud, and then accessed and used in CHRONI to create the same customized data display on the mobile device. In addition to providing geologists effortless and mobile access to archived data and analyses, CHRONI allows users to manage their GeoChron credentials, quickly download private and public files via a specified IEDA International Geo Sample Number (IGSN) or URL, and view specialized graphics associated with particular IGSNs. Future versions of CHRONI will be developed to support iOS compatible devices. CHRONI is an open source project under the Apache 2 license and is hosted at https://github.com/CIRDLES/CHRONI. We encourage community participation in its continued development.

  12. Who is looking for an internship and successful in obtaining one? Examining application data from REU programs funded through NSF GEO

    Science.gov (United States)

    Hubenthal, M.; Kelly, M.

    2017-12-01

    The Directorate for Geosciences (GEO) at the National Science Foundation (NSF) is currently funding 60 Research Experiences for Undergraduate (REU) sites. Each site offers opportunities for 8 to 12 undergraduates to participate in research within solid earth, oceans, atmospheric and cryosphere sciences. Because applicant data is collected at individual REU sites, the exact number of unique applicants to all REU sites, and the demographics of this national applicant pool has not been previously reported. While some sites do provide some of this information to NSF in annual reports, obtaining and combining such data is problematic because the percentage of individuals that apply to multiple programs is unknown and generally believed anecdotally to be high, especially for students traditionally underrepresented in the geosciences. Understanding both the scale and makeup of the national applicant pool is important for several reasons. First, very little is known about how the supply and geographic location of slots in REU programs compares to the demand from undergraduate STEM majors interested in research experiences. Second, research into internship programs and their role in the career development process are limited by a lack of baseline data that includes both successful and unsuccessful internship applicants across the various sub-disciplines of the Earth sciences. Finally, designing and refining efforts to engage underrepresented populations in STEM research, and measuring the impact of such efforts is difficult without baseline data for comparison. We will present aggregate application data from up to 20 GEO REU funded programs. These programs represent Oceans, Atmospheres and Earth Science research areas and includes over a thousand applicants. Preliminary analysis suggests the number of unique applicants in the pool is higher than anecdotally predicted. Similarly, unique applicants from underrepresented communities also appears higher than anticipated.

  13. Perfil epidemiológico das infecções bacterianas do aparelho respiratório em doentes com fibrose quística

    Directory of Open Access Journals (Sweden)

    Sofia Quintas

    2003-07-01

    Full Text Available RESUMO: Com o intuito de caracterizar a evolução do perfil epidemiológico das infecções bacterianas do aparelho respiratório dos doentes com Fibrose Quística (FQ, os autores realizaram um estudo retrospectivo da prevalência e incidência das mesmas em 78 doentes com FQ seguidos no Centro Especializado de FQ da Clínica Universitária de Pediatria do Hospital de Santa Maria, Lisboa durante um período de 5 anos (1995-1999.A Pseudomonas aeruginosa foi a bactéria mais frequentemente isolada nos três primeiros anos do estudo (60-73%, sendo ultrapassada nos dois anos seguintes pelo Staphylococcus aureus. No entanto, a Pseudomonas aeruginosa constituiu sempre o principal agente de colonização crónica (44-59%, com um pico de início da mesma entre os 0 e os 5 anos (34%. Verificou-se ao longo dos 5 anos um aumento significativo da prevalência de colonização intermitente e crónica por Staphylococcus aureus (48% para 83% e 32% para 54%. A prevalência de isolamentos de Staphylococcus aureus resistente à meticilina e de Burkholderia cepacia quase que duplicou neste período. As taxas de isolamento e de colonização crónica por Alcaligenes xylosoxidans aumentaram bruscamente a partir de 1997 (de 3% e 0% em 1996 para 7% e 5% em 1997 e 10% e 7% em 1999. A colonização crónica por Haemophilus influenzae manteve uma prevalência média de 22%, apesar dum aumento dos isolamentos (de 42% para 61%. Em 55% dos doentes observou-se colonização crónica por dois ou mais agentes.Em função destes resultados são discutidos os esquemas terapêuticos e as medidas de prevenção de contágios que têm sido preconizados nos doentes com FQ do nosso centro.REV PORT PNEUMOL 2003; IX (4: 337-352 ABSTRACT: With the aim of characterizing the evolution of the epidemiological profile of respiratory bacterial infections of patients having Cystic Fibrosis (CF, the authors

  14. Biofilm ved kronisk rhinosinuitis og cystisk fibrose

    DEFF Research Database (Denmark)

    Fisker, Jacob; Buchwald, Christian von; Johansen, Helle Krogh

    2011-01-01

    Microbial biofilms are known to cause persistent foreign-body infections and have recently been acknowledged as involved in more than 65% of all human infections. Microbial biofilms have been detected in chronic rhinosinusitis, and chronic rhinosinusitis is mandatory in patients with cystic...

  15. Idiopatisk pulmonal fibrose er en overset sygdom

    DEFF Research Database (Denmark)

    Bendstrup, Elisabeth; Kronborg-White, Sissel; Prior, Thomas Skovhus

    2017-01-01

    Idiopathic pulmonary fibrosis is a chronic, progressive and fatal disease which primarily occurs in male patients over 60 years with a smoking history. Cryobiopsy is a new promising method for obtaining lung tissue for histologic analysis with fewer complications than surgical lung biopsy...

  16. Imaging pulmonary fibrosis; Imagerie des fibroses pulmonaires

    Energy Technology Data Exchange (ETDEWEB)

    Brauner, M.W.; Rety, F.; Naccache, J.M.; Girard, F.; Valeyre, D.F. [Hopital Avicenne, 93 - Bobigny (France). Service de radiologie et de pneumologie

    2001-02-01

    Localized fibrosis of the lung is usually scar tissue while diffuse pulmonary fibrosis is more often a sign of active disease. Chronic infiltrative lung disease may be classified into four categories: idiopathic pneumonitis, collagen diseases, granulomatosis (sarcoidosis), and caused by known diseases (pneumoconiosis, hypersensitivity pneumonitis, drug-induced lung disease, radiation). (authors)

  17. Morphometric study of the fibrosis and mast cell count in the circular colon musculature of chronic Chagas patients with and without megacolon Estudo morfométrico da fibrose e do número de mastócitos na muscular circular do cólon de chagásicos crônicos com e sem megacólon

    Directory of Open Access Journals (Sweden)

    Simone Wanderley Pinheiro

    2003-07-01

    Full Text Available A morphometric study of the circular colon musculature was performed, in which the mast cell count was determined and the connective fibrous tissue in this layer was measured. The objective was to gain better understanding of Chagas megacolon morphology and contribute towards the knowledge of fibrosis pathogenesis in Chagas megas. An evaluation was made of 15 distal sigmoid rings from Chagas patients with megacolon (MCC, 15 without megacolon (CSMC and 15 non-Chagas patients (NC. The rings were fixed in formol, embedded in paraffin, and 7mm thick sections were cut and stained using Azan-Heidenhain and Giemsa. The mast cell count and fibrosis were greater in the MCC group than in the CSMC and NC groups (p Com os objetivos de conhecer melhor a morfologia do megacólon chagásico e contribuir para o conhecimento da patogênese da fibrose dos megas, realizou-se estudo morfométrico na muscular circular do cólon, contando-se o número de mastócitos e medindo o conjuntivo fibroso nessa camada. Foram avaliados anéis do sigmóide distal de 15 chagásicos com megacólon (MCC, 15 sem megacólon (CSMC e 15 não chagásicos (NC. Os anéis foram fixados em formol, incluídos em parafina, cortados com 7mm de espessura e corados por Azan-Heidenhain e Giemsa. O número de mastócitos e a fibrose foram maiores no grupo com MCC em relação ao CSMC e NC (p < 0,05; teste de Kruskal-Wallis; não houve diferença significante entre os dois últimos grupos. Diante destes achados, é possível, que haja relação entre mastocitose e fibrose no megacólon chagásico, como já se demonstrou em outras doenças.

  18. Incidência e evolução da polipose nasal em crianças e adolescentes com fibrose cística Incidence and evolution of nasal polyps in children and adolescents with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Silke Anna Thereza Weber

    2008-02-01

    Full Text Available A polipose nasal é manifestação clínica de alerta para investigação de fibrose cística (FC. OBJETIVO: Avaliar incidência de pólipos nasais em crianças e adolescentes com FC, sua associação com idade, sexo, sintomas clínicos, achados laboratoriais e genótipo, e sua evolução com corticoterapia tópica. CASUÍSTICA E MÉTODOS: Foram avaliados sintomas clínicos, níveis de cloro no suor e mutações genéticas de 23 pacientes com FC. A polipose nasal foi investigada por exame endoscópico e quando presente, o paciente recebeu 6 meses de tratamento com corticosteróide tópico e foi realizada nova endoscopia depois. Para análise estatística utilizou-se média, desvio padrão e Teste de Fisher. RESULTADOS: 39,1% dos pacientes apresentaram polipose nasal (cinco bilateral, quatro unilateral, todos com mais de seis anos, 82,6%, pneumonias recorrentes, 87%, insuficiência pancreática e 74%, desnutrição. Não houve associação entre polipose e nível de cloro no suor, genótipo, fenótipo clínico e sintomas nasais. Houve melhora da polipose com tratamento clínico em sete pacientes, com regressão completa em seis. CONCLUSÃO: O estudo mostrou elevada incidência de polipose em crianças com FC, sendo encontrada em todos os espectros de gravidade clínica, mesmo na ausência de sintomas nasais. O tratamento com corticosteróide tópico mostrou-se eficaz. A interação de pneumopediatra e do otorrinolaringologista é fundamental para diagnóstico e seguimento.Nasal polyps are a clinical sign of alert for investigating Cystic Fibrosis (CF. AIMS: To study the incidence of nasal polyps in children and adolescents with cystic fibrosis, its possible association with age, gender, clinical manifestations, genotype and sweat chlorine level, and its evolution with topical steroid therapy. METHODS: Clinical symptoms, sweat chlorine level and genotype were studied in 23 cystic fibrosis patients. Nasal polyps were diagnosed by nasal endoscopy

  19. Prevalência da doença do refluxo gastroesofágico em pacientes com fibrose pulmonar idiopática Prevalence of gastroesophageal reflux disease in patients with idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    Cristiane Dupont Bandeira

    2009-12-01

    Full Text Available OBJETIVO: Determinar a prevalência da doença do refluxo gastroesofágico (DRGE e sua apresentação clínica, além do perfil funcional do esôfago em pacientes com fibrose pulmonar idiopática (FPI. MÉTODOS: Foram avaliados prospectivamente 28 pacientes com FPI. Os pacientes foram submetidos à esofagomanometria estacionária, pHmetria de 24 h e testes de função pulmonar, assim como responderam a questionários sobre sintomas e qualidade de vida em DRGE. RESULTADOS: A prevalência de DRGE foi de 35,7%. Os pacientes foram divididos em dois grupos: grupo DRGE+ (pHmetria anormal; n = 10, e grupo DRGE- (pHmetria normal; n = 18. No grupo DRGE+, 77,7% dos pacientes apresentavam pelo menos um sintoma típico de DRGE. Nesse grupo de pacientes, 8 (80% apresentaram refluxo em posição supina, e 5 (50% apresentaram refluxo exclusivamente nessa posição. Nos grupos DRGE+ e DRGE-, respectivamente, 5 (50,0% e 7 (38,8% dos pacientes apresentaram hipotonia do esfíncter esofágico inferior, assim como 7 (70,0% e 10 (55,5% apresentaram hipomotilidade esofágica. Não houve diferenças significativas entre os grupos quanto a características demográficas, função pulmonar, apresentação clínica ou achados manométricos. CONCLUSÕES: A prevalência de DRGE nos pacientes comOBJECTIVE: To determine the prevalence of gastroesophageal reflux disease (GERD and to evaluate its clinical presentation, as well as the esophageal function profile in patients with idiopathic pulmonary fibrosis (IPF. METHODS: In this prospective study, 28 consecutive patients with IPF underwent stationary esophageal manometry, 24-h esophageal pH-metry and pulmonary function tests. All patients also completed a symptom and quality of life in GERD questionnaire. RESULTS: In the study sample, the prevalence of GERD was 35.7%. The patients were then divided into two groups: GERD+ (abnormal pH-metry; n = 10 and GERD- (normal pH-metry; n = 18. In the GERD+ group, 77.7% of the patients

  20. Padrões ventilatórios na espirometria em pacientes adolescentes e adultos com fibrose cística Respiratory patterns in spirometric tests of adolescents and adults with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Bruna Ziegler

    2009-09-01

    Full Text Available OBJETIVO: Avaliar os padrões dos distúrbios ventilatórios observados na espirometria em pacientes com fibrose cística (FC e suas relações com a gravidade funcional e com o comportamento dos fluxos máximos expiratórios a baixos volumes. MÉTODOS: Estudo transversal e retrospectivo, incluindo pacientes adolescentes e adultos com FC. Todos os pacientes foram submetidos à espirometria. Os pacientes foram classificados como tendo função ventilatória preservada, distúrbio ventilatório obstrutivo (DVO, DVO com CVF reduzida, sugestivo de distúrbio ventilatório restritivo (DVR ou distúrbio ventilatório combinado (DVC. Os fluxos máximos expiratórios a baixos volumes foram avaliados utilizando-se FEF25-75%, FEF75%e FEF75%/CVF. O grupo controle incluiu 65 indivíduos normais, também submetidos à espirometria. RESULTADOS: Foram incluídos 65 pacientes no grupo de estudo: 8 (12,3% com função pulmonar preservada, 18 (27,7% com DVO, 24 (36,9% com DVO com CVF reduzida, 5 (7,7% com padrão sugestivo de DVR e 10 (15,4% com DVC. O VEF1 foi significativamente menor nos grupos DVO com CVF reduzida e DVC, comparados com os outros grupos (p OBJECTIVE: To evaluate spirometric patterns of respiratory disorders and their relationship with functional severity and maximal expiratory flows at low lung volumes in patients with cystic fibrosis (CF. METHODS: A retrospective cross-sectional study including adolescents and adults with CF. All of the patients were submitted to spirometry. Patients were classified as having preserved respiratory function, obstructive lung disease (OLD, OLD with reduced FVC, presumptive restrictive lung disease (RLD or mixed obstructive and restrictive lung disease (MORLD. Maximal expiratory flows at low lung volumes were assessed using FEF25-75%, FEF75% and FEF75%/FVC. We included 65 normal subjects, also submitted to spirometry, as a control group. RESULTS: The study group included 65 patients: 8 (12.3% with preserved lung

  1. Percepção da gravidade da doença em pacientes adultos com fibrose cística Perception of disease severity in adult patients with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso Roth Dalcin

    2009-01-01

    Full Text Available OBJETIVO: Avaliar a percepção da gravidade da doença em pacientes com fibrose cística (FC, investigando sua relação com escore clínico, escore radiológico, testes de função pulmonar, adesão ao tratamento e percepção de autocuidado. MÉTODOS: Estudo transversal, prospectivo, envolvendo pacientes com FC atendidos em um programa para adultos com FC. A percepção da gravidade da doença, a adesão ao tratamento e o relato de autocuidado foram avaliados por questionários. Foram obtidos de todos os pacientes dados clínicos, escore clínico de Shwachman-Kulczycki, escore radiológico de Brasfield e espirometria. RESULTADOS: De 38 pacientes estudados, 3 (7,9% relataram percepção de sua saúde como muito abaixo da média; 5 (13,2%, como abaixo da média; 15 (39,5%, como na média; 10 (26.3%, como acima da média; e 5 (13,2%, como muito acima da média. A percepção da gravidade da doença correlacionou-se significativamente com o escore clínico (r = 0,43, p = 0,007, CVF (r = 0,34, p = 0,034, VEF1 (r = 0,38, p = 0,019 e com relato de autocuidado (r = 0,33, p = 0,044, mas não com o grau de adesão (r = -0,03, p = 0,842 e escore radiológico (r = 0,33, p = 0,51. CONCLUSÕES: A percepção da gravidade da doença se relacionou com medidas objetivas de gravidade da doença (escore clínico e testes de função pulmonar e com relato de autocuidado, mas não com a adesão ao tratamento.OBJECTIVE: To evaluate the perception of disease severity in patients with cystic fibrosis (CF, investigating its relationship with clinical score, radiographic score, respiratory function tests, adherence to treatment and perception of self-care practices. METHODS: Prospective, cross-sectional study involving CF patients treated in a program for adults with CF. The perception of disease severity, adherence to treatment and reported self-care practices were evaluated by means of questionnaires. Clinical data, Shwachman-Kulczycki clinical score, Brasfield

  2. Applying the Science of Science Communication to Climate Change and Clean Energy: Lessons Learned from the NSF- and PBS-supported "Earth: The Operators' Manual"

    Science.gov (United States)

    Haines-Stiles, G.; Akuginow, E.; Sanford, C.

    2014-12-01

    Yale legal scholar and professor of psychology Dan Kahan has criticized the climate change science community for not applying what's known about effective communications strategies to topics with potentially controversial content. "Earth: The Operators' Manual," funded by NSF's Informal Science Education program and appearing on PBS was hosted by Penn State geoscientist Richard Alley. From the initial proposal forward into airing on public television in 2011 and 2012, ETOM aimed to be authoritative and apolitical while still being engaging to general audiences. Based on social scientific insights from project Advisor, Suzanne Moser, and others, ETOM aimed to avoid "climate porn" scare tactics and over-used footage, and to enlist a diverse group of "messengers" in addition to Alley. An important design criterion was to give equal time to clean energy solutions while pulling no punches as to the consensus findings of leading climate scientists. With the ETOM project now completed and final reports submitted to NSF, what results can be shared to inform future efforts? And how did ETOM compare in audience impact with other major media efforts such as Al Gore's "An Inconvenient Truth" or Showtime's more recent "Years of Living Dangerously"? Results reported draw on the external evaluation by Rockman Et Al, and include both quantitative and qualitative data. Key findings are the importance of including Texan ranchers enthusiastic about wind power alongside Navy Admirals adamant that climate change is human-caused and Marines implementing solar energy to reduce casualties incurred while transporting fossil fuels. In-person presentations by Alley and others at science centers served as de facto focus groups for scripting the TV programs, along with actual focus groups convened by Rockman. The 3rd program, ENERGY QUEST USA, documented 5 quite different communities, from Alaska to Forth Worth, Baltimore, Portland and Kansas, all using competition, local values, and economic

  3. Análise descritiva dos pacientes com fibrose cística em acompanhamento na Unidade de Pneumologia Pediátrica de um hospital universitário em Porto Alegre-RS = Descriptive analysis of cystic fibrosis patients followed by the Pediatric Pulmonology Unit of a university hospital in Porto Alegre-RS

    Directory of Open Access Journals (Sweden)

    Chakr, Valentina Coutinho Baldoto Gava

    2006-01-01

    Full Text Available Objetivos: Descrever o perfil de pacientes acompanhados num centro de tratamento de médio porte, especializado em fibrose cística, e comparar os dados obtidos com os encontrados na literatura atual. Métodos: Foram analisados e correlacionados dados de importância para o seguimento clínico dos pacientes com fibrose cística obtidos no banco de dados de acompanhamento dos mesmos pacientes. Os resultados foram expressos em médias ± desvio padrão (DP ou medianas e amplitude interquartil 25-75%, conforme a distribuição das variáveis. Resultados: Foram estudados 26 pacientes do sexo masculino e 22 do feminino. A idade mediana do diagnóstico foi de 0,98 anos. Dos 48 pacientes, 89,6% apresentam insuficiência pancreática e 29,1% mostraram pelo menos uma cultura positiva para Pseudomonas aeruginosa nos últimos 6 meses. Apresentavam redução dos parâmetros de função pulmonar o grupo com insuficiência pancreática (84 versus 112%; p = 0,005 e os portadores de infecção crônica por P. aeruginosa (75 versus 85%; p = 0,006. Conclusões: Os dados obtidos em nosso estudo mostram que este grupo de pacientes se apresenta de maneira concordante aos dados disponíveis na literatura quanto às características analisadas da doença. Contudo, há uma exceção marcante quanto ao diagnóstico da mesma, ainda muito tardiamente realizado no Brasil

  4. The University of Minnesota Morris - N.S.F. REU Program: Twenty years of encouraging women to participate in the Geological Sciences

    Science.gov (United States)

    Cotter, J. F.

    2009-12-01

    support network that has developed among the UMM-REU alumni. Participants read publications by past UMM-REU researchers, they are encouraged to contact alumni for information and advice, and alumni are invited back to mentor participants, provide insights and interact socially. UMM-REU reunions are held on a regular basis. The UMM-REU network is growing. Ninety-three women from 30 institutions have participated in the UMM-REU program. Participants have published four papers and 75 abstracts. Initial career trajectories are good. Of the 80 UMM-REU alumni that have (to date) received a bachelor degree: 29 went directly into careers in the sciences or teaching and 46 enrolled in graduate (9 have completed Ph.D.s). Over the long term results are also good. Of the 93 UMM-REU participants only 13 are not now pursuing degrees or working in careers in the sciences. Research for this study was funded by a grant from the N.S.F.-R.E.U. Program, including NSF-EAR 9820249 and NSF-EAR 0640575.

  5. Características funcionais pulmonares e uso de broncodilatador em pacientes com fibrose cística Pulmonary function parameters and use of bronchodilators in patients with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Lucia Harumi Muramatu

    2013-02-01

    Full Text Available OBJETIVO: Analisar as características funcionais pulmonares, a resposta farmacodinâmica a um broncodilatador e sua prescrição em pacientes com diagnóstico de fibrose cística (FC. MÉTODOS: Estudo de coorte retrospectivo de pacientes (6-18 anos com diagnóstico de FC acompanhados em um centro de referência, capazes de realizar testes de função pulmonar (TFP entre 2008 e 2010. Foram analisados CVF, VEF1 e FEF25-75%, em percentual do previsto, antes e após prova broncodilatadora (pré-BD e pós-BD, respectivamente de 312 TFP. Foram realizadas ANOVA para medidas repetidas e comparações múltiplas. RESULTADOS: Foram incluídos no estudo 56 pacientes. Desses, 37 e 19, respectivamente, tinham resultados de TFP entre 2008 e 2010 e apenas em 2009-2010, formando dois grupos. No grupo com TFP nos três anos estudados, houve redução significativa em VEF1 pós-BD em 2008-2010 (p = 0,028 e 2009-2010 (p = 0,036 e em FEF25-75% pré-BD e pós-BD em todas as comparações múltiplas (2008 vs. 2009; 2008 vs. 2010; e 2009 vs. 2010. No grupo com TFP apenas em 2009-2010, não houve diferenças significativas em nenhuma das comparações das variáveis estudadas. Dos 312 TFP, somente 24 (7,7% apresentaram resposta significativa ao broncodilatador e pertenciam a pacientes sem prescrição de broncodilatador durante o período estudado. CONCLUSÕES: Houve perda funcional, com indicação de doença pulmonar progressiva, nos pacientes com FC estudados. Houve maiores alterações no FEF25-75%, sugerindo o comprometimento inicial de vias aéreas menores.OBJECTIVE: To analyze pulmonary function parameters and pharmacodynamic response to a bronchodilator, as well as the prescription of bronchodilators, in cystic fibrosis (CF patients. METHODS: This was a retrospective cohort study involving patients 6-18 years of age, diagnosed with CF, and followed at a referral center between 2008 and 2010. We evaluated only those patients who were able to perform pulmonary

  6. What Lies Behind NSF Astronomer Demographics? Subjectivities of Women, Minorities and Foreign-born Astronomers within Meshworks of Big Science Astronomy

    Science.gov (United States)

    Guillen, Reynal; Gu, D.; Holbrook, J.; Murillo, L. F.; Traweek, S.

    2011-01-01

    Our current research focuses on the trajectory of scientists working with large-scale databases in astronomy, following them as they strategically build their careers, digital infrastructures, and make their epistemological commitments. We look specifically at how gender, ethnicity, nationality intersect in the process of subject formation in astronomy, as well as in the process of enrolling partners for the construction of instruments, design and implementation of large-scale databases. Work once figured as merely technical support, such assembling data catalogs, or as graphic design, generating pleasing images for public support, has been repositioned at the core of the field. Some have argued that such databases enable a new kind of scientific inquiry based on data exploration, such as the "fourth paradigm" or "data-driven" science. Our preliminary findings based on oral history interviews and ethnography provide insights into meshworks of women, African-American, "Hispanic," Asian-American and foreign-born astronomers. Our preliminary data suggest African-American men are more successful in sustaining astronomy careers than Chicano and Asian-American men. A distinctive theme in our data is the glocal character of meshworks available to and created by foreign-born women astronomers working at US facilities. Other data show that the proportion of Asian to Asian American and foreign-born Latina/o to Chicana/o astronomers is approximately equal. Futhermore, Asians and Latinas/os are represented in significantly greater numbers than Asian Americans and Chicanas/os. Among professional astronomers in the US, each ethnic minority group is numbered on the order of tens, not hundreds. Project support is provided by the NSF EAGER program to University of California, Los Angeles under award 0956589.

  7. Prevalência da mutação ΔF508 no gene cystic fibrosis transmembrane conductance regulator em pacientes com fibrose cística em um centro de referência no Brasil Prevalence of ΔF508 mutation in the cystic fibrosis transmembrane conductance regulator gene among cystic fibrosis patients from a Brazilian referral center

    Directory of Open Access Journals (Sweden)

    Andréia Marisa Bieger

    2012-12-01

    Full Text Available OBJETIVO: Verificar a presença da mutação ΔF508 no gene cystic fibrosis transmembrane conductance regulator na população de pacientes com fibrose cística, diagnosticados pelo teste de sódio e cloro no suor, em acompanhamento no Ambulatório de Pneumologia Pediátrica da Universidade Estadual de Campinas, centro de referência no tratamento da fibrose cística. MÉTODOS: Foram analisadas 167 amostras de DNA de pacientes com fibrose cística. O genótipo dos pacientes foi determinado pela técnica de reação da polimerase e realizado cálculo para a frequência dos alelos e genótipos da mutação ΔF508. RESULTADOS: A frequência genotípica encontrada foi, respectivamente, para os genótipos -/-, ΔF508/- e ΔF508/ΔF508: 43,7% (73 pacientes, 32,9% (55 pacientes e 23,4% (39 pacientes. Do total de 334 alelos analisados, foi observada a frequência de 201 (60,18% alelos para a ausência da mutação ΔF508 e de 133 (39,82% para a presença da mutação ΔF508. O cálculo do equilíbrio de Hardy-Weinberg foi realizado, e obtivemos o valor de qui-quadrado = 16,34 (p OBJECTIVE: To verify the presence of ΔF508 mutation in the cystic fibrosis transmembrane conductance regulator gene among patients with cystic fibrosis diagnosed by the sweat test for sodium and chlorine and followed at the Pediatric Pneumology Outpatient Clinic of Universidade Estadual de Campinas, Brazil, a referral center for the treatment of cystic fibrosis. METHODS: The study analyzed 167 DNA samples from cystic fibrosis patients. Patients' genotype was determined by polymerase chain reaction, and allele and genotype frequencies of ΔF508 mutation were calculated. RESULTS: The genotype frequencies found for -/-, ΔF508/-, and ΔF508/ΔF508 genotypes were respectively: 43.7% (73 patients, 32.9% (55 patients, and 23.4% (39 patients. Of the 334 alleles analyzed, we observed a frequency of 201 (60.18% alleles for the absence of ΔF508 mutation and of 133 (39.82% for the

  8. Comparisons of cirrus cloud properties between polluted and pristine air based on in-situ observations from the NSF HIPPO, EU INCA and NASA ATTREX campaigns

    Science.gov (United States)

    Diao, M.; Schumann, U.; Jensen, J. B.; Minikin, A.

    2015-12-01

    The radiative forcing of cirrus clouds is influenced by microphysical (e.g., ice crystal number concentration and size distribution) and macroscopic properties. Currently it is still unclear how the formation of cirrus clouds and their microphysical properties are influenced by anthropogenic emissions. In this work, we use airborne in-situ observations to compare cirrus cloud properties between polluted and pristine regions. Our dataset includes: the NSF HIAPER Pole-to-Pole Observations (HIPPO) Global campaign (2009-2011), the EU Interhemispheric Differences In Cirrus Properties from Anthropogenic Emissions (INCA) campaign (2000) and the NASA Airborne Tropical Tropopause Experiment (ATTREX) campaign (2014). The combined dataset include observations of both extratropical (HIPPO and INCA) and tropical (ATTREX) cirrus, over the Northern and Southern Hemispheres. We use the in-situ measured carbon monoxide (CO) mixing ratio as a pollution indicator, and compare ice microphysical properties (i.e., ice crystal number concentration (Nc) and number-weighted mean diameter (Dc)) between air masses with higher and lower CO. All analyses are restricted to T ≤ -40°C. By analyzing ice crystals (Fast-2DC, 87.5-1600 µm) in HIPPO, we found that Dc decreases with increasing CO concentration at multiple constant pressure levels. In addition, analysis of INCA data shows that Nc and extinction of small ice particles (FSSP 3-20 µm) increases with increasing CO. Particles < 87.5 µm in Fast-2DC data are not considered due to uncertainty in sample volume, and the FSSP measurements are subject to possible shattering. We further analyze the ice crystals (SPEC FCDP, 1-50 µm) in the tropical tropopause layer in ATTREX. At -70°C to -90°C, we found that the average Nc (Dc) increases (decreases) at higher CO. Overall, our results suggest that extratropical and tropical cirrus are likely to have more numerous small ice particles, when sampled in the more polluted background. Back

  9. Involving Minority High School Students in Cutting Edge Research through C-DEBI, an NSF-National Science and Technology Center

    Science.gov (United States)

    Singer, E.; Edwards, K. J.

    2012-12-01

    The Center for Dark Energy Biosphere Investigations (C-DEBI) was established as a National Science and Technology Center (NTC) funded by NSF in 2009. Its mission is to explore life beneath the seafloor and make transformative discoveries that advance science, benefit society, and inspire people of all ages and origins. Thanks to the multi-institutional character of C-DEBI, the Center has not only started a collaborative framework for experimental and exploratory research, but also targets education programs at the K-12, undergraduate, graduate and postdoctoral levels involving biogeochemists, microbiologists, geochemists and geologists. An example for this is the introduction of deep biosphere research into the K-12 classroom. In this context, C-DEBI has collaborated with teachers from the Animo Leadership High School in Inglewood, which is ranked 27th within California and has a total minority enrollment of 99%, to adapt Marine Biology classes and introduce latest Deep Biosphere Science discoveries. Three high school students participated in a pilot project over 6 months to gain hands-on experience in an ongoing study in a Marine Microbiology laboratory at University of Southern California. Graduate and postdoctoral students from the Departments of Biological and Earth Sciences supervised theory, praxis and project design, which was aimed at culturing strains of Marinobacter, one of the most ubiquitous marine microbial genera, and preparing extracted DNA for sequencing using the latest Ion Torrent Technology. Students learned about the interdisciplinary global context of the study and gained experience in laboratory procedures, including basic aseptical techniques, molecular biology methods, and cutting-edge sequencing Technology, as well as problem-solving and creative thinking in project preparation and conduction. This hands-on training included discussions about the 'Whys' and 'Hows' in today's research with respect to their specific project, but also from a

  10. NASA's Van Allen Probes RBSP-ECT and NSF's FIREBIRD Data Products and Access to Them: An Insider's Outlook on the Inner and Outer Belts.

    Science.gov (United States)

    Smith, S. S.; Spence, H. E.; Geoffrey, R.; Klumpar, D. M.

    2017-12-01

    In this poster, we present a summary of access to data products Radiation Belt Storm Probes - Energetic Particle Composition, and Thermal plasma (RBSP-ECT) suite of NASA's Van Allen Probes mission. The RBSP-ECT science investigation (http://rbsp-ect.sr.unh.edu) measures comprehensively the near-Earth charged particle environment in order to understand the processes that control the acceleration, global distribution, and variability of radiation belt electrons and ions. RBSP-ECT data products derive from the three instrument elements that comprise the suite, which collectively covers the broad energies that define the source and seed populations, the core radiation belts, and also their highest energy ultra-relativistic extensions. These RBSP-ECT instruments include, from lowest to highest energies: the Helium, Oxygen, Proton, and Electron (HOPE) sensor, the Magnetic Electron and Ion Spectrometer (MagEIS), and the Relativistic Electron and Proton Telescope (REPT). We provide a brief overview of their principles of operation, as well as a description of the Level 1-3 data products that the HOPE, MagEIS, and REPT instruments produce, both separately and together. We provide a summary of how to access these RBSP-ECT data products at our Science Operation Center and Science Data Center (http://www.rbsp-ect.lanl.gov/rbsp_ect.php ) as well as caveats for their use. In addition, we also provide a summary of access to the data products from NSF's CubeSat mission called Focused Investigation of Relativistic Electron Burst: Intensity, Range, and Dynamics (FIREBIRD). The dual CubeSat FIREBIRD missions provide data on energetic radiation belt electrons precipitating into the atmosphere at low altitudes, which complements and is contemporary with RBSP-ECT measurements. We provide a similar summary of how to access these data (https://ssel.montana.edu/firebird2.html). Finally, in the spirit of efficiently and effectively promoting and encouraging new collaborations, we present a

  11. Exercício aeróbico, treinamento de força muscular e testes de aptidão física para adolescentes com fibrose cística: revisão da literatura Exercise testing, aerobic and strength training for adolescents with cystic fibrosis: a literature review

    Directory of Open Access Journals (Sweden)

    Celia Regina Moutinho de Miranda Chaves

    2007-09-01

    Full Text Available São reconhecidos os benefícios da prática do exercício físico regular para pacientes com fibrose cística. Entretanto, poucos estudos envolvem pacientes adolescentes. O objetivo deste artigo foi revisar os efeitos da prática regular de exercícios aeróbicos e de força e resistência muscular para adolescentes com fibrose cística. Os principais testes de aptidão física para esta faixa etária e a importância deles para melhora do prognóstico e tratamento da doença também foram avaliados. As informações foram coletadas a partir de livro-texto e artigos publicados na literatura nacional e estrangeira nas seguintes bases de dados: LILACS, MEDLINE/PubMed, Biblioteca Cochrane e SciELO, abrangendo o período de 1994 a 2004. Foram utilizados os termos "exercise" e "cystic fibrosis" para seleção dos artigos. Esta pesquisa demonstrou que a prática de exercício aeróbico e treinamento de força muscular melhoram a desobstrução da árvore brônquica, diminuem a queda progressiva da função pulmonar, aumentam a massa muscular e a resistência ao exercício, promovem o desenvolvimento ósseo e melhoram a auto-estima e a qualidade de vida. Os melhores resultados foram obtidos com os programas de treinamento assistido, devido a sua maior regularidade.The benefits of regular physical exercises for cystic fibrosis patients are well known. Nevertheless, few studies involve adolescent patients. The objective of this article was to review the effects of regular practice of aerobic exercises, strength exercises and muscular exercises in adolescents with cystic fibrosis. The main physical fitness tests for this age bracket and their value in improving prognosis and treatment were assessed as well. Information was collected from text books and articles published in the national and foreign literature in the following databases: LILACS, MEDLINE/PubMed, Cochrane Library and SciELO, comprising the period of 1994 to 2004. The terms "exercise" and

  12. Nephrogenic systemic fibrosis: risk factors suggested from Japanese published cases

    DEFF Research Database (Denmark)

    Tsushima, Y; Kanal, E; Thomsen, H S

    2010-01-01

    The aim of this article is to review the published cases of nephrogenic systemic fibrosis (NSF) in Japan. The Japanese medical literature database and MedLine were searched using the keywords NSF and nephrogenic fibrosing dermopathy (January 2000 to March 2009). Reports in peer-reviewed journals ...

  13. Are we there yet? An NSF-CAREER sponsored field program as a vehicle for engaging high school students in geology

    Science.gov (United States)

    Frank, T. D.

    2011-12-01

    Many students graduate from high school having never been exposed to the geosciences. The idea of a career in the geosciences is therefore often not on the radar when students embark on university studies. History on the Rocks, a field-based summer program developed as part of a NSF-CAREER grant and offered annually since 2008, is designed to expose high school students to geology through hands-on experiences. The program focuses on interpreting the sedimentary rock record, the major archive of Earth history. Following a day of introductory exercises in the lab, participants travel to world-class geologic sites around Nebraska and collect evidence that allows them to interpret environment and climate at the time of deposition. They use their data to consider how climate change, sea level, and catastrophic events leave their imprints on the rock record and to reconstruct Nebraska's geologic history. In 2008, 12 high school science teachers from districts across Nebraska, incuding the Santee Nation district, enrolled in the program. Teachers developed a set of lesson plans related to their field experience. They posted the plans online and now routinely use them in their home schools, thereby exposing their students to geology. Subsequent programs have been held for groups of high school students drawn from rural and urban regions throughout the state. Working with students raised some unforeseen issues related to accident liability and parental concern about students working in remote areas. These problems were solved by offering the program through existing, well-known entities, including Girls Inc., a nonprofit organization that empowers girls from low-income families in urban settings (i.e., Omaha), and the 4H Youth Development Extension Office at the University of Nebraska-Lincoln (UNL). Both groups are eager to provide students with the opportunity to visit a university and explore careers. Convincing inner-city students, who generally came to the program with

  14. Validação do escore ultra-sonográfico de Williams para o diagnóstico da hepatopatia da fibrose cística Validation of the Williams ultrasound scoring system for the diagnosis of liver disease in cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Eleonora D. T. Fagundes

    2004-01-01

    Full Text Available OBJETIVOS: Descrever as alterações hepáticas observadas ao exame ultra-sonográfico de fibrocísticos do Ambulatório de Fibrose Cística do Hospital das Clínicas da UFMG, comparar os achados ultra-sonográficos com critérios clínicos e bioquímicos e validar o escore de Williams para o diagnóstico de hepatopatia associada à fibrose cística. MÉTODOS: Setenta fibrocísticos foram acompanhados prospectivamente e submetidos a exame clínico, bioquímico e ultra-sonográfico. Os achados ultra-sonográficos foram comparados com os resultados do exame clínico e bioquímico. Para a validação do escore ultra-sonográfico de Williams, os critérios clínicos e bioquímicos foram utilizados como padrão-ouro. Foram calculados sensibilidade, especificidade, valor preditivo positivo e valor preditivo negativo do escore de Williams. Para os cálculos, os pacientes foram divididos em dois grupos: normal ao exame ultra-sonográfico (escore = 3 ou alterado (escore > 3. RESULTADOS: Dez pacientes preencheram os critérios clínicos e/ou bioquímicos para hepatopatia (14,3%. Todos os pacientes hepatopatas segundo os critérios clínicos e/ou bioquímicos apresentavam alguma alteração ao exame ultra-sonográfico. As alterações do parênquima hepático, borda hepática e fibrose periportal foram encontradas mais freqüentemente entre os hepatopatas, com diferença estatisticamente significativa. O escore de Williams apresentou alta especificidade (91,7%; IC 80,9-96,9, mas baixa sensibilidade (s = 50%; IC 20,1-79,9 para o diagnóstico da hepatopatia. CONCLUSÕES: O escore de Williams não constituiu um bom exame de triagem quando comparado ao exame clínico e bioquímico. Uma vez que ainda não há nenhum teste que, utilizado isoladamente, apresente sensibilidade adequada, é recomendável a utilização conjunta dos exames clínico, bioquímico e ultra-sonográfico no diagnóstico da hepatopatia associada à fibrose cística, sempre em avalia

  15. Fibrose miocárdica em pacientes com cardiomiopatia hipertrófica com alto risco para morte súbita cardíaca Fibrosis miocárdica en pacientes con cardiomiopatía hipertrófica con alto riesgo para muerte súbita cardíaca Myocardial fibrosis in patients with hypertrophic cardiomyopathy and high risk for sudden death

    Directory of Open Access Journals (Sweden)

    Afonso Akio Shiozaki

    2010-04-01

    Full Text Available FUNDAMENTO: A estratificação de risco para morte súbita na cardiomiopatia hipertrófica (CMH, continua a ser um verdadeiro desafio devido à grande heterogeneidade da sua apresentação, em que a maioria dos indivíduos permanecem assintomáticos por toda sua vida e outros apresentam a morte súbita como primeiro sintoma. Recentes trabalhos vêm sugerindo que a fibrose miocárdica pode constituir-se em um importante substrato para as arritmias ventriculares malignas, responsáveis pela morte súbita nesta doença. OBJETIVO: Avaliação da prevalência e quantificação da fibrose miocárdica (FM, em pacientes com CMH com alto risco ou recuperados de morte súbita, portadores de cardiodesfibrilador implantável (CDI. MÉTODOS: Vinte e oito pacientes com CMH portadores de CDI foram submetidos à tomografia computadorizada com múltiplos detectores, para realização da técnica de realce tardio, e avaliação da fibrose miocárdica. RESULTADOS: 96% dos pacientes apresentavam fibrose miocárdica (20,38 ± 15,55 gramas correspondendo a 15,96 ± 10,20% da massa miocárdica total. A FM foi significativamente mais prevalente que os demais fatores de risco clássicos para morte súbita. CONCLUSÃO: Concluímos que existe uma alta prevalência de fibrose miocárdica em pacientes com cardiomiopatia hipertrófica de alto risco ou recuperados de morte súbita, como neste grupo - portadores de cardiodesfibrilador implantável. A maior prevalência da fibrose miocárdica comparada aos fatores de risco de pior prognóstico levantam a hipótese de que a fibrose miocárdica possa ser um importante substrato potencialmente necessário na gênese das arritmias desencadeadoras da morte súbita.FUNDAMENTO: La estratificación de riesgo para muerte súbita en la cardiomiopatía hipertrófica (CMH, sigue siendo un verdadero reto debido a la gran heterogeneidad de su presentación, cuya mayoría de los individuos permanecen asintomáticos por toda su vida y otros

  16. Evidence against roles for phorbol binding protein Munc13-1, ADAM adaptor Eve-1, or vesicle trafficking phosphoproteins Munc18 or NSF as phospho-state-sensitive modulators of phorbol/PKC-activated Alzheimer APP ectodomain shedding

    Directory of Open Access Journals (Sweden)

    Lovestone Simon

    2007-12-01

    Full Text Available Abstract Background Shedding of the Alzheimer amyloid precursor protein (APP ectodomain can be accelerated by phorbol esters, compounds that act via protein kinase C (PKC or through unconventional phorbol-binding proteins such as Munc13-1. We have previously demonstrated that application of phorbol esters or purified PKC potentiates budding of APP-bearing secretory vesicles at the trans-Golgi network (TGN and toward the plasma membrane where APP becomes a substrate for enzymes responsible for shedding, known collectively as α-secretase(s. However, molecular identification of the presumptive "phospho-state-sensitive modulators of ectodomain shedding" (PMES responsible for regulated shedding has been challenging. Here, we examined the effects on APP ectodomain shedding of four phorbol-sensitive proteins involved in regulation of vesicular membrane trafficking of APP: Munc13-1, Munc18, NSF, and Eve-1. Results Overexpression of either phorbol-sensitive wildtype Munc13-1 or phorbol-insensitive Munc13-1 H567K resulted in increased basal APP ectodomain shedding. However, in contrast to the report of Roßner et al (2004, phorbol ester-dependent APP ectodomain shedding from cells overexpressing APP and Munc13-1 wildtype was indistinguishable from that observed following application of phorbol to cells overexpressing APP and Munc13-1 H567K mutant. This pattern of similar effects on basal and stimulated APP shedding was also observed for Munc18 and NSF. Eve-1, an ADAM adaptor protein reported to be essential for PKC-regulated shedding of pro-EGF, was found to play no obvious role in regulated shedding of sAPPα. Conclusion Our results indicate that, in the HEK293 system, Munc13-1, Munc18, NSF, and EVE-1 fail to meet essential criteria for identity as PMES for APP.

  17. Evidence against roles for phorbol binding protein Munc13-1, ADAM adaptor Eve-1, or vesicle trafficking phosphoproteins Munc18 or NSF as phospho-state-sensitive modulators of phorbol/PKC-activated Alzheimer APP ectodomain shedding.

    Science.gov (United States)

    Ikin, Annat F; Causevic, Mirsada; Pedrini, Steve; Benson, Lyndsey S; Buxbaum, Joseph D; Suzuki, Toshiharu; Lovestone, Simon; Higashiyama, Shigeki; Mustelin, Tomas; Burgoyne, Robert D; Gandy, Sam

    2007-12-09

    Shedding of the Alzheimer amyloid precursor protein (APP) ectodomain can be accelerated by phorbol esters, compounds that act via protein kinase C (PKC) or through unconventional phorbol-binding proteins such as Munc13-1. We have previously demonstrated that application of phorbol esters or purified PKC potentiates budding of APP-bearing secretory vesicles at the trans-Golgi network (TGN) and toward the plasma membrane where APP becomes a substrate for enzymes responsible for shedding, known collectively as alpha-secretase(s). However, molecular identification of the presumptive "phospho-state-sensitive modulators of ectodomain shedding" (PMES) responsible for regulated shedding has been challenging. Here, we examined the effects on APP ectodomain shedding of four phorbol-sensitive proteins involved in regulation of vesicular membrane trafficking of APP: Munc13-1, Munc18, NSF, and Eve-1. Overexpression of either phorbol-sensitive wildtype Munc13-1 or phorbol-insensitive Munc13-1 H567K resulted in increased basal APP ectodomain shedding. However, in contrast to the report of Rossner et al (2004), phorbol ester-dependent APP ectodomain shedding from cells overexpressing APP and Munc13-1 wildtype was indistinguishable from that observed following application of phorbol to cells overexpressing APP and Munc13-1 H567K mutant. This pattern of similar effects on basal and stimulated APP shedding was also observed for Munc18 and NSF. Eve-1, an ADAM adaptor protein reported to be essential for PKC-regulated shedding of pro-EGF, was found to play no obvious role in regulated shedding of sAPPalpha. Our results indicate that, in the HEK293 system, Munc13-1, Munc18, NSF, and EVE-1 fail to meet essential criteria for identity as PMES for APP.

  18. O que é ser mãe de uma criança com fibrose cística Qué significa ser madre de un niño con fibrosis quística What is being a mother of a child with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Keila Okuda Tavares

    2010-12-01

    Full Text Available Conhecer o que é ser mãe de uma criança que apresenta fibrose cística é fundamental para o cuidado desses indivíduos, pois geralmente ela divide as responsabilidades relacionadas ao tratamento com o filho que apresenta essa doença grave e sem cura. Nesse sentido, este estudo teve como objetivo conhecer a vivência de ser mãe de uma criança com fibrose cística. Trata-se de um estudo descritivo-exploratório, qualitativo, de caráter fenomenológico. Foram entrevistadas 14 mulheres e a coleta de dados foi realizada por meio de uma entrevista semiestruturada. A análise das falas transcritas na íntegra seguiu direcionamentos propostos pela fenomenologia. Essa é uma experiência que a tristeza, angústia, dúvidas, sofrimento e medo estão presentes, levando essas mulheres a refletirem sobre suas vidas e a de seus filhos, promovendo mudanças em seu mundo vida e uma reorganização de toda a família.Conocer o que es ser madre de un niño con fibrosis quística es esencial para el cuidado de estas personas, porque generalmente ella divide las responsabilidades relacionadas con el tratamiento, con el niño que tiene esta enfermedad grave y sin cura. Este estudio tuvo como objetivo conocer la vivencia de ser madre de un niño con fibrosis quística. Se trata de un estudio descriptivo-exploratorio, cualitativo, fenomenológico. Fueron entrevistadas 14 mujeres y la colecta de datos se realizó por medio de una entrevista semiestructurada. El análisis de las elocuciónes transcriptas en la íntegra siguió direcciones propuestas por la fenomenologia. Esta es una experiencia donde la tristeza, angustia, dudas, sufrimiento y el temor están presentes, haciendo que esas mujeres reflexionen a respecto de sus vidas y la de sus hijos, promoviendo cambios en su mundo vida y una reorganización de toda familia.Knowing what is being a mother of a child with cystic fibrosis is essential to the care of these individuals, because she usually divides the

  19. Análise descritiva dos pacientes com fibrose cística em acompanhamento na Unidade de Pneumologia Pediátrica de um hospital universitário em Porto Alegre-RS =Descriptive analysis of cystic fibrosis patients followed by the Pediatric Pulmonology Unit of a university hospital in Porto Alegre-RS

    Directory of Open Access Journals (Sweden)

    Chakr, Valentina Coutinho Baldoto Gava et al.

    2006-01-01

    Full Text Available Objetivos: Descrever o perfil de pacientes acompanhados num centro de tratamento de médio porte, especializado em fibrose cística, e comparar os dados obtidos com os encontrados na literatura atual. Métodos: Foram analisados e correlacionados dados de importância para o seguimento clínico dos pacientes com fibrose cística obtidos no banco de dados de acompanhamento dos mesmos pacientes. Os resultados foram expressos em médias ± desvio padrão (DP ou medianas e amplitude interquartil 25-75%, conforme a distribuição das variáveis. Resultados: Foram estudados 26 pacientes do sexo masculino e 22 do feminino. A idade mediana do diagnóstico foi de 0,98 anos. Dos 48 pacientes, 89,6% apresentam insuficiência pancreática e 29,1% mostraram pelo menos uma cultura positiva para Pseudomonas aeruginosa nos últimos 6 meses. Apresentavam redução dos parâmetros de função pulmonar o grupo com insuficiência pancreática (84 versus 112%; p = 0,005 e os portadores de infecção crônica por P. aeruginosa (75 versus 85%; p = 0,006. Conclusões: Os dados obtidos em nosso estudo mostram que este grupo de pacientes se apresenta de maneira concordante aos dados disponíveis na literatura quanto às características analisadas da doença. Contudo, há uma exceção marcante quanto ao diagnóstico da mesma, ainda muito tardiamente realizado no Brasil. Aims: To provide a descriptive analysis of patients followed in a local cystic fibrosis treatment center and compare the collected data with those found in the literature. Methods: Relevant data for clinical follow-up of cystic fibrosis patients were used for analysis and correlation. Results: Twenty six male and twenty two female patients were studied. From 48 patients, 89,6% presented with pancreatic insufficiency and 29,1% had at least one positive culture to Pseudomonas aeruginosa in the last 6 months. The patients colonized by P. aeruginosa and the ones with pancreatic insufficiency presented with

  20. A hospitalização e o adoecimento pela perspectiva de crianças e jovens portadores de fibrose cística e osteogênese imperfeita The hospitalization and the process of becoming ill through the children's and adolescents' perspective with cystic fibrosis and osteogenesis imperfecta

    Directory of Open Access Journals (Sweden)

    Daniele Borges de Mello

    2010-03-01

    Full Text Available O presente artigo visa discutir os resultados de uma pesquisa realizada em um hospital localizado no município do Rio de Janeiro, considerado referência em saúde da criança, do adolescente e da mulher. Analisamos os significados da hospitalização e do adoecimento crônico na infância e adolescência pela perspectiva de crianças e adolescentes com fibrose cística e osteogênese imperfeita durante suas internações hospitalares com vistas a explorar suas vivências e suas possibilidades de expressão enquanto sujeitos de conhecimento. Para tanto, privilegiamos a observação e a construção de suas produções mediadas pelo suporte lúdico, utilizando o desenho e/ou história como relevantes vias de acesso aos conteúdos infanto-juvenis. Os dados advindos desse estudo apontam para a capacidade de aquisição e produção de conhecimento que crianças e jovens possuem acerca de sua situação de adoecimento.The present article intends to discuss the results of a study completed in a hospital located in the municipal district of Rio de Janeiro, considered most prominent for child, adolescent and woman's health. We analyzed the meanings of hospitalization and chronic illness in childhood and adolescence through the perspective of children and adolescents with cystic fibrosis and osteogenesis imperfecta during their hospitalizations in order to explore their experience and communicative possibilities as knowledgeable informants. Hence, we privileged the observation and the construction of their productions through games, using drawings and/or story-telling as a relevant approach to childhood and adolescence contents. The data collected signify the acquisition and knowledge production capacity of children and adolescents concerning their illness processes.

  1. Programa de triagem neonatal para fibrose cística no estado do Paraná: avaliação após 30 meses de sua implantação Neonatal cystic fibrosis screening program in the state of Paraná: evaluation 30 months after implementation

    Directory of Open Access Journals (Sweden)

    Grégor P. Chermikoski Santos

    2005-06-01

    Full Text Available OBJETIVOS: Apresentar e analisar os resultados da implantação do Programa Nacional de Triagem Neonatal em Fibrose Cística, no Paraná, após 30 meses do seu início. MÉTODOS: Foi realizado um estudo descritivo com análise dos dados da triagem feita em aproximadamente 98% dos recém-nascidos entre setembro de 2001 e abril de 2004 no laboratório do Serviço de Triagem Neonatal da Fundação Ecumênica de Proteção ao Excepcional do Paraná. As amostras de sangue para o "teste do pezinho" foram coletadas na alta hospitalar, idealmente entre o segundo e sexto dias de vida, com o envio dos papéis-filtro para a dosagem de tripsina imunorreativa por imunofluorimetria. Crianças com valores da dosagem de tripsina imunorreativa > 70 ng/ml em duas amostras distintas, nos primeiros 30 dias de vida, foram submetidas à determinação da condutividade do suor pelo método de Wescor. Com o resultado maior que 50 mMol/l procedeu-se à dosagem quantitativa de cloro e/ou sódio no suor (iontoforese por pilocarpina. RESULTADOS: De 456.982 exames realizados, 4.028 (0,9% crianças apresentaram a primeira dosagem de tripsina imunorreativa acima do ponto de corte estabelecido. Dessas, 478 (12,5% tiveram uma segunda amostra de sangue com dosagem de tripsina imunorreativa acima de 70 ng/ml, das quais, após a realização do teste de suor por condutividade, 56 (11,7% crianças foram encaminhadas para ambulatórios especializados com resultado acima de 50 mMol/l e 48 (0,01% do total de triagens tiveram o diagnóstico de fibrose cística confirmado. A incidência foi de 1:9.520 em nosso estado, embora algumas crianças ainda não tenham completado a investigação. CONCLUSÕES: A triagem neonatal para fibrose cística no estado do Paraná, de acordo com as normas do Ministério da Saúde, foi uma iniciativa pioneira no Brasil. Realizou-se o diagnóstico precocemente em muitos pacientes, mesmo os assintomáticos, fato que representa um desafio à melhora no progn

  2. Socialization of children and adolescents with cystic fibrosis: support for nursing care El proceso de socialización de niños y adolescentes con fibrosis quística: apoyo para la atención de enfermería O processo de socialização de crianças e adolescentes com fibrose cística: subsídios para o cuidado de enfermagem

    Directory of Open Access Journals (Sweden)

    Tainá Maués Pelúcio Pizzignacco

    2006-08-01

    salud conozcan esas demandas y las incorporen al plan de cuidados, con vistas a intervenciones efectivas que promuevan el crecimiento y desarrollo infanto-juvenil.O presente estudo tem por objetivo conhecer o dia-a-dia (escola, trabalho, atividades de lazer e interações com a família e amigos da criança e do adolescente com Fibrose Cística (FC, a partir de suas próprias vivências, bem como identificar situações que possam interferir nesse cotidiano. Os sujeitos da pesquisa são crianças e adolescentes portadores de Fibrose Cística em acompanhamento num hospital-escola do interior do estado de São Paulo. Trata-se de pesquisa com abordagem qualitativa, com coleta de dados empíricos realizada mediante análise de prontuários e entrevista aberta. Dos dados, emergiram os seguintes temas: conhecimento equivocado sobre a doença; preocupação com a auto-imagem; busca pelo autocuidado e esperança de melhorias no futuro. Os resultados evidenciam as repercussões da Fibrose Cística no processo de socialização desses pacientes, salientando a importância dos profissionais de saúde conhecerem essas demandas e incorporarem-nas ao plano de cuidados, visando a intervenções efetivas que promovam o crescimento e o desenvolvimento infanto-juvenil.

  3. Análise semiquantitativa de biópsias cirúrgicas de diferentes lobos pulmonares de pacientes com pneumonia intersticial usual/fibrose pulmonar idiopática Semiquantitative analysis of surgical biopsies of distinct lung lobes of patients with usual interstitial pneumonia/idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    José Júlio Saraiva Gonçalves

    2009-07-01

    Full Text Available OBJETIVO: Avaliar as diferenças histológicas da pneumonia intersticial usual entre biópsias cirúrgicas de lobos pulmonares distintos, utilizando um escore semiquantitativo. MÉTODOS: Foram selecionados todos os pacientes com o diagnóstico de fibrose pulmonar idiopática e submetidos à biópsia cirúrgica em dois lobos distintos no Hospital São Paulo e em hospitais afiliados da Universidade Federal de São Paulo, no período entre 1995 e 2005. Foi utilizado um método semiquantitativo na avaliação histológica dos espécimes, com base em estudos prévios, aplicando-se um escore para cada local submetido à biópsia. RESULTADOS: Nenhuma diferença estatisticamente significante foi encontrada nesta amostra de pacientes que viesse alterar o estágio da doença, com base no escore utilizado. Este achado foi independente do local da biópsia (lobo médio ou segmento lingular. CONCLUSÕES: Não foram observadas diferenças histológicas significantes entre os lobos pulmonares estudados. O diagnóstico histológico definitivo de pneumonia intersticial usual não alterou o estágio da doença.OBJECTIVE: To evaluate the differences between surgical biopsies of distinct lung lobes in terms of the histopathological features of usual interstitial pneumonia, using a semiquantitative score. METHODS: We selected all of the patients diagnosed with idiopathic pulmonary fibrosis and submitted to surgical biopsy in two distinct lobes between 1995 and 2005 at the Hospital São Paulo and other hospitals operated by the Federal University of São Paulo. In the histological evaluation of the specimens, we used a semiquantitative method based on previous studies, assigning a score to each of the biopsied sites. RESULTS: In this sample of patients, we found no statistically significant differences that would alter the stage of the disease, based on the score used. This finding was independent of the biopsy site (middle lobe or lingular segment. CONCLUSIONS: No

  4. A moderate response to plasmapheresis in nephrogenic systemic fibrosis

    Directory of Open Access Journals (Sweden)

    Pelin Ustuner

    2011-11-01

    Full Text Available Nephrogenic systemic fibrosis (NSF is a recently identified idiopathic cutaneous fibrosing disorder that occurs in the setting of renal failure. The disease initially called nephrogenic fibrosing dermopathy is closely linked to exposure to gadolinium-based contrast media used during magnetic resonance imaging in patients with renal insufficiency. Although little is known about the pathogenesis of this disease, the increased expression of transforming growth factor-beta has been demonstrated recently. Herein, we present a case of NSF was partially treated due to a moderate and temporary response to plasmapheresis with no recurrence for 6 months, but returned at the end of 6th month.

  5. The Tri-Agency Climate Education (TrACE) Catalog: Promoting collaboration, effective practice, and a robust portfolio by sharing educational resources developed across NASA, NOAA & NSF climate education initiatives

    Science.gov (United States)

    McDougall, C.; Martin, A.; Givens, S. M.; Yue, S.; Wilson, C. E.; Karsten, J. L.

    2012-12-01

    The Tri-Agency Climate Education (TrACE) Catalog is an online, interactive, searchable and browsable web product driven by a database backend. TrACE was developed for and by the community of educators, scientists, and Federal agency representatives involved in a tri-agency collaboration for climate education. NASA, NOAA, and NSF are working together to strategically coordinate and support a portfolio of projects focused on climate literacy and education in formal and informal learning environments. The activities of the tri-agency collaboration, including annual meetings for principal investigators and the ongoing development of a nascent common evaluation framework, have created a strong national network for effectively engaging diverse audiences with the principles of climate literacy (see Eos Vol. 92, No. 24, 14 June 2011). TrACE is a tool for the climate education community that promotes the goals of the tri-agency collaboration to leverage existing resources, minimize duplicate efforts, and facilitate communication among this emergent community of scientists and educators. TrACE was born as "The Matrix," a product of the 2011 Second Annual NASA, NOAA and NSF Climate Change Education Principal Investigators Meeting (see McDougall, Wilson, Martin & Knippenberg, 2011, Abstract ED21B-0583 presented at 2011 Fall Meeting, AGU, San Francisco, CA.) Meeting attendees were asked to populate a pen-and-paper matrix with all of the activities or deliverables they had created or anticipated creating as part of their NOAA/NASA/NSF-funded project. During the 2012 Third Annual Tri-Agency PI Meeting, projects were given the opportunity to add and update their products and deliverables. In the intervening year, the dataset comprising the Matrix was converted to a MySQL database, with a standardized taxonomy and minimum criteria for inclusion, and further developed into the interactive TrACE Catalog. In the fall of 2012, the TrACE Catalog web product will be made publicly

  6. 12 December 2012 - US NSF Physics Division Acting Director D. Caldwell signing the guest book with Adviser for the US R. Voss and Head of International Relations F. Pauss; CMS Collaboration Spokesperson J. Incandela and ATLAS Deputy Spokesperson A. Lankford present.

    CERN Multimedia

    Samuel Morier-Genoud

    2012-01-01

    12 December 2012 - US NSF Physics Division Acting Director D. Caldwell signing the guest book with Adviser for the US R. Voss and Head of International Relations F. Pauss; CMS Collaboration Spokesperson J. Incandela and ATLAS Deputy Spokesperson A. Lankford present.

  7. The vitamin E reduces liver lipoperoxidation and fibrosis in a model of nonalcoholic steatohepatitis A vitamina E reduz a lipoperoxidação hepática e a fibrose em modelo experimental de esteatohepatite não-alcoólica

    Directory of Open Access Journals (Sweden)

    Idilio Zamin Jr

    2010-03-01

    colina, bem como avaliar o papel do metformina, da vitamina E e da sinvastatina na evolução da esteatohepatite não-alcoólica. MÉTODOS: Foram estudados prospectivamente 50 ratos da linhagem Wistar, por um período de 90 dias, sendo os mesmos divididos em cinco grupos de 10 ratos. Um grupo recebeu ração convencional e os demais a dieta deficiente em metionina e colina. Dentre os quatro grupos que receberam a dieta, para um foi administrado soro fisiológico e para os demais o metformina, a vitamina E e a sinvastatina. Após o período de estudo os animais foram mortos, sendo colhido sangue para análise bioquímica e removido o fígado para análise da lipoperoxidação através do teste de substâncias reativas ao ácido tiobarbitúrico e para a realização dos exames histológicos. RESULTADOS: A dieta deficiente em metionina e colina foi capaz de induzir esteatose em 100% dos animais enquanto que esteatohepatite não-alcoólica foi diagnosticada em 27 (69,2%. Os níveis da ALT foram significativamente maiores no grupo da sinvastatina. Os níveis de AST também foram maiores no grupo da sinvastatina, mas apenas foram estatisticamente significantes em relação ao grupo da ração. Quando se compararam os valores de lipoperoxidação, os grupos da ração convencional e da vitamina E apresentaram índices significativamente menores que os demais. A presença de fibrose foi significativamente menor no grupo que recebeu a vitamina E. CONCLUSÕES: A dieta utilizada foi capaz de induzir esteatose e esteatohepatite não-alcoólica, sendo que a vitamina E demonstrou reduzir o estresse oxidativo hepático, bem como o desenvolvimento de fibrose

  8. Diagnóstico de ABPA em pacientes portadores de fibrose cística: utilidade clínica da pesquisa de IgE específica contra alérgenos recombinantes do Aspergillus fumigatus ABPA diagnosis in cystic fibrosis patients: the clinical utility of IgE specific to recombinant Aspergillus fumigatus allergens

    Directory of Open Access Journals (Sweden)

    Marina B. Almeida

    2006-06-01

    Full Text Available OBJETIVO: A aspergilose broncopulmonar alérgica (ABPA é um fator complicador da fibrose cística que pode determinar uma combinação devastadora na evolução da doença pulmonar. A sobreposição de sinais e sintomas das duas enfermidades dificulta o diagnóstico, mesmo aplicando critérios padronizados. O objetivo deste trabalho foi identificar, em grupo de portadores de fibrose cística, os casos de ABPA através da detecção de IgE específica contra os alérgenos recombinantes do Aspergillus fumigatus e confrontar esse método com os critérios preconizados pela Cystic Fibrosis Foundation. MÉTODOS: Cinqüenta e quatro pacientes de 2 a 20 anos, com características que poderiam estar isoladamente presentes na ABPA, foram avaliados sistematicamente, incluindo: dados clínicos, tomografia computadorizada de tórax, teste cutâneo de hipersensibilidade imediata para A. fumigatus; dosagem de IgE sérica total, RAST para A. fumigatus, e IgE sérica específica para alérgenos recombinantes r Asp f1, f2, f3, f4 e f6. RESULTADOS: Foram elegíveis para o estudo 39 pacientes. Destes, 32 foram investigados. Houve sensibilização ao A. fumigatus em 34%. Ambos os métodos, o critério da Cystic Fibrosis Foundation e a pesquisa de IgE específica contra antígenos recombinantes, determinaram três casos de ABPA; entretanto, o diagnóstico foi concordante em apenas dois pacientes. CONCLUSÃO: A detecção de IgE específica contra antígenos recombinantes do A. fumigatus foi ferramenta útil para detecção precoce da sensibilização e diagnóstico de ABPA. No entanto, a confirmação diagnóstica não pôde ser desvinculada da condição clínica, e sua utilização para diagnóstico, detecção de recidivas e critério de cura ainda requer estudos longitudinais, envolvendo maior número de pacientes.OBJECTIVE: Allergic bronchopulmonary aspergillosis (ABPA is a complicating factor of cystic fibrosis which can result in a devastating combination as

  9. Noninvasiv vurdering af fibrose ved kronisk viral hepatitis

    DEFF Research Database (Denmark)

    Risum, Malene; Barfod, Toke Seierøe; Lindhardt, Bjarne Orskov

    2013-01-01

    In chronic viral hepatitis the liver biopsy helps the clinician to decide when to start treatment and plan follow-up. However, the execution of a liver biopsy is associated with discomfort, and sampling error can lead to misinterpretation. Serum markers and transient elastography (TE) are being...

  10. Rekombinant humant deoxyribonuklease til andet end cystisk fibrose

    DEFF Research Database (Denmark)

    Kristensen, Kim

    2010-01-01

    be associated with increased need for supplemental oxygen. In adults with idiopathic bronchiectasis, treatment with rhDNase leads to more pulmonary exacerbations and a greater decline in pulmonary function tests. There are no controlled studies on rhDNase in primary ciliary dyskinesia or atelectasis.......Recombinant human DNase (rhDNase) reduces viscosity of sputum. Effect has been documented in cystic fibrosis and postoperatively in paediatric heart disease. Single dose treatment with rhDNase in paediatric asthma has no effect. In respiratory syncytial virus infection, treatment with rhDNase may...

  11. Rekombinant humant deoxyribonuklease til andet end cystisk fibrose

    DEFF Research Database (Denmark)

    Kristensen, Kim

    2010-01-01

    be associated with increased need for supplemental oxygen. In adults with idiopathic bronchiectasis, treatment with rhDNase leads to more pulmonary exacerbations and a greater decline in pulmonary function tests. There are no controlled studies on rhDNase in primary ciliary dyskinesia or atelectasis....

  12. NIH/NSF accelerate biomedical research innovations

    Science.gov (United States)

    A collaboration between the National Science Foundation and the National Institutes of Health will give NIH-funded researchers training to help them evaluate their scientific discoveries for commercial potential, with the aim of accelerating biomedical in

  13. NSF tandem stack support structure deflection characteristics

    International Nuclear Information System (INIS)

    Cook, J.

    1979-12-01

    Results are reported of load tests carried out on the glass legs of the insulating stack of the 30 MV tandem Van de Graaff accelerator now under construction at Daresbury Laboratory. The tests to investigate the vulnerability of the legs when subjected to tensile stresses were designed to; establish the angle of rotation of the pads from which the stresses in the glass legs may be calculated, proof-test the structure and at the same time reveal any asymmetry in pad rotations or deflections, and to confirm the validity of the computer design analysis. (UK)

  14. The pressure vessel for the NSF tandem

    International Nuclear Information System (INIS)

    Jones, C.W.

    1979-04-01

    The pressure vessel is a major component of the 30 MV tandem Van de Graaff electrostatic accelerator to be used in nuclear structure research at Daresbury Laboratory. The accelerator will be capable of accelerating the full range of ions in the form of a beam. Acceleration takes place in a vertical evacuated tube (beam tube) by means of a high potential on a terminal at the central position, the terminal and beam tube assembly being supported by an insulated stack structure within the pressure vessel. Under operating conditions the vessel is filled with sulphur hexafluoride gas (SF 6 ) at high pressure which acts as an insulating medium between the centre terminal and the vessel wall. The vessel is situated inside a concrete tower which besides supporting the injector room above the vessel also acts as radiation shielding around the accelerator. The report covers: functional requirements; fundamental considerations with regard to the design and procurement; detail design; materials; manufacture; acceptance test; surface treatment; final leak test. (U.K.)

  15. NSF-RANN trace contaminants abstracts

    International Nuclear Information System (INIS)

    Copenhaver, E.D.; Harnden, D.S.

    1976-10-01

    Specific areas of interest of the Environmental Aspects of Trace Contaminants Program are organic chemicals of commerce, metals and organometallic compounds, air-borne contaminants, and environmental assay methodology. Fifty-three abstracts of literature on trace contaminants are presented. Author, keyword, and permuted title indexes are included

  16. NSF Conference Report for FY12

    Data.gov (United States)

    National Science Foundation — OMB Memorandum M-12-12 requires federal agencies to report by January 31st of each year, information on all agency-sponsored conferences from the previous year where...

  17. Plasma science and engineering at NSF

    International Nuclear Information System (INIS)

    Goldberg, L.S.

    1996-01-01

    The author gives a perspective of the breadth of fundamental plasma science and engineering that the National Science Foundation supports through its Directorates for Engineering, Mathematical and Physical Sciences, Geosciences, and the Office of Polar Programs. He plans also to discuss the diverse interests and commitment within the Foundation to maintaining the vitality of research and education activities in this field

  18. Nephrogenic systemic fibrosis: risk factors suggested from Japanese published cases

    DEFF Research Database (Denmark)

    Tsushima, Y; Kanal, E; Thomsen, H S

    2010-01-01

    The aim of this article is to review the published cases of nephrogenic systemic fibrosis (NSF) in Japan. The Japanese medical literature database and MedLine were searched using the keywords NSF and nephrogenic fibrosing dermopathy (January 2000 to March 2009). Reports in peer-reviewed journals...... and meeting abstracts were included, and cases with biopsy confirmation were selected. 14 biopsy-verified NSF cases were found. In seven of eight patients reported after the association between gadolinium-based contrast agent (GBCA) and NSF was proposed, GBCA administration was documented: five received only...

  19. Prevalência de hipertensão pulmonar avaliada por ecocardiografia Doppler em uma população de pacientes adolescentes e adultos com fibrose cística Prevalence of pulmonary hypertension evaluated by Doppler echocardiography in a population of adolescent and adult patients with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Paula Maria Eidt Rovedder

    2008-02-01

    Full Text Available OBJETIVO: Determinar a prevalência de hipertensão pulmonar (HP em pacientes com fibrose cística (FC, comparar características clínicas, escore radiológico, função pulmonar e parâmetros ecocardiográficos nos grupos com e sem HP e correlacionar achados ecocardiográficos com características clínicas, escore radiológico e função pulmonar. MÉTODOS: Estudo transversal prospectivo em pacientes clinicamente estáveis (idade > 16 anos atendidos por um programa de adultos para FC. Os pacientes foram submetidos a avaliação clínica, ecocardiografia Doppler, testes de função pulmonar e exame radiológico do tórax. RESULTADOS: Obteve-se a velocidade de regurgitação tricúspide (VRT em 37 dos 40 pacientes estudados. A prevalência de HP foi de 49% com um ponte de corte da VRT de 2,5 m/s (18 pacientes e de 30% com um ponte de corte da VRT de 2,8 m/s (11 pacientes. Os valores de saturação periférica de oxigênio (SpO2 em repouso, escore clínico, volume expiratório forçado no primeiro segundo (VEF1 e capacidade vital forçada (CVF foram significativamente menores no grupo com HP. A VRT correlacionou-se significativamente com SpO2 em repouso (p OBJECTIVE: To determine the prevalence of pulmonary hypertension (PH in patients with cystic fibrosis (CF, to compare clinical characteristics, radiographic scores, pulmonary function, and echocardiographic parameters in patients with and without PH, and to correlate echocardiographic findings with clinical characteristics, radiographic scores, and pulmonary function. METHODS: This was a prospective, cross-sectional study involving clinically stable patients (aged 16 or older enrolled in an adult CF program. The patients were submitted to clinical evaluation, Doppler echocardiography, pulmonary function tests, and chest X-rays. RESULTS: Tricuspid regurgitant jet velocity (TRV was obtained in 37 of the 40 patients studied. The prevalence of PH was 49% with a TRV cut-off of 2.5 m/s (18 patients

  20. Correlação dos achados tomográficos com parâmetros de função pulmonar na fibrose pulmonar idiopática em não fumantes Correlation of tomographic findings with pulmonary function parameters in nonsmoking patients with idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    Agnaldo José Lopes

    2007-12-01

    Full Text Available OBJETIVO: Correlacionar os achados tomográficos com os parâmetros de função pulmonar em portadores de fibrose pulmonar idiopática (FPI. MÉTODOS: Foi realizado um estudo de corte transversal, em que foram avaliados 30 pacientes não tabagistas, portadores de FPI. Utilizando um sistema de escore semiquantitativo, os seguintes achados na tomografia computadorizada de alta resolução (TCAR foram quantificados: extensão total da doença intersticial (Tot, infiltrado reticular e faveolamento (Ret+Fav, e opacidade em vidro fosco (Vif. As variáveis funcionais foram mensuradas através de espirometria, técnica de oscilações forçadas (TOF, método da diluição com hélio e método da respiração única para medir a capacidade de difusão do monóxido de carbono (DLCO. RESULTADOS: Dos 30 pacientes estudados, 18 eram mulheres e 12 eram homens, com média de idade de 70,9 anos. Foram encontradas correlações significativas de Tot e Ret+Fav com as medidas de capacidade vital forçada (CVF, capacidade pulmonar total (CPT, DLCO e complacência dinâmica do sistema respiratório (correlações negativas, e de Vif com volume residual/CPT (correlação positiva. A relação fluxo expiratório forçado entre 25 e 75% da CVF/CVF (FEF25-75%/CVF correlacionou-se positivamente com Tot, Ret+Fav e Vif. CONCLUSÕES: Em portadores de FPI, as medidas de volume, difusão e complacência dinâmica são as variáveis fisiológicas que melhor refletem a extensão da doença intersticial na TCAR.OBJECTIVE: To correlate tomographic findings with pulmonary function parameters in patients with idiopathic pulmonary fibrosis (IPF. METHODS: A cross-sectional study was carried out, in which 30 nonsmoking patients with IPF were evaluated. Using a semiquantitative scoring system, the following high-resolution computerized tomography (HRCT findings were quantified: total interstitial disease (TID, reticular abnormality/honeycombing, and ground-glass opacity (GGO. The

  1. Capnografia volumétrica como meio de detectar obstrução pulmonar periférica precoce em pacientes com fibrose cística Volumetric capnography as a tool to detect early peripheric lung obstruction in cystic fibrosis patients

    Directory of Open Access Journals (Sweden)

    Maria Ângela G. O. Ribeiro

    2012-12-01

    Full Text Available OBJETIVO: Comparar a espirometria e a capnografia volumétrica (CapV para determinar se os valores amostrados pela capnografia acrescentam informações sobre doenças pulmonares precoces em pacientes com fibrose cística (FC. MÉTODOS: Este foi um estudo do tipo corte transversal envolvendo pacientes com FC: Grupo I (42 pacientes, 6-12 anos de idade e Grupo II (22 pacientes, 13-20 anos de idade. Os grupos controle correspondentes eram formados por 30 e 50 indivíduos saudáveis, respectivamente. A capacidade vital forçada (CVF, o volume expiratório forçado no primeiro segundo (VEF1 e a relação VEF1/CVF foram determinados pela espirometria. Através da CapV, medimos a saturação periférica de oxigênio (SpO2, a frequência respiratória (FR, o tempo inspiratório (TI, o tempo expiratório (TE e o slope da fase III normalizado pelo volume corrente (slope da fase III/Vc. RESULTADOS: Em comparação com os grupos controle, todos os pacientes com FC apresentaram valores de slope da fase III/Vc (p OBJECTIVE: To compare spirometry and volumetric capnography (VCap to determine if the capnographic values add more information about early lung disease in cystic fibrosis (CF patients. METHODS: This was a cross-sectional study involving CF patients: Group I (42 patients, 6-12 years of age; and Group II (22 patients, 13-20 years of age. The corresponding control groups were comprised of 30 and 50 healthy subjects, respectively. Forced vital capacity (FVC, forced expiratory volume in one second (FEV1, and the FEV1/FVC ratio was determined by spirometry. Using VCap, we measured peripheral oxygen saturation (SpO2, respiratory rate (RR, inspiratory time (IT, expiratory time (ET, and the phase III slope normalized by expiratory volume (phase III slope/Ve. RESULTS: In comparison with control groups, all CF patients presented higher phase III slope/Ve values (p < 0.001 independent of the pulmonary disease stage. The phase III slope/Ve was significantly

  2. Deve-se extrapolar o tratamento de bronquiectasias em pacientes com fibrose cística para aqueles com bronquiectasias de outras etiologias? Should the bronchiectasis treatment given to cystic fibrosis patients be extrapolated to those with bronchiectasis from other causes?

    Directory of Open Access Journals (Sweden)

    Rodrigo Abensur Athanazio

    2010-08-01

    Full Text Available OBJETIVO: Conhecer o perfil de pacientes adultos com bronquiectasias, comparando portadores de fibrose cística (FC com aqueles com bronquiectasias de outra etiologia, a fim de determinar se é racional extrapolar terapêuticas instituídas em fibrocísticos para aqueles com bronquiectasias de outras etiologias. MÉTODOS: Análise retrospectiva dos prontuários de 87 pacientes adultos com diagnóstico de bronquiectasia em acompanhamento em nosso serviço. Pacientes com doença secundária a infecção por tuberculose corrente ou no passado foram excluídos. Foram avaliados dados clínicos, funcionais e terapêuticos dos pacientes. RESULTADOS: Dos 87 pacientes com bronquiectasias, 38 (43,7% tinham diagnóstico confirmado de FC através de dosagem de sódio e cloro no suor ou análise genética, enquanto 49 (56,3% apresentavam a doença por outra etiologia, 34 (39,0% desses com bronquiectasia idiopática. Os pacientes com FC apresentavam média de idade ao diagnóstico mais baixa (14,2 vs. 24,2 anos; p OBJECTIVE: To profile the characteristics of adult patients with bronchiectasis, drawing comparisons between cystic fibrosis (CF patients and those with bronchiectasis from other causes in order to determine whether it is rational to extrapolate the bronchiectasis treatment given to CF patients to those with bronchiectasis from other causes. METHODS: A retrospective analysis of the medical charts of 87 patients diagnosed with bronchiectasis and under follow-up treatment at our outpatient clinic. Patients who had tuberculosis (current or previous were excluded. We evaluated the clinical, functional, and treatment data of the patients. RESULTS: Of the 87 patients with bronchiectasis, 38 (43.7% had been diagnosed with CF, through determination of sweat sodium and chloride concentrations or through genetic analysis, whereas the disease was due to another etiology in 49 (56.3%, of whom 34 (39.0% had been diagnosed with idiopathic bronchiectasis. The mean

  3. The Center for Astronomy Education (CAE) Ushers in a New Community-Based Model for Astronomy Education Research with the NSF Funded CCLI Phase III Collaboration of Astronomy Teaching Scholars (CATS) Program

    Science.gov (United States)

    Brissenden, Gina; Impey, C.; Prather, E.; Lee, K.; Duncan, D.

    2009-01-01

    The Center for Astronomy Education (CAE) has been devoted to improving teaching & learning in Astro 101 by creating research-validated curriculum & assessment instruments for use in Astro 101 & by providing Astro 101 instructors professional development opportunities to increase their pedagogical content knowledge & instructional skills at implementing these curricula & assessment materials. To create sustainability and further expand this work, CAE, in collaboration with other national leaders in astronomy education & research, developed the Collaboration of Astronomy Teaching Scholars (CATS) Program. The primary goals of CATS are to: 1) increase the number of Astro 101 instructors conducting fundamental research in astronomy education 2) increase the amount of research-validated curriculum & assessment instruments available for use in Astro 101 3) increase the number of people prepared to develop & conduct their own CAE Teaching Excellence Workshops In our first year we have concluded a national study assessing the teaching & learning of Astro 101 & the effect of interactive instruction. We have begun the initial analysis of the demographics data of this study. We have begun a classroom research validation study on the use of the "ClassAction” electronic learning system. We have begun to analyze data from two different studies on students’ attitudes & understanding of science to inform the creation of an assessment instrument designed specifically for Astro 101 to evaluate the effectiveness of our instruction in improving students’ attitudes & beliefs about science. We have also begun the development of a Solar System Concept Inventory. Additionally the development of the Solar System Concept Inventory and research into students’ beliefs and reasoning difficulties on topics in Cosmology are well underway. We acknowledge the NSF for funding under Award No. 0715517, a CCLI Phase III Grant for the Collaboration of Astronomy Teaching Scholars (CATS) Program.

  4. The Center for Astronomy Education (CAE) and Our NSF Funded CCLI Phase III Collaboration of Astronomy Teaching Scholars (CATS) Program: Updates to Our New Community-Based Model for Astronomy Education Research

    Science.gov (United States)

    Brissenden, Gina; Impey, C.; Prather, E. E.; Lee, K. M.; CATS

    2010-01-01

    The Center for Astronomy Education (CAE) has been devoted to improving teaching & learning in Astro 101 by creating research-validated curriculum & assessment instruments for use in Astro 101 & by providing Astro 101 instructors professional development opportunities to increase their pedagogical content knowledge & instructional skills at implementing these curricula & assessment materials. To create sustainability and further expand this work, CAE, in collaboration with other national leaders in astronomy education & research, developed the Collaboration of Astronomy Teaching Scholars (CATS) Program. The primary goals of CATS are to: 1) increase the number of Astro 101 instructors conducting fundamental research in astronomy education 2) increase the amount of research-validated curriculum & assessment instruments available for use in Astro 101 3) increase the number of people prepared to develop & conduct their own CAE Teaching Excellence Workshops In our second year we have concluded a national study assessing the contribution students’ personal characteristics make to student learning gains and the effectiveness of interactive learning strategies. We have results from our classroom research validation study on the use of the "ClassAction” electronic learning system. We have begun creation of an assessment instrument designed specifically for Astro 101 to evaluate the effectiveness of our instruction in improving students’ attitudes & beliefs about science, and which is being informed by several of our studies and community input. We have also begun field-testing of our Solar System Concept Inventory. Additionally research into students’ beliefs and reasoning difficulties on topics in Cosmology is underway. We acknowledge the NSF for funding under Award No. 0715517, a CCLI Phase III Grant for the Collaboration of Astronomy Teaching Scholars (CATS) Program.

  5. Fibrose pulmonar idiopática: características clínicas e sobrevida em 132 pacientes com comprovação histológica Pulmonary idiopathic fibrosis: clinical findings and survival in 132 histologically-proven patients

    Directory of Open Access Journals (Sweden)

    ADALBERTO SPERB RUBIN

    2000-04-01

    Full Text Available Com o objetivo de avaliar as características clínicas e sobrevida de pacientes portadores de fibrose pulmonar idiopática, foram analisados 132 casos com confirmação histológica, internados no Pavilhão Pereira Filho entre 1970 e 1996. O diagnóstico foi realizado em 120 casos por biópsia a céu aberto e em 12 casos por biópsia transbrônquica. A idade média do grupo estudado foi de 56 anos; 78 eram do sexo masculino; 126 eram brancos e 6, negros. O tabagismo estava presente em 61 casos. A duração média dos sintomas antes do diagnóstico foi de 22,7 meses. O hipocratismo digital esteve presente em 75 pacientes e estertores teleinspiratórios foram verificados em 100 casos. Dispnéia só não foi constatada em dois pacientes e tosse esteve presente em 89 casos. As provas de função pulmonar apresentaram os seguintes valores médios: CVF, 62%; VEF1, 70%; DCO, 43,4%; CPT, 76,7%; PaO2, 67,3mmHg; PaCO2, 39,1mmHg e SaO2, 92,3%. O lavado broncoalveolar apresentou os seguintes valores médios: macrófagos, 83,8%; neutrófilos, 9,1%; linfócitos; 6,1% e eosinófilos, 0,6%. Na radiologia convencional de tórax, foi observado faveolamento em 79 casos, redução da capacidade pulmonar total em 107 e alargamento da traquéia intratorácica em 50. Na TC de tórax, o grau médio de profusão do padrão reticular foi de 42,3% e do padrão de granularidade, de 43,6%. O padrão histológico usual esteve presente em 128 casos, sendo apenas quatro pacientes portadores de padrão descamativo. Em 121 casos foram obtidas informações quanto à sobrevida em dezembro de 1997. A sobrevida média total desta série foi de 28 meses, sendo de 24 meses para os pacientes que foram a óbito. Os pacientes desta série apresentaram características associadas a um estágio avançado da doença. Este fato, mais a presença maciça de pacientes com padrão usual e a rígida seleção de casos muito provavelmente contribuíram para os resultados encontrados quanto

  6. Quadro clínico e nutricional de pacientes com fibrose cística: 20 anos de seguimento no HC-UFMG Clinical and nutritional aspects of a Center of Cystic Fibrosis-HC-UFMG: 20 years of follow-up

    Directory of Open Access Journals (Sweden)

    F. J. C. Reis

    2000-10-01

    Full Text Available OBJETIVOS: A fibrose cística (FC é a doença genética letal, de herança autossômica recessiva, mais comum entre pacientes de cor branca. O presente estudo foi realizado com o objetivo de identificar o quadro clínico e nutricional à admissão dos pacientes no Centro de Tratamento de FC do HC-UFMG e avaliar a sobrevida a longo prazo. PACIENTES E MÉTODOS: Em um período de 20 anos, 127 pacientes portadores de FC foram acompanhados longitudinalmente e submetidos a protocolo previamente estabelecido, após confirmação do diagnóstico pelo teste do suor. Foram obtidos na admissão dados demográficos, da apresentação clínica, nutricionais e laboratoriais. O genótipo foi obtido de 106 pacientes pela técnica do PCR. Os pacientes foram seguidos por mediana de 44 meses. A análise de sobrevida foi realizada utilizando-se o método de Kaplan-Meier. RESULTADOS: A mediana da idade do diagnóstico da FC foi de 33 meses. A manifestação clínica predominante na época do diagnóstico foi a associação de sintomas respiratórios e gastrointestinais crônicos, presentes em 61% das crianças. A mutação mais freqüente encontrada foi a deltaF508: 17 pacientes (16% eram homozigotos para essa mutação e 30 (28% eram heterozigotos. Houve uma prevalência de desnutrição à admissão de 63% tendo sido reduzida para 45% ao final do seguimento. Um total 20 pacientes (15,7% evoluiu para o óbito. A probabilidade estimada de sobrevida nos primeiros 12 meses após o diagnóstico foi de 96% e após 5 anos de seguimento de 80%. CONCLUSÕES: O diagnóstico da FC é ainda tardio em nosso meio e a sobrevida é menor quando comparada a dados internacionais. O seguimento desses pacientes em centro especializado permitiu uma melhora no estado nutricional apesar da inerente evolução da doença.BACKGROUND: Cystic fibrosis (CF is the most common severe autosomal recessive disease in caucasian population. The life expectancy of patients with CF has improved

  7. Densidade mineral óssea, função pulmonar, idade cronológica e idade de diagnóstico em crianças e adolescentes com fibrose cística Bone mineral density, pulmonary function, chronological age, and age at diagnosis in children and adolescents with cystic fibrosis

    Directory of Open Access Journals (Sweden)

    Márcio V.F. Donadio

    2013-04-01

    Full Text Available OBJETIVO: Avaliar a densidade mineral óssea de pacientes com fibrose cística (FC e correlacioná-la com possíveis variáveis intervenientes. MÉTODOS: Foram incluídos crianças e adolescentes com diagnóstico clínico de FC, idade entre seis e dezoito anos, e em acompanhamento ambulatorial. Primeiramente, foram coletados os dados demográficos, para posterior realização do teste espirométrico. Todos os pacientes responderam ao questionário de qualidade de vida em FC (QFC e realizaram o teste de caminhada dos seis minutos (TC6 e o exame de densitometria óssea (DXA. RESULTADOS: Foram incluídos 25 pacientes fibrocísticos, sendo 56% do sexo masculino. A média de idade foi de 12,3 ± 3,4 anos, altura de 149,2 ± 14,4 cm e peso de 44,4 ± 13,9 kg. A maioria dos dados de função pulmonar e de densidade mineral óssea (DMO encontrou-se dentro dos limites de normalidade. A média do volume expiratório forçado no primeiro segundo (VEF1 foi de 92,5 ± 23,6 (% do previsto, capacidade vital forçada (CVF de 104,4 ± 21,3 (% do previsto e o escore z da DMO de 0,1 ± 1,0. A DMO correlacionou-se de forma moderada com o VEF1 (r = 0,43; p = 0,03 e com a CVF (r = 0,57; p = 0,003. Em relação à idade cronológica e à idade de diagnóstico, também foi encontrada uma correlação moderada e inversa (r = -0,55; p = 0,004 /r = -0,57; p = 0,003, respectivamente. Entretanto, não foram encontradas correlações significativas com os dados do QFC, TC6 e índice de massa corporal. CONCLUSÃO: A maioria dos pacientes avaliados apresenta DMO dentro dos limites de normalidade e possui correlação positiva com a função pulmonar e negativa com a idade cronológica e a idade de diagnóstico.OBJECTIVE: To assess bone mineral density in patients with cystic fibrosis (CF, and to correlate it with possible intervening variables. METHODS: Children and adolescents diagnosed with CF, aged 6 to 18 years, followed at the outpatient clinic were included in the study

  8. Regulation der FOXO-Gene durch E2F-1und die induzierbare systemische Rekombination eines konditionellen Allels in der Maus

    OpenAIRE

    Geßner, Christine Ruth

    2010-01-01

    1.) FOXO1 und FOXO3A sind Zielgene von E2F-1 in Neuroblastomzellen. 2.) In einem Mausstamm, der ubiquitär ein CRE-ER Fusionsprotein exprimiert, konnte nach Tamoxifen Gabe die Rekombination des konditionellen mutierten p300 AS Gens in der untersuchten Geweben des entsprechenden Mausstammes nachgewiesen werden. Auf Basis dieses Experimentes kann nun die Tumorsuppressor von p300 in vivo untersucht werden.

  9. Pulmonary granulomatous diseases and pulmonary manifestations of systemic granulomatous disease. Including tuberculosis and nontuberculous mycobacteriosis; Pulmonale granulomatoese Erkrankungen und pulmonale Manifestationen systemischer Granulomatosen. Inklusive Tuberkulose und nichttuberkuloese Mykobakteriosen

    Energy Technology Data Exchange (ETDEWEB)

    Piel, S. [Universitaet Heidelberg, Zentrum fuer interstitielle und seltene Lungenerkrankungen, Pneumologie und Beatmungsmedizin, Thoraxklinik, Heidelberg (Germany); Kreuter, M.; Herth, F. [Universitaet Heidelberg, Zentrum fuer interstitielle und seltene Lungenerkrankungen, Pneumologie und Beatmungsmedizin, Thoraxklinik, Heidelberg (Germany); Universitaetsklinikum Heidelberg, Translational Lung Research Center (TLRC), Heidelberg (Germany); Kauczor, H.U. [Universitaetsklinikum Heidelberg, Abteilung fuer Diagnostische und Interventionelle Radiologie, Heidelberg (Germany); Universitaetsklinikum Heidelberg, Translational Lung Research Center (TLRC), Heidelberg (Germany); Heussel, C.P. [Universitaet Heidelberg, Abteilung fuer Diagnostische und Interventionelle Radiologie mit Nuklearmedizin, Thoraxklinik, Heidelberg (Germany); Universitaetsklinikum Heidelberg, Translational Lung Research Center (TLRC), Heidelberg (Germany)

    2016-10-15

    Granulomas as signs of specific inflammation of the lungs are found in various diseases with pulmonary manifestations and represent an important imaging finding. The standard imaging modality for the work-up of granulomatous diseases of the lungs is most often thin-slice computed tomography (CT). There are a few instances, e. g. tuberculosis, sarcoidosis and silicosis, where a chest radiograph still plays an important role. Further radiological modalities are usually not needed in the routine work-up of granulomatous diseases of the chest. In special cases magnetic resonance imaging (MRI) and positron emission tomography (PET)-CT scans play an important role, e. g. detecting cardiac sarcoidosis by cardiac MRI or choline C-11 PET-CT in diagnosing lung carcinoma in scar tissue after tuberculosis. The accuracy of thin-slice CT is very high for granulomatous diseases. In cases of chronic disease and fibrotic interstitial lung disease it is important to perform thin-slice CT in order to diagnose a specific disease pattern. Thin-slice CT is also highly sensitive in detecting disease complications and comorbidities, such as malignancies. Given these indications thin-slice CT is generally accepted in the routine daily practice. A thin-slice CT and an interdisciplinary discussion are recommended in many cases with a suspected diagnosis of pulmonary granulomatous disease due to clinical or radiographic findings. (orig.) [German] Granulome als Zeichen der spezifischen Entzuendung im Lungengewebe treten bei zahlreichen Erkrankungen mit pulmonaler Manifestation auf und stellen einen wichtigen Befund in der Bildgebung dar. Das radiologische Standardverfahren bei pulmonalen Granulomatosen ist meistens die Duennschichtcomputertomographie, in wenigen Faellen, wie z. B. bei Tuberkulose, Sarkoidose und Silikose, spielt die Roentgenthoraxuebersicht immer noch eine wichtige Rolle. Bei der Standardabklaerung der meisten Granulomatosen ist die Hinzunahme weiterer Verfahren nicht notwendig. Bei speziellen Fragestellungen spielen MRT und Positronenemissionstomographie (PET) eine Rolle, z. B. die Kardio-MRT bei Verdacht auf kardiale Beteiligung bei Sarkoidose oder die Cholin-PET-CT bei V. a. ein Narbenkarzinom bei Tuberkulose. Die Sensitivitaet der Duennschicht-CT ist bei den Granulomatosen sehr hoch. Insbesondere bei chronifizierten Verlaeufen mit Ausbildung fibrotischer Veraenderungen bzw. einer interstitiellen Lungenerkrankung ist eine Duennschicht-CT zur Differenzierung des Erkrankungsmusters wichtig. Ebenso spielt die Duennschicht-CT eine wichtige Rolle bei der Diagnostik von Komplikationen und Begleiterkrankungen, z. B. Malignomen. Die Methode gehoert inzwischen zur alltaeglichen klinischen Praxis. Bei klinischem Verdacht auf eine pulmonale Granulomatose und entsprechenden Hinweisen in der Thoraxuebersicht sind eine Duennschicht-CT und die interdisziplinaere Diskussion der Befunde zu empfehlen. (orig.)

  10. Deposição pulmonar de tobramicina inalatória antes e após fisioterapia respiratória e uso de salbutamol inalatório em pacientes com fibrose cística colonizados por Pseudomonas aeruginosa Pulmonary deposition of inhaled tobramycin prior to and after respiratory therapy and use of inhaled albuterol in cystic fibrosis patients colonized with Pseudomonas aeruginosa

    Directory of Open Access Journals (Sweden)

    Milena Baptistella Grotta

    2009-01-01

    Full Text Available OBJETIVO: Avaliar se a fisioterapia respiratória seguida do uso de salbutamol inalatório modifica a deposição pulmonar de tobramicina inalatória em pacientes com fibrose cística (FC e se a deposição pulmonar apresenta correlação com a gravidade da doença ou com o genótipo. MÉTODOS: Um estudo prospectivo foi realizado com pacientes com FC maiores de 6 anos e colonizados por Pseudomonas aeruginosa. Os critérios de exclusão foram exacerbação pulmonar, mudança terapêutica entre as fases do estudo e FEV1 OBJECTIVE: To evaluate whether respiratory therapy followed by the use of inhaled albuterol modifies the pulmonary deposition of inhaled tobramycin in patients with cystic fibrosis (CF and whether pulmonary deposition correlates with disease severity or genotype. METHODS: A prospective study was carried out including patients with CF older than 6 years of age and colonized with Pseudomonas aeruginosa. Exclusion criteria were pulmonary exacerbation, changes in therapy between the study phases and FEV1 < 25%. All patients were submitted to pulmonary scintigraphy by means of a scintillation camera equipped with a low energy all purpose collimator in order to evaluate drug penetration following the administration of inhaled 99mTc-tobramycin, as well as to pulmonary perfusion with 99mTc-macroaggregated albumin (phase 1. One month later, the same procedure was performed following respiratory therapy and administration of inhaled albuterol (phase 2. RESULTS: We included 24 patients (12 males aged 5-27 years (mean ± SD: 12.85 ± 6.64 years. The Shwachman score (SS was excellent/good in 8 patients, moderate/fair in 16 and poor in 0. Genotyping revealed that 7 patients were ΔF508 homozygotes, 13 were ΔF508 heterozygotes; and 4 presented other mutations. In all patients, lung deposition of tobramycin decreased in phase 2, especially in those with moderate/fair SS (p = 0.017 and in heterozygotes (p = 0.043. CONCLUSIONS: The use of a

  11. Clinical and histological findings in nephrogenic systemic fibrosis

    International Nuclear Information System (INIS)

    Cowper, Shawn E.; Rabach, Morgan; Girardi, Michael

    2008-01-01

    Nephrogenic systemic fibrosis (NSF) is a relative newcomer to the world of medicine. NSF was introduced just over 10 years ago as nephrogenic fibrosing dermopathy, but with further investigation, its systemic nature was determined. The strict adherence to a definition requiring both clinical and pathological concordance has allowed for careful separation of this entity from other fibrosing disorders, leading eventually to the realization that gadolinium-based contrast agents were closely associated with its onset. As planned prospective studies get underway, it is of paramount importance that researchers and clinicians realize that NSF remains a very challenging diagnosis, and that both clinical and histopathological criteria must be employed to reach the most accurate diagnosis possible

  12. Influência da infecção pregressa pelo vírus da hepatite B na fibrose hepática em portadores de hepatite C crônica: avaliação retrospectiva de uma série de casos Influence of previous hepatitis B virus infection on liver fibrosis in patients with chronic hepatitis C: a retrospective case series evaluation

    Directory of Open Access Journals (Sweden)

    Gaspar Lisboa Neto

    2010-08-01

    Full Text Available INTRODUCÃO: A hepatite C é uma das principais causas de doença hepática em todo mundo. Apresenta um curso evolutivo dinâmico e influenciável por diversos co-fatores. Dentre eles, a infecção pregressa pelo vírus B (anti-HBcAg [+] e HBsAg [-] tem se associado a pior prognóstico histológico e terapêutico. Este trabalho teve como objetivo analisar a associação entre a infecção pregressa pelo vírus B e fibrose hepática em portadores de hepatite C crônica, de maneira independente. MÉTODOS: Foram revistos retrospectivamente prontuários médicos de pacientes infectados cronicamente pelo vírus C, atendidos consecutivamente durante um ano no ambulatório de Doenças Infecciosas e Parasitárias - HC FMUSP, quanto aos dados epidemiológicos, clínicos, laboratoriais e histológicos. A análise de independência do impacto da infecção pregressa pelo vírus B foi realizada através de modelo estatístico de regressão logística multivariado, considerando a detecção do anti-HBcAg como variável de exposição, sendo o desfecho a alteração estrutural histopatológica graus 3 e 4 (septos com formação de nódulos e cirrose.0 RESULTADOS: 145 indivíduos foram avaliados pelo estudo, 47.2% com anti-HBcAg (+. O fator de risco mais comumente relatado foi transfusão de sangue e hemoderivados (35,9%. Embora necrose em saca-bocado tenha sido encontrada com maior frequência no grupo de infecção pregressa, a sorologia anti-HBcAg (+ não se associou à fibrose hepática avançada. CONCLUSÕES: A infecção pregressa pelo vírus B não parece acentuar a lesão estrutural desencadeada pela hepatite C crônica, após controle estatístico para outros co-fatores sabidamente capazes de influenciar a história natural desta infecção.INTRODUCTION: Hepatitis C is a major cause of liver disease worldwide. Its evolutionary course is dynamics and may be influenced by several cofactors. Among them, previous hepatitis B virus infection (anti

  13. O cotidiano da família com filhos portadores de fibrose cística: subsídios para a enfermagem pediátrica El cotidiano de la familia con hijos portadores de fibrosis quística: aportes para la enfermería pediátrica The routine of families with children bearing cystic fibrosis: subsidies for pediatric nursing

    Directory of Open Access Journals (Sweden)

    Maria Cândida de Carvalho Furtado

    2003-02-01

    Full Text Available A fibrose cística é uma doença genética caracterizada pelo aumento na produção de muco que, depositado em alguns órgãos, causa: doença pulmonar obstrutiva crônica, insuficiência pancreática e nível elevado de eletrólitos no suor. Pretende-se, neste estudo, descrever o cotidiano de famílias com filhos portadores de fibrose cística nos aspectos relacionados à repercussão da doença crônica na dinâmica familiar. Para tanto, realizou-se um estudo qualitativo, com coleta de dados empíricos a partir de entrevistas com 14 famílias de pacientes menores de 18 anos em tratamento no Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto, da Universidade de São Paulo. Dos dados emergiram os seguintes temas: envolvimento da família, aceitação/entendimento da doença e enfrentando desafios. Identificamos uma vida de dependência relacionada à doença, com desgaste físico e emocional, tanto da criança quanto da família. Implicações para a enfermagem: constituição de modelos assistenciais que tenham a família como foco de atenção, considerando meio ambiente, estilo de vida e promoção à saúde como seus fundamentos básicos.La fibrosis quística es una enfermedad genética caracterizada por el aumento en la producción de moco que es depositado en algunos órganos causando: enfermedad pulmonar obstructiva crónica, insuficiencia pancreática y nivel elevado de electrolitos en el sudor. El objetivo de este estudio es describir el cotidiano de las familias con hijos portadores de fibrosis quística en los aspectos relacionados a la repercusión de la enfermedad crónica en la dinámica familiar. Por lo tanto, se realizó un estudio cualitativo, a través de la recolección de datos empíricos a partir de entrevistas con 14 familias de pacientes menores de 18 años en tratamiento en el Hospital Clínicas de la Facultad de Medicina de Ribeirão Preto de la Universidad de São Paulo. De los datos emergieron los

  14. NSF: A "Populist" Pattern in Metallurgy, Materials Research?

    Science.gov (United States)

    Shapley, Deborah

    1975-01-01

    Describes the testimony of a University of Virginia professor of applied science, who charged that the National Science Foundation grants disproportionately small funds to the best university departments in the field of metallurgy and materials, while preferentially funding middle-ranked departments. (MLH)

  15. NSF-DMR Highlight from NHMFL-PFF 2017

    Energy Technology Data Exchange (ETDEWEB)

    Mielke, Charles H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-12

    The alkali-doped fullerides provide the first example of a transition from a three-dimensional Mott insulator to a superconductor, enabling the effects of both dimensionality and electron correlations on superconductivity to be explored. Chemically, the alkali species tunes the superconductivity in the vicinity of the Mott transition by varying the unit cell volume.

  16. Analysis of the NSF IUSE Physics & Astronomy Education Portfolio

    Science.gov (United States)

    Lee, Kevin M.

    2017-01-01

    The National Science Foundation’s IUSE:EHR (Improving Undergraduate STEM Education) Program is now over 3 years old. This presentation will describe the characteristics of the awards presently in the physics & astronomy portfolio. Awards will be described based upon a) general characteristics (duration, total funding, PI rank, type of institution, etc.), b) applicability (intended audience, level, and arena of implementation), c) nature of project (educational research, practical implementation, or both), and d) pedagogical focus (curriculum, STEM recruitment, STEM retention, information collection, and tools and/or skills development). General trends and exemplars will be identified as well as voids in the portfolio. Understanding what has been funded will help attendees design future proposals that will make innovative contributions to the portfolio.

  17. US NSF: scientists discover planetary system similar to our own

    CERN Multimedia

    2003-01-01

    An international team of scientists has discovered a planet and star that may share the same relationship as Jupiter and our Sun, the closest comparison that researchers have found since they began their search for extra-solar planets nearly a decade ago (1 page).

  18. Advancing Geographic Information Science—Proposal to NSF, with Addendum

    OpenAIRE

    National Center for Geographic Information and Analysis

    1995-01-01

    This document from 1995 and the addendum from 1996 represent NCGIA's proposal for Varenius—a program of research initiatives to advance geographic information science in the context of digitial worlds and the information society.

  19. Accelerator tube vacuum conditions in the NSF tandem

    International Nuclear Information System (INIS)

    Groome, A.E.

    1979-08-01

    The Nuclear Structure Facility currently under construction at the Daresbury Laboratory contains a 30 MV tandem Van de Graaff accelerator with a modular design of accelerator tube. The vacuum system requirements are specified to limit beam loss due to charge-state-changing collisions in the residual gas. This report gives an assessment of some of the parameters affecting the vacuum pressure in an operational machine. Measurements are made of the vacuum conductance and outgassing rate of accelerator tube modules. An assessment is made of the effects of temperature rise, beam mis-steering and the presence of suppression magnets on the ultimate vacuum obtainable. Predictions are made of the pressure profile throughout the machine and consideration is given to operational problems such as tube conditioning and temporary loss of pumping. A schematic diagram of the tandem and its vacuum system is shown. (author)

  20. USING OF MSC WITH DIFFERENT ONTOGENETIC MATURITY FOR CORRECTION OF CHRONIC FIBROSING LIVER DAMAGE

    Directory of Open Access Journals (Sweden)

    M. Y. Shagidulin

    2013-01-01

    Full Text Available Aim. To compare the effectiveness of MSC with different degree of ontogenetic maturity (MSC bone marrow – MSC BM and MSC umbilical cord – MSC UC on regenerative processes in injured liver. Methods. In 4 groups of experiments on Wistar rats (n = 80 with a model of fibrotic toxic liver damage (FLD it was studied the effect of MSCs with different degree of ontogenetic maturity on recovery processes at the regeneration of damaged liver: 1 gr. – Control, 2 gr. and 3 gr. introduction of MSC BM, included in Sphero®GEL-long in doses of 2.5 ×106 and 5.0 x 106 cells, respectively, and 4 gr. – introduction of MSC UC in the form of cell-spheroids (8–10 × 105 cells. The cells were injected into the damaged liver in 7 days after the end of FDL-modeling. The effect of cell therapy was studied during 180 days. The effectiveness of corrective therapy was evaluated by the results of functional and morphological investigations of livers (histological control of parenchymal and nonparenchy- mal liver tissue. Results. MSC BM in both doses and MSC UC contributed to a more rapid normalization of liver enzyme indices compared with the control (1 gr., but the differences in the rate of recovery of disturbed enzymatic liver functions between groups 2, 3 and 4 – were absent. In 90 days after the cell application it was determined a more pronounced recovery activity of cells in groups 3 and 4; in 180 days the more pronounced activation of recovery processes was observed in group 3; but in group 4 the sclerotic processes were more pro- nounced in this period. Conclusion. For the induction of recovery processes in damage liver it is advisable not to use the MSC UC, but to use MSC BM in the Sphero®GEL, because MSC BM exert not only local but also systemic immune-regulatory effect, increasing the pool of T-reg. cells, which are additional carriers of regenera- tion information in organism. 

  1. Catheter-based intervention for pulmonary vein stenosis due to fibrosing mediastinitis: The Mayo Clinic experience

    Directory of Open Access Journals (Sweden)

    Shiva P. Ponamgi

    2015-09-01

    Conclusions: We describe the largest reported case series of catheter-based intervention for PV stenosis in FM. Although catheter-based therapy improved hemodynamics, short-term vascular patency, and patient symptoms, the rate of life-threatening complications, restenosis, and mortality associated with these interventions was found to be high. Despite these associated risks, catheter-based intervention is the only palliative option available to improve quality of life in severely symptomatic patients with PV stenosis and FM. Patients with PV stenosis and FM (especially those with bilateral disease have an overall poor prognosis in spite of undergoing these interventions due to the progressive and recalcitrant nature of the disease. This underscores the need for further innovative approaches to manage this disease.

  2. Hermansky-Pudlak syndrome type 2 manifests with fibrosing lung disease early in childhood

    NARCIS (Netherlands)

    Hengst, M. (Meike); Naehrlich, L. (Lutz); P. Mahavadi (Poornima); Grosse-Onnebrink, J. (Joerg); Terheggen-Lagro, S. (Suzanne); Skanke, L.Hø. (Lars Høsøien); Schuch, L.A. (Luise A.); Brasch, F. (Frank); A. Guenther (Andreas); S. Reu (Simone); Ley-Zaporozhan, J. (Julia); Griese, M. (Matthias)

    2018-01-01

    textabstractBackground: Hermansky-Pudlak syndrome (HPS), a hereditary multisystem disorder with oculocutaneous albinism, may be caused by mutations in one of at least 10 separate genes. The HPS-2 subtype is distinguished by the presence of neutropenia and knowledge of its pulmonary phenotype in

  3. Prova do Suor no Diagnóstico Laboratorial da Fibrose Quistica

    OpenAIRE

    Costa, Alcina; Batalha, Lídia; Almeida, Suza; Vilares, Arminda; Pacheco, Paula; Silva, Conceição; Miranda, Armandina

    2014-01-01

    Objectivo: Apresentar a casuística da Prova do Suor, no período de 2009 a 2013 da UDR do DPS do INSA, I.P. Lisboa , e o estudo do gene CFTR, efetuado na Unidade de Genética Molecular, Departamento de Genética Humana, INSA, I.P. Lisboa.

  4. IMPACT OF ANTIVIRAL THERAPY FOR CHRONIC HEPATITIS C ON CYTOKINE SYNTHESIS AND HEPATIC FIBROSING PROCESSES

    Directory of Open Access Journals (Sweden)

    V. V. Shchekotov

    2015-01-01

    Full Text Available Objective: to estimate the time course of changes in the levels of tumor necrosis factor-α (TNF-α, interleukin-4 (IL-4, IL-6, and the hepatic fibrosis indicators hyaluronic acid (HA and liver elasticity index during combined antiviral therapy (AVT with interferon alpha-2b and ribavirin in patients with chronic hepatitis C (CHC. Subjects and methods. Fifty patients with CHC were examined. Serum TNF-α, IL-6, IL-4, and HA were estimated using an enzyme immunoassay. The stage of hepatic fibrosis was determined by fibroelastography with the liver elastic index being measured; the time course of changes in the indicators was assessed in 20 patients at the end of AVT. A virological response was monitored at therapy completion and 6 months later. Results. The patients with CHC in the reactivation phase were found to have enhanced TNF-α, IL-6, and IL-4 activities in 84, 60, and 100 % of the cases, respectively (р < 0.001, р = 0.01, р < 0.001, respectively. The median serum concentration of HA in CHC was 1.8-fold higher than that in the control group (p = 0.03; the liver elastic index averaged 6.5 kPa. TNF-α and IL-6 levels correlated with viremia, transaminases, and hepatic fibrosis indicators. At combined AVT completion, the virological response rate was as high as 85 %, which was attended by a considerable reduction in cytolysis, HA concentrations, and liver density index to 5.4 kPa (3.6–6.8 kPa (p < 0.04, and in the activity of the examined cytokines. The sustained virological response rate was 80 %. Only IL-4 levels decreased and TNF-α and IL-6 concentration remained at the baseline level in patients unresponsive to AVT. Conclusion. It is expedient to monitor TNF-α, IL-4, IL-6, and HA to evaluate the severity of liver involvement in CHC and to predict the efficiency of AVT.

  5. Systemic application of rhenium-186 hydroxyethylidenediphosphonate ({sup 186}Re HEDP) as an option for the treatment of chronic arthritis and arthropathy[Radiosynoviorthesis]; Systemische Applikation von Rhenium-186 Hydroxyethylidendiphosphonat ({sup 186}Re HEDP) als Therapieoption bei chronischen Arthritiden und Arthropathien

    Energy Technology Data Exchange (ETDEWEB)

    Bucerius, J.; Biersack, H.J.; Palmedo, H. [Klinik und Poliklinik fuer Nuklearmedizin, Universitaetsklinikum Bonn (Germany); Wallny, T. [Orthopaedische Klinik l, Klinik fuer Orthopaedische Chirurgie, St. Bernhard-Hospital Kamp-Lintfort (Germany); Klinik und Poliklinik fuer Orthopaedie, Universitaetsklinikum Bonn (Germany); Brackmann, H.H. [Inst. fuer experimentelle Haematologie und Transfusionsmedizin, Universitaetsklinikum Bonn (Germany)

    2006-03-15

    Chronic arthritis is very common and is associated with a variety of systemic diseases whereas hemophilic arthropathy is one of the most common clinical manifestations of hemophilia, mainly of hemophilia type A. All of these polyarticular diseases are associated with progressive pain and increasing lack of mobility. Therapy is based on conservative treatment such as medication with non-steroidal anti-inflammatory drugs, selective therapy strategies such as intraarticular injections of e.g. radioactive substances (radiosynoviorthesis) or surgical interventions. However, in some cases, the disease does not respond to one of these treatment options or cannot be continued due to important side-effects. Systemic application of radioisotopes like {sup 186}Re HEDP has been successfully administered for pain palliation of osseous metastases. Today, only few data exist for systemic therapy with {sup 186}Re HEDP in patients suffering from benign polyarticular disease. In a prospective study with patients suffering from chronic arthritis a single systemic application of {sup 186}Re HEDP led to a reduction of disease activity in six of eight and to a reduction of the number of painful or swollen joints in five of eight included patients. In a further prospective study with 12 patients with hemophilic arthropathy, 19 of 36 (52.7%) most painful joints could be successfully treated with one systemic {sup 186}Re HEDP therapy. Furthermore, a reduction of global pain could be observed in those patients. However, further randomized studies with larger study populations are necessary in order to confirm this promising results. (orig.)

  6. Nephrogenic systemic fibrosis: chronic imaging findings and review of the medical literature

    International Nuclear Information System (INIS)

    Weigle, Jeffrey P.; Broome, Dale R.

    2008-01-01

    Nephrogenic systemic fibrosis (NSF) is a systemic fibrosing disorder which has been strongly associated with exposure to gadolinium-based contrast media (GBCM) in the setting of renal insufficiency. Although this disorder primarily affects the skin, it can result in severe joint contractures, disabilities and even death. However, to date, there have been no published studies reporting chronic imaging findings of NSF. In this report we present three biopsy-proven cases of NSF with the associated chronic MRI, radiographic and bone scintigraphy findings. Two of the patients had been exposed to gadodiamide, and one had been exposed to gadopentetate dimeglumine prior to the onset of NSF. Two are newly reported cases. One patient's subacute imaging findings have previously been reported, but significant chronic images will now be presented. This patient became severely disabled from contractures and developed long bone smooth periosteal reaction, extensive intra-articular and periarticular calcifications, musculotendinous heterotopic ossification and ankylosis of several joints. One of the patients underwent renal transplantation 6 months after GBCM exposure, with near complete resolution of the skin fibrosis. The third patient had persistent MRI findings of skin thickening, with low T1 and high T2 signal intensity 5 years after exposure to gadodiamide. A review of the medical literature is provided, emphasizing the association of NSF with various GBCM. These cases broaden our understanding of the long-term imaging findings and complications of NSF and the stratified risk of NSF with various GBCM. (orig.)

  7. Nephrogenic systemic fibrosis associated with gadolinium based contrast agents: A summary of the medical literature reporting

    International Nuclear Information System (INIS)

    Broome, Dale R.

    2008-01-01

    Nephrogenic systemic fibrosis (NSF) is a systemic fibrosing disorder that principally affects the skin, but can involve virtually any tissue in the human body and result in significant disability and even death. Since 2006 numerous retrospective case reports and case series have reported a very strong association of this disease with exposure to gadolinium-based contrast agents (Gd-CA) for MR imaging in the setting of severe or end-stage renal disease. The purpose of this report is to summarize the medical literature reporting of biopsy-proven NSF cases in which the authors specifically investigated patient exposure to Gd-CA. A Pub Med MEDLINE search was performed using the key words-nephrogenic systemic fibrosis and nephrogenic fibrosing dermopathy. All case reports and case series of NSF were reviewed to determine if patients had a preceding exposure to Gd-CA and which specific Gd-CA was involved. If the original reports did not clarify the specific Gd-CA, I reviewed follow-up letters to the editors or contacted the authors to clarify which specific Gd-CA were linked to the NSF cases. If several reports originated from the same institution, clarification was also obtained to avoid redundant reporting. As of February 1, 2008 there have been 190 biopsy-proven cases of NSF published in the peer-reviewed literature with the following associations: 157 gadodiamide (Omniscan, GE Healthcare), 8 gadopentetate (Magnevist, Bayer Healthcare), 3 gadoversetamide (OptiMARK, Covidien), and 18 unspecified Gd-CA, and 4 confounded cases with more than one Gd-CA. Five cases of NSF were unassociated with Gd-CA

  8. HRCT of the lung in collagen vascular diseases; HRCT der Lunge bei Kollagenosen

    Energy Technology Data Exchange (ETDEWEB)

    Diederich, S. [Inst. fuer Klinische Radiologie, Westfaelische Wilhelms-Univ., Muenster (Germany); Roos, N. [Inst. fuer Klinische Radiologie, Westfaelische Wilhelms-Univ., Muenster (Germany); Schmitz-Linneweber, B. [Medizinische Klinik B, Westfaelische Wilhelms-Univ., Muenster (Germany); Gaubitz, M. [Medizinische Klinik B, Westfaelische Wilhelms-Univ., Muenster (Germany); Peters, P.E. [Inst. fuer Klinische Radiologie, Westfaelische Wilhelms-Univ., Muenster (Germany)

    1996-07-01

    Collagen vascular diseases, representing systemic soft tissue disorders, may cause a broad spectrum of pathologic changes of the respiratory tract. The type and extent of manifestations can vary considerably among individuals and entities. This survey describes the chest radiographic and, in particular, high-resolution computed tomographic and, in particular, high-resolution computed tomographic (HRCT) findings of individual lesions of the respiratory tract. It includes fibrosing alveolitis (alveolitis, interstitial pneumonia, pulmonary fibrosis) and bronchial (bronchitis/bronchiolitis, bronchiectasis), pleural and vascular manifestations, as well as lymphadenopathy and abnormalities related to therapy. We present typical patterns of changes in progressive systemic sclerosis (PSS, scleroderma), systemic lupus erythematosus (SLE), mixed connective tissue disease (MCTD, Sharp syndrome), Sjoegren syndrome, overlap syndrome and rheumatoid arthritis (RA). Furthermore, we describe findings which are specific for individual entities such as esophageal involvement in PSS, acute pneumonitis and pulmonary hemorrhage in SLE, lymphoproliferative disease in Sjoegren syndrome and necrobiotic nodules in RA. (orig.) [Deutsch] Die Kollagenosen koennen als systemische Bindegewebserkrankungen auch zu einem breiten Spektrum pathologischer Veraenderungen am Respirationstrakt fuehren, wobei sich Art und Ausmass der Manifestationen innerhalb einzelner Entitaeten und zwischen verschiedenen Krankheitsbildern erheblich unterscheiden koennen. In der vorliegenden Uebersicht werden die entsprechenden Befunde von Thoraxuebersichtsaufnahme und insbesondere hochaufloesender Computertomographie (HRCT) beschrieben. Beruecksichtigt werden dabei die fibrosierende Alveolitis (Alveolitis, interstitielle Pneumonie, Lungenfibrose), bronchiale (Bronchitis/Bronchiolitis, Bronchiektasen), pleurale und vaskulaere Manifestationen sowie Lymphadenopathie und therapie-induzierte Befunde. Typische Befundmuster

  9. Fibrosing gastrointestinal leiomyositis as a cause of chronic intestinal pseudo-obstruction in an 8-month-old dog.

    Science.gov (United States)

    Johnson, C S; Fales-Williams, A J; Reimer, S B; Lotsikas, P J; Haynes, J S

    2007-01-01

    An 8-month-old, female, mixed-breed dog presented to the Iowa State University Veterinary Teaching Hospital with a 1-month history of vomiting and diarrhea. An exploratory laparotomy was performed revealing markedly distended and fluid-filled small and large intestines that were not obstructed. The clinical condition of the dog did not improve subsequent to exploratory surgery, and it was euthanized. At necropsy, both the small and large intestines were distended (approximately 4 cm in diameter) and fluid-filled, and the wall was thin. The abdominal cavity contained approximately 500 ml of a brownish clear fluid. Microscopic lesions of the intestines were confined to the intestinal tunica muscularis and muscularis mucosae and consisted of locally extensive-to-diffuse replacement of the smooth muscle by fibrous tissue and multifocal infiltration by a moderately dense mononuclear inflammatory infiltrate. A unique finding was the presence of similar microscopic lesions in the tunica muscularis of the urinary bladder and stomach.

  10. Oxidative Stress Markers in Exhaled Breath Condensate in Lung Fibroses Are Not Significantly Affected by Systemic Diseases

    Czech Academy of Sciences Publication Activity Database

    Pelclová, D.; Fenclová, Z.; Syslová, K.; Vlčková, Š.; Lebedová, J.; Pecha, O.; Běláček, J.; Navrátil, Tomáš; Kuzma, Marek; Kačer, P.

    2011-01-01

    Roč. 49, č. 6 (2011), s. 746-754 ISSN 0019-8366 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z50200510 Keywords : 8-iso-prostaglandin F-2 alpha * 4-hydroxy-trans-2-nonenale * Malondialdehyde Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.940, year: 2011

  11. Fibrose hépatique : lien force mécanique et génotoxicité

    OpenAIRE

    Langouët , Sophie

    2014-01-01

    En 2012, en France, il y a eu 6.867 nouveaux cas de cancer du foie chez l’homme et 1.586 chez la femme. On soupçonne que les maladies du foie sont associées à un dysfonctionnement sévère des fonctions hépatiques et susceptibles d’entraîner une sensibilité accrue des patients vis-à-vis des contaminants environnementaux. Comment évaluer cette susceptibilité individuelle au cours de maladies chroniques, qui se prolongent dans le temps ? L’objectif du projet Mécagénotox est de caractériser et mod...

  12. Malignant transformation of a rat fibroma by the treatment with an anti-fibrosing drug: CY-168F (Plastenan

    Directory of Open Access Journals (Sweden)

    Sonia G. Andrade

    1981-09-01

    Full Text Available Fifteen albino (Sprague Dawley rats with subcutaneous transplanted fibromas was used in the present study. The tumour was formed by typical fibroblasts in a dense collagen matrix and was provenient from a fibroma that appeared spontaneously in an albino rat of the same strain. Ultrastructurally collagen disclosed normal periodicity and the fibroblasts showed irregular notched nuclei with irregular distribution of chromatin, that suggests transitional aspects to fibrosarcoma. The 15 animals, from different passage groups, were divided into: 8 animals submitted to treatment with the drug acexamic acid (CY-168F - N acetyl-amino-6-hexanoic acid (plastenan and 7 untreated control animals. Three of the treated animals showed a malignant transformation to fibrosarcoma. transitional histological features from typical fibroma to highly indifferentiated fibrosarcoma could be detected in come animal subjected to repeated biopsies. Ultrastructural study disclosed nuclear alterations and hyperactive ergastoplasm and collagen containing inclusions into the cytoplasm of fibroblasts. In the group of 7 untreated naimals, no malignant transformation could be detected histologically. Two aspects deserve attention: the malignant potential of a typical fibroma and the apparent effect of an antifibrosing drug in inducing malignization of this tumour.Foram utilizados no presente estudo, quinze ratos albinos (Sprague Dawley portadores de fibronas transplantados no tecido subcutâneo da parede abdominal. O tumor era constituído por fibroblastos típicos, em uma densa matriz colagênica e eram provenientes de um fibroma que apareceu espontaneamente em um rato albino da mesma linhagem. Ultraestruturalmente o colágeno mostrava periodicidade normal e os fibroblastos mostravam núcleo irregularmente denteado, com cromatina irregularmente distribuída, sugerindo aspectos transicionais para um fibrossarcoma. Os quinze animais, de diferentes grupos de passagem do tumor, foram divididos em: oito animais submetidos a tratamento com a droga CY-168F (Plastenan e sete animais controles não tratados. Três dos animais tratados mostraram uma transformação malígna para um fibrossarcoma. Em um dos animais emque foram feitas biópsias sucessivas, foram observados aspectos histológicos transicionais de um fibroma típico até um fibrossarcoma altamente indiferenciado. O estudo ultraestrutural demonstrou alterações nucleares, ergastoplasma hiperativo e inclusções contendo colágeno, no citoplasma dos fibroblastos. No grupo dos sete animais não tratados, não foi verificada transformação malígna do tumor. Dois aspectos merecem atenção neste estudo; o potencial malígno de um fibroma típico e o aparente efeito de um antifibrosante na indução da malignização deste tumor.

  13. The Impact of NSF-funded Physics Education Research at the University of Washington

    Science.gov (United States)

    Heron, Paula

    2015-03-01

    It is now well known that many students who complete introductory physics courses are unable to apply fundamental concepts in situations that involve qualitative reasoning. Systematic investigations have helped researchers understand why so many students fail to develop robust and coherent conceptual frameworks, and have led to the development of new teaching practices and materials that are far more effective than conventional ones. The Physics Education Group at the University of Washington has played a leading role in raising awareness of the need to improve instruction, and in supporting physics faculty in their efforts to do so. With support from the National Science Foundation, the group has helped build a research base that instructors can draw on, and has produced practical, flexible instructional materials that promote deeper learning in physics classrooms. Both ``Tutorials in Introductory Physics'' (Pearson, 2002) and ``Physics by Inquiry'' (Wiley, 1996) have been developed in an iterative process in which ongoing assessment of student learning plays an integral role. These materials have had a widespread and significant impact on physics teaching and on student learning from kindergarten through graduate school. In this talk I will describe the role of research in curriculum development, and speculate on the next generation of tools and resources to support physics teaching and learning.

  14. Growth of ruby crystals by the heat exchanger method, phase 1: NSF small business innovation research

    Science.gov (United States)

    Schmid, F.; Khattak, C. P.

    1980-03-01

    Conditions for the growth of large, uniformly doped laser crystals by the heat exchanger method are explored. Determination of the melt point, selection of crucible material and establishment of furnace operating parameters are discussed. The melt point of ruby was found to be 2040 plus or minus 10 C. Molybdenum crucibles can be used to contain ruby in vacuum as well as under argon atmospheres at desired superheat temperatures over extended periods required for crystal growth. Thermodynamic analysis was conducted and vapor pressures of volatile species calculated. Experimentally, volatilization of chromium oxides was suppressed by using welded covers on crucibles and operating under an argon pressure in the furnace.

  15. The mechanical development and construction of the insulating legs for the NSF tandem

    International Nuclear Information System (INIS)

    Leese, J.M.

    1978-06-01

    The Science Research Council is constructing at its Daresbury Laboratory a 30 MV tandem Van de Graaff accelerator which will be used as a research tool to accelerate ions of a wide range of elements. Ions are accelerated through an evacuated beam tube by maintaining a high electric field along it. The ion beam is steered and focussed by magnets situated at various positions along the tube, which, together with the beam handling elements, is supported by a vertical insulating stack. The stack consists of eight vertical columns tied together at regular intervals by stiff rings to obtain the necessary mechanical stability. Each column is made up of 'insulating legs' with tubular steel legs at the terminal and dead section positions. This report describes the manufacturing processes and their development for the insulating legs. (author)

  16. How Well Do the NSF Funded Elementary Mathematics Curricula Align with the GAISE Report Recommendations?

    Science.gov (United States)

    Bargagliotti, Anna E.

    2012-01-01

    Statistics and probability have become an integral part of mathematics education. Therefore it is important to understand whether curricular materials adequately represent statistical ideas. The "Guidelines for Assessment and Instruction in Statistics Education" (GAISE) report (Franklin, Kader, Mewborn, Moreno, Peck, Perry, & Scheaffer, 2007),…

  17. Evaluation of inlet sampling integrity on NSF/NCAR airborne platforms

    Science.gov (United States)

    Campos, T. L.; Stith, J. L.; Stephens, B. B.; Romashkin, P.

    2017-12-01

    An inlet test project was conducted during IDEAS-IV-GV (2013), to evaluate the sampling integrity of two inlet designs. Use of a single CO2 sensor provided a high precision detector and a large difference in the mean cabin and external concentrations (500-700 ppmv in the cabin). The original HIAPER Modular InLet (HIMIL) is comprised of a tapered flow straightening flow through `cigar' mounted to a strut. The cigar center sampling line sits 12" from the fuselage skin. An o-ring seals the feedthrough plate coupling sampling lines from the strut into the cigar. However, there is no seal to prevent air inside the strut from seeping out around the cigar body. A pressure-equalizing drain hole in the strut access panel; it was positioned at an approximate distance of 4" from the fuselage to ensure that air from any source that drained out of the strut was confined to a low release point. A second aft-facing inlet design was also evaluated. The sampling center line was moved farther from the fuselage at a height of 16". A similar approach was also applied to sampling locations on the C-130 in 2015. The results of these tests and recommendations for best practices will be presented.

  18. Notes on the voltage performance of accelerator tube sub-modules for the NSF tandem

    International Nuclear Information System (INIS)

    Eastham, D.A.; Groome, A.E.; Powell, P.

    1978-01-01

    Measurements are reported of the d.c. voltage performance of vacuum accelerator tube sub-modules for the Nuclear Structure Facility 30 MV Tandem at Daresbury. Using diagnostic techniques it has been possible to separate out the different processes in the tube which can lead to breakdown. As a result, improved sub-modules have been produced. Tests, have simulated the ion exchange processes which occur in longer tube lengths, and a better understanding has been obtained of the way in which these processes depend on the tube geometry and cleanliness. (U.K.)

  19. Cybersecurity Implications for Industry, Academia, and Parents: A Qualitative Case Study in NSF STEM Education

    Science.gov (United States)

    Stevenson, Gregory V.

    2017-01-01

    Rationale: Former President Barack Obama's $3.9 trillion for the 2015 fiscal year budget request included a $2.9 billion investment in Science, Technology, Engineering and Math (STEM) education. Research then showed that the national spending for cybersecurity has exceeded $10.7 billion in the 2015 fiscal year. Nonetheless, the number of…

  20. Real Time Data for Seismology at the IRIS Data Management Center, AN Nsf-Sponsored Facility

    Science.gov (United States)

    Benson, R. B.; Ahern, T. K.; Trabant, C.; Weertman, B. R.; Casey, R.; Stromme, S.; Karstens, R.

    2012-12-01

    When IRIS was incorporated in 1984, it committed to provide long-term support for the science of seismology. It first upgraded analog networks by installing observatory grade digital seismic recording equipment (by constructing the Global Seismic Network to upgrade the World Wide Standardized Seismographic Network) that became the backbone of the International Federation of Digital Seismic Networks (FDSN), and in 1990 constructed a state-of-the-art data center that would allow free and open access to data to everyone. For the first decade, IRIS leveraged a complicated system of telemetry which laid the foundation for delivering (relatively) high rate and continuous seismic time series data to the IRIS Data Management Center, which was designed to accept data that arrived with highly variable latencies and on many media formats. This meant that science had to often wait until data became complete, which at the time was primarily related to studying earthquakes or similar events. During the 1990's, numerous incremental but small improvements were made to get data into the hands of users with less latency, leveraging dialup, satellite telemetry, and a variety of Internet protocols. But beginning in 2000, the IRIS Data Management Center began the process of accumulating data comprehensively in real time. It was first justified because it eliminated the time-consuming transcription and manual data handling on various media formats, like magnetic tapes, CD's and DVD's. However, the switch to real-time telemetry proved to be a major improvement technologically because it not only simplified data transfer, it opened access to a large volume of previously inaccessible data (local resource limitations), and many networks began willingly providing their geophysical data to the broad research community. It also enabled researchers the ability to process data in different and streamlined ways, by incorporating data directly into workflows and processing packages. Any network on the Internet, small or large, can now share data, and today, the IRIS DMC receives nearly all of its seismic data from regional and international networks in real time. We will show that this evolution to managing real time data has provided the framework for accomplishing many important benefits that illustrate that open, real time data should be the goal of every observatory operation and can provide: - Faster (therefore cost and data saving) quality control, - Data products that highlight source properties and provide teachable moments - Data delivery to regional or national networks around the globe for immediate access for monitoring. -Use in teaching the public, providing streaming data to museums, schools, etc.

  1. NSF Workshop Report: Discovering General Principles of Nervous System Organization by Comparing Brain Maps across Species

    OpenAIRE

    Striedter, Georg F.; Belgard, T. Grant; Chen, Chun-Chun; Davis, Fred P.; Finlay, Barbara L.; Güntürkün, Onur; Hale, Melina E.; Harris, Julie A.; Hecht, Erin E.; Hof, Patrick R.; Hofmann, Hans A.; Holland, Linda Z.; Iwaniuk, Andrew N.; Jarvis, Erich D.; Karten, Harvey J.

    2014-01-01

    Efforts to understand nervous system structure and function have received new impetus from the federal Brain Research through Advancing Innovative Neurotechnologies (BRAIN) Initiative. Comparative analyses can contribute to this effort by leading to the discovery of general principles of neural circuit design, information processing, and gene-structure-function relationships that are not apparent from studies on single species. We here propose to extend the comparative approach to nervous sys...

  2. The design, manufacture and testing of the hydrostatic bearing for the NSF 900 analysing magnet

    International Nuclear Information System (INIS)

    Acton, W.J.; Myers, D.B.

    1978-10-01

    This report describes the design, manufacture and testing of the hydrostatic bearing which will be used to support the 90 0 analysing magnet of the 30 MV tandem electrostatic accelerator now being constructed at Daresbury Lboratory. (author)

  3. International Scientific Data, Standards, and Digital Libraries: An NSF NSDL (U.S. and CODATA Workshop

    Directory of Open Access Journals (Sweden)

    Laura M Bartolo

    2006-11-01

    Full Text Available There is little debate that recent advances in information technology (IT are revolutionizing the practice of science and expanding its impact on global society. It is still debatable whether the transformation can take full advantage of these advances without open, international standards, embraced by the scientific community. Accompanying the increases in computing power and bandwidth, considerable discussion has surfaced about the availability and exchange of scientific data. Common themes in the dialogue underscore the need for new visions of data organization, storage, and dissemination (Nature Editorial, 2005.

  4. NSF-supported education/outreach program takes young researchers to the Arctic

    Science.gov (United States)

    Alexeev, V. A.; Walsh, J. E.; Hock, R.; Kaden, U.; Euskirchen, E. S.; Kholodov, A. L.; Bret-Harte, M. S.; Sparrow, E. B.

    2015-12-01

    Today, more than ever, an integrated cross-disciplinary approach is necessary to explain changes in the Arctic and understand their implications for the human environment. Advanced training and active involvement of early-career scientists is an important component of this cross-disciplinary approach. This effort led by the International Arctic Research Center at the University of Alaska Fairbanks (UAF) started in 2003. The newly supported project in 2013 is planning four summer schools (one per year) focused on four themes in four different Arctic locations. It provides the participants with an interdisciplinary perspective on Arctic change and its impacts on diverse sectors of the North. It is linked to other ongoing long-term observational and educational programs (e.g. NABOS, Nansen and Amundsen Basins Observational System; LTER, Long Term Environmental Research) and targets young scientists by using the interdisciplinary and place-based setting to broaden their perspective on Arctic change and to enhance their communication skills. Each course for 15-20 people consists of classroom and hands-on components and work with a multidisciplinary group of mentors on projects devoted to themes exemplified by the location. A specialist from the School of Education at UAF evaluates student's progress during the summer schools. Lessons learned during the 12 years of conducting summer schools, methods of attracting in-kind support and approaches to teaching students are prominently featured in this study. Activities during the most recent school, conducted in Fairbanks and LTER Toolik Lake Field Station in 2015 are the focus of this presentation.

  5. Integration of Vocational and Academic Curricula through the NSF Advanced Technological Education Program (ATE).

    Science.gov (United States)

    Bailey, Thomas R.; Matsuzuka, Yukari

    A study examined the impact of the Advanced Technological Education (ATE) program on efforts in academic and vocational integration. A case study of 10 community colleges housing ATE-funded projects collected data through interviews with administrators, faculty, ATE program practitioners, and faculty and administrators at collaborating high…

  6. Analysis of Propagation Plans in NSF-Funded Education Development Projects

    Science.gov (United States)

    Stanford, Courtney; Cole, Renee; Froyd, Jeff; Henderson, Charles; Friedrichsen, Debra; Khatri, Raina

    2017-08-01

    Increasing adoption and adaptation of promising instructional strategies and materials has been identified as a critical component needed to improve science, technology, engineering, and mathematics (STEM) education. This paper examines typical propagation practices and resulting outcomes of proposals written by developers of educational innovations. These proposals were analyzed using the Designing for Sustained Adoption Assessment Instrument (DSAAI), an instrument developed to evaluate propagation plans, and the results used to predict the likelihood that a successful project would result in adoption by others. We found that few education developers propose strong propagation plans. Afterwards, a follow-up analysis was conducted to see which propagation strategies developers actually used to help develop, disseminate, and support their innovations. A web search and interviews with principal investigators were used to determine the degree to which propagation plans were actually implemented and to estimate adoption of the innovations. In this study, we analyzed 71 education development proposals funded by the National Science Foundation and predicted that 80% would be unsuccessful in propagating their innovations. Follow-up data collection with a subset of these suggests that the predictions were reasonably accurate.

  7. Providing Web Interfaces to the NSF EarthScope USArray Transportable Array

    Science.gov (United States)

    Vernon, Frank; Newman, Robert; Lindquist, Kent

    2010-05-01

    Since April 2004 the EarthScope USArray seismic network has grown to over 850 broadband stations that stream multi-channel data in near real-time to the Array Network Facility in San Diego. Providing secure, yet open, access to real-time and archived data for a broad range of audiences is best served by a series of platform agnostic low-latency web-based applications. We present a framework of tools that mediate between the world wide web and Boulder Real Time Technologies Antelope Environmental Monitoring System data acquisition and archival software. These tools provide comprehensive information to audiences ranging from network operators and geoscience researchers, to funding agencies and the general public. This ranges from network-wide to station-specific metadata, state-of-health metrics, event detection rates, archival data and dynamic report generation over a station's two year life span. Leveraging open source web-site development frameworks for both the server side (Perl, Python and PHP) and client-side (Flickr, Google Maps/Earth and jQuery) facilitates the development of a robust extensible architecture that can be tailored on a per-user basis, with rapid prototyping and development that adheres to web-standards. Typical seismic data warehouses allow online users to query and download data collected from regional networks, without the scientist directly visually assessing data coverage and/or quality. Using a suite of web-based protocols, we have recently developed an online seismic waveform interface that directly queries and displays data from a relational database through a web-browser. Using the Python interface to Datascope and the Python-based Twisted network package on the server side, and the jQuery Javascript framework on the client side to send and receive asynchronous waveform queries, we display broadband seismic data using the HTML Canvas element that is globally accessible by anyone using a modern web-browser. We are currently creating additional interface tools to create a rich-client interface for accessing and displaying seismic data that can be deployed to any system running the Antelope Real Time System. The software is freely available from the Antelope contributed code Git repository (http://www.antelopeusersgroup.org).

  8. Balancing Academic Teaching, Research, and Service: a Paradigm Emerging from NSF-TUES Sponsored Project Experiences

    Science.gov (United States)

    De Paor, D. G.

    2012-12-01

    As every academic administrator stresses in interviews with new faculty, the role of a professor today involves balancing three areas - teaching, research, and service. Few institutions can afford the old policy of promoting and tenuring faculty based solely on research output and grantsmanship, whilst ignoring poor teaching outcomes. Outreach activities involving parents and the extramural community are increasingly important as expensive universities and four-year colleges seek to demonstrate their relevance in the age of much less expensive community colleges and distance education. Nevertheless, many faculty complain that teaching and outreach duties compete for their valuable research time. Some fields of research have such broad impacts that they merit the dedicated time of our best scientists. However, other research projects constitute little more than publicly funded professorial hobbies. The challenge is to reliably identify and prioritize the research questions that merit investigation. IN ODU's geospatial visualization group, we instituted a policy requiring Ph.D. theses to include a component (at least one chapter) dedicated to the development and testing of learning resources. TAs test visualizations in their lab sections in tandem with their research studies. They must incorporate original geophysical mapping, modeling, and/or analysis in order to justify a degree in the Physics Department (the traditional home of Geophysics at our institution) rather than, say, the College of Education. Geospatial graduate students also train to offer planetarium presentations to the public using digital full-dome projection technology that can be used with a wide range of geoscience and planetary science topics. Thus they tackle the three aspects of academic work from the outset. In contrast, students in other programs frequently serve as TAs in their first and then switch to grant-supported RA work, resulting in a steady stream of new TAs with little or no training. Our policy has lead to the emergence of a paradigm for academic inquiry. We develop and test learning resources to cover the gamut of earth and planetary sciences, which we view as the science of four-dimensional place-time. Our learning objects emphasize the role of visualization in promoting understanding. If these resources fail to achieve desired outcomes, we look into their design but also examine our own understanding of topics, since instructor misconceptions are an obvious hindrance to learning. Redesign of visualizations may improve outcomes but sometimes the problem lies not with presentation or content knowledge, but rather with gaps in the science itself. Thus teaching and public outreach can become vehicles for the discovery of fertile research questions. Dissemination of a policy that eastablishes teaching and service as bridges leading to research products has the potential to generate transformative changes in the education that graduate students deliver and thus the education that undergraduate students receive.

  9. Women, Minorities, and Persons with Disabilities in Science and Engineering: 2004. NSF 04-317

    Science.gov (United States)

    National Science Foundation, 2004

    2004-01-01

    In October 1997, the U.S. Office of Management and Budget announced new government-wide standards for the collection of data on race and ethnicity (published as U.S. OMB 1999) effective January 1, 2003. Previously, racial/ethnic groups were identified as white, non-Hispanic; black, non-Hispanic; Hispanic; Asian or Pacific Islander; and American…

  10. The Institutionalization of NSF-ADVANCE at Lamont-Doherty Earth Observatory, Columbia University

    Science.gov (United States)

    Dutt, K.

    2011-12-01

    National level data indicate that women and minorities remain underrepresented in academic and research institutions, especially in the physical sciences. Current research shows evidence of "leaks" in the academic pipeline with women leaving academic and research institutions before attaining senior positions, the biggest leak occurring during postdoctoral years. These trends have been consistent with the LDEO experience with approximately 18% women at the junior scientist level in 2005 - a massive drop-off after approximately 41% women at the postdoctoral level. As a response to the recommendations of ADVANCE at Columbia University (2004-2009) the Office of Academic Affairs and Diversity was created within the LDEO Directorate in 2008 with the goal of increasing diversity through institutional transformation. The goals of this office are to: a) Develop and implement new policies and procedures to increase the recruitment, retention and advancement of women and minorities among the scientific staff; b) Impact key decision-making areas such as appointments, promotions, salary structures, and governance; c) Promote the advancement of postdoctoral scholars and junior staff; d) Stimulate an institutional cultural shift based on social science research on race and gender. A series of concerted efforts and initiatives in recent years have included: a) More structured search processes; b) Improved family leave policies and paid time off; c) Emphasis on advancement of postdoctoral scholars, including the implementation of a postdoctoral mentoring plan; and d) Promoting awareness within the LDEO community on diversity in the sciences. In recent years LDEO has experienced visible progress towards its diversity goals. The proportion of women among junior Lamont research professors has doubled from 18% in 2005 to 36% in 2011. The proportion of women on the junior scientific staff (excluding postdoctoral scholars) increased from 22% in 2005 to 37% in 2011. Overall, the proportion of women on the entire scientific staff, senior and junior (excluding postdoctoral scholars) has risen from 19% in 2005 to 27% in 2011. With the revised search processes, diversity in the applicant pool (defined as the number of women and/or racial minorities as a percent of the total number of applicants) increased dramatically, with 8 out of 10 searches over the period 2009-2010 showing a diversity of at least 70% in the applicant pool compared to an average diversity of less than 50% over the period 2007-2009. Of the new scientific hires in 2009-2010 almost half were either female or a racial minority. Postdoctoral scholars at LDEO have seen the greatest increase in racial diversity, from approximately 91% white in 2005 to 67% white in 2011. This group also has the most gender diversity at LDEO - approximately 47% female in 2011 up from 41% in 2005. Overall, the LDEO experience of institutionalizing ADVANCE has the potential to serve as a model for other scientific research institutions.

  11. DOE-NSF-NIH Workshop on Opportunities in THz Science, February 12-14, 2004

    Energy Technology Data Exchange (ETDEWEB)

    Sherwin, M.A.; Bucksbaum, P.H.; Schmuttenmaer, C. A.; Allen, J.; Biedron, S.; Carr, L.; Chamberlain, M.; Crowe, T.; DeLucia, F.; Hu, Q.; Jones, B.; Noordham, B.; Norris, T.; Orenstein, J.; Unterrainer, K.; Van der Meer, L.; Wilke, I.; Williams, G.; Zhang, X.-C.; Cheville, A.; Markelz, A.; Parks, B.; Plancken, P.; Shan, J.; Austin, B.; Basov, D.; Citrin, D.; Grundfest, W.; Heinz, T.; Kono, J.; Mittleman, D.; Siegel, P.; Taylor, T.; Jones, B.; Markelz, A.; Martin, M.; Nelson, K.; Smith, T.; Williams, G.; Allen, M.; Averitt, R.; Brunel, L.; Heilweil, T.; Heyman, J.; Jepsen, P.; Kaind, R.; Leemans, W.; Mihaly, L.; Rangan, C.; Tom, H.; Wallace, V.; Zimdars, D.

    2004-02-14

    This is the report of the Workshop on Opportunities in THz Science, held on February 12-14, 2004 in Arlington, VA. This workshop brought together researchers who use or produce THz radiation for physics, chemistry, biology, medicine, and materials science to discuss new research opportunities and common resource needs. The charge from the sponsors of the workshop was to focus on basic science questions within these disciplines that have and can be answered using THz radiation.

  12. Final Technical Report for NSF/DOE partnership grant ER54905; 2006-2009

    International Nuclear Information System (INIS)

    Stenzel, Reiner; Urrutia, J. Manuel

    2009-01-01

    The nonlinear physics of electron magnetohydrodynamics (EMHD) in plasmas. Time-varying wave magnetic field exceeding the background magnetic field produces highly nonlinear whistler mode since the wave dispersion depends on the total magnetic field. There exists no theory for such whistler modes. The present experimental work is the first one to explore this regime of nonlinear whistlers. A field-reversed configuration has been found which has the same vortex topology as an MHD spheromak, termed a whistler spheromak. Whistler mirrors have compressed and twisted field lines propagating in the whistler mode. Their helicity properties have been studied. Whistler spheromaks and mirrors have different propagation and damping characteristics. Wave collisions have been studied. Head-on collisions of two whistler spheromaks form a stationary field-reversed configuration (FRC) without helicity. When whistler spheromaks are excited the toroidal current flows mainly in the toroidal null line. It is only carried by electrons since ion currents and displacement currents are negligible. A change in the poloidal (axial) magnetic field induces a toroidal electric field which drives the current. Magnetic energy is dissipated and converted into electron kinetic energy. This process is called magnetic reconnection in 2D geometries, which are simplifications for theoretical convenience but rarely occur in nature. A crucial aspect of reconnection is its rate, determined by the electron collisionality. Regular Coulomb collisions can rarely account for the observed reconnection rates. In the present experiments we have also observed fast reconnection and explained it by electron transit time damping in the finite-size null layer. Electrons move faster than a whistler spheromak, hence transit through the toroidal null line where they are freely accelerated. The transit time is essentially the collision time but no particle collisions are required. Strong electron heating and visible light emissions are only observed in whistler spheromaks and FRCs but not in mirrors or asymmetric configurations lacking magnetic null lines. The collisionless electron energization in a toroidal null line usually produces non-Maxwellian distributions. Off the null axis electrons gain more perpendicular than parallel energy. Distributions with T # perpendicular# > T # parallel# lead to whistler instabilities which have been observed. A whistler spheromak is a source of high-frequency whistler emissions. These are usually small amplitude whistlers propagating in a complicated background magnetic field. The waves are emitted from a moving source. High frequency whistlers propagate faster than the spheromak, thus partly move ahead of it and partly in the reverse direction. In test wave experiments wave growth opposite to the direction of the hot electron flow has been observed, confirming that Doppler-shifted cyclotron resonance instabilities account for the emission process. Propagating whistler mirrors produce no significant instabilities except when they interact with other fields which exhibit null lines. For example, a whistler mirror has been launched against a stationary FRC, resulting in strong FRC heating and whistler instabilities. In the whistler mirror configuration the antenna near-zone field produces a toroidal null line outside the coil which can also become a source for whistler emissions. Finally, nonlinear EMHD research has been extended to initially unmagnetized plasmas where a new nonlinear skin depth has been discovered. When a small-amplitude oscillating magnetic field is applied to a plasma the field penetration is governed by the skin depth, collisional or collisionless depending on frequency, collision frequency and plasma frequency. However, when the magnetic field increases the electrons become magnetized and the field penetration occurs in the whistler mode if the cyclotron frequency exceeds the oscillating frequency. This phenomenon has been observed. A loop antenna creates a dipole field which is frozen into the plasma for a half cycle and becomes the background field for the wave launched by the next half cycle. The field topology consists of field-reversed dipoles of decreasing strength with distance. The propagation region depends on field amplitude but not on the skin depth. Our research has been published in 13 scientific papers.

  13. Report of the Panel on Electron Accelerator Facilities, DOE/NSF Nuclear Science Advisory Committee

    International Nuclear Information System (INIS)

    1983-04-01

    This Panel finds that the highest priority for new accelerator construction in the US nuclear physics program is for an electron accelerator of high duty factor capable of producing beams at any energy in the range from 500 to 4000 MeV. After detailed study and consideration of the proposals for such facilities submitted to it, the Panel recommends: that the proposal submitted by the Southeastern University Research Association (SURA) be accepted and funded for the construction of a new National Electron Accelerator Laboratory (NEAL) centering on a 4 GeV linear accelerator-stretcher ring system capable of delivering intense, high duty factor, electron beams in the energy range from 500 to 4000 MeV. Additional recommendations relating to this principal one are to be found in the body of this report. As modified by the Panel consequent to its own studies and analyses, the estimated cost (in 1983 dollars) of the accelerator complex is 111.8 million dollars; of the entire laboratory is 146.8 million dollars; and the operating cost averaged over the first five years of operation is 18.1 million dollars per year. The projected 15 year total cost of the project is 418.3 million dollars. The construction period is estimated to be 4.5 years. The NEAL Laboratory, from the outset will be constructed and managed as a national rather than a regional facility and will provide the United States with a truly unique facility for research in electromagnetic physics

  14. Use of real-time tools to support field operations of NSF's Lower Atmosphere Observing Facilities

    Science.gov (United States)

    Daniels, M.; Stossmeister, G.; Johnson, E.; Martin, C.; Webster, C.; Dixon, M.; Maclean, G.

    2012-12-01

    NCAR's Earth Observing Laboratory (EOL) operates Lower Atmosphere Observing Facilities (LAOF) for the scientific community, under sponsorship of the National Science Foundation. In order to obtain the highest quality dataset during field campaigns, real-time decision-making critically depends on the availability of timely data and reliable communications between field operations staff and instrument operators. EOL incorporates the latest technologies to monitor the health of instrumentation, facilitate remote operations of instrumentation and keep project participants abreast of changing conditions in the field. As the availability of bandwidth on mobile communication networks and the capabilities of their associated devices (smart phone, tablets, etc.) improved, so has the ability of researchers to respond to rapidly changing conditions and coordinate ever more detailed measurements from multiple remote fixed, portable and airborne platforms. This presentation will describe several new tools that EOL is making available to project investigators and how these tools are being used in a mobile computing environment to support enhanced data collection during field campaigns. LAOF platforms such as radars, aircraft, sondes, balloons and surface stations all rely on displays of real-time data for their operations. Data from sondes are ingested into the Global Telecommunications System (GTS) for assimilation into regional forecasting models that help guide project operations. Since many of EOL's projects occur around the globe and at the same time instrument complexity has increased, automated monitoring of instrumentation platforms and systems has become essential. Tools are being developed to allow remote instrument control of our suite of observing systems where feasible. The Computing, Data and Software (CDS) Facility of EOL develops and supports a Field Catalog used in field campaigns for nearly two decades. Today, the Field Catalog serves as a hub for the collection and browsing of field research products, related operational and forecast imagery, project documentation as well as tools for real-time decision-making, communication, mission planning and post analysis. Incorporation of new capabilities into the Field Catalog to support the mobile computing environment and devices has led to the development of new tools which will be described. EOL/CDS has also developed a customized Internet Relay Chat (IRC) chat system to enable communication between all project participants distributed across various land-based, shipboard and airborne remote sites. The CDS chat system has incorporated aspects of fault tolerance in order to handle intermittent communications links. NOAA and NASA have used this chat system for their field missions as well. These new tools were recently deployed in support of the Deep Convective Clouds and Chemistry (DC3) field campaign that took place May - June 2012 in the Central United States. This presentation will show examples of these real-time tools from recent projects. We will also describe some of the challenges, problems and surprises, as well as improvements that have been made to the tools. The capabilities of this system continue to advance, taking advantage of new technology and guided by our experience and feedback from users participating in field campaigns.

  15. Fiber link design for the NASA-NSF extreme precision Doppler spectrograph concept "WISDOM"

    Science.gov (United States)

    Fżrész, Gábor; Pawluczyk, Rafal; Fournier, Paul; Simcoe, Robert; Woods, Deborah F.

    2016-08-01

    We describe the design of the fiber-optic coupling and light transfer system of the WISDOM (WIYN Spectrograph for DOppler Monitoring) instrument. As a next-generation Precision Radial Velocity (PRV) spectrometer, WISDOM incorporates lessons learned from HARPS about thermal, pressure, and gravity control, but also takes new measures to stabilize the spectrograph illumination, a subject that has been overlooked until recently. While fiber optic links provide more even illumination than a conventional slit, careful engineering of the interface is required to realize their full potential. Conventional round fiber core geometries have been used successfully in conjunction with optical double scramblers, but such systems still retain a memory of the input illumination that is visible in systems seeking sub-m/s PRV precision. Noncircular fibers, along with advanced optical scramblers, and careful optimization of the spectrograph optical system itself are therefore necessary to study Earth-sized planets. For WISDOM, we have developed such a state-of-the-art fiber link concept. Its design is driven primarily by PRV requirements, but it also manages to preserve high overall throughput. Light from the telescope is coupled into a set of six, 32 μm diameter octagonal core fibers, as high resolution is achieved via pupil slicing. The low-OH, step index, fused silica, FBPI-type fibers are custom designed for their numerical aperture that matches the convergence of the feeding beam and thus minimizes focal ratio degradation at the output. Given the demanding environment at the telescope the fiber end tips are mounted in a custom fused silica holder, providing a perfect thermal match. We used a novel process, chemically assisted photo etching, to manufacture this glass fiber holder. A single ball-lens scrambler is inserted into the 25m long fibers. Employing an anti-reflection (AR) coated, high index, cubic-zirconia ball lens the alignment of the scrambler components are straightforward, as the fiber end tips (also AR coated) by design touch the ball lens and thus eliminate spacing tolerances. A clever and simple opto-mechanical design and assembly process assures micron-level self-alignment, yielding a 87% throughput and a scrambling gain of >20,000. To mitigate modal noise the individual fibers then subsequently combined into a pair of rectangular fibers, providing a much larger modal area thanks to the 34x106 micron diameter. To minimize slit height, and thus better utilize detector area, the octagonal cores are brought very close together in this transition. The two outer fibers are side polished at one side, into a D-shaped cladding, while the central fiber has a dual side polish. These tapered, side-flattening operations are executed with precise alignment to the octagonal core. Thus the cores of the 3 fibers are brought together and aligned within few microns of each other before spliced onto the rectangular fiber. Overall throughput kept high and FRD at bay by careful management of fiber mounting, vacuum feed-through, application of efficient AR coatings, and implementation of thermal breaks that allow for independent expansion of the fibers and the protective tubing.

  16. Postsecondary STEM Education for Students with Disabilities: Lessons Learned from a Decade of NSF Funding

    Science.gov (United States)

    Thurston, Linda P.; Shuman, Cindy; Middendorf, B. Jan; Johnson, Cassandra

    2017-01-01

    The Research in Disabilities Education Synthesis Project (RDE-SP), a four-year mixed methods research project, assessed a decade of funded projects (2001-2011) under the National Science Foundation's Research in Disabilities Education program which is aimed at increasing participation and retention of students with disabilities (SWD) in Science,…

  17. Unconscious Bias - The Focus of the University of Arizona's NSF ADVANCE Award

    Science.gov (United States)

    Richardson, R. M.; Tolbert, L. P.; Vaillancourt, A. M.; Leahey, E. E.; Rodrigues, H. A.

    2011-12-01

    The University of Arizona ADVANCE program focuses on unconscious bias and ways to minimize its negative impact on the academy. Unconscious bias involves social stereotypes about certain groups of people that individuals form outside their own consciousness. Overwhelming scientific evidence supports that unconscious bias pervasively influences hiring, evaluation, selection of leaders, and even daily interactions. UA ADVANCE has a three-tiered strategy for improving the representation and advancement of women faculty in STEM departments that includes: 1) fostering the scientific and leadership careers of women; 2) promoting responsibility for gender equity among faculty and administrators; and 3) developing management software useful for promoting more equitable decision-making. This strategy has brought together a diverse array of faculty, staff, and faculty administrators working toward a common goal of promoting faculty diversity and the equitable treatment of faculty. Among the most effective aspects of our programming and products have been: 1) department head and search committee trainings; 2) monthly career discussion series events, and; 3) a salary modeling tool for department heads and deans. One key to the success of these efforts has been collaborations with campus partners, including the Office of the Associate Provost for Faculty Affairs, the Office of the Special Advisor to the President for Diversity and Inclusion, and the Division of Human Resources. A second key has been a commitment to the use of research-based material and tools, presented by respected colleagues, in small workshop-style settings that foster discussion. This has enabled us to extend our reach to more STEM departments and secure broader support in creating a more equitable environment for women faculty. Nearing the close of our grant period, our efforts are now concentrated on institutionalizing success. UA ADVANCE needs continued support from an increasingly tasked administration in a transitional environment where the University is in the middle of national searches for both president and provost. In addition to unknown new leadership, there is an ongoing hiring freeze, additional budget cuts are anticipated, and more institutional reorganization is likely. An added challenge has been the difficulty of assessing true impact beyond participation, even with professional assessment. Fortunately, the UA ADVANCE team has worked in a challenging environment for much of its award period, and remains fundamentally optimistic about efforts to reduce the negative effects of unconscious bias in hiring, evaluating, and rewarding a diverse faculty.

  18. NSF/AFOSR/ASME Workshop on Tribology Issues and Opportunities in MEMS

    CERN Document Server

    1998-01-01

    Micro Electro Mechanical Systems (MEMS) is already about a billion dollars a year industry and is growing rapidly. So far major emphasis has been placed on the fabrication processes for various devices. There are serious issues related to tribology, mechanics, surfacechemistry and materials science in the operationand manufacturingof many MEMS devices and these issues are preventing an even faster commercialization. Very little is understood about tribology and mechanical properties on micro- to nanoscales of the materials used in the construction of MEMS devices. The MEMS community needs to be exposed to the state-of-the-artoftribology and vice versa. Fundamental understanding of friction/stiction, wear and the role of surface contamination and environmental debris in micro devices is required. There are significantadhesion, friction and wear issues in manufacturing and actual use, facing the MEMS industry. Very little is understood about the tribology of bulk silicon and polysilicon films used in the constr...

  19. NSF Antarctic and Arctic Data Consortium; Scientific Research Support & Data Services for the Polar Community

    Science.gov (United States)

    Morin, P. J.; Pundsack, J. W.; Carbotte, S. M.; Tweedie, C. E.; Grunow, A.; Lazzara, M. A.; Carpenter, P.; Sjunneskog, C. M.; Yarmey, L.; Bauer, R.; Adrian, B. M.; Pettit, J.

    2014-12-01

    The U.S. National Science Foundation Antarctic & Arctic Data Consortium (a2dc) is a collaboration of research centers and support organizations that provide polar scientists with data and tools to complete their research objectives. From searching historical weather observations to submitting geologic samples, polar researchers utilize the a2dc to search andcontribute to the wealth of polar scientific and geospatial data.The goals of the Antarctic & Arctic Data Consortium are to increase visibility in the research community of the services provided by resource and support facilities. Closer integration of individual facilities into a "one stop shop" will make it easier for researchers to take advantage of services and products provided by consortium members. The a2dc provides a common web portal where investigators can go to access data and samples needed to build research projects, develop student projects, or to do virtual field reconnaissance without having to utilize expensive logistics to go into the field.Participation by the international community is crucial for the success of a2dc. There are 48 nations that are signatories of the Antarctic Treaty, and 8 sovereign nations in the Arctic. Many of these organizations have unique capabilities and data that would benefit US ­funded polar science and vice versa.We'll present an overview of the Antarctic & Arctic Data Consortium, current participating organizations, challenges & opportunities, and plans to better coordinate data through a geospatial strategy and infrastructure.

  20. 45 CFR 680.12 - One-year NSF post-employment restrictions.

    Science.gov (United States)

    2010-10-01

    ... when granting an exception would not result in an unfair advantage to the former employee. (c)(1... individuals or firms; adjudicatory hearings; and court cases. (2) For former employees, other than special...; (iii) Decisions to open or not open a contract to competitive bidding; (iv) General policy or...

  1. Integrating Research and Extension for the Nsf-Reu Program in Water Resources

    Science.gov (United States)

    Judge, J.; Migliaccio, K.; Gao, B.; Shukla, S.; Ehsani, R.; McLamore, E.

    2011-12-01

    Providing positive and meaningful research experiences to students in their undergraduate years is critical for motivating them to pursue advanced degrees or research careers in science and engineering. Such experiences not only offer training for the students in problem solving and critical thinking via hands-on projects, but also offer excellent mentoring and recruiting opportunities for the faculty advisors. The goal of the Research Experience for Undergraduates (REU) Program in the Agricultural and Biological Engineering Department (ABE) at the University of Florida (UF) is to provide eight undergraduate students a unique opportunity to conduct research in water resources using interdisciplinary approaches, integrating research and extension. The students are selected from diverse cultural and educational backgrounds. The eight-week REU Program utilizes the extensive infrastructure of UF - Institute of Food and Agricultural Sciences (IFAS) through the Research and Education Centers (RECs). Two students are paired to participate in their own project under the direct supervision of one of the four research mentors. Four of the eight students are located at the main campus, in Gainesville, Fl, and four remaining students are located off-campus, at the RECs, where some of the ABE faculty are located. The students achieve an enriching cohort experience through social networking, daily blogs, and weekly video conferences to share their research and other REU experiences. The students are co-located during the Orientation week and also during the 5-day Florida Waters Tour. Weekly group meetings and guest lectures are conducted via synchronously through video conferencing. The integration of research and extension is naturally achieved through the projects at the RECs, the guest lectures, Extension workshops, and visits to the Water Management Districts in Florida. In the last two years of the Program, we have received over 80 applicants, from four-year and advanced degree offering institutions and a variety of majors such as Geology, Meteorology, Environmental Sciences & Engineering, Civil Engineering, Water Resources, Agricultural Engineering, Physics, Geography, Chemical Engineering, to name a few. This model of providing integrated research and extension opportunities in hydrology where not all the REU participants are physically co-located, is unique and can be extended to other disciplines.

  2. Final Technical Report for NSF/DOE partnership grant 1004284/ER54905/SC0004660; 2011- 2013

    Energy Technology Data Exchange (ETDEWEB)

    Stenzel, Reiner [University of California, Los Angeles, CA (United States); Urrutia, Manuel [University of California, Los Angeles, CA (United States)

    2014-10-15

    Research has been performed on two topics: (1) Nonlinear time-dependent phenomena in the regime of electron magnetohydrodynamics (EMHD). (2) Plasma structures forming ”bubbles”. The latter are regions of localized density depletions or enhancements separated from the ambient plasma by sheaths or double layers. Three-dimensional magnetic null points can also be considered as ”magnetic bubbles”. Nonlinear EMHD fields are generated by pulsed magnetic loops. The magnetic field varies in time faster than an ion cyclotron period, hence interacts only with electrons. Space charge electric fields are created when magnetic forces try to separate electrons from ions. Electric and magnetic forces nearly balance to keep the plasma quasi neutral. This leads to rotational electron motions, i.e. Hall currents and associated magnetic perturbations. When the time scale falls between the ion and electron cyclotron period the magnetic perturbation is convected in the whistler mode. When the time-varying magnetic field exceeds the background magnetic field the whistler mode becomes highly nonlinear since its properties depend on the total magnetic field. When the time-varying magnetic field creates magnetic null points or null lines EMHD breaks down. Electrons can be accelerated in null lines which dissipated magnetic energy like in magnetic reconnection. Energized electrons with anisotropic distributions create secondary whistler instabilities. These effects have been observed in field topologies resembling spheromaks and field-reversed configurations (FRCs). The whistler mode propagation near magnetic nulls is not trivial when the field gradients and wavelength are comparable. Ray tracing is inappropriate when the WKB approximation breaks down. Experiments have been started to map wave propagation on curved field lines with null points. Initial results show that whistlers in highly nonuniform fields have highly oblique phase velocities but the energy flow remains dominantly along the field. Density bubbles are created by anode discharges, typically forming spherical ”fireballs” bounded by a double layer. In a magnetized plasma the shape becomes cylindrical, in nonuniform magnetic fields many asymmetric fireball shapes are possible. Due to electron energization the fireball plasma has higher density and temperature than the ambient plasma. The double layer can also be produced by a high transparency positively biased grid. Instabilities arise from the electron transit through the plasma bubble and the double layer. When a permanent magnet is biased positively the electrons perform ExB drifts in the equatorial plane between the poles. Electron drift modes are excited with a high spectral contents. Similarly, a negatively biased magnet produces a disk-shaped plasma bubble. The cold magnet emits secondary electrons due to the impact of energetic ions. Such magnetron discharges exhibit a variety of instabilities which affect the cross-field transport and sputtering applications. This report will summarize the main effects observed and provide references to more detailed publications.

  3. Quantitative radioisotope measurements with the NSF-Arizona regional accelerator facility

    International Nuclear Information System (INIS)

    Zabel, T.H.; Damon, P.E.; Donahue, D.J.; Jull, A.J.T.

    1983-01-01

    Results of tests on the tandem accelerator mass spectrometer (TAMS) at the University of Arizona are presented. These results demonstrate: (a) measurements of 14 C/ 13 C ratios with precisions of a few percent can be made in a period of one to several hours; (b) measurements with precisions of 0.5% have been made in which the uncertainties were mainly statistical and in which contributions to the uncertainty of machine fluctuations were negligible; (c) precise measurements of the ratio of 14 C/ 13 C in samples of N.B.S. oxalic acid and of 1890 wood are consistent with the accepted value of that ratio; (d) the real signal from a 44,000 year old sample is equal to the background rate produced from a dead carbon sample. In addition, results of some measurements on archaeological samples are presented

  4. Nanostructured materials for multifunctional applications under NSF-CREST research at Norfolk State University

    Science.gov (United States)

    Pradhan, A. K.; Mundle, R.; Zhang, K.; Holloway, T.; Amponsah, O.; Biswal, D.; Konda, R.; White, C.; Dondapati, H.; Santiago, K.; Birdsong, T.; Arslan, M.; Peeples, B.; Shaw, D.; Smak, J.; Samataray, C.; Bahoura, M.

    2012-04-01

    Magnetic nanoparticles of CoFe2O4 have been synthesized under an applied magnetic field through a co-precipitation method followed by thermal treatments at different temperatures, producing nanoparticles of varying size. The magnetic behavior of these nanoparticles of varying size was investigated. As-grown nanoparticles demonstrate superparamagnetism above the blocking temperature, which is dependent on the particle size. The anomalous magnetic behavior is attributed to the preferred Co ions and vacancies arrangements when the CoFe2O4 nanoparticles were synthesized under applied magnetic field. Furthermore, this magnetic property is strongly dependent on the high temperature heat treatments, which produce Co ions and vacancies disorder. We performed the fabrication of condensed and mesoporous silica coated CoFe2O4 magnetic nanocomposites. The CoFe2O4 magnetic nanoparticles were encapsulated with well-defined silica layer. The mesopores in the shell were fabricated as a consequence of removal of organic group of the precursor through annealing. The NiO nanoparticles were loaded into the mesoporous silica. The mesoporous silica coated magnetic nanostructure loaded with NiO as a final product may have potential use in the field of biomedical applications. Growth mechanism of ZnO nanorod arrays on ZnO seed layer investigated by electric and Kelvin probe force microscopy. Both electric and Kelvin force probe microscopy was used to investigate the surface potentials on the ZnO seed layer, which shows a remarkable dependence on the annealing temperature. The optimum temperature for the growth of nanorod arrays normal to the surface was found to be at 600 °C, which is in the range of right surface potentials and energy measured between 500 °C and 700 °C. We demonstrated from both EFM and Kelvin force probe microscopy studies that surface potential controls the growth of ZnO nanorods. This study will provide important understanding of growth of other nanostructures. ZnO nanolayers were also grown by atomic layer deposition techniques. These nanolayers of ZnO demonstrate remarkable optical and electrical properties. These nanolayers were patterned by the Electron Beam Lithography (EBL) technique. A major goal of nanotechnology is to couple the self-assembly of molecular nanostructures with conventional lithography, using either or both bottom-up and top-down fabrication methods, that would enable us to register individual molecular nanostructures onto the functional devices. However, combining the nanofabrication technique with high resolution Electron Beam Lithography, we can achieve 3D bimolecular or/and DNA origami that will be able to identify nucleic acid sequences, antigen targets, and other molecules, as for a perfect nano-biosensor. We have explored some of the nanopatterning using EBL in order to fabricate biomolecule sensing on a single chip with sub nm pitch. The applications are not limited for the bioactivity, but for enhancing immunoreactions, cell culture dishes, and tissue engineering applications.

  5. Noted astrophysicist Michael S. Turner to Head NSF'S mathematical and physical sciences directorate

    CERN Multimedia

    2003-01-01

    "The National Science Foundation has named celebrated astrophysicist Michael S. Turner of the University of Chicago as Assistant Director for Mathematical and Physical Sciences. He will head a $1 billion directorate that supports research in mathematics, physics, chemistry, materials and astronomy, as well as multidisciplinary programs and education" (1/2 page).

  6. Possible involvement of gadolinium chelates in the pathophysiology of nephrogenic systemic fibrosis: A critical review

    International Nuclear Information System (INIS)

    Idee, Jean-Marc; Port, Marc; Medina, Christelle; Lancelot, Eric; Fayoux, Emmanuelle; Ballet, Sebastien; Corot, Claire

    2008-01-01

    Nephrogenic systemic fibrosis (NSF) is a recently described, highly debilitating scleroderma-like disease occurring in patients with severe or end-stage renal failure. NSF is characterized by cutaneous papules and coalescing plaques ('peau d'orange' appearance) and a wooden consistency. It may ultimately cause disabling contractures of several joints, thus making many patients wheelchair-dependent. NSF has been associated to prior administration of gadolinium chelates (GC) used as contrast agents for magnetic resonance imaging. The best available treatment option at the present time is renal transplantation. The mechanism of NSF has not been fully elucidated. Several hypotheses have been proposed so far and are critically discussed in the present review article. Gadolinium has been found in skin biopsy samples of patients. The most widely accepted hypothesis is related to dechelation of less stable GC, progressively releasing free Gd 3+ which may subsequently lead to the attraction of CD34+, CD45+, pro-collagen+ circulating fibrocytes via the release of chemokines, thereby inducing systemic fibrosing disorders. Pre-existing renal failure may facilitate the process by delaying the excretion of GC. A complex interplay between gadolinium and co-factors (pro-inflammatory status, vascular injury, high dose of erythropoietin, high levels of calcium, phosphorus, etc.) may occur in patients with impaired renal function. This and other hypotheses remain to be investigated, as well as the role and independence of co-factors

  7. Automated scanning electron microscopy and x-ray microanalysis for in situ quantification of gadolinium deposits in skin

    International Nuclear Information System (INIS)

    Thakral, Charu; Abraham, Jerrold L.

    2007-01-01

    Gadolinium (Gd) has been identified as a possible causative agent of an emerging cutaneous and systemic fibrosing disorder, nephrogenic systemic fibrosis (NSF), which can cause serious disability and even death. To date, there are only two known associations with this disorder - renal insufficiency and Gd enhanced magnetic resonance imaging (MRI). We developed an automated quantitative scanning electron microscopy (SEM) and Energy dispersive x-ray spectroscopy (EDS) method for Gd in tissue of NSF patients. Freshly cut paraffin block surfaces examined using the variable pressure mode under standardized conditions and random search of the tissue area allow in situ detection and semiquantitative morphometric (volumetric) analysis of insoluble higher atomic number features using backscattered electron imaging. We detected Gd ranging from 1 to 2270 cps/mm 2 in 57 cutaneous biopsies of NSF. Gd was associated with P, Ca, and usually Na in tissue deposits. Our method reproducibly determines the elemental composition, relative concentration, and spatial distribution of detected features within the tissue. However, we cannot detect features below our spatial resolution, nor concentrations below the detection limit of our SEM/EDS system. The findings confirm transmetallation and release of toxic Gd ions in NSF and allow dose-response analysis at the histologic level. (author)

  8. Nephrogenic systemic fibrosis

    International Nuclear Information System (INIS)

    Samtleben, W.

    2007-01-01

    A scleromyxedema-like disease was recognized in 1997. In 2000 this disorder was first published and termed nephrogenic fibrosing dermopathy because all patients had advanced renal failure. In 2006 it was discovered that the patients had a history of a preceding contrast-enhanced magnetic resonance imaging (MRI). All patients had acute or chronic severe renal insufficiency with a glomerular filtration rate (GFR) 2 . So far a total of about 215 patients with this new skin disorder have been reported to international registries. The skin thickening has a typical histology and begins in the peripheral extremities and progresses proximally, including also the abdominal wall and the head in some patients. NSF involves not only the skin, but also the muscles and other organs (e.g., lungs, heart, eyes) in some patients. Therefore the term nephrogenic systemic fibrosis (NSF) was introduced. Skin fibrosis and sclerosis are usually progressive with disabling contractures of involved joints (knees, hands, feet). NSF may be lethal in up to 28% of patients. Spontaneous remissions are rare. No generally accepted treatment is available. So far, the pathogenesis is not well understood. One hypothesis supposes a role of gadolinium liberated from the contrast agents. As patients with acute or chronic advanced renal failure (GFR 2 ) including those with hepatorenal dysfunctions are at high risk to develop NSF after exposure to gadolinium-based contrast agents, contrast-enhanced MRI should be avoided in this group and alternative diagnostic procedures should be used whenever possible. (orig.) [de

  9. Nephrogenic systemic fibrosis

    Directory of Open Access Journals (Sweden)

    Bhushan Madke

    2011-01-01

    Full Text Available Nephrogenic systemic fibrosis (NSF is a relatively new fibrosing disorder which has caught the attention of various specialities in the past decade. NSF is an extremely disabling and often painful condition, affecting up to 13% of the individuals with chronic kidney disease. The administration of a gadolinium chelate contrast agent has been reported to induce the development of NSF, particularly in patients who have acute or chronic renal disease with a glomerular filtration rate (GFR lower than 30-mL/min/1.73 m 2 and in those with acute renal insufficiency. Mass spectroscopy studies have demonstrated particles of gadolinium in the lesional tissue. The exact pathogenesis of this curious sclerosing condition is unknown. The role of the aberrant targeting of ′circulating fibrocytes′ to the peripheral tissues and viscera has been hypothesized. NSF has distinct clinicopathological features in the setting of renal failure and needs to be looked upon as a new entity on the block. The condition is characterized by irregular indurated plaques, with amoeba-like projections and islands of sparing, chiefly on the trunk and extremities. Flexion contractures of fingers, knees, and elbow joints are known to occur in advanced cases of NSF. The course is frequently associated with painful episodes and loss of ambulation. Histopathology shows haphazard arrangement of thickened bundles of collagen, varying amount of mucin, and increased population of fibroblast-like cells in the dermis. Immunohistochemistry shows increased deposition of type-I procollagen and CD 34+ cells having fibroblastic activity. The condition is refractory to treatment with corticosteroids and immunosuppressive agents. Various modalities of therapy such as UVA1 phototherapy, imatinib mesylate, photodynamic therapy, plasmapheresis, extracorporeal photochemotherapy, and high-dose intravenous immunoglobulin have shown a moderate degree of improvement in skin thickness scores. A prudent

  10. Aberrant immune response with consequent vascular and connective tissue remodeling - causal to scleroderma and associated syndromes such as Raynaud phenomenon and other fibrosing syndromes?

    Science.gov (United States)

    Durmus, Nedim; Park, Sung-Hyun; Reibman, Joan; Grunig, Gabriele

    2016-11-01

    Scleroderma and other autoimmune-induced connective tissue diseases are characterized by dysfunctions in the immune system, connective tissue and the vasculature. We are focusing on systemic sclerosis (SSc)-associated pulmonary hypertension, which remains a leading cause of death with only a 50-60% of 2-year survival rate. Much research and translational efforts have been directed at understanding the immune response that causes SSc and the networked interactions with the connective tissue and the vasculature. One of the unexpected findings was that in some cases the pathogenic immune response in SSc resembles the immune response to helminth parasites. During coevolution, means of communication were developed which protect the host from over-colonization with parasites and which protect the parasite from excessive host responses. One explanation for the geographically clustered occurrence of SSc is that environmental exposures combined with genetic predisposition turn on triggers of molecular and cellular modules that were once initiated by parasites. Future research is needed to further understand the parasite-derived signals that dampen the host response. Therapeutic helminth infection or treatment with parasite-derived response modifiers could be promising new management tools for autoimmune connective tissue diseases.

  11. Comparative study of Candida in oral submucous fibrosis and healthy individuals = Estudo comparativo de Candida em fibrose submucosa oral e indivíduos saudáveis

    Directory of Open Access Journals (Sweden)

    Anila, K.

    2011-01-01

    Conclusão: A incidência e intensidade de Candida (primariamente C. albicans foi maior nos pacientes com FSO que nos sujeitos controle, mas estes achados estavam dentro dos limites normais (3-47%. Portanto, Candida pode não ser um fator etiológico na transformação maligna. Entretanto, ainda há controvérsias se o hábito de mascar ‘betel’ em casos de FSO teria um efeito inibidor ou promoveria a aderência e invasão de Candida

  12. Comparative study of Candida in oral submucous fibrosis and healthy individuals = Estudo comparativo de Candida em fibrose submucosa oral e indivíduos saudáveis

    Directory of Open Access Journals (Sweden)

    Anila, K.

    2011-01-01

    Conclusão: A incidência e intensidade de Candida (primariamente C. albicans foi maior nos pacientes com FSO que nos sujeitos controle, mas estes achados estavam dentro dos limites normais (3-47%. Portanto, Candida pode não ser um fator etiológico na transformação maligna. Entretanto, ainda há controvérsias se o hábito de mascar ‘betel’ em casos de FSO teria um efeito inibidor ou promoveria a aderência e invasão de Candida.

  13. Photobiomodulation therapy alleviates tissue fibroses associated with chronic Graft-Versus-Host Disease : Two case reports and putative anti-fibrotic roles of TGF-β

    NARCIS (Netherlands)

    Epstein, J.B.; Raber-Durlacher, J.E.; Huysmans, M.C.; Schoordijk, M.C.E.; Cheng, J.E.; Bensadoun, R.J.; Arany, P.R.

    2018-01-01

    Objective: Patients who receive allogeneic hematopoietic stem cell transplantation may experience oral complications due to chronic graft-versus-host disease (cGVHD). The manifestations may include progressive sclerosis-like changes that may involve various body sites, including the oropharynx.

  14. Photobiomodulation Therapy Alleviates Tissue Fibroses Associated with Chronic Graft-Versus-Host Disease: Two Case Reports and Putative Anti-Fibrotic Roles of TGF-

    NARCIS (Netherlands)

    Epstein, Joel B.; Raber-Durlacher, Judith E.; Huysmans, Marie-Charlotte; Schoordijk, Maria C. E.; Cheng, Jerry E.; Bensadoun, Rene-Jean; Arany, Praveen R.

    2018-01-01

    Objective: Patients who receive allogeneic hematopoietic stem cell transplantation may experience oral complications due to chronic graft-versus-host disease (cGVHD). The manifestations may include progressive sclerosis-like changes that may involve various body sites, including the oropharynx.

  15. Remote Sensing for Hazard Mitigation and Resource Protection in Pacific Latin America: New NSF sponsored initiative at Michigan Tech.

    Science.gov (United States)

    Rose, W. I.; Bluth, G. J.; Gierke, J. S.; Gross, E.

    2005-12-01

    Though much of the developing world has the potential to gain significantly from remote sensing techniques in terms of public health and safety and, eventually, economic development, they lack the resources required to advance the development and practice of remote sensing. Both developed and developing countries share a mutual interest in furthering remote sensing capabilities for natural hazard mitigation and resource development, and this common commitment creates a solid foundation upon which to build an integrated education and research project. This will prepare students for careers in science and engineering through their efforts to solve a suite of problems needing creative solutions: collaboration with foreign agencies; living abroad immersed in different cultures; and adapting their academic training to contend with potentially difficult field conditions and limited resources. This project makes two important advances: (1) We intend to develop the first formal linkage among geoscience agencies from four Pacific Latin American countries (Guatemala, El Salvador, Nicaragua and Ecuador), focusing on the collaborative development of remote sensing tools for hazard mitigation and water resource development; (2) We will build a new educational system of applied research and engineering, using two existing educational programs at Michigan Tech: a new Peace Corp/Master's International (PC/MI) program in Natural Hazards which features a 2-year field assignment, and an "Enterprise" program for undergraduates, which gives teams of geoengineering students the opportunity to work for three years in a business-like setting to solve real-world problems This project will involve 1-2 post-doctoral researchers, 3 Ph.D., 9 PC/MI, and roughly 20 undergraduate students each year.

  16. ANIMAL WASTE IMPACT ON SOURCE WATERSAIDED BY EPA/NSF ENVIRONMENTAL TECHNOLOGY VERIFICATION (ETV) SOURCE WATER PROTECTION PILOT

    Science.gov (United States)

    The Environmental Technology Verification Program (ETV) was established in 1995 by the U.S. Environmental Protection Agency to encourage the development and commercialization of new environmental technologies through third part testing and reporting of performance data. By ensur...

  17. ENVIRONMENTAL TECHNOLOGY VERIFICATION: JOINT (NSF-EPA) VERIFICATION STATEMENT AND REPORT: TRITON SYSTEMS, LLC SOLID BOWL CENTRIFUGE, MODEL TS-5000

    Science.gov (United States)

    Verification testing of the Triton Systems, LLC Solid Bowl Centrifuge Model TS-5000 (TS-5000) was conducted at the Lake Wheeler Road Field Laboratory Swine Educational Unit in Raleigh, North Carolina. The TS-5000 was 48" in diameter and 30" deep, with a bowl capacity of 16 ft3. ...

  18. Building transparent data access for ocean observatories: Coordination of U.S. IOOS DMAC with NSF's OOI Cyberinfrastructure

    Science.gov (United States)

    Arrott, M.; Alexander, Corrine; Graybeal, J.; Mueller, C.; Signell, R.; de La Beaujardière, J.; Taylor, A.; Wilkin, J.; Powell, B.; Orcutt, J.

    2011-01-01

    The NOAA-led U.S. Integrated Ocean Observing System (IOOS) and the National Science Foundation's Ocean Observatories Initiative (OOI) have been collaborating since 2007 on advanced tools and technologies that ensure open access to ocean observations and models. Initial collaboration focused on serving ocean data via cloud computing-a key component of the OOI cyberinfrastructure (CI) architecture. As the OOI transitioned from planning to execution in the Fall of 2009, an OOI/IOOS team developed a customer-based "use case" to align more closely with the emerging objectives of OOI-CI team's first software release scheduled for Summer 2011 and provide a quantitative capacity for stress-testing these tools and protocols. A requirements process was initiated with coastal modelers, focusing on improved workflows to deliver ocean observation data. Accomplishments to date include the documentation and assessment of scientific workflows for two "early adopter" modeling teams from IOOS Regional partners (Rutgers-the State University of New Jersey and University of Hawaii's School of Ocean and Earth Science and Technology) to enable full understanding of data sources and needs; generation of all-inclusive lists of the data sets required and those obtainable through IOOS; a more complete understanding of areas where IOOS can expand data access capabilities to better serve the needs of the modeling community; and development of "data set agents" (software) to facilitate data acquisition from numerous data providers and conversions of the data format to the OOI-CI canonical form. ?? 2011 MTS.

  19. Assessing readiness of cyberinfrastructure resources for cross-domain interoperability: a view from an NSF EarthCube roadmap

    Science.gov (United States)

    Zaslavsky, Ilya; Couch, Alva; Richard, Stephen; Valentine, David; Lehnert, Kerstin; Stocks, Karen; Murphy, Philip

    2013-04-01

    EarthCube is a new research initiative of the U.S. National Science Foundation, with the mission to develop community-guided cyberinfrastructure integrating data, models and other resources across geoscience disciplines. Analysis and modeling of physical processes that are not confined to disciplinary or jurisdictional boundaries, requires that data and models can be re-used outside the original context in which they are collected or developed. Infrastructure readiness for cross-domain interoperability encompasses the capabilities that need to be in place to enable such information re-use and ensure that it is both scientifically sound and technically feasible. In an ideal cross-domain information integration scenario, resources can be discovered via federated catalogs and linked nomenclatures from neighboring domains, while standard data services can be used to transparently compile composite data products and to integrate information using commonality in key data characteristics related to shared models of spatial features, time measurements, and observations. The main premise of the cross-domain readiness assessment is that when accessing domain resources from another domain, a user expects to be able to discover these resources, interpret them, retrieve the information, and integrate it with other data. Documentation of the resource must be sufficient for a user in a different context to determine fitness for use, and establish trust in scientific soundness. As part of an EarthCube roadmap focused on cross-domain interoperability, we explored a number of approaches to cyberinfrastructure readiness assessment, addressing both readiness of existing resources, and readiness of processes that enable cross-domain communication and information exchange across disciplinary boundaries. Our initial assessment considers basic infrastructure components required to enable cross-domain interoperability in the geosciences. These components, and the evaluation metrics, include: 1) Metadata catalogs, at the appropriate community defined granularity, that provide standard discovery services over datasets and other resources of the domain. Metrics: use of specific metadata content standard, as well as catalog search capabilities (availability of a web page interface, API, standards-compliant API such as OGC CSW) and harvest capabilities (whether harvesting is supported, and the API used). 2) Vocabularies that support unambiguous interpretation of domain resources and metadata. Metrics: use of controlled vocabularies, their documentation and standards-compliance (e.g. SKOS, OWL), and type of online access provided. 3) Services or other mechanisms used to access data repositories and other resources including models, visualizations and workflows. Metrics: types of information access, query, processing and visualization capabilities, and their standards-compliance. 4) Formal information models defining structure and semantics of the accessed information. Metrics: is there a formal model, how is it documented, its standards-compliance, and data instance validation processes. Additional factors evaluated included assessment of community governance processes, and use of persistent identifiers. The presentation will describe the details of the cross-domain readiness model as enabling effective communication among scientists, governance bodies, and information providers, and include an initial readiness assessment and a cross-domain connectivity map for the geosciences. In addition, we demonstrate "fitness-for-use" workflows implementing cross-domain research scenarios, which are designed to collect user's data integration experiences and make them available via searchable catalogs.

  20. Global Nuclear Fuel launches GNF{sub 3} and NSF: The most reliable BWR fuel just got better

    Energy Technology Data Exchange (ETDEWEB)

    Cantonwine, P.; Schneider, R.; Hunt, B.

    2015-11-01

    Bases on evolutionary design changes and advanced technology developed by Global Nuclear Fuel (GNF), the GNF3 fuel assembly is designed to offer customers with improved fuel economics, increased performance and flexibility in operation while maintaining the superior reliability of GNF2, the most reliable design in GNFs history. In addition to improved fuel utilization and performance, GNF3 is designed and manufactured to be more resistant to debris capture, to eliminate channel control blade interference concerns, and to exhibit to best available corrosion resistance of any boiling water reactor fuel. While delivering fuel cycle savings and reliability benefits with GNF3, GNF maintains a similar licensing and operating basis to GNF2, thereby minimizing fuel transition risks. GNF3 is available in lead use assembly quantities to customers today. Eight GNF3 lead use assemblies are in operation at two utilities in the USA GNF3 is scheduled to be available for full reloads in 2018. (Author)

  1. Calcium Regulates Molecular Interactions of Otoferlin with Soluble NSF Attachment Protein Receptor (SNARE) Proteins Required for Hair Cell Exocytosis*

    Science.gov (United States)

    Ramakrishnan, Neeliyath A.; Drescher, Marian J.; Morley, Barbara J.; Kelley, Philip M.; Drescher, Dennis G.

    2014-01-01

    Mutations in otoferlin, a C2 domain-containing ferlin family protein, cause non-syndromic hearing loss in humans (DFNB9 deafness). Furthermore, transmitter secretion of cochlear inner hair cells is compromised in mice lacking otoferlin. In the present study, we show that the C2F domain of otoferlin directly binds calcium (KD = 267 μm) with diminished binding in a pachanga (D1767G) C2F mouse mutation. Calcium was found to differentially regulate binding of otoferlin C2 domains to target SNARE (t-SNARE) proteins and phospholipids. C2D–F domains interact with the syntaxin-1 t-SNARE motif with maximum binding within the range of 20–50 μm Ca2+. At 20 μm Ca2+, the dissociation rate was substantially lower, indicating increased binding (KD = ∼10−9) compared with 0 μm Ca2+ (KD = ∼10−8), suggesting a calcium-mediated stabilization of the C2 domain·t-SNARE complex. C2A and C2B interactions with t-SNAREs were insensitive to calcium. The C2F domain directly binds the t-SNARE SNAP-25 maximally at 100 μm and with reduction at 0 μm Ca2+, a pattern repeated for C2F domain interactions with phosphatidylinositol 4,5-bisphosphate. In contrast, C2F did not bind the vesicle SNARE protein synaptobrevin-1 (VAMP-1). Moreover, an antibody targeting otoferlin immunoprecipitated syntaxin-1 and SNAP-25 but not synaptobrevin-1. As opposed to an increase in binding with increased calcium, interactions between otoferlin C2F domain and intramolecular C2 domains occurred in the absence of calcium, consistent with intra-C2 domain interactions forming a “closed” tertiary structure at low calcium that “opens” as calcium increases. These results suggest a direct role for otoferlin in exocytosis and modulation of calcium-dependent membrane fusion. PMID:24478316

  2. Anatomy of the Berkeley Sensor & Actuator Center (BSAC): The NSF Industry/University Cooperative Research Center on MEMS

    Science.gov (United States)

    2013-04-08

    market  goals edge sharing mmercial Re tion  Researc  centers, whi at least the p ercial benefi rial participa be continuall izations in or ions to...effectively work with industry and government to help  transformations  into unforeseen  new MEMS/NEMS  technologies, products and  markets . The model...businesses and  markets .  This research foundation is the extended community of dedicated researchers  practicing in public and private laboratories and

  3. Second Joint NSF-ESF Symposium on, 'Nanoparticles: Technologies and Applications,' Tacoma, Washington, USA, October 10, 1999

    International Nuclear Information System (INIS)

    Pui, David Y.H.; Fissan, Heinz

    1999-01-01

    The symposium had the objective to (a) bring together European and US scientists in the field of aerosol, materials and health sciences, and to enhance cooperation especially among young scientists in both regions, (b) present most recent findings in the nanotechnology and nanoparticle fields, with a focus on sensors and fuel cells, drug delivery and health effects, engines and nanoparticles, as well as electronic and opto-electronic devices and (c) evaluate the research trends and opportunities, and highlight the technologies and applications of nanoparticles

  4. A Ten-Year Retrospective Look at the NSF/GEO Opportunities for Enhancing Diversity in the Geosciences (OEDG) Program

    Science.gov (United States)

    Karsten, J. L.

    2013-12-01

    The Opportunities for Enhancing Diversity in the Geosciences (OEDG) program - established in 2002 by the National Science Foundation's Directorate for Geosciences (GEO) - has been a mainstay in GEO's efforts to broaden participation of traditionally underrepresented minorities in the geosciences. The primary goal of the OEDG program has been to engage a diverse population of students in learning about - and pursuing advanced degrees and careers in - the geosciences. Raising public awareness of the importance and relevance of the geosciences among diverse audiences has been a secondary goal. During the past decade, the OEDG program has supported a variety of planning grants, proof-of-concept projects, and larger full-scale implementation efforts across the U.S. These projects have contributed a rich array of culturally-tailored resources for learning about geoscience career pathways and opportunities to participate in geoscience research experiences. OEDG has also developed networking and mentoring programs tailored for diverse student audiences, as well as the educators who work with them, and has helped to build capacity in the geosciences at minority-serving institutions. Perhaps the most important legacy of the OEDG program has been the establishment of an enthusiastic and effective community of educators, administrators, students and organizations dedicated to increasing diversity in the geosciences. Evaluation data collected for individual OEDG projects has helped to improve the impact of specific projects and increase our understanding of which approaches are more successful in achieving OEDG program goals. In addition, GEO has supported a decade-long, program-wide evaluation of the OEDG portfolio through a contract to the American Institutes for Research (AIR). Synthesis of results from both the project- and program-level evaluation activities has identified evidence-based 'best practices' that are essential for achieving success in broadening participation in the geosciences. The OEDG program is slated to end in FY 2013, but GEO remains strongly committed to the program goals and is actively exploring new mechanisms for pursuing and achieving those goals. This presentation will provide a retrospective look at the OEDG portfolio and its achievements, and summarize the many insights gained regarding best practices for broadening participation in the geosciences.

  5. Major Trends in Mobility Technology Research and Development: Overview of the Results of the NSF-WTEC European Study

    OpenAIRE

    Reinkensmeyer, David J; Boninger, Michael L; Chan, Leighton; Cowan, Rachel E; Fregly, Benjamin J; Rodgers, Mary M; Bonato, Paolo

    2012-01-01

    Abstract Mobility technologies, including wheelchairs, prostheses, joint replacements, assistive devices, and therapeutic exercise equipment help millions of people participate in desired life activities. Yet, these technologies are not yet fully transformative because many desired activities cannot be pursued or are difficult to pursue for the millions of individuals with mobility related impairments. This WTEC study, initiated and funded by the National Science Foundation, was designed to g...

  6. Connective tissue growth factor in renal development and injury

    NARCIS (Netherlands)

    Ito, Y.

    2011-01-01

    Langdurige weefselbeschadiging leidt vaak tot functieverlies van het betreffende orgaan door het ontstaan van veel littekens (fibrose). Yasuhiko Ito ontdekte dat genexpressie van de factor CTGF sterk is verhoogd bij veelvoorkomende nierziekten waarbij fibrose optreedt. De hoeveelheid CTGF in de

  7. Attenuating fibrosis : Modulation of myofibroblast formation and extracellular matrix synthesis

    NARCIS (Netherlands)

    Mia, Md Masum

    2016-01-01

    Fibrose behelst het verlittekenen van weefsels en organen. Daardoor kunnen vitale functies uitvallen, met de dood tot gevolg. Fibrose is in veel gevallen dan ook een zeer ernstige aandoening. Toch bestaat er geen enkel effectief medicijn tegen. Hét kenmerk van fibrose is de excessieve productie van

  8. Molar Incisor Hypomineralisation

    NARCIS (Netherlands)

    Elfrink, M.; Weerheijm, K.L.

    2013-01-01

    Molar Incisor Hypomineralisation (mih) wordt omschreven als een hypomineralisatie (van systemische oorsprong) van één tot vier blijvende eerste molaren, vaak in combinatie met aangedane incisieven. mih-molaren zijn fragieler en cariësgevoeliger dan gewone molaren. Een kenmerk van mih-molaren is een

  9. Molar Incisor Hypomineralisation

    NARCIS (Netherlands)

    Elfrink, M.; Weerheijm, K.L.

    2009-01-01

    Molar Incisor Hypomineralisation (MIH) wordt gedefinieerd als een hypomineralisatie van systemische oorsprong van één tot vier blijvende eerste molaren, vaak in combinatie met aangedane incisieven. MIH-molaren zijn fragieler en cariësgevoeliger dan gewone molaren. Een kenmerk van MIH-molaren is een

  10. Molar Incisor Hypomineralisation

    NARCIS (Netherlands)

    Elfrink, M.; Weerheijm, K.

    2011-01-01

    Molar Incisor Hypomineralisation (mih ) wordt gedefinieerd als een hypomineralisatie van systemische oorsprong van één tot vier blijvende eerste molaren, vaak in combinatie met aangedane incisieven. mih -molaren zijn fragieler en cariësgevoeliger dan gewone molaren. Een kenmerk van mih -molaren is

  11. Micromanagement of lupus autoimmunity by microRNAs

    NARCIS (Netherlands)

    Shen, N.

    2012-01-01

    De observaties die Nan Shen deed in zijn promotieonderzoek verschaffen nieuwe inzichten in het ontstaan van de auto-immuunziekte systemische lupus erythematodes (SLE). Ook dragen ze bij aan De observaties die Nan Shen deed in zijn promotieonderzoek verschaffen nieuwe inzichten in het ontstaan van de

  12. Identificação de bactérias não fermentadoras isoladas de pacientes com fibrose cística e em hemoculturas de pacientes internados no HC da Unicamp

    OpenAIRE

    Élio Barreto de Carvalho Filho

    2015-01-01

    Resumo: Introdução: Bacilos gram-negativos não fermentadores (BGN-NFs) são microrganismos que se caracterizam pela incapacidade de utilizar a glicose como fonte de energia pela fermentação, degradando-a pela via oxidativa. A identificação dos BGN-NFs continua sendo um desafio para os laboratórios de rotina em microbiologia pela dificuldade de identificação, em virtude, da baixa ocorrência em amostras ambulatoriais, assim como, pela falta de recursos rápidos, eficientes e pela complexidade e ...

  13. Fibrose congênita de reto inferior atípica com hipotonia muscular generalizada: relato de um caso Atipical inferior rectus congenital fibrosis with generalizated muscular hypotonia: case report

    Directory of Open Access Journals (Sweden)

    Ezon Vinicius Alves Pinto Ferraz

    1999-10-01

    Full Text Available O caso descrito apresentava uma hipotropia pouco severa com acuidade visual normal e binocularidade em infra-versão; além de uma hipotonia muscular generalizada, ao contrário da severa hipotropia e ambliopia encontrada nessa afecção. O procedimento cirúrgico levou estes fatos em consideração, tendo-se optado por um retrocesso pequeno do reto inferior para que se corrigisse o torcicolo sem interferir na posição de leitura. Os resultados pós-operatórios foram satisfatórios.A case report of an atipical inferior rectus congenital fibrosis associated with a generalized muscular hypotonia is presented. It shows mild hipotropia with a normal visual acuity and binocularity in infraversion position contrasting with the severe hipotropia and ambliopy found. The surgical procedure took these facts into consideration, so we performed a small retrocess of the muscle with the objective to correct the head position without changes in the reading position. The postoperative results were satisfactory.

  14. Diagnóstico ecodopplercardiográfico da fibrose crônica da válvula mitral em cão Echodopplercardiographic diagnostic of mitral chronic valvular fibrosis in dog

    Directory of Open Access Journals (Sweden)

    R.A.L. Muzzi

    1999-12-01

    Full Text Available A ten year-old male Poodle dog, weighing 3kg, was referred to the Veterinary Hospital of UFMG due to nocturnal coughing, exercise intolerance, weakness and weight loss. Physical examination revealed pale mucous membranes, prolonged capillary refill time, holosystolic regurgitant murmur at left apex and signs of congestive heart failure. M-mode, two-dimensional, and Doppler echocardiography revealed mitral chronic valvular disease

  15. MRI-based flow measurements in the main pulmonary artery to detect pulmonary arterial hypertension in patients with cystic fibrosis; MRT-basierte Flussmessungen im Truncus pulmonalis zur Detektion einer pulmonal-arteriellen Hypertonie in Patienten mit zystischer Fibrose

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, T.; Anjorin, A.; Abolmaali, N. [TU Dresden (Germany). OncoRay, Biologisches und Molekulares Imaging; Posselt, H. [Frankfurt Univ. (Germany). Klinik fuer Paediatrie I, Muskoviszidoseambulanz; Smaczny, C. [Frankfurt Univ. (Germany). Medizinische Klinik I, Pneumologie und Allergologie; Vogl, T.J. [Frankfurt Univ. (Germany). Inst. fuer Diagnostische und Interventionelle Radiologie

    2009-02-15

    Development of pulmonary arterial hypertension (PH) is a common problem in the course of patients suffering from cystic fibrosis (CF). This study was performed to evaluate MRI based flow measurements (MR{sub venc}; Velocity ENCoding) to detect signs of an evolving PH in patients suffering from CF. 48 patients (median age: 16 years, range: 10 - 40 years, 25 female) suffering from CF of different severity (mean FEV1: 74 % {+-} 23, mean Shwachman-score: 63 {+-} 10) were examined using MRI based flow measurements of the main pulmonary artery (MPA). Phase-contrast flash sequences (TR: 9.6 ms, TE: 2.5 ms, bandwidth: 1395 Hertz/Pixel) were utilized. Results were compared to an age- and sex-matched group of 48 healthy subjects. Analyzed flow data where: heart frequency (HF), cardiac output (HZV), acceleration time (AT), proportional acceleration time related to heart rate (ATr), mean systolic blood velocity (MFG), peak velocity (Peak), maximum flow (Fluss{sub max}), mean flow (Fluss{sub mitt}) and distensibility (Dist). The comparison of means revealed significant differences only for MFG, Fluss{sub max} and Dist, but overlap was marked. However, using a scatter-plot of AT versus MFG, it was possible to identify five CF-patients demonstrating definite signs of PH: AT = 81 ms {+-} 14, MFG = 46 {+-} 11 cm/s, Dist = 41 % {+-} 7. These CF-patients where the most severely affected in the investigated group, two of them were listed for complete heart and lung transplantation. The comparison of this subgroup and the remaining CF-patients revealed a highly significant difference for the AT (p = 0.000001) without overlap. Screening of CF-patients for the development of PH using MR{sub venc} of the MPA is not possible. In later stages of disease, the quantification of AT, MFG and Dist in the MPA may be useful for the detection, follow-up and control of therapy of PH. MR{sub venc} of the MPA completes the MRI-based follow-up of lung parenchyma damage in patients suffering from CF. (orig.)

  16. {sup 18}F-F.D.G. PET imaging of infection and inflammation: intestinal, prosthesis replacements, fibrosis, sarcoidosis, tuberculosis..; La TEP au {sup 18}F-FDG dans la pathologie inflammatoire et infectieuse: intestinale, prothetique, fibrose, sarcoidose, tuberculose..

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, A.; Cortes, M.; Caresia, A.P.; Juan, R. de; Vidaller, A.; Mana, J.; Martinez-Yelamos, S.; Gamez, C. [Hospital Universitari de Bellvitge, Service TEP-Centre IDI, Services de Medecine Interne, Barcelone (Spain)

    2008-10-15

    Nuclear medicine plays an important role in the evaluation of infection and inflammation. A variety of diagnostic methods are available for imaging this inflammation and infection, most notably computed tomography, {sup 68}Ga scintigraphy or radionuclide labeled leucocytes. Fluorine 18 fluorodeoxyglucose ({sup 18}F-F.D.G.) is a readily available radiotracer that offers rapid, exquisitely sensitive high-resolution images by positron emission tomography (PET). Inflammation can be acute or chronic, the former showing predominantly neutrophilic granulocyte infiltrates, whereas in the latter, macrophages predominate. F.D.G. uptake in infection is based on the fact that mononuclear cells and granulocytes use large quantities of glucose by way of the hexose monophosphate shunts. {sup 18}F-F.D.G. PET accurately helps diagnose spinal osteomyelitis, diabetic foot and in inflammatory conditions such as sarcoidosis and tuberculosis.(it appears to be useful for defining the extent of disease and monitoring response to treatment). {sup 18}F-F.D.G. PET can also help localize the source of fever of undetermined origin, thereby guiding additional testing. {sup 18}F-F.D.G. PET may be of limited usefulness in postoperative patients and in patients with a failed joint prosthesis or bowel inflammatory disease. In this review, we will focus on the role of {sup 18}F-F.D.G. PET in the management of patients with inflammation or suspected or confirmed infection.

  17. Diagnosis of chronic rhino sinusitis in patients with cystic fibrosis: correlation between anamnesis, nasal endoscopy and computed tomography; Diagnostico de rinossinusite cronica em pacientes com fibrose cistica: correlacao entre anamnese, nasofibroscopia e tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Boari, Leticia; Castro Junior, Ney Penteado de [Faculdade de Ciencias Medicas da Santa Casa de Sao Paulo, SP (Brazil)]. E-mail: curyboari@uol.com.br

    2005-11-15

    The sinonasal involvement is one of the most common manifestations in cystic fibrosis. Data show a high incidence of chronic rhino sinusitis in these patients. Although it has been found radiographic opacification of the sinus in more than 90% of cases, few are symptomatic. So that, it is difficult to recognize nasossinusal disease in patients with cystic fibrosis. Questionnaire, nasal endoscopy and CT-scan are very important methods in this approach. Aim: to evaluate the diagnosis of chronic rhino sinusitis in patients with cystic fibrosis by anamnesis, nasal endoscopy and CT-scan and compare those results.Study Design: Clinical prospective. Material and method: evaluation of 34 patients - older than 6 years and with a confirmed diagnoses of cystic fibrosis - by anamnesis (questionnaire), nasal endoscopy (score Lund-Kennedy) and CT-scan (score Lund-Mackay). Results: chronic rhino sinusitis was confirmed in: 20,58% of cases by the questionnaire, 73,52% of the cases by the nasal endoscopy and in 93,54% of the cases by the CT-scan. The results showed significant differences. The correlation between nasal endoscopy score (Lund-Kennedy score) and CT-scan score (Lund-Mackay score) was statistically significant. Conclusion: the diagnosis of chronic rhino sinusitis was statistically different between the three methods. It was higher in imaging analysis and lower in questionnaire. The nasal endoscopy is an excellent method to evaluate nasossinusal disease in cystic fibrosis. (author)

  18. Advances and Directions for the Intelligent Systems for Geosciences Research Community: Updates and Opportunities from the NSF EarthCube IS-GEO RCN

    Science.gov (United States)

    Pierce, S. A.

    2017-12-01

    The Earthcube Intelligent Systems for Geosciences Research Collaboration Network (IS-GEO RCN) represents an emerging community of interdisciplinary researchers aiming to create fundamental new capabilities for understanding Earth systems. Collaborative efforts across IS-GEO fields of study offer opportunities to accelerate scientific discovery and understanding. The IS-GEO community has an active membership of approximately 65 researchers and includes researchers from across the US, international members, and an early career committee. Current working groups are open to new participants and are focused on four thematic areas with regular coordination meetings and upcoming sessions at professional conferences. (1) The Sensor-based data Collection and Integration Working group looks at techniques for analyzing and integrating of information from heterogeneous sources, with a possible application for early warning systems. (2) The Geoscience Case Studies Working group is creating benchmark data sets to enable new collaborations between geoscientists and data scientists. (3) The Geo-Simulations Working group is evaluating the state of the art in practices for parametrizations, scales, and model integration. (4) The Education Working group is gathering, organizing and collecting all the materials from the different IS-GEO courses. Innovative IS-GEO applications will help researchers overcome common challenges while will redefining the frontiers of discovery across fields and disciplines. (Visit IS-GEO.org for more information or to sign up for any of the working groups.)

  19. ENVIRONMENTAL TECHNOLOGY VERIFICATION: JOINT (NSF-EPA) VERIFICATION STATEMENT AND REPORT: BROME AGRI SALES, LTD., MAXIMIZER SEPARATOR, MODEL MAX 1016 - 03/01/WQPC-SWP

    Science.gov (United States)

    Verification testing of the Brome Agri Sales Ltd. Maximizer Separator, Model MAX 1016 (Maximizer) was conducted at the Lake Wheeler Road Field Laboratory Swine Educational Unit in Raleigh, North Carolina. The Maximizer is an inclined screen solids separator that can be used to s...

  20. Promoting Art through Technology, Education and Research of Natural Sciences (PATTERNS) across Wyoming, A Wyoming NSF EPSCoR Funded Project

    Science.gov (United States)

    Gellis, B. S.; McElroy, B. J.

    2016-12-01

    PATTERNS across Wyoming is a science and art project that promotes new and innovative approaches to STEM education and outreach, helping to re-contextualize how educators think about creative knowledge, and how to reach diverse audiences through informal education. The convergence of art, science and STEM outreach efforts is vital to increasing the presence of art in geosciences, developing multidisciplinary student research opportunities, expanding creative STEM thinking, and generating creative approaches of visualizing scientific data. A major goal of this project is to train art students to think critically about the value of scientific and artistic inquiry. PATTERNS across Wyoming makes science tangible to Wyoming citizens through K-14 art classrooms, and promotes novel maker-based art explorations centered around Wyoming's geosciences. The first PATTERNS across Wyoming scientific learning module (SIM) is a fish-tank sized flume that recreates natural patterns in sand as a result of fluid flow and sediment transport. It will help promotes the understanding of river systems found across Wyoming (e.g. Green, Yellowstone, Snake). This SIM, and the student artwork inspired by it, will help to visualize environmental-water changes in the central Rocky Mountains and will provide the essential inspiration and tools for Wyoming art students to design biological-driven creative explorations. Each art class will receive different fluvial system conditions, allowing for greater understanding of river system interactions. Artwork will return to the University of Wyoming for a STE{A}M Exhibition inspired by Wyoming's varying fluvial systems. It is our hope that new generations of science and art critical thinkers will not only explore questions of `why' and `how' scientific phenomena occur, but also `how' to better predict, conserve and study invaluable artifacts, and visualize conditions which allow for better control of scientific outcomes and public understanding.

  1. Oceanography and Geoscience Scholars at Texas A&M University Funded through the NSF S-STEM (Scholarships in Science, Technology, Engineering and Mathematics) Program

    Science.gov (United States)

    Richardson, M. J.; Gardner, W. D.

    2016-02-01

    Over the last seven years we have led the creation and implementation of the Oceanography and Geoscience Scholars programs at Texas A&M University. Through these programs we have been able to provide scholarship support for 92 undergraduates in Geosciences and 29 graduate students in Oceanography. Fifty-seven undergraduate scholars have graduated in Geosciences: 30 undergraduate students in Meteorology, 7 in Geology, and 20 in Environmental Geosciences. Two students have graduated in other STEM disciplines. Twenty-four students are in the process of completing their undergraduate degrees in STEM disciplines. Twenty-three students have graduated with MS or PhD degrees in Oceanography and five PhD students are completing their dissertations. As specified in the program solicitation all of the scholars are academically talented students with demonstrated financial need as defined by the FAFSA (Free Application for Federal Student Aid). We have endeavored to recruit students from underrepresented groups. One-third of the undergraduate scholars were from underrepresented groups; 28% of the graduate students. We will present the challenges and successes of these programs.

  2. Defining Linkages between the GSC and NSF's LTER Program: How the Ecological Metadata Language (EML) Relates to GCDML and Other Outcomes

    Science.gov (United States)

    Inigo San Gil; Wade Sheldon; Tom Schmidt; Mark Servilla; Raul Aguilar; Corinna Gries; Tanya Gray; Dawn Field; James Cole; Jerry Yun Pan; Giri Palanisamy; Donald Henshaw; Margaret O' Brien; Linda Kinkel; Kathrine McMahon; Renzo Kottmann; Linda Amaral-Zettler; John Hobbie; Philip Goldstein; Robert P. Guralnick; James Brunt; William K. Michener

    2008-01-01

    The Genomic Standards Consortium (GSC) invited a representative of the Long-Term Ecological Research (LTER) to its fifth workshop to present the Ecological Metadata Language (EML) metadata standard and its relationship to the Minimum Information about a Genome/Metagenome Sequence (MIGS/MIMS) and its implementation, the Genomic Contextual Data Markup Language (GCDML)....

  3. Report on the SNL/AWE/NSF international workshop on joint mechanics, Dartington, United Kingdom, 2729 April 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Ewins, David J. (University of Bristol, UK); Bergman, Lawrence A. (University of Illinois, Urbana, IL); Segalman, Daniel Joseph

    2010-08-01

    The SNL/AWE joint mechanics workshop, held in Dartington Hall, Totnes, Devon, UK 26-29 April 2009 was a follow up to another international joints workshop held in Arlington, Virginia, in October 2006. The preceding workshop focused on identifying what length scales and interactions would be necessary to provide a scientific basis for analyzing and understanding joint mechanics from the atomistic scale on upward. In contrast, the workshop discussed in this report, focused much more on identification and development of methods at longer length scales that can have a nearer term impact on engineering analysis, design, and prediction of the dynamics of jointed structures. Also, the 2009 meeting employed less technical presentation and more break out sessions for developing focused strategies than was the case with the early workshop. Several 'challenges' were identified and assignments were made to teams to develop approaches to address those challenges.

  4. Collaboration in Academic R&D: A Decade of Growth in Pass-Through Funding. InfoBrief. NSF 12-325

    Science.gov (United States)

    Hale, Katherine

    2012-01-01

    Research collaboration involving multiple institutions is a growing trend. Contributing to this growth are federal initiatives as well as practical considerations, such as technological advances that facilitate communication and opportunities for division of labor, risk sharing, and increased research credibility. One measure of this research…

  5. Mykotische Infektionen des Penis

    Directory of Open Access Journals (Sweden)

    Mayser P

    1999-01-01

    Full Text Available Die häufigste mykotische Infektion des Penis stellt die Balanitis/Balonoposthitis durch Candida albicans dar. Sie weist eine steigende Inzidenz auf und scheint vornehmlich durch Genitalverkehr übertragen zu werden. Penile Infektionen durch Dermatophyten sind sehr selten, obwohl die Tinea inguinalis zu den häufigeren Erkrankungen zählt. Eine Mitbeteiligung des Penis im Rahmen von Systemmykosen kennzeichnet zumeist ein schwer verlaufende Erkrankung. Ursächlich kann beim immunoinkompetenten Patienten nahezu jeder Erreger in Frage kommen. Biopsie sowie Gewebekultur aus den meist ulzerativen Veränderungen können die Diagnose sichern. Die meisten superfiziellen Infektionen sprechen zufriedenstellend auf eine topische antimykotische Behandlung an, insbesondere wenn Provokationsfaktoren und die Möglichkeit der sexuellen Transmission berücksichtigt werden. Ausgedehnte Infektionen durch Dermatophyten, Hefen und natürlich systemische Infektionen erfordern eine systemische antimykotische Therapie.

  6. Wirkungen eines Bifidojoghurts mit Laktulose und eines konventionellen Joghurts auf Darmphysiologie und bakterielle Metaboliten als Risikomodulatoren der Kolonkarzinogenese sowie Darmflora und Blutlipide bei gesunden Erwachsenen

    OpenAIRE

    Gerlach, Stefanie

    2007-01-01

    Hintergrund: Probiotische und synbiotische Milchprodukte zählen zu den "funktionellen Lebensmitteln", denen im Vergleich zu herkömmlichen Produkten ein gesundheitsfördernder Zusatznutzen zugeschrieben wird. Dabei wird diskutiert, ob die Gesundheit bereits gesunder Personen noch optimierbar ist, ob und in welcher Weise die Darmflora gezielt "günstig" modifiziert werden kann und/oder ob diese Manipulation zu messbaren gesundheitsfördernden Veränderungen metabolischer und systemischer Biomarker ...

  7. Übergewicht und Adipositas, Gesundheit und Krankheit : Diskussionsbeiträge aus philosophischer Sicht

    OpenAIRE

    Gottschalk-Mazouz, Niels; Ertelt, Susanne; Radinkovic, Zeljko

    2010-01-01

    Der vorliegende Band vereint Studien, die im Rahmen des Philosophie-Teilprojekts des Forschungsverbunds "Übergewicht und Adipositas bei Kindern, Jugendlichen und jungen Erwachsenen als systemisches Risiko" entstanden sind. Dieser Verbund wurde vom BMBF von 2006-2009 im Rahmen der sozial-ökologischen Forschung im Themenbereich: Strategien zum Umgang mit systemischen Risiken gefördert. In diesem Verbund wurden unter der Leitung des Risikosoziologen Ortwin Renn die Perspektiven von Epidemiologie...

  8. Overcoming major bottlenecks in aquaponics - A practical approach

    OpenAIRE

    Monsees, Hendrik

    2018-01-01

    Aquaponik-Systeme stellen an sich einen sehr nachhaltigen, innovativen Ansatz für die zukünftige Lebensmittelproduktion dar. Allerdings hat sich bis heute noch kein flächendeckender, ökonomischer Erfolg eingestellt und wesentliche systemische Engpässe wurden wissenschaftlich nicht untersucht. Daher waren die Hauptziele dieser Dissertation, (I) sichere Nitratkonzentrationen in geschlossenen Kreislaufanlagen (RAS) zu ermitteln, unter denen optimales Wachstum und Tierwohl produzierter Tilapien g...

  9. Disease: H01906 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01906 Poikiloderma, hereditary fibrosing, with tendon contractures, myopathy, and... pulmonary fibrosis Poikiloderma, hereditary fibrosing, with tendon contractures, myopathy, and pulmonary fi...ies especially on the face and sun-exposed areas. Scalp hair, eyelashes, and eyebrows are typically sparse. Tendon contract

  10. Final report for the NSF/DOE partnership in basic plasma science grant DE-FG02-06ER54906 'Laser-driven collisionless shocks in the Large Plasma Device'

    Energy Technology Data Exchange (ETDEWEB)

    Niemann, Christoph [UCLA, CA (United States); Gekelman, W. [UCLA, CA (United States); Winske, D. [LANL, NM (United States); Larsen, D. [LLNL, CA (United States)

    2012-12-14

    We have performed several thousand high-energy laser shots in the LAPD to investigate the dynamics of an exploding laser-produced plasma in a large ambient magneto-plasma. Debris-ions expanding at super-Alfvenic velocity (up to MA=1.5) expel the ambient magnetic field, creating a large (> 20 cm) diamagnetic cavity. We observed field compressions of up to B/B{sub 0} = 1.5 at the edge of the bubble, consistent with the MHD jump conditions, as well as localized electron heating at the edge of the bubble. Two-dimensional hybrid simulations reproduce these measurements well and show that the majority of the ambient ions are energized by the magnetic piston to super-Alfvenic speeds and swept outside the bubble volume. Nonlinear shear-Alfven waves ({delta}B/B{sub 0} > 25%) are radiated from the cavity with a coupling efficiency of 70% from magnetic energy in the bubble to the wave. While the data is consistent with a weak magneto-sonic shock, the experiments were severely limited by the low ambient plasma densities (10{sup 12} cm{sup -3}). 2D hybrid simulations indicate that future experiments with the new LAPD plasma source and densities in excess of 10{sup 13} cm{sup -3} will drive full-blown collisionless shocks with MA>10 over several c/wpi and shocked Larmor radii. In a separate experiment at the LANL Trident laser facility we have performed a proof-of-principle experiment at higher densities to demonstrate key elements of collisionless shocks in laser-produced magnetized plasmas with important implications to NIF. Simultaneously we have upgraded the UCLA glass-laser system by adding two large amplitude disk amplifiers from the NOVA laser and boost the on-target energy from 30 J to up to 1 kJ, making this one of the world’s largest university-scale laser systems. We now have the infrastructure in place to perform novel and unique high-impact experiments on collision-less shocks at the LAPD.

  11. Final report for the NSF/DOE partnership in basic plasma science grant DE-FG02-06ER54906 'Laser-driven collisionless shocks in the Large Plasma Device'™

    International Nuclear Information System (INIS)

    Niemann, Christoph; Gekelman, W.; Winske, D.; Larsen, D.

    2012-01-01

    We have performed several thousand high-energy laser shots in the LAPD to investigate the dynamics of an exploding laser-produced plasma in a large ambient magneto-plasma. Debris-ions expanding at super-Alfvenic velocity (up to MA=1.5) expel the ambient magnetic field, creating a large (> 20 cm) diamagnetic cavity. We observed field compressions of up to B/B 0 = 1.5 at the edge of the bubble, consistent with the MHD jump conditions, as well as localized electron heating at the edge of the bubble. Two-dimensional hybrid simulations reproduce these measurements well and show that the majority of the ambient ions are energized by the magnetic piston to super-Alfvenic speeds and swept outside the bubble volume. Nonlinear shear-Alfven waves (δB/B 0 > 25%) are radiated from the cavity with a coupling efficiency of 70% from magnetic energy in the bubble to the wave. While the data is consistent with a weak magneto-sonic shock, the experiments were severely limited by the low ambient plasma densities (10 12 cm -3 ). 2D hybrid simulations indicate that future experiments with the new LAPD plasma source and densities in excess of 10 13 cm -3 will drive full-blown collisionless shocks with MA>10 over several c/wpi and shocked Larmor radii. In a separate experiment at the LANL Trident laser facility we have performed a proof-of-principle experiment at higher densities to demonstrate key elements of collisionless shocks in laser-produced magnetized plasmas with important implications to NIF. Simultaneously we have upgraded the UCLA glass-laser system by adding two large amplitude disk amplifiers from the NOVA laser and boost the on-target energy from 30 J to up to 1 kJ, making this one of the world's largest university-scale laser systems. We now have the infrastructure in place to perform novel and unique high-impact experiments on collision-less shocks at the LAPD

  12. ICASE/LaRC/NSF/ARO Workshop, conducted by the Institute for Computer Applications in Science and Engineering, NASA Langley Research Center, The National Science Foundation and the Army Research Office

    CERN Document Server

    Anderson, W

    2000-01-01

    Over the last decade, the role of computational simulations in all aspects of aerospace design has steadily increased. However, despite the many advances, the time required for computations is far too long. This book examines new ideas and methodologies that may, in the next twenty years, revolutionize scientific computing. The book specifically looks at trends in algorithm research, human computer interface, network-based computing, surface modeling and grid generation and computer hardware and architecture. The book provides a good overview of the current state-of-the-art and provides guidelines for future research directions. The book is intended for computational scientists active in the field and program managers making strategic research decisions.

  13. A Network for Integrated Science and Mathematics Teaching and Learning Conference Plenary Papers. NSF/SSMA Wingspread Conference (Racine, Wisconsin, April 1991). School Science and Mathematics Association Topics for Teachers Series Number 7.

    Science.gov (United States)

    Berlin, Donna F., Ed.

    The integration of mathematics and science is not a new concept. However, during recent years it has been a major focus in education reform. A Wingspread conference promoted discussion regarding the integration of mathematics and science and explored ways to improve science and mathematics education in grades K-12. Papers from the conference…

  14. ENVIRONMENTAL TECHNOLOGY VERIFICATION REPORT - REMOVAL OF PRECURSORS TO DISINFECTION BY-PRODUCTS IN DRINKING WATER, PCI MEMBRANE SYSTEMS FYNE PROCESS MODEL ROP 1434 WITH AFC-30 NANOFILTRATON AT BARROW, AK - NSF 00/19/EPADW395

    Science.gov (United States)

    Equipment testing and verification of PCI Membrane Systems Inc. Fyne Process nanofiltraton systems Model ROP 1434 equipped with a C10 module containing AFC-30 tubular membranes was conducted from 3/16-5/11/2000 in Barrow, AS. The source water was a moderate alkalinity, moderately...

  15. Aplicación de los índices NSF, DINIUS y BMWP para el análisis de la calidad de agua de la Quebrada La Ayurá, Antioquia Colombia

    Directory of Open Access Journals (Sweden)

    Orlando Caicedo Quintero

    2013-06-01

    Full Text Available En esta investigación se evaluó la calidad de agua de la quebrada la Ayurá en Envigado- Antioquia  Colombia, mediante la aplicación de los índices de Calidad de la Fundación Nacional de Saneamiento (INSF, de calidad de Dinius y el índice biótico BMWP. La estimación de estos índices se efectuó con información recolectada en tres sitios durante tres muestreos. Se determinaron variables fisicoquímicas y microbiológicas, además se realizaron muestreos cualitativos y cuantitativos de macroinvertebrados acuáticos.                                                                                                                                                                                                                                                                                                                              El empleo de esta metodología permitió conocer el comportamiento fisicoquímico y de la comunidad biológica en los diferentes sitios. Los resultados fisicoquímicos, microbiológicos, macroinvertebrados acuáticos y de los índices indicaron que en la estación 1 se presenta una buena calidad del agua y en las estaciones 2 y 3  un deterioro medio de la calidad del agua. PALABRAS CLAVES: Quebrada la Ayurá, Calidad del agua, Índices de calidad, Índices bióticos, oxigeno disuelto, macroinvertebrados acuáticos. 

  16. Radioinduced intestinal fibrosis: from molecular mechanisms to therapy applications. Contribution of the TGF--{beta}1, of the CTGF and of the transduction pathway of the Rho/ROCK signal; La fibrose intestinale radio-induite: des mecanismes moleculaires aux applications therapeutiques. Roles du TGF-{beta}1, du CTGF et de la voie de transduction du signal Rho/ROCK

    Energy Technology Data Exchange (ETDEWEB)

    Haydont, V

    2006-12-15

    Delayed radiation enteritis is an intestinal fibrosis induced by accidental or therapeutic radiation for pelvic and abdominal cancer treatments. Studies of molecular mechanisms involved in the development and maintenance of fibrosis have showed the respective contribution of CTGF, low TGF-{beta}1 concentrations and Rho/ROCK pathway. Thus, based on the relationship between CTGF, TGF-{beta}1 and Rho pathway, 2 therapeutics strategies have been develop. First, a pravastatin curative gift leads to a fibro-lysis involving an inhibition of Rho and in cascade a reduction of CTGF expression and extracellular matrix deposition. The data suggest that reversal of established radiation fibrosis in the gut is possible. Second, a pravastatin prophylactic gift prevents the installation of a chronic fibrosis but does not protect the tumor. On the base of these results, the radiation therapy department of the Institut Gustave Roussy will soon initiate 2 clinical trials. (author)

  17. Sarcoidosis and Histoplasmosis: Is One a Consequence of the Other? A Case Report and Review of the Literature

    Directory of Open Access Journals (Sweden)

    Anupam Bansal

    2015-01-01

    Full Text Available Sarcoidosis involves abnormal collections of inflammatory cells (granulomas which may form as nodules in multiple organs. 90% of affected patients have respiratory tract abnormalities. We present a 61-year-old male with sarcoidosis who was admitted for respiratory distress. Fibrosing mediastinitis was seen in the chest computograph. Management was conservative and included steroids, antibiotics, and oxygen therapy. Sarcoidosis and fibrosing mediastinitis are rare. Fibrosing mediastinitis is more commonly seen with histoplasmosis. We explore the clinical similarities between histoplasmosis and sarcoidosis. We also explore the potential cause and effect relationship and workup for each disease entity.

  18. The Emerging Role of Soluble Adenylyl Cyclase in Primary Biliary Cholangitis

    NARCIS (Netherlands)

    Chang, Jung-Chin; Beuers, Ulrich; Oude Elferink, Ronald P. J.

    2017-01-01

    Primary biliary cholangitis (PBC; previously referred to as primary biliary cirrhosis) is a chronic fibrosing cholangiopathy with the signature of an autoimmune disease and features of intrahepatic cholestasis. Immunosuppressing treatments are largely unsuccessful. Responsiveness to ursodeoxycholic

  19. Dicty_cDB: AFJ307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nsf ml*fiigtinlfillfkmekiykrsnlfkskgylwwyndvisssyfiidpfsrlssikd* ckikerifikyknn*ri*km*snfis*scyfsxknknnnnnn...irs*i*nsf ml*fiigtinlfillfkmekiykrsnlfkskgylwwyndvisssyfiidpfsrlssikd* ckikerifikyknn*ri*km*snfis*scyfsxknkn

  20. The invisible patients: posttraumatic stress disorder in parents of individuals with cystic fibrosis

    OpenAIRE

    Cabizuca, Mariana; Mendlowicz, Mauro; Marques-Portella, Carla; Ragoni, Celina; Coutinho, Evandro Silva Freire; Souza, Wanderson de; Mari, Jair de Jesus [UNIFESP; Figueira, Ivan

    2010-01-01

    CONTEXTO: Apesar do crescente reconhecimento da relevância do transtorno de estresse pós-traumático (TEPT) secundário a doenças médicas, ainda não existem estudos em fibrose cística. OBJETIVO: Verificar a prevalência de TEPT e dos três grupos de sintomas de estresse pós-traumático em pais de pacientes com fibrose cística. MÉTODOS: Pais de pacientes com fibrose cística (idade média: 2 a 33 anos) foram recrutados da Associação Carioca de Mucoviscidose. Neste estudo transversal, os pais preenche...

  1. Videos Designed to Watch but Audience Required Telling stories is a cliché for best practice in videos. Frontier Scientists, a NSF project titled Science in Alaska: using Multimedia to Support Science Education stressed story but faced audience limitations. FS describes project's story process, reach results, and hypothesizes better scenarios.

    Science.gov (United States)

    O'Connell, E. A.

    2016-12-01

    Telling stories is a cliché for best practice in science videos. It's upheld as a method to capture audience attention in many fields. Findings from neurobiology research show character-driven stories cause the release of the neurochemical oxytocin in the brain. Oxytocin motivates cooperation with others and enhances a sense of empathy, in particular the ability to experience others' emotions. Developing character tension- as in our video design showcasing scientists along with their work- holds the viewers' attention, promotes recall of story, and has the potential to clearly broadcast the feelings and behaviors of the scientists. The brain chemical change should help answer the questions: Why should a viewer care about this science? How does it improve the world, or our lives? Is just a story-driven video the solution to science outreach? Answer: Not in our multi-media world. Frontier Scientists (FS) discovered in its three year National Science Foundation project titled 'Science in Alaska: using Multimedia to Support Science Education': the storied video is only part of the effort. Although FS created from scratch and drove a multimedia national campaign throughout the project, major reach was not achieved. Despite FS' dedicated web site, YouTube channel, weekly blog, monthly press release, Facebook and G+ pages, Twitter activity, contact with scientists' institutions, and TV broadcast, monthly activity on the web site seemed to plateau at about 3000 visitors to the FS website per month. Several factors hampered the effort: Inadequate funding for social media limited the ability of FS to get the word to untapped markets: those whose interest might be sparked by ad campaigns but who do not actively explore unfamiliar agencies' science education content. However, when institutions took advantage of promoting their scientists through the FS videos we saw an uptick in video views and the participating scientists were often contacted for additional stories or were invited to participate in more visible videos (for example, a National Geographic show). Our suggestion for future science video use is to coordinate media with an institution, an already established news network, an entity with constant traffic flow like a museum, or to move into the academic world to supplement science curriculum with real world field science.

  2. CTD Niskin bottle data from the R/V WECOMA in the North Pacific Ocean in support of the National Science Foundation Coastal Ocean Processes program River Influences on Shelf Ecosystems (NSF CoOP RISE), cruise RISE06W4, from 20040708 to 20060613 (NODC Accession 0050194)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The CoOP RISE program collected CTD and water chemistry (macronutrients, chlorophyll) data during four cruises from 2004-2006 off the Oregon and Washington coast,...

  3. Trаnsfоrmаtiоn оf Institutiоnаl Structurе in thе Vоlgа Rеgiоn in 1917: Drivеrs аnd Stаgеs оf thе Рrоcеss

    Directory of Open Access Journals (Sweden)

    Viktоr N. Dаnilоv

    2017-12-01

    Full Text Available The peculiаrity of interconnection аnd interdependence of the power’s аnd society’s аctions in Russiаn regions аs а complex of emerged circumstаnces cаused by the revolution hаs become the subject of speciаl considerаtion in historiogrаphy of our country quite recently. Rаising this problem hаs given the opportunity to study the sociаl аnd psychologicаl аspects of the revolution the result of which is the аcceptаnce of the conflict between modernizаtion of аuthoritаtive аnd intellectuаl elite аnd trаditionаlism аnd discrepаncy of sociаl reflection аnd people’s аrchаic chаrаcter in the course of the revolutionаry process in provinces in 1917. On the bаsis of the Volgа region mаteriаls it is shown how in the conditions of the 1917 system crisis, trаnsformаtion of the institutionаl structure of the Russiаn stаtehood took plаce. Interconnection of the formаtion аnd functioning of аuthoritаtive bodies аnd revolutionаry аctions of the mаjority of society is determined. Institutionаl chаnges sequentiаlly pаssed some stаges from democrаcy through ochlocracy to dictаtorship, thus highlighting а syncretic model of the sociаl order. The аuthoritаtive system thаt hаd emerged аfter the Februаry – Mаrch revolution did not turn out to conform to аn аccepted view of the mаjority of society аnd cаused а powerful opposite wаve which brought the country to nаtionаl disаster. Аll аttempts of liberаl аnd moderаte revolutionаry forces to introduce democrаtic principles of sociаl order chаrаcteristic of western countries fаiled especiаlly in provinces where trаditionаl bаses were stronger. To overcome revolutionаry crisis the Bolsheviks mаnаged to use councils (soviets which were even less аble to cаrry out the functions of stаte governаnce but which demonstrаted а form of democrаcy. Lаter аll locаl initiаtive аssociаtions were grаduаlly eliminаted, аnd the Soviet system of power wаs unified in order to build the stаte of “proletаriаn dictаtorship”.

  4. A library of 7TM receptor C-terminal tails - Interactions with the proposed post-endocytic sorting proteins ERM-binding phosphoprotein 50 (EBP50), N-ethylmaleimide-sensitive factor (NSF), sorting nexin 1 (SNX1), and G protein-coupled receptor-associated sorting protein (GASP)

    DEFF Research Database (Denmark)

    Heydorn, A.; Sondergaard, B.P.; Ersbøll, Bjarne Kjær

    2004-01-01

    Adaptor and scaffolding proteins determine the cellular targeting, the spatial, and thereby the functional association of G protein-coupled seven-transmembrane receptors with co-receptors, transducers, and downstream effectors and the adaptors determine post-signaling events such as receptor...... only a single receptor tail, i.e. the beta(2)-adrenergic receptor, whereas N-ethylmaleimide-sensitive factor bound 11 of the tail-fusion proteins. Of the two proteins proposed to target receptors for lysosomal degradation, sorting nexin 1 (SNX1) bound 10 and the C-terminal domain of G protein...... the expected nanomolar affinities for interaction with SNX1. Truncations of the NK1 receptor revealed that an extended binding epitope is responsible for the interaction with both SNX1 and G protein-coupled receptor-associated sorting protein as well as with N-ethylmaleimide-sensitive factor. It is concluded...

  5. A library of 7TM receptor C-terminal tails. Interactions with the proposed post-endocytic sorting proteins ERM-binding phosphoprotein 50 (EBP50), N-ethylmaleimide-sensitive factor (NSF), sorting nexin 1 (SNX1), and G protein-coupled receptor-associated sorting protein (GASP)

    DEFF Research Database (Denmark)

    Heydorn, Arne; Søndergaard, Birgitte P; Ersbøll, Bjarne

    2004-01-01

    Adaptor and scaffolding proteins determine the cellular targeting, the spatial, and thereby the functional association of G protein-coupled seven-transmembrane receptors with co-receptors, transducers, and downstream effectors and the adaptors determine post-signaling events such as receptor...... only a single receptor tail, i.e. the beta(2)-adrenergic receptor, whereas N-ethylmaleimide-sensitive factor bound 11 of the tail-fusion proteins. Of the two proteins proposed to target receptors for lysosomal degradation, sorting nexin 1 (SNX1) bound 10 and the C-terminal domain of G protein...... the expected nanomolar affinities for interaction with SNX1. Truncations of the NK(1) receptor revealed that an extended binding epitope is responsible for the interaction with both SNX1 and G protein-coupled receptor-associated sorting protein as well as with N-ethylmaleimide-sensitive factor. It is concluded...

  6. Macronutrient data from bottle casts from the R/V WECOMA off the coast of Washington and Oregon in support of the National Science Foundation (NSF) Coastal Ocean Processes (CoOP) and River Influences on Shelf Ecosystems (RISE) projects from 08 July 2004 to 13 June 2006 (NODC Accession 0049434)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The CoOP RISE program collected CTD and water chemistry (macronutrients, chlorophyll) data during four cruises from 2004-2006 off the Oregon and Washington coast,...

  7. CTD Niskin bottle data from the R/V WECOMA in the North Pacific Ocean in support of the National Science Foundation Coastal Ocean Processes program River Influences on Shelf Ecosystems (NSF CoOP RISE), cruise RISE05W3, from 20040708 to 20060613 (NODC Accession 0051411)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The CoOP RISE program was designed to determine the impact of large river discharge on coastal shelf ecosystems. Macronutrient and chlorophyll data were collected as...

  8. Arzneimittelentwicklung zu vernachlässigten Krankheiten

    Directory of Open Access Journals (Sweden)

    Katrin Gerlinger

    2017-08-01

    Full Text Available Krankheiten, die fast ausschließlich in armen Ländern auftreten, werden seit Jahrzehnten in der medizinischen Forschung und Entwicklung vernachlässigt. Eine Ursache wird in der zahlungsschwachen Nachfrage gesehen. Sie kann die aufwendige kommerzialisierte Produktentwicklung nicht in ausreichendem Maße anreizen. Seit etlichen Jahren werden Wege gesucht, das systemische Problem des patentbasierten Innovationsprozesses zumindest bei armutsassoziierten Krankheiten abzumildern. Einige Akteure testen, inwiefern sich eine Grundidee der Open-Source-Softwareentwicklung – die Zusammenarbeit Freiwilliger bringt Produkte hervor, die keiner Firma allein gehören – auf die Arzneimittelentwicklung übertragen lässt. Dafür öffnen sie unterschiedliche Elemente des pharmakologischen Innovationsprozesses für eine gemeinsame Nutzung und Weiterentwicklung. Sie bezeichnen dies teilweise als Open Innovation. Der Artikel stellt relevante Initiativen vor.

  9. 75 FR 68323 - Annual Surveys in the Manufacturing Area

    Science.gov (United States)

    2010-11-05

    ... MA321T Lumber Production and Mill Stocks MA325F Paints and Allied Products MA325G Pharmaceutical... Science Foundation (NSF) and the Census Bureau. The NSF publishes the results in its publication series...

  10. 76 FR 35482 - Sunshine Act Meetings; Notice

    Science.gov (United States)

    2011-06-17

    .... A room will be available for the public and NSF staff to listen-in on this teleconference meeting... for pick-up at the visitor's desk on the day of the meeting. All visitors must report to the NSF...

  11. Protease-activated receptor (PAR)-2 is required for PAR-1 signalling in pulmonary fibrosis

    NARCIS (Netherlands)

    Lin, Cong; von der Thüsen, Jan; Daalhuisen, Joost; ten Brink, Marieke; Crestani, Bruno; van der Poll, Tom; Borensztajn, Keren; Spek, C. Arnold

    2015-01-01

    Idiopathic pulmonary fibrosis is the most devastating diffuse fibrosing lung disease of unknown aetiology. Compelling evidence suggests that both protease-activated receptor (PAR)-1 and PAR-2 participate in the development of pulmonary fibrosis. Previous studies have shown that bleomycin-induced

  12. Pharmacological targeting of protease-activated receptor 2 affords protection from bleomycin-induced pulmonary fibrosis

    NARCIS (Netherlands)

    C. Lin (Cong); J. von der Thusen (Jan); J. Daalhuisen (Joost); M. Ten Brink (Marieke); B. Crestani (Bruno); T. van der Poll (Tom); K. Borensztajn (Keren); C. Arnold Spek (C.)

    2015-01-01

    textabstractIdiopathic pulmonary fibrosis is the most devastating diffuse fibrosing lung disease that remains refractory to therapy. Despite increasing evidence that protease-activated receptor 2 (PAR-2) contributes to fibrosis, its importance in pulmonary fibrosis is under debate. We addressed

  13. Pharmacological Targeting of Protease-Activated Receptor 2 Affords Protection from Bleomycin-Induced Pulmonary Fibrosis

    NARCIS (Netherlands)

    Lin, Cong; von der Thüsen, Jan; Daalhuisen, Joost; ten Brink, Marieke; Crestani, Bruno; van der Poll, Tom; Borensztajn, Keren; Spek, C. Arnold

    2015-01-01

    Idiopathic pulmonary fibrosis is the most devastating diffuse fibrosing lung disease that remains refractory to therapy. Despite increasing evidence that protease-activated receptor 2 (PAR-2) contributes to fibrosis, its importance in pulmonary fibrosis is under debate. We addressed whether PAR-2

  14. The emerging mysteries of IgG4-related disease

    NARCIS (Netherlands)

    Smit, Wouter; Barnes, Eleanor

    2014-01-01

    IgG4-related disease (IgG4-RD) is increasingly recognised in Western societies as a multi-system, inflammatory, fibrosing disease of unknown aetiology that typically, though not exclusively, presents in older men. The clinical manifestations are diverse and almost any organ may be affected. The

  15. Case Presentation at a Clinico-Pathological Conference*

    African Journals Online (AJOL)

    of low-strength mannitoi to reduce possible cerebral oede- ma. His convulsions were ..... No vascular lesions were noted but a few degenerate muscle fibres were ... The liver necrosis appears to have been a terminal event. Cases of fibrosing ...

  16. Case series

    African Journals Online (AJOL)

    abp

    1 oct. 2013 ... conduit, 23 patients ont eu une atteinte pulmonaire rhumatoïde à type de pneumonie infiltrante diffuse, de nodules rhumatoïdes pulmonaires ou de fibrose pulmonaire, 38 patients avaient un syndrome sec, dont 7 souffraient d'un goujerot sjogren retenu selon les critères de l'American European Consensus ...

  17. Dupuytren diathesis and genetic risk

    NARCIS (Netherlands)

    Dolmans, Guido H; de Bock, Geertruida H; Werker, Paul M

    2012-01-01

    PURPOSE: Dupuytren disease (DD) is a benign fibrosing disorder of the hand and fingers. Recently, we identified 9 single nucleotide polymorphisms (SNPs) associated with DD in a genome-wide association study. These SNPs can be used to calculate a genetic risk score for DD. The aim of this study was

  18. Potential novel targets: Protease-activated receptors in idiopathic pulmonary fibrosis

    NARCIS (Netherlands)

    Lin, C.

    2015-01-01

    Idiopathic pulmonary fibrosis (IPF) is the most devastating diffuse fibrosing lung disease of unknown etiology. IPF patients suffer from severe breathlessness caused by decreasing lung compliance eventually leading to respiratory failure and death. The prognosis of IPF is devastating: there is only

  19. Nephrogenic systemic fibrosis symptoms alleviated by renal transplantation

    DEFF Research Database (Denmark)

    Hansen, Jesper Melchior

    2011-01-01

    are limited. Anecdotal reports have shown partial or complete resolution of NSF following successful renal transplantation early in the course of NSF. In this report, we describe alleviation of NSF symptoms in two women following successful renal transplantation more than 3 years after onset of NSF.......Nephrogenic systemic fibrosis (NSF) is a rare, serious, and life-threatening disease of patients with severe renal impairment. Gadolinium-containing contrast agents have been shown to be the crucial trigger. There is no proven medical cure for the disease, and symptomatic treatment options...

  20. Relationship between serum concetrations of type III procollagen, hyluronic acid and histopathological findings in the liver of HCV-positive blood donors Relação entre concentrações séricas de procolágeno tipo III, ácido hialurônico com achados histopatológicos do fígado em doadores de sangue anti-HCV positivos

    Directory of Open Access Journals (Sweden)

    Vera Regina Rodrigues Camacho

    2007-06-01

    Full Text Available BACKGROUND: Serologic markers have been proposed for monitoring hepatic fibrosis in chronic liver disease. Among fibrosis markers, type III procollagen (PIIIP and hyaluronic acid have been studied in these patients. AIM: To evaluate the association between these serum markers with histological findings. METHODS: A prospective cross-sectional study was carried out with HCV-positive blood donors. The studied population included men and women whose age ranged from 18 to 60 years, with elevated liver function tests [ALT levels > 1.5 times the normal value and alterations of two or more of the following: any changes in the levels of ALT, aspartate aminotransferase, conjugated bilirrubin, gammaglobulin, gammaglutamyltranspeptidase, albumin, platelet count; alkaline phosphatase levels >1.5 times the normal value, or prothrombin time below 70% and above 60%]. Fourty-nine patients were submitted to liver biopsy, blood analysis of PIIIP, hyaluronic acid, besides liver function tests. RESULTS: Liver function tests were not associated with tissular fibrosis, as assessed by ALT (>1.5 times above normal, fibrosis risk=18.8%; RACIONAL: Marcadores sorológicos têm sido propostos para monitorar fibrose hepática em doença crônica do fígado. Dentre os marcadores de fibrose, ácido hialurônico e procolágeno tipo III têm sido estudados nestes pacientes. OBJETIVO: Avaliar a associação de marcadores séricos de fibrose com achados histológicos. MÉTODOS: Foi realizado estudo transversal prospectivo em doadores de sangue anti-HCV positivos. A população estudada incluiu homens e mulheres com idade entre 18-60 anos com provas de função hepática alteradas (níveis de alanina aminotransferase >1.5 vezes do normal e alterações de dois ou mais dos seguintes: qualquer alteração nos níveis de alanina aminotransferase, aspartato aminotransferase, bilirrubina conjugada, gamaglobulina, gamaglutamiltranspeptidase, albumina, plaquetas, níveis de fosfatase

  1. Elevação dos níveis séricos de laminina na cirrose hepática induzida pelo tetracloreto de carbono

    Directory of Open Access Journals (Sweden)

    Neves Lindalva Batista

    2003-01-01

    Full Text Available RACIONAL: Laminina sérica tem sido correlacionada com a hipertensão portal e a capilarização dos sinusóides na doença hepática crônica. Pouco é conhecido sobre sua dinâmica nas doenças hepáticas. OBJETIVO: Estudar os níveis séricos de laminina e correlacioná-los com graus de fibrose hepática e hipertensão portal em ratos tratados com tetracloreto de carbono. MATERIAL E MÉTODO: Quarenta e nove ratos albinos Wistar foram mantidos como controles (n = 16 ou tratados com solução de tetracloreto de carbono a 8% (n = 23. Entre a 6ª e 16ª semana de experimento animais foram sacrificados após cateterização da veia porta e medida da pressão portal. Fragmentos de fígado foram fixados em formol para microscopia óptica. A fibrose hepática foi classificada em perivenular, septal incompleta e completa e cirrose. Concentração de laminina circulante foi determinada pela técnica de ensaio imunoenzimático com anticorpo desenvolvido a partir de laminina isolada de tumor Engelbreth-Holm-Swarm e purificado em coluna de afinidade. RESULTADOS: A pressão portal correlacionou-se com grau de fibrose hepática (r = 0,82; n = 45 e seus níveis nos grupos fibrose septal (10,8 ± 1,2 cm H2O e cirrose (13,6 + 3,1 cm H2O foram estatisticamente superiores aos observados no grupo-controle (7,9 + 1,5 cmH2O e no grupo com fibrose perivenular (9,1 + 0,8 cmH2O. A concentração de laminina no sangue periférico dos cirróticos (40,0 + 18,7 µg/dL foi significativamente superior aos grupos-controle (13,8 + 12,1 µg/dL, fibrose perivenular (19,1 + 15,5 e fibrose septal (22,2 + 27,0 µg/dL. Laminina circulante correlacionou-se de maneira significativa com o grau de fibrose hepática (r = 0,59; n = 49 e com os níveis de pressão portal (r = 0,29; n = 45. CONCLUSÕES: Na intoxicação crônica experimental pelo tetracloreto de carbono, níveis circulantes de laminina correlacionam-se mais com o grau de fibrose hepática do que com os níveis de hipertens

  2. Gadolinium-induced nephrogenic systemic fibrosis: the rise and fall of an iatrogenic disease

    DEFF Research Database (Denmark)

    Bennett, Charles L; Qureshi, Zaina P; Sartor, A Oliver

    2012-01-01

    BACKGROUND.: In 2006, nephrologists in Denmark unexpectedly identified chronic kidney disease (CKD) patients with a new syndrome, nephrogenic systemic fibrosis (NSF). Subsequently, 1603 NSF patients were reported to the Food and Drug Administration. Sixty hospitals in the USA account for 93......% of these cases, and two hospitals in Denmark account for 4% of these reports. We review Denmark's identification and subsequent rapid eradication of NSF. METHODS.: NSF reports from clinicians, the Danish Medicines Agency (DMA) and gadolinium-based contrast agents (GBCAs) manufacturers were reviewed (2002...... at Skejby Hospital and Herlev Hospital, respectively, began performing gadodiamide-enhanced magnetic resonance angiography scans (0.3 mmol/kg) of CKD patients. In 2005, Herlev clinicians requested assistance in evaluating etiological causes of NSF occurring among 10 CKD patients who had developed NSF...

  3. Current status of nephrogenic systemic fibrosis

    International Nuclear Information System (INIS)

    Daftari Besheli, L.; Aran, S.; Shaqdan, K.; Kay, J.; Abujudeh, H.

    2014-01-01

    Nephrogenic systemic fibrosis (NSF) occurs in patients with advanced chronic kidney disease (CKD) or acute renal failure, most commonly following exposure to gadolinium-based contrast agents (GBCAs). NSF can be debilitating and associated with increased mortality. The putative association of NSF with GBCAs prompted the development of guidelines to limit the use of these contrast agents in at-risk patients. Indeed, the incidence of NSF has decreased dramatically following application of these guidelines, which appears to be the only effective means of decreasing NSF incidence. Thus, increasing clinician awareness of these updated guidelines is important. The present review introduces and compares updated guidelines for GBCA use and discusses the latest advances in the understanding of the pathogenic mechanisms and treatment of NSF

  4. NSB organizational changes

    Science.gov (United States)

    To increase its involvement in National Science Foundation (NSF) policy and program oversight, the National Science Board (NSB), which is the NSF governing body, has instituted a number of changes in its committee structure and operations.One reason for the changes, according to Roland Schmitt, senior vice president for corporate research and development at the General Electric Company and chairman of NSB, is to move away from approval of NSF awards as the primary mechanism for NSB oversight of NSF programs. By law, NSB must approve awards that are above a certain dollar value. Most awards above that limit come from only a few NSF programs. The new changes will allow NSB to review programs and projects throughout NSF earlier in the review process and to affect major program decisions when they are being made.

  5. Nephrogenic systemic fibrosis: history and epidemiology

    DEFF Research Database (Denmark)

    Thomsen, Henrik S

    2009-01-01

    Nephrogenic systemic fibrosis (NSF) is a new disease; the first case was diagnosed in 1997. It took 9 years before an association between NSF and gadolinium-based contrast agents (Gd-CAs) was identified. Gadolinium has several advantages for use in relation to enhanced MRI, but it is also a toxic...... that the real number of patients who have NSF has not been accurately totaled; the disease seems to be underdiagnosed for various reasons....

  6. Pushouts in software architecture design

    OpenAIRE

    Riché, T. L.; Gonçalves, Rui; Marker, B.; Batory, D.

    2012-01-01

    A classical approach to program derivation is to progressively extend a simple specification and then incrementally refine it to an implementation. We claim this approach is hard or impractical when reverse engineering legacy software architectures. We present a case study that shows optimizations and pushouts--in addition to refinements and extensions--are essential for practical stepwise development of complex software architectures. NSF CCF 0724979 NSF CNS 0509338 NSF CCF 0917167 ...

  7. Doing science, technology and society in the National Science Foundation : commentary on: "Engaged, embedded, enjoined: science and technology studies in the National Science Foundation".

    Science.gov (United States)

    Gorman, Michael E

    2011-12-01

    The author describes his efforts to become a participant observer while he was a Program Director at the NSF. He describes his plans for keeping track of his reflections and his goals before he arrived at NSF, then includes sections from his reflective diary and comments after he had completed his two-year rotation. The influx of rotators means the NSF has to be an adaptive, learning organization but there are bureaucratic obstacles in the way.

  8. A radar survey of M- and X-class asteroids

    Czech Academy of Sciences Publication Activity Database

    Shepard, M.K.; Clark, B. E.; Nolan, M. C.; Howell, E. S.; Magri, C.; Giorgini, J. D.; Benner, L. A. M.; Ostro, S. J.; Harris, A. W.; Warner, B. D.; Pray, D. P.; Pravec, Petr; Fauerbach, M.; Bennett, T.; Klotz, A.; Behrend, R.; Correia, H.; Coloma, J.M.; Casulli, S.; Rivkin, A. S.

    2008-01-01

    Roč. 195, č. 1 (2008), s. 184-205 ISSN 0019-1035 R&D Projects: GA ČR(CZ) GA205/05/0604 Grant - others:NSF(US) AST-0605903; NSF(US) AST-0606704; NSF(US) AST-0607505; NASA (US) NNG06GI32G Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * asteroids composition * surfaces Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.268, year: 2008

  9. Expanding Science Teacher Preparation: the Role of External Funding

    Science.gov (United States)

    Lindberg, John M.; Vokos, S.; Seeley, L.; Close, E.

    2006-12-01

    The Department of Physics and the School of Education at Seattle Pacific University are in the early stages of expanding the scope and reach of our science teacher preparation. We will describe how we are putting the puzzle together and our results to date. * Supported in part by NSF grant #ESI-0455796, NSF grant # DUE-0630460, NSF grant DUE-0310583, The Boeing Corporation, PhysTec and the SPU Science Initiative.

  10. Some highlights of the Daresbury nuclear structure programme

    International Nuclear Information System (INIS)

    Gelletly, W.

    1984-01-01

    The paper concerns the nuclear structure programme at the Daresbury laboratory, United Kingdom. A description is given of the Nuclear Structure Facility (NSF), along with its principal properties and design features. Some of the latest equipment used at the NSF is discussed, including the isotope separator, recoil separator, magnetic spectrometer and gamma-ray detectors. Uses of this equipment at the NSF to study the nuclear properties at high angular momentum and nuclei far from stability, are also described. (U.K.)

  11. Imaging appearances of synovial plicae syndrome of the knee

    OpenAIRE

    Osama Abdalla Mabrouk Kheiralla

    2016-01-01

    Synovial plicae are synovial folds that may be found as intraarticular structures within the knee joint. They are remnants of incomplete resorption of mesenchymal tissue during fetal development. Synovial plicae, if present, are supposed to be non-pathological and asymptomatic, however if they are exposed to special events like direct trauma or repeated activities, they may be inflamed and become fibrosed and rigid and irritates the synovium of the underlying femoral condyle resul...

  12. Paracoccidioidomycosis: high-resolution computed tomography - anatomo-pathological correlation; Paracoccidioidomicose: correlacao da tomografia computadorizada de alta resolucao com a anatomopatologia

    Energy Technology Data Exchange (ETDEWEB)

    Marchiori, Edson; Muniz, Maria Angelica Soares; Santos, Maria Lucia de Oliveira [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Inst. de Radiologia; Moraes, Heleno Pinto de [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Inst. de Patologia; Capone, Domenico [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Inst. de Pneumologia

    2000-12-01

    We reviewed the high-resolution computed tomography scans of 13 patients with paracoccidioidomycosis and correlated the findings with the anatomo-pathological findings of 5 patients. The most frequent findings observed were thickening of the interlobular septa, emphysema, ground glass areas, thickening of bronchial walls, tracheal dilatation, nodules, cavities and evidence of fibrosing disease such as architectural distortion, parenchymatous bands, spicular pleural thickening, intralobular reticulate and thickening with distortion off the axial interstitium. (author)

  13. Research

    African Journals Online (AJOL)

    ebutamanya

    15 mars 2016 ... Selon les marqueurs évolutifs, 112 patients (78,3%) avaient un AgHBe négatif. Quant à la charge virale, 106 patients (74,2%) avaient une virémie inférieure à 2000UI/ml et une fibrose minime inférieure à 7kpa selon le FibroScan. Parmi eux, 13 malades avaient un ADN du VHB indétectable (<20UI/ml).

  14. Scleroderma Mimickers

    Science.gov (United States)

    Morgan, Nadia D.; Hummers, Laura K.

    2017-01-01

    Opinion statement Cutaneous fibrosing disorders encompass a diverse array of diseases united by the presence of varying degrees of dermal sclerosis. The quality and distribution of skin involvement, presence or absence of systemic complications and unique associated laboratory abnormalities often help to distinguish between these diseases. It is imperative that an effort is made to accurately differentiate between scleroderma and its mimics, in order to guide long-term management and facilitate implementation of the appropriate treatment modality where indicated. PMID:28473954

  15. The diffuse interstitial lung disease - with emphasis in the idiopathic interstitial pneumonias

    International Nuclear Information System (INIS)

    Bustillo P, Jose G; Pacheco, Pedro M; Matiz, Carlos; Ojeda, Paulina; Carrillo B, Jorge A.

    2003-01-01

    The term diffuse interstitial lung disease, it refers to those diseases that commit the interstice basically, the space between the membrane basal epithelial and endothelial, although the damage can also commit the outlying air spaces and the vessels; the supplement is centered in the diffuse interstitial lung illness of unknown cause; well-known as idiopathic interstitial pneumonias, making emphasis in the more frequents, the pulmonary fibrosis idiopathic or cryptogenic fibrosant alveolitis

  16. Morphea: Evidence-based recommendations for treatment

    OpenAIRE

    Nicole M Fett

    2012-01-01

    Morphea is a rare fibrosing disorder of the skin. Evidence-based treatment strategies in morphea are lacking. This review summarizes the available data on morphea treatment and provides therapeutic strategies based on morphea subtypes. The Cochrane Library, Medline and Embase from inception until May of 2011 were searched using the key words "morphea" and "morphea treatment." Reference lists of the resultant articles, as well as relevant reviews, were also searched. This review focuses on ran...

  17. Coexisting Morphea and Bullous Lichen Sclerosus Et Atrophicus: A Case Report

    OpenAIRE

    Nurcan Metin; Mahizer Yaldız; Teoman Erdem; Şahin Erdem

    2015-01-01

    Morphea and lichen skleroatrofikans (LSA)are localized fibrosing diseases characterized by well-defined fibrotic plaques. Blisters rarely occur on morphea plaque, and these blisters are mostly considered as bullous morphea which is a rare type of morphea. The cases of bullous LSA growing on plaque morphea are rarer. In this case report, we presented a patient has bullous lesions compatible with of lichen skleroatrofikans clinically and histopathologically on morphea lesions, to draw attention...

  18. Einfluss von Hypothyreose und Mukoviszidose auf das Ruhe- und Belastungs-EKG

    OpenAIRE

    Gerlach, Julia

    2009-01-01

    Bei Menschen, die an cystischer Fibrose oder auch an einer Hypothyreose erkrankt sind, ist die Beteiligung des Herz-Kreislauf-Systems eine bekannte Komplikation. Ziel dieser Arbeit war, möglicherweise bislang unbekannte Auswirkungen dieser Erkrankungen auf das Belastungs-EKG von Kindern und Jugendlichen zu identifizieren und ggf. zu deuten. Dadurch sollte die Beurteilbarkeit des Belastungs-EKGs bei der Untersuchung der genannten Patientengruppen verbessert werden. Es wurden insgesamt 64 Patie...

  19. Inflammatory Pseudotumor of the Pituitary Gland Mimicking a Pituitary Adenoma: A Case Report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Da Mi; Yu, In Kyu [Dept. of Radiology, Eulji University Hospital, Daejeon (Korea, Republic of); Kim, Han Kyu [Dept. of Neurosurgery, Eulji University Hospital, Daejeon (Korea, Republic of); Son Hyun Jin [Dept. of Pathology, Eulji University Hospital, Daejeon (Korea, Republic of)

    2011-04-15

    A 38-year-old man was admitted to our hospital with diplopia. The patient had a relatively well-defined pituitary mass with high cellularity as well as weaker enhancement on imaging modalities including computed tomography (CT) and magnetic resonance imaging (MRI), than a typical pituitary adenoma. The distinction between a pseudotumor and an invasive neoplasm is very difficult before biopsy. In this case report, we discuss the characteristic imaging features of a fibrosing inflammatory pseudotumor of the pituitary gland

  20. Riedel thyroiditis: Fine needle aspiration findings of a rare entity.

    Science.gov (United States)

    Weidner, Anna-Sophie; Molina, David; DeSimone, Robert A; Cohen, Marc A; Giorgadze, Tamar; Scognamiglio, Theresa; Hoda, Rana S

    2015-09-01

    Riedel thyroiditis is a rare fibrosing disorder characterized by extension of the fibroinflammatory process beyond the thyroid capsule. Due to the nature of this lesion, fine-needle aspiration often yields scant material and may be interpreted as non-diagnostic. In this report, we describe cytologic features that allow the cytopathologist to favor a diagnosis of Riedel thyroiditis, thereby guiding appropriate further work-up and management. © 2015 Wiley Periodicals, Inc.

  1. Canopy and litter ant assemblages share similar climate-species density relationships

    Czech Academy of Sciences Publication Activity Database

    Weiser, M. D.; Sanders, N. J.; Agosti, D.; Andersen, A. N.; Ellison, A. M.; Fisher, B. L.; Gibb, H.; Gotelli, N. J.; Gove, A. D.; Gross, K.; Guénard, B.; Janda, Milan; Kaspari, M.; Lessard, J.-P.; Longino, J. T.; Majer, J. D.; Menke, S. B.; McGlynn, T. P.; Parr, C. L.; Philpott, S. M.; Retana, J.; Suarez, A. V.; Vasconcelos, H.L.; Yanoviak, P.; Dunn, R. R.

    2010-01-01

    Roč. 6, č. 6 (2010), s. 769-772 ISSN 1744-9561 Grant - others: NASA Biodiversity Grant(US) ROSES-NNX09AK22G; National Science Foundation(US) NSF-OISE-0749047; National Science Foundation(US) NSF-DEB-0640015; National Science Foundation(US) NSF-0716966; National Science Foundation(US) NSF-DEB0842395 Institutional research plan: CEZ:AV0Z50070508 Keywords : Formicidae * species richness * global diversity gradients Subject RIV: EH - Ecology, Behaviour Impact factor: 3.651, year: 2010

  2. MEMS Terahertz Focal Plane Array With Optical Readout

    Science.gov (United States)

    2016-06-01

    heat sink via a thermal insulator (pure SiO2 ) and two bi-material legs formed by Al and SiO2 as shown in Figure 12. 13 Figure 12. THz...The primary doublet lens is made of two different pieces of glass (E- BAF11 and N-SF11) which are cemented together. The respective indices of...BAF11 glass 1.6725 n2 (N-SF11) Index of refraction of N-SF11 glass 1.7975 t1 (E-BAF11) Thickness of E-BAF11 glass 20 mm t2 (N-SF11) Thickness of N

  3. PROGRESSION OF LIVER FIBROSIS IN MONOINFECTED PATIENTS BY HEPATITIS C VIRUS AND COINFECTED BY HCV AND HUMAN IMMUNODEFICIENCY VIRUS

    Directory of Open Access Journals (Sweden)

    Cristiane Valle TOVO

    2013-03-01

    Full Text Available Context The progression of liver fibrosis in patients coinfected by hepatitis C virus and human immunodeficiency virus (HCV/HIV has been increasingly studied in the past decade. Studies made before the highly active antiretroviral therapy suggest that HIV can change the natural history of the HCV infection, leading to a faster progression of the liver fibrosis. Objective To evaluate and compare the fibrosis progression in two groups of patients (HCV/HIV coinfected and HCV monoinfected Methods Seventy patients HCV monoinfected and 26 patients HCV/HIV coinfected who had not undertaken HCV treatment and were submitted to serial percutaneous liver biopsies were retrospectively evaluated. There was no difference in the fibrosis progression between the two groups. Conclusion The fibrosis grade evolution was not worse in the coinfected patients. The immunosuppression absence and the shortest time period between the biopsies in the coinfected group are possible explanations. Contexto A progressão da fibrose hepática em pacientes coinfectados pelos vírus da hepatite C (VHC e da imunodeficiência humana (VHC/HIV tem sido mais estudada na última década. Estudos realizados antes da terapia antiretroviral de alta potência (HAART sugerem que o HIV pode mudar a história natural da infecção pelo VHC, levando a uma progressão mais rápida da fibrose hepática. Objetivo Avaliar e comparar a progressão de fibrose em duas populações de pacientes (coinfectados VHC/HIV e monoinfectados VHC. Métodos Foram avaliados retrospectivamente 70 pacientes monoinfectados VHC e 26 coinfectados VHC/HIV nunca tratados para o VHC e que haviam realizado duas biopsias hepáticas seriadas. Não houve diferença na progressão de fibrose entre os dois grupos. Conclusão A evolução do grau de fibrose não foi pior nos pacientes coinfectados. A ausência de imunodepressão e o menor intervalo de tempo entre as biopsias no grupo de coinfectados são poss

  4. Hipertensão arterial pulmonar: uso do realce tardio miocárdico pela ressonância magnética cardíaca na avaliação de risco

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Pignataro Bessa

    2013-10-01

    Full Text Available FUNDAMENTO: A hipertensão arterial pulmonar é uma doença grave e progressiva. O maior desafio clínico é seu diagnóstico precoce. OBJETIVO: Avaliar a presença e a extensão do realce tardio miocárdico pela ressonância magnética cardíaca bem como verificar se o percentual da massa de fibrose miocárdica é indicador de gravidade. MÉTODOS: Estudo transversal com 30 pacientes com hipertensão arterial pulmonar dos grupos I e IV, submetidos às avaliações clínica, funcional e hemodinâmica, e à ressonância magnética cardíaca. RESULTADOS: A média de idade dos pacientes foi de 52 anos, com predomínio do gênero feminino (77%. Dentre os pacientes, 53% apresentavam insuficiência ventricular direita ao diagnóstico, e 90% encontravam-se em classe funcional II/III. A média do teste de caminhada de 6 minutos foi de 395 m. No estudo hemodinâmico com o cateterismo direito, a média da pressão arterial pulmonar foi de 53,3 mmHg, do índice cardíaco de 2,1 L/min.m², e a mediana da pressão atrial direita foi de 13,5 mmHg. Realce tardio do miocárdio pela ressonância magnética cardíaca foi encontrado em 28 pacientes. A mediana da massa de fibrose foi 9,9 g e do percentual da massa de fibrose de 6,17%. A presença de classe funcional IV, insuficiência ventricular direita ao diagnóstico, teste de caminhada de 6 minutos 15 mmHg, com índice cardíaco < 2,0 L/min.m², teve associação significativa com maior percentual de fibrose miocárdica. CONCLUSÃO: O percentual da massa de fibrose miocárdica mostra-se um marcador não invasivo com perspectivas promissoras na identificação do paciente portador de hipertensão pulmonar com fatores de alto risco.

  5. New advances in the therapy of non-cystic fibrosis bronchiectasis

    Directory of Open Access Journals (Sweden)

    A. Amorim

    2013-11-01

    Full Text Available Non-cystic fibrosis bronchiectasis remains a common and important respiratory disease to date. It is a chronic pathology and consequently the patients usually require continuous treatment.In recent decades therapies that do not have scientific evidence of their benefits have been commonly used in non-cystic fibrosis bronchiectasis. Cystic fibrosis has provided the experience to extrapolate therapeutic approaches to other bronchiectasis patients. Finally, in the last few years some trials have been carried out specifically in non-cystic fibrosis bronchiectasis which aim to assess the efficacy of some of the treatments which are commonly used but sometimes without clear indication.This review will discuss the recent results from these trials, namely mucoactive, anti-inflammatory and antibiotic therapy. Several trials are ongoing and we hope they will be able to add clarification to the management of these patients. Resumo: As bronquiectasias não-fibrose quística continuam a ser uma doença respiratória comum e importante. Trata-se de uma patologia crónica e, consequentemente, os doentes geralmente precisam de um tratamento contínuo.Nas últimas décadas, tratamentos sem evidência científica dos seus benefícios foram comumente usadas nas bronquiectasias não-fibrose quística. A fibrose quística serviu de experiência para extrapolar a abordagem terapêutica para outros doentes com bronquiectasias. Finalmente, nos últimos anos, foram realizados alguns ensaios bronquiectasias não-fibrose quística que visam avaliar a eficácia de alguns dos tratamentos que são comummente usados mas por vezes sem uma clara indicação.Nesta revisão serão apresentados os resultados recentes destes ensaios, nomeadamente sobre o tratamento mucoactivo, anti-inflamatório e antibiótico. Diversos estudos estão a decorrer e esperamos que estes venham a esclarecer a abordagem mais adequada destes doentes. Keywords: Non-cystic fibrosis bronchiectasis, Advances

  6. Doença intersticial pulmonar em doentes com artrite reumatóide: comparação com a alveolite fibrosante criptogénica

    Directory of Open Access Journals (Sweden)

    B.A. Rajasekaran

    2002-09-01

    Full Text Available RESUMO: Os autores efectuaram um estudo prospectivo longitudinal com o objectivo de comparar a história natural da alveolite fibrosante criptogénica (AFC com a doença do interstício pulmonar (DIP relacionada com a artrite reumatóide (AR.Seleccionaram 1 grupo de 18 doentes com AFC e um grupo de 18 doentes com AR e doença do interstício pulmonar. Ambos os grupos apresentavam idade, sexo e duração da doença semelhantes, tendo todos os doentes sido submetidos a uma avaliação clínica, estudo funcional respiratório e TAC torácica de alta resolução.Os resultados revelaram que, em termos clínicos, a dispneia apresentava uma evolução média de 30 meses até ao diagnóstico nos 2 grupos, sendo mais frequente o hipocratismo digital nos doentes apenas com AFC. A presença de Factor Reumatóide foi superior nos doentes com AR e, segundo estes autores, estava relacionada com um pior prognóstico a nível articular mas parecia ser um factor protector contra a fibrose pulmonar neste grupo.A nível de estudo funcional respiratório, os resultados foram praticamente sobreponíveis quer a nível do VEMS, capacidade vital e capacidade de difusão (DLCO nos 2 grupos de doentes.Radiologicamente, nos doentes com artrite reumatóide, a TAC revelou uma maior percentagem de alveolite (vidro despolido em 4 casos, tendo os restantes 14 doentes fibrose pulmonar estabelecida, tal como no outro grupo estudado. Os doentes com AR apresentavam ainda uma distribuição mais periférica das lesões pulmonares, ao contrário dos outros doentes, em que predominavam as alterações basais.Uma diminuição mais acentuada da DLCO correlacionou-se com a existência de fibrose em favo na TAC em ambos os grupos. COMENTÁRIO: A alveolite fibrosante criptogénica, sinónimo de fibrose pulmonar idiopática, possui um mau prognóstico, com uma sobrevida média aos 5 anos após o diagnóstico de cerca de 50%, e aos 10 anos de aproximadamente 20%.A incidência de doença do

  7. Docetaxel-induced radiation recall dermatitis. A case report and literature review

    Energy Technology Data Exchange (ETDEWEB)

    Strouthos, Iosif; Tselis, Nikolaos; Zamboglou, Nikolaos [Sana Klinikum Offenbach, Strahlenklinik, Offenbach (Germany)

    2016-10-15

    Radiation recall dermatitis (RRD) refers to an acute inflammatory skin reaction appearing on a previously irradiated area following the systemic administration of a reaction-triggering agent. Despite various hypotheses, the pathomechanism of RRD appears complex and is still not fully understood. In addition, no clinical guidelines exist concerning whether drug treatment should be continued upon manifestation of an associated radiation recall phenomenon. We present the case of a patient with docetaxel-induced RRD, which was successfully treated with topical steroids and systemic antihistamines; re-challenge to docetaxel did result in very mild remanifestation of skin reactions. (orig.) [German] Die Strahlen-Recall-Dermatitis (RRD) ist eine akute entzuendliche Reaktion der Haut in einem zuvor bestrahlten Areal als Reaktion auf die systemische Applikation eines triggernden Agens. Der zugrunde liegende Pathomechanismus ist bisher nicht vollstaendig geklaert. Ferner gibt es keine klinischen Leitlinien dazu, ob bei einem assoziierten RRD-Phaenomen die medikamentoese Behandlung fortgesetzt werden sollte oder nicht. Vorgestellt wird ein Fall von Docetaxel-induzierter RRD, welche erfolgreich mit topischen Steroiden und systemischen Antihistaminika behandelt wurde. Eine erneute Docetaxel-Exposition des Patienten ging mit einer sehr milden Remanifestation der kutanen Effloreszenzen einher. (orig.)

  8. Auswirkungen der pharmakologischen Osteoporosetherapie in der Zahnheilkunde

    Directory of Open Access Journals (Sweden)

    Gruber R

    2013-01-01

    Full Text Available Die pharmakologische Osteoporosetherapie greift systemisch in den Knochenumbau ein und erreicht damit auch den Kieferknochen. Die komplexen Auswirkungen auf die Klinik der Parodontologie und Implantologie werden im vorliegenden Beitrag beispielhaft dargestellt. Vitamin D3 fördert die Heilung nach Parodontalchirurgie. Bisphosphonate können die parodontale Situation während der Nachsorgetherapie verbessern und möglicherweise die Einheilung von dentalen Implantaten fördern. Die meisten klinischen Studien zeigen keine negativen Effekte in Bezug auf die Entstehung von Osteonekrosen des Kieferknochens. Die Bedeutung von Strontium für die Zahnheilkunde ist primär in der Kariesprävention angesiedelt. Erste klinische Pilotstudien unterstützen eine mögliche Wirkung von Teriparatid auf die Einheilung dentaler Implantate. Bedeutsam erscheinen die positiven Effekte von Teriparatid bei der Regeneration nach chirurgischer Parodontaltherapie. Die vorliegenden Studien zeigen, dass die pharmakologische Osteoporosetherapie einen positiven Einfluss auf die Klinik der Parodontologie und Implantologie haben kann.

  9. Die Bedeutung des Knochenstoffwechsel-Biomarker in der Osteologie 2012

    Directory of Open Access Journals (Sweden)

    Obermayer-Pietsch B

    2012-01-01

    Full Text Available In den vergangenen Jahren wurden zahlreiche Moleküle aus unterschiedlichen Knochenstoffwechselwegen – so genannte „Knochenbiomarker“ – identifiziert. Sowohl Serum und Plasma als auch Harnanalysen werden für klinische Messungen des Knochenstoffwechsels herangezogen, wobei die Genauigkeit und Nutzerfreundlichkeit Blutproben deutlich bevorzugt. Die systemische Messbarkeit dieser Labormarker außerhalb des Knochens dient dabei als Basis für einen aktuellen „Schnappschuss“ des Knochenstoffwechsels. Die Bedeutung der Knochenbiomarker 2012 liegt in der zunehmend ganzheitlichen Betrachtung von Knochenerkrankungen, wobei einzelne morphologische Messungen wie die Dual-Energie- Röntgenabsorptiometrie (DXA nicht mehr als einzige Methode zur Knochenbeurteilung herangezogen werden. Eine internationale Standardisierung der wichtigsten Knochenmarker zur besseren Vergleichbarkeit ist bereits im Laufen. Eine vereinfachte technische Umsetzung soll in den nächsten Jahren auch weniger spezialisierte Labors und Point-of-Care-Tests einschließen, wobei neue Erkenntnisse aus der Präanalytik von Bedeutung sind. Ob sich Knochenbiomarker in Zukunft weiter durchsetzen werden, hängt allerdings nicht nur von wissenschaftlichen und medizintechnischen, sondern auch von ökonomischen und demographischen Umständen ab.

  10. Die Bedeutung des Knochenstoffwechsel-Biomarker in der Osteologie 2012

    Directory of Open Access Journals (Sweden)

    Obermayer-Pietsch B

    2013-01-01

    Full Text Available In den vergangenen Jahren wurden zahlreiche Moleküle aus unterschiedlichen Knochenstoffwechselwegen – so genannte „Knochenbiomarker“ – identifiziert. Sowohl Serum und Plasma als auch Harnanalysen werden für klinische Messungen des Knochenstoffwechsels herangezogen, wobei die Genauigkeit und Nutzerfreundlichkeit Blutproben deutlich bevorzugt. Die systemische Messbarkeit dieser Labormarker außerhalb des Knochens dient dabei als Basis für einen aktuellen „Schnappschuss“ des Knochenstoffwechsels. Die Bedeutung der Knochenbiomarker 2012 liegt in der zunehmend ganzheitlichen Betrachtung von Knochenerkrankungen, wobei einzelne morphologische Messungen wie die Dual-Energie- Röntgenabsorptiometrie (DXA nicht mehr als einzige Methode zur Knochenbeurteilung herangezogen werden. Eine internationale Standardisierung der wichtigsten Knochenmarker zur besseren Vergleichbarkeit ist bereits im Laufen. Eine vereinfachte technische Umsetzung soll in den nächsten Jahren auch weniger spezialisierte Labors und Point-of-Care-Tests einschließen, wobei neue Erkenntnisse aus der Präanalytik von Bedeutung sind. Ob sich Knochenbiomarker in Zukunft weiter durchsetzen werden, hängt allerdings nicht nur von wissenschaftlichen und medizintechnischen, sondern auch von ökonomischen und demographischen Umständen ab.

  11. Ökonomie der Bandbreite: Evolutionär-ökonomische und kulturanthropologische Überlegungen zu Schnittstellen in Mensch-Maschine-Komplexen

    Directory of Open Access Journals (Sweden)

    Manuel Wäckerle

    2012-09-01

    Full Text Available In diesem Artikel diskutieren wir Bandbreite als kognitive, kulturelle und technische Regel, als eine Regel, die Informationsübertragung pro Zeiteinheit beschränkt. Wir verstehen Wirtschaft, Kultur und Gesellschaft als regelbasiertes evolvierendes System und geben der Bandbreite als generische Regel eine zentrale Rolle. Dabei untersuchen wir theoretisch die wechselwirkenden Prozesse der Ausbeutung und Ausweitung von Bandbreite in Mensch-Maschine-Komplexen. Des Weiteren verweisen wir auf die historische Dimension der digitalisierten Gesellschaft und diskutieren kulturelle Entwicklungen von evolvierten Prothesen. In diesem Zusammenhang formulieren wir eine Genealogie von Gleichheit und Freiheit im Netz. Abschließend betrachten wir zwei Beispiele von evolvierenden Prothesen: Das „Automated Trading“ und die Thematik des „Freundschaftskapitals bei Facebook“. Es zeigt sich, dass sich in beiden Beispielen, so unterschiedlich ihre Implikationen auf ersten Blick auch sind, systemisches Risiko auf ähnliche Art und Weise akkumuliert. Unser Artikel versucht einerseits wesentliche Aspekte der Ökonomie der Bandbreite aufzuzeigen, andererseits erste interdisziplinäre Denkschemata für ebendiese zu entwickeln.

  12. Nephrogenic systemic fibrosis

    DEFF Research Database (Denmark)

    Khurram, Misbah; Skov, Lone; Rossen, Kristian

    2007-01-01

    Nephrogenic systemic fibrosis (NSF) is a fibrotic disease seen in renal failure patients that may lead to severe physical disability. It has been demonstrated in recent studies that NSF can be caused by some gadolinium-containing MRI contrast agents. In this report we present one of a total of 26...

  13. An electromagnetic calorimeter for the solenoidal tracker at the Relativistic Heavy Ion Collider

    International Nuclear Information System (INIS)

    Westfall, G.D.; Llope, W.J.; Underwood, D.G.

    1993-10-01

    In this document, we outline a proposal to the National Science Foundation (NSF) for the construction of an electromagnetic calorimeter for STAR that fulfills these requirements. This proposal creates the opportunity for the NSF to make a major impact on the experimental program at RHIC by providing a crucial, but defensibly omitted, component of the STAR experiment as approved

  14. 75 FR 21678 - Business and Operations Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2010-04-26

    ... Management/Leadership Development. May 19, 2010 NSF Strategic Plan Update--2010-2015; Future NSF-2013 Lease... NATIONAL SCIENCE FOUNDATION Business and Operations Advisory Committee; Notice of Meeting In... announces the following meeting: Name: Business and Operations Advisory Committee (9556). Date/Time: May 18...

  15. Salts of Dodecamethylcarba-closo-dodecaborate(-) Anion, CB11Me12-, and the Radical Dodecamethylcarba-closo-dodecaboranyl, CB11Me12

    Czech Academy of Sciences Publication Activity Database

    Clayton, J. R.; King, B. T.; Zharov, I.; Fete, M. G.; Volkis, V.; Douvris, C.; Valášek, Michal; Michl, Josef

    2010-01-01

    Roč. 35, - (2010), s. 56-63 ISSN 0073-8077 Grant - others:NSF(US) CHE0446688; NSF(US) CHE0848477 Institutional research plan: CEZ:AV0Z40550506 Keywords : boron clusters * methylation * stable free radical Subject RIV: CF - Physical ; Theoretical Chemistry

  16. 77 FR 12884 - Agency Information Collection Activities: Comment Request

    Science.gov (United States)

    2012-03-02

    ... colleges, universities, K-12 school systems, businesses, informal science organizations and other research... welfare by supporting research and education in all fields of science and engineering.'' NSF has had a... scientists, engineers, and science and engineering educators. NSF funds research and education in most fields...

  17. Characterization of porcine CD19 and anti-CD19 monoclonal antibodies

    Czech Academy of Sciences Publication Activity Database

    Sun, J.; Šinkora, J.; Wertz, N.; Morávková, Alena; Butler, J. E.

    2004-01-01

    Roč. 41, - (2004), s. 929-938 ISSN 0161-5890 Grant - others:NSF-MCB(US) 0077237; NSF International grant(US) 99-04130 Institutional research plan: CEZ:AV0Z5045916 Keywords : swine * B cell * sequence Subject RIV: ED - Physiology Impact factor: 3.196, year: 2004

  18. 75 FR 13141 - National Science Board; Sunshine Act Meetings; Notice

    Science.gov (United States)

    2010-03-18

    ... AND TIME: Wednesday, March 24, 2010, 11 a.m. SUBJECT MATTER: Discussion of Recent NSF Portfolio Review Materials, Issues for the Portfolio Assessment, and Next Steps. STATUS: Open. This meeting will be held by... National Science Board Web site ( http://www.nsf.gov/nsb ) for information or schedule updates, or contact...

  19. 45 CFR 617.10 - Mediation.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Mediation. 617.10 Section 617.10 Public Welfare... OF AGE IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE FROM NSF § 617.10 Mediation. (a) NSF will refer to the Federal Mediation and Conciliation Service all complaints that fall within...

  20. T-Shaped Molecular Building Blocks by Combined Bridgehead and Bridge Substitution on Bicyclo[1.1.1]pentanes

    Czech Academy of Sciences Publication Activity Database

    Kaleta, J.; Michl, Josef; Mazal, C.

    2010-01-01

    Roč. 75, č. 7 (2010), s. 2350-2356 ISSN 0022-3263 R&D Projects: GA MŠk ME09114 Grant - others:NSF(US) CHE0848477; NSF(US) OISE-0532040 Institutional research plan: CEZ:AV0Z40550506 Keywords : staffanes * molecular electronics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.002, year: 2010

  1. Gender Differences in Major Federal External Grant Programs. Technical Report

    Science.gov (United States)

    Hosek, Susan D.; Cox, Amy G.; Ghosh-Dastidar, Bonnie; Kofner, Aaron; Ramphal, Nishal; Scott, Jon; Berry, Sandra H.

    2005-01-01

    The Wyden amendment to the National Science Foundation (NSF) Authorization Act of 2002 sought to determine whether federally funded educational programs other than sports comply with Title IX, which prohibits gender discrimination. At the request of NSF, this report analyzes administrative data from fiscal years 2001 through 2003 describing the…

  2. Gender Differences in Major Federal External Grant Programs. Technical Report Summary

    Science.gov (United States)

    Hosek, Susan D.; Cox, Amy G.; Ghosh-Dastidar, Bonnie; Kofner, Aaron; Rampal, Nishal; Scott, Jon; Berry, Sandra H.

    2005-01-01

    The Wyden amendment to the National Science Foundation (NSF) Authorization Act of 2002 sought to determine whether federally funded educational programs other than sports comply with Title IX, which prohibits gender discrimination. At the request of NSF, this report analyzes administrative data from fiscal years 2001 through 2003 describing the…

  3. Accommodating Scientific Illiteracy: Award-Winning Visualizations on the Covers of "Science"

    Science.gov (United States)

    Gigante, Maria E.

    2012-01-01

    The International Science and Engineering Visualization Challenge, recently established by the National Science Foundation (NSF), is an alleged attempt at public outreach. The NSF encourages scientists to submit visualizations that would appeal to non-expert audiences by displaying their work in an annual "special feature" in "Science" magazine,…

  4. Naar meer bruto nationaal sportgeluk? Verkenning van de rol van sport in geluk

    NARCIS (Netherlands)

    Dool, R. van den; Breedveld, K.

    2017-01-01

    Op verzoek van NOC*NSF heeft het Mulier Instituut, met financiële steun van het ministerie van VWS, een verkenning uitgevoerd naar de relatie tussen sport en geluk. NOC*NSF en de Nederlandse sportbonden streven, als onderdeel van het 'transitietraject', ernaar om duidelijker voor het

  5. Formation of molecular bromine from the reaction of ozone with deliquesced NaBr aerosol: Evidence for interface chemistry

    Czech Academy of Sciences Publication Activity Database

    Hunt, S. W.; Roeselová, Martina; Wang, W.; Wingen, L. M.; Knipping, E. M.; Tobias, D. J.; Dabdub, D.; Finlayson-Pitts, B. J.

    2004-01-01

    Roč. 108, - (2004), s. 11559-11572 ISSN 1089-5639 Grant - others:NSF(US) 0209719; NSF(US) 0431512 Institutional research plan: CEZ:AV0Z4055905 Keywords : ozone * sea-salt aerosol * molecular dynamics simulation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.639, year: 2004

  6. Colloquy on Minority Males in Science, Technology, Engineering, and Mathematics

    Science.gov (United States)

    Didion, Catherine; Fortenberry, Norman L.; Cady, Elizabeth

    2012-01-01

    On August 8-12, 2010 the National Academy of Engineering (NAE), with funding from the National Science Foundation (NSF), convened the Colloquy on Minority Males in Science, Technology, Engineering, and Mathematics (STEM), following the release of several reports highlighting the educational challenges facing minority males. The NSF recognized the…

  7. Compulsory Project-Level Involvement and the Use of Program-Level Evaluations: Evaluating the Local Systemic Change for Teacher Enhancement Program

    Science.gov (United States)

    Johnson, Kelli; Weiss, Iris R.

    2011-01-01

    In 1995, the National Science Foundation (NSF) contracted with principal investigator Iris Weiss and an evaluation team at Horizon Research, Inc. (HRI) to conduct a national evaluation of the Local Systemic Change for Teacher Enhancement program (LSC). HRI conducted the core evaluation under a $6.25 million contract with NSF. This program…

  8. 78 FR 3453 - Notice of Intent To Seek Approval To Establish an Information Collection System

    Science.gov (United States)

    2013-01-16

    ... will be required to submit these indicators to NSF via a data collection Web site that will be embedded in NSF's IT infrastructure. These indicators are both quantitative and descriptive and may include... proposed collection of information; (c) ways to enhance the quality, utility, and clarity of the...

  9. 77 FR 74516 - Notice of Intent To Seek Approval To Establish an Information Collection

    Science.gov (United States)

    2012-12-14

    ... Evaluation of the Scholarships in Science, Technology, Engineering, and Mathematics (S-STEM) Program OMB... National Science Foundation (NSF) is supporting an evaluation of the Scholarships in Science, Technology, Engineering, and Mathematics (S-STEM) Program, which operates within NSF's Division of Undergraduate Education...

  10. High prevalence of nephrogenic systemic fibrosis in chronic renal failure patients exposed to gadodiamide, a gadolinium-containing magnetic resonance contrast agent

    DEFF Research Database (Denmark)

    Rydahl, Casper; Thomsen, Henrik S; Marckmann, Peter

    2008-01-01

    OBJECTIVE: Nephrogenic systemic fibrosis (NSF) is a serious disease affecting renal failure patients. It may be caused by some gadolinium (Gd)-containing contrast agents, including gadodiamide. The study aimed at estimating the prevalence of NSF after gadodiamide exposure for patients with chronic...

  11. A Legacy of Leadership and Lessons Learned: Results from the Rural Systemic Initiatives for Improving Mathematics and Science Education

    Science.gov (United States)

    Harmon, Hobart L.; Smith, Keith

    2007-01-01

    This report pays tribute to the National Science Foundation's (NSF) Rural Systemic Initiatives (RSIs), an investment of more than $140 million to improve mathematics and science education in some of rural America's most impoverished communities. The report illustrates the impact of NSF's RSI program on a national scale. Each RSI planned a project…

  12. Magnetic anisotrpy in quantum Hall feromagnets

    Czech Academy of Sciences Publication Activity Database

    Jungwirth, Tomáš; Shlukla, S. P.; Smrčka, Ludvík; Shayegan, M.; MacDonald, A. H.

    1998-01-01

    Roč. 81, č. 11 (1998), s. 2328-2331 ISSN 0031-9007 R&D Projects: GA ČR GA202/98/0085; GA MŠk ME 104 Grant - others:NSF GRANTS(US) INT-9602140; NSF GRANTS(US) DMR-9623511 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 6.017, year: 1998

  13. 76 FR 47271 - Implementation of Scientific Integrity Principles: Draft Plan for Public Comment

    Science.gov (United States)

    2011-08-04

    ... Communications The Office of Legislative and Public Affairs (OLPA) is the authorized news media liaison for NSF... follows: Media Policy: Purpose This document establishes NSF's media policy governing media communications... conduct our merit review process and make funding decisions to adhere to the highest standards of ethical...

  14. 77 FR 11163 - Notice of Buy American Waiver Under the American Recovery and Reinvestment Act of 2009

    Science.gov (United States)

    2012-02-24

    ...) companies world-wide were identified that manufacture ABS approved anchors of superior holding anchors. Of... NATIONAL SCIENCE FOUNDATION Notice of Buy American Waiver Under the American Recovery and Reinvestment Act of 2009 AGENCY: National Science Foundation (NSF). ACTION: Notice. SUMMARY: NSF is hereby...

  15. 76 FR 35920 - Notice of Buy American Waiver Under the American Recovery and Reinvestment Act of 2009

    Science.gov (United States)

    2011-06-20

    ... antifouling system was done by UAF in 2009. Only two sources were identified world-wide and none were... NATIONAL SCIENCE FOUNDATION Notice of Buy American Waiver Under the American Recovery and Reinvestment Act of 2009 AGENCY: National Science Foundation (NSF). ACTION: Notice. SUMMARY: NSF is hereby...

  16. 1968 Listing of Swimming Pool Equipment.

    Science.gov (United States)

    National Sanitation Foundation, Ann Arbor, MI. Testing Lab.

    An up-to-date listing of swimming pool equipment including--(1) companies authorized to display the National Sanitation Foundation seal of approval, (2) equipment listed as meeting NSF swimming pool equipment standards relating to diatomite type filters, (3) equipment listed as meeting NSF swimming pool equipment standard relating to sand type…

  17. 76 FR 35481 - National Science Board; Sunshine Act Meetings; Notice

    Science.gov (United States)

    2011-06-17

    ... 22230. A room will be available for the public and NSF staff to listen-in on this teleconference meeting... for pick-up at the visitor's desk on the day of the meeting. All visitors must report to the NSF...

  18. 78 FR 23312 - National Science Board; Sunshine Act Meetings; Notice

    Science.gov (United States)

    2013-04-18

    ... must report to the NSF visitor desk located in the lobby at the 9th and N. Stuart Streets entrance on... information which may be found at http://www.nsf.gov/nsb/notices/ . Point of contact for the meeting is John...

  19. 78 FR 14593 - National Science Board; Sunshine Act Meetings

    Science.gov (United States)

    2013-03-06

    ... NSF visitor desk located in the lobby at the 9th and N. Stuart Streets entrance on the day of the... matter or status of meeting) may be found at http://www.nsf.gov/nsb/notices/ . Point of contact for this...

  20. 78 FR 20359 - Sunshine Act Meetings; National Science Board

    Science.gov (United States)

    2013-04-04

    ... for May 2013 meeting. STATUS: Open. LOCATION: This meeting will be held by teleconference at the... visitors must report to the NSF visitor desk located in the lobby at the 9th and N. Stuart Streets entrance... information and updates (time, place, subject matter or status of meeting) may be found at http://www.nsf.gov...

  1. Nephrogenic systemic fibrosis: late skin manifestations

    DEFF Research Database (Denmark)

    Bangsgaard, Nannie; Marckmann, Peter; Rossen, Kristian

    2009-01-01

    BACKGROUND: Nephrogenic systemic fibrosis (NSF) is a serious disease that occurs in patients with severe renal disease and is believed to be caused by gadolinium-containing contrast agents. A detailed description of the late skin manifestations of NSF is important to help dermatologists...... and nephrologists recognize the disease. OBSERVATIONS: We studied 17 patients with NSF late in the disease. All patients showed epidermal atrophy and hairlessness of the affected regions, primarily the lower legs. Affected areas were symmetrically distributed and hyperpigmented in most cases. Eleven patients showed......: This descriptive case series of patients with NSF gives a detailed clinical picture of the skin manifestations late in the disease. It demonstrates that the clinical picture in the late stage has a varied presentation and that NSF has a significant effect on the quality of life....

  2. A utilização da Pfaffia glomerata no processo de cicatrização de feridas da pele Pfaffia glomerata in the process of healing of skin wounds

    Directory of Open Access Journals (Sweden)

    Marileide Inacio da Silva

    2010-12-01

    Full Text Available RACIONAL: Quando ocorre perda tecidual na pele surge a necessidade de reconstituir-se o tecido lesionado e atualmente cada vez mais surgem artifícios que se propõem neoformá-lo. O uso de fitoterápicos, como a Pfaffia glomerata, tem a finalidade de buscar nestes produtos princípios ativos que desempenhem efetivo papel no processo de cicatrização. OBJETIVO: Avaliar os resultados da utilização da Pfaffia glomerata na cicatrização de feridas cirúrgicas em ratos. MÉTODOS: Foram utilizados 40 ratos, nos quais realizaram-se feridas cirúrgicas com punch de 3 mm de diâmetro no dorso da parte superior direita onde nenhuma substância foi aplicada e nesses mesmos animais foram também realizadas feridas cirúrgicas na região inferior, onde foi aplicado o extrato do fitoterápico. Foram divididos em quatro subgrupos de 48 horas, uma, duas e três semanas em relação ao sacrifício. Foram tomadas as medidas na circunferência para analisar a contração da ferida macroscopicamente. Microscopicamente os resultados foram analisados utilizando-se a coloração de Hematoxilina-Eosina, para verificar o processo inflamatório; imunohistoquímica, fator VIII, para observar a densidade vascular; e tricrômio de Masson para estudar a fibrose. RESULTADOS: Macroscopicamente o grupo planta obteve resultados superiores ao grupo controle. A análise da variável fator VIII mostrou significância estatística no grupo de uma semana do fitoterápico. Na variável fibrose, constatou-se que no período de 48 horas o grupo controle apresentou 70% de casos com fibrose mínima, ao passo que o da planta, 90%. Em uma semana, o grupo controle apresentou 10% de casos com ausência de fibrose , 60% com fibrose mínima e 30% com fibrose moderada, enquanto que o grupo planta apresentou 70% de casos com fibrose mínima e 30% com fibrose moderada. Já no período de duas semanas, o grupo controle manteve 60% dos casos com fibrose mínima e aumentou para 40% os com

  3. Pengaruh Pemberian Valsartan Dan Kurkumin Terhadap Pembentukan Fibrosis Di Tubulus Proksimal Ginjal Akibat Obstruksi Ureter Unilateral pada Tikus Wistar.

    Directory of Open Access Journals (Sweden)

    Lubis M

    2013-01-01

    . Perbedaan bermakna terbentuKata kunci: Obstruksi ureter, Valsartan, Kurkumin, Fibrosis, Degenerasi hidrofilik, AtrofiAbstractIntroduction: ureter obstruction is a condition where is an obstacle for urine flow from renal to blast (vesica urinaria. The obstruction in ureter will decrease glomerulus filtration flow and it destroys renal parenchym. Fibroses in obstructed renal present through two mediators, there are necrotizing tumor factors-α (TNF-α and angiotension-II. Obstruction of this two mediators will decrease fibroses grading in proximal tubules of renal caused by obtruction. One of TNF-α inhibitors is curcumene and angiotension-II will be obstructed by valsartan. Methods: this experiment is kind of experimental type using animal experiment (Wistar Mice. Wistar Mice are divided into two groups, each group consist of 15 mice, so the total are 30 mice. This animals tighted with at proximal ureter The first group is control one, given valsartan. The second group is given valsartan and curcumene. Oral route and dilution before given. Medicine is given use 1 cc spuit. Giving action in 14 days. The fifteenth day, we take renal of Wistar and do histology examination. Significant difference between fibroses forming in proximal tubulus analyzed by Chi Square Statistic Test with correction of Yates and T-Test, beside that, hydofic degeneration and atrophy in proximal tubulus analyzed by T-Test Statistic Test. Result: there is significant difference in forming of fibroses in proximal tubules of renal between action group and controlled group (Chi Square with p ≤ 0.0001 and T-Test with p ≤ 0.000. In hydrophilic degeneration forming in proximal tubules gotten significant difference between two groups ( T-Test with p ≤ 0.000. In atrophy forming in proximal tubules, there is important difference between two groups (T-Test with p ≤ 0.000.Concultion. There is an effect in giving valsartan and curcumene to fibroses forming in proximal tubules of renal. There is significant

  4. Miopatia por propoxifeno: relato de 2 casos com histoquimica de músculos

    Directory of Open Access Journals (Sweden)

    Lineu Cesar Werneck

    1981-03-01

    Full Text Available São relatados os casos de dois pacientes sofredores de dores crônicas (um com gota e outro com lombalgia, que desenvolveram o vício pelo dextro-propo-xifeno, administrado por via intramuscular. Isto determinou alterações importantes na musculatura onde eram aplicado as injeções, com endurecimento da pele, edema e diminuição da mobilidade do membro afetado. A investigação revelou miopatia crônica, com intensa fibrose do tecido conjuntivo perimisial e endomisial, com infiltração por células linfomonocitárias; havia também atrofia de fibras musculares nas regiões próximas e fibrose com atividade muito aumentada para a fosfatase alcalina no local das lesões. Eletromiografia em um dos casos sugeria denervação e, no outro, envolvimento muscular primário. A retirada da medicação determinou regressão dos sintomas e sinais, mas o retorno de ambos os pacientes ao hábito, fêz recrudescer o processo. São discutidos os achados clínico-patológicos comparando com outras medicação e agressões físicas que acometendo o tecido muscular, acabam levando o musculo à fibrose. Possivelmente as injeções intramusculares repetidas, a irritação pelo cloridrato de dextro-propoxifeno e a redução da drenagem linfática sejam as causas dos sintomas e alterações patológicas.

  5. O Projeto Queixadinha: a morbidade e o controle da esquistossomose em área endêmica no nordeste de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    José Roberto Lambertucci

    1996-04-01

    Full Text Available Nos últimos cinco anos, em uma área endêmica para esquistossomose no nordeste de Minas Gerais, 561 indivíduos submeteram-se a exames clínico, laboratoriais, ultra-sonografia abdominal e dopplerecocardtografia visando definir a morbidade da doença antes e após o tratamento. Revelaram-se altas a prevalência de esquistossomose (66,3% e de formas graves (9,5% com baço palpável. A prevalência de indivíduos sem fibrose hepática e com fibrose teve, moderada e intensa ao ultra-som foi de 46,0%, 19,6%, 27,6% e 6,8%, respectivamente. Vinte um (39,6%: de 53 indivíduos com baço palpável não apresentavam fibrose periportal ao ultrasom. Linfonodos periportais foram identificados em 33,8% dos indivíduos examinados e anticorpos anti-KLH no soro de 40,7%,. Observaram-se alterações urinárias compatíveis com glomerulopatia esquistossamótica em 4,5% da população e 11,7% apresentavam achados dopplerecocardiográficos de hipertensão pulmonar. Doze meses após o tratamento da esquistossomose, a prevalência da doença reduziu-se de 66,3% para 25,0%. Em Queixadinha, um perfil da morbidade da doença e de sua evolução após o tratamento começa a ser delineado.

  6. Enhancing Geoscience Education in Public Schools

    Science.gov (United States)

    Silliman, James; Hansen, Alan; McDonald, JoAnn; Blount, Kit Price; Hill, Denise; Martinez, Mayra

    2007-01-01

    Positive experiences are crucial to student learning as well as in deciding what career to pursue. U.S. National Science Foundation (NSF) studies have shown that by the time students enter high school, 80% are not interested in pursuing science, mathematics, or engineering [NSF, 2002]. Moreover, students without a sufficient background in mathematics and science by the sixth grade will be unable to take advantage of necessary high school classes for college preparation in technological areas [NSF, 2002]. If students have positive experiences earlier, these experiences will be of greater benefit to them in learning and in making important life decisions.

  7. Importance Sampling, Large Deviations, and Differential Games

    Science.gov (United States)

    2002-01-01

    National Science Foundation (NSF- DMS-0072004, NSF-ECS-9979250) and the Army Research Office (DAAD19-00-1-0549, DAAD19-02-1-0425). �Research of this author...supported in part by the National Science Foundation (NSF- DMS-0103669). Report Documentation Page Form ApprovedOMB No. 0704-0188 Public reporting...Process. Appl., 20:213�229, 1985. [2] S. Asmussen. Risk theory in a Markovian environment. Scand. Acturial J., pages 69�100, 1989. [3] S. Asmussen, R

  8. Multiorgan gadolinium (Gd) deposition and fibrosis in a patient with nephrogenic systemic fibrosis--an autopsy-based review

    DEFF Research Database (Denmark)

    Sanyal, Soma; Marckmann, Peter; Scherer, Susanne

    2011-01-01

    tissues of NSF patients, predominantly at the bulk chemical level. The distribution of Gd at the histologic level of organs other than skin has not been reported previously. METHODS: We analysed tissues from an autopsy case with verified advanced NSF by light microscopy and scanning electron microscopy......), kidney, lymph node, skeletal muscle, dura mater and cerebellum of the NSF autopsy case, primarily in vascular walls. Some, but not all, Gd deposits were seen in fibrotic areas. Literature review highlighted that non-specific tissue fibrosis and calcification are frequent findings in tissues of patients...

  9. Adsorption of polycyclic aromatic hydrocarbons at the air-water interface: Molecular dynamics simulations and experimental atmospheric observations

    Czech Academy of Sciences Publication Activity Database

    Vácha, Robert; Jungwirth, Pavel; Chen, J.; Valsaraj, K.

    2006-01-01

    Roč. 8, č. 38 (2006), s. 4461-4467 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) LC512; GA MŠk(CZ) ME 644 Grant - others:NSF(US) CHE0431312; NSF(US) CHE0209719; NSF(US) ATM-0355291 Institutional research plan: CEZ:AV0Z40550506 Keywords : polycyclic aromatic hydrocarbons * water surface * molecular dynamics simulations * heterogeneous atmospheric chemistry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.892, year: 2006

  10. Theoretical and experimental studies of N and SF2 reaction

    International Nuclear Information System (INIS)

    Yu Shuqin; Zhou Xiaoguo

    2000-02-01

    In this paper, free radical reaction of N+SF 2 induced by dc discharge in N 2 and SF 6 system was examined. Although the NS + (m/z = 46) ion signals were detected, NS + is not the spectral carrier from obtained REMPI spectra analysis. Ab initio quantum calculation shows that NSF is the main product of N + SF 2 . It is confirmed from this calculation that NS + obtained in experiment was produced by multiphoton ionization and dissociation of NSF which is real product of N + SF 2 reaction. (author)

  11. Realce Tardio miocárdico por Ressonância Magnética Cardíaca pode identificar risco para Taquicardia Ventricular na Cardiopatia Chagásica Crônica

    OpenAIRE

    Ronaldo Peixoto de Mello; Gilberto Szarf; Paulo Roberto Schvartzman; Edson Minoru Nakano; Mariano Martinez Espinosa; Denis Szejnfeld; Verônica Fernandes; João A. C. Lima; Claudio Cirenza; Angelo A.V. De Paola

    2012-01-01

    FUNDAMENTO: Testes invasivos e não invasivos têm sido usados para identificar risco para Taquicardia Ventricular (TV) em pacientes com Cardiopatia Chagásica Crônica (CCC). Ressonância Magnética Cardíaca (RMC) pela técnica do Realce Tardio (RT) pode ser útil para selecionar pacientes com disfunção ventricular global ou segmentar, com alto grau de fibrose e maior risco para TV clínica. OBJETIVO: Melhorar a identificação de elementos preditivos de TV em pacientes com CCC. MÉTODO: Quarenta e um p...

  12. Comorbidities in interstitial lung diseases

    Directory of Open Access Journals (Sweden)

    George A. Margaritopoulos

    2017-01-01

    Full Text Available Fibrosing lung disorders include a large number of diseases with diverse behaviour. Patients can die because of the progression of their illness, remain stable or even improve after appropriate treatment has been instituted. Comorbidities, such as acute and chronic infection, gastro-oesophageal reflux, pulmonary hypertension, lung cancer, cardiovascular diseases, and obstructive sleep apnoea, can pre-exist or develop at any time during the course of the disease and, if unidentified and untreated, may impair quality of life, impact upon the respiratory status of the patients, and ultimately lead to disease progression and death. Therefore, early identification and accurate treatment of comorbidities is essential.

  13. A molecular imaging approach to cystic fibrosis

    OpenAIRE

    Ferreira, Vera Filipa Cerqueira

    2013-01-01

    Tese de mestrado em Bioquímica, apresentada à Universidade de Lisboa, através da Faculdade de Ciências, 2013 A Fibrose Quística (FQ) é a doença autossómica recessiva letal mais comum na população caucasiana. É caracterizada por um mau funcionamento ao nível pulmonar, pancreático, gastrointestinal e reprodutivo, embora a principal causa de morbilidade e mortalidade se deva à progressiva disfunção pulmonar. A elevada concentração de electrólitos no suor constitui também uma das principais ca...

  14. Pulmonary arterial hypertension secondary to chronic thromboemboli

    International Nuclear Information System (INIS)

    Crysikopoulos, H.; Forrest, J.V.; Olson, L.K.; Roberts, A.C.

    1989-01-01

    The authors report their experience in 150 patients with pulmonary arterial hypertension secondary to chronic pulmonary embolism (CPE). Plain film findings are variable, commonly nonspecific. Occasionally nonuniformity of pulmonary perfusion or truncation of central pulmonary arteries suggest CPE. Multiple, large, unmatched perfusion defects are the most common scintigraphic observations. CT can exclude conditions mimicking CPE, particularly fibrosing mediastinitis. Pulmonary arteriography depicts the location and distribution of emboli. CPE is becoming an increasingly important entity to recognize because of available surgical treatment. Thromboendarterectomy may improve functional status and survival. The diagnosis should be considered in any patient with pulmonary arterial hypertension

  15. Estudo histológico do tecido conjuntivo areolar perifascial implantado em pregas vocais de coelhos

    OpenAIRE

    Adriana Hachiya

    2009-01-01

    Apesar do grande avanço da laringologia nas últimas décadas, o tratamento da rigidez da prega vocal continua sendo um desafio. A rigidez da prega vocal pode estar associada a alterações estruturais mínimas como no sulco vocal profundo ou decorrente da fibrose cicatricial como nos casos de cicatriz pós-operatória. Em ambos os casos, há perda dos elementos da matriz extracelular da camada superficial da lâmina própria (Espaço de Reinke) que se encontra substituída por tecido cicatricial. O obje...

  16. CT appearance of amiodarone-induced pneumonitis

    International Nuclear Information System (INIS)

    Nicholson, A.A.; Hayward, C.

    1989-01-01

    Basal peripheral pleuroparenchymal opacities are described on CT of early cryptogenic fibrosing alveolitis, asbestosis and bleomycin pneumonitis. These diseases may be caused by free radical effects on phospholipid metabolism causing cell wall damage. Amiodarone hydrochloride alters phospholipid synthesis metabolically. Amiodarone pneumonitis might be expected to show similar CT appearances. Sixteen patients who have developed new respiratory symptoms while taking amiodarone have been scanned prone and supine and at inspiration and expiration by means of a scanner with 2-mm sections at 1-cm intervals. All have been previously healthy nonsmokers with no relevant occupational history. Previous chest radiographs have been normal. Results are presented

  17. Eighty cases of nape muscular fasciae inflammation treated with puncture at Hégǔ(合谷LI 4) and Sānjiān(三间 LI 3)%针刺合谷、三间穴治疗项背肌筋膜炎80例

    Institute of Scientific and Technical Information of China (English)

    孙化斌; ZHANG Nan

    2010-01-01

    @@ Nape muscular fasciae inflammation refers to a chronic disease manifesting pain in soft tissues such as fascia and muscle on nape caused by aseptic inflammation, and it is named as "dorsal muscles fibrositis" as well.It is characterized as pain, stiffness and motor limitation in back and nape, involving trapezius, rhomboids and levator scapulae due to coldness, moist, chronic injury and incorrect positions.The author has treated 80 cases of nape muscular fasciae inflammation by puncturing at Hégǔ(合谷LI4)and Sānjiān(三间LI 3), and it is reported as follows.

  18. Epithelial-mesenchymal transition: An emerging target in tissue fibrosis

    Science.gov (United States)

    Li, Meirong; Luan, Fuxin; Zhao, Yali; Hao, Haojie; Zhou, Yong; Han, Weidong

    2016-01-01

    Epithelial-mesenchymal transition (EMT) is involved in a variety of tissue fibroses. Fibroblasts/myofibroblasts derived from epithelial cells contribute to the excessive accumulation of fibrous connective tissue in damaged tissue, which can lead to permanent scarring or organ malfunction. Therefore, EMT-related fibrosis cannot be neglected. This review highlights the findings that demonstrate the EMT to be a direct contributor to the fibroblast/myofibroblast population in the development of tissue fibrosis and helps to elucidate EMT-related anti-fibrotic strategies, which may enable the development of therapeutic interventions to suppress EMT and potentially reverse organ fibrosis. PMID:26361988

  19. Nephrogenic systemic fibrosis: A brief review

    Directory of Open Access Journals (Sweden)

    Rajesh Waikhom

    2011-01-01

    Full Text Available Nephrogenic systemic fibrosis is a fibrosing disorder of the skin that develops in patients with advanced renal failure. It mostly presents with progressive hardening or induration of the skin of the extremities. Systemic involvement is also known to occur in this entity. Exposure to gadolinium contrast for radiological evaluation has been identified as the offending agent. The condition is progressive and can be seriously disabling. Therapeutic options are limited and not rewarding in majority of the cases. Awareness of this entity is important so that proper precautionary measures can be taken at the earliest to ameliorate the condition.

  20. Systemic involvement in localized scleroderma/morphea.

    Science.gov (United States)

    Gorkiewicz-Petkow, Anna; Kalinska-Bienias, Agnieszka

    2015-01-01

    Localized scleroderma (LoSc), also known as morphea, is a rare fibrosing disorder of the skin and underlying tissues. Sclerosis is mainly limited to the skin, but subcutaneous tissue, fascia, and underlying muscles and bone may also be involved. In some cases, systemic manifestation with visceral abnormalities may occur. Several publications have focused on significant aspects of LoSc: genetics, immunity, epidemiology, scoring systems, and unification of classifications. Clinical studies featuring large cohorts with the disease published by various international study groups have been of great value in furthering the diagnostic and therapeutic management of LoSc. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. Update on diagnosis and treatment of idiopathic pulmonary fibrosis

    Science.gov (United States)

    Baddini-Martinez, José; Baldi, Bruno Guedes; da Costa, Cláudia Henrique; Jezler, Sérgio; Lima, Mariana Silva; Rufino, Rogério

    2015-01-01

    Idiopathic pulmonary fibrosis is a type of chronic fibrosing interstitial pneumonia, of unknown etiology, which is associated with a progressive decrease in pulmonary function and with high mortality rates. Interest in and knowledge of this disorder have grown substantially in recent years. In this review article, we broadly discuss distinct aspects related to the diagnosis and treatment of idiopathic pulmonary fibrosis. We list the current diagnostic criteria and describe the therapeutic approaches currently available, symptomatic treatments, the action of new drugs that are effective in slowing the decline in pulmonary function, and indications for lung transplantation. PMID:26578138

  2. [Nonspecific interstitial pneumonitis: a clinicopathologic entity, histologic pattern or unclassified group of heterogeneous interstitial pneumonitis?].

    Science.gov (United States)

    Morais, António; Moura, M Conceição Souto; Cruz, M Rosa; Gomes, Isabel

    2004-01-01

    Nonspecific interstitial pneumonitis (NSIP) initially described by Katzenstein and Fiorelli in 1994, seems to be a distinct clinicopathologic entity among idiopathic interstitial pneumonitis (IIP). Besides different histologic features from other IIP, NSIP is characterized by a better long-term outcome, associated with a better steroids responsiveness than idiopathic pulmonar fibrosis (IPF), where usually were included. Thus, differentiating NSIP from other IIP, namely IPF is very significant, since it has important therapeutic and prognostic implications. NSIP encloses different pathologies, namely those with inflammatory predominance (cellular subtype) or fibrous predominance (fibrosing subtype). NSIP is reviewed and discussed by the authors, after two clinical cases description.

  3. PATHOMORPHOLOGICAL FEATURES OF BONE LESIONS AND CORRELATION OF CLINICAL, LABORATORY AND MORPHOMETRIC CRITERIA IN PATIENTS WITH LATENT SCLEROSING HEMATOGENOUS OSTEOMYELITIS (GARRÉ

    Directory of Open Access Journals (Sweden)

    V. V. Grigorovsky

    2018-01-01

    Full Text Available Introduction. Sclerosing hematogenous osteomyelitis of Garré (SHO holds a significant place among cases of latent hematogenous osteomyelitis. Pathomorphological studies of sclerosing hematogenous osteomyelitis are needed to improve differentiated diagnostics, to prognosticate morphology specifics of nidus and to choose the optimal treatment tactics.Purpose of the study — to identify statistical differences between manifestation patterns of various disease types and correlation between clinical, laboratorial and morphometric criteria of bone lesions in patients with sclerosing hematogenous osteomyelitis.Material and methods. The authors studied tissue fragments of affected bones of 25 patients with SHO which was diagnosed by clinical, laboratorial, visualizing and morphological methods. Gradation morphometric criteria were used to reflect condition of nidus tissues. The authors made the analysis of qualitative characters and correlation analysis of dependencies between clinical and laboratorial criteria on the one hand, and with morphometric criteria — on the other, and identified association factor. Results. Pathomorphological study of SHO nidus demonstrated variances of bone lesions in separate disease cases despite the overall similarity of morphological manifestation. About 2/3 of all cases correspond to fibrosing type whereby even small exudative inflammation sites are absent. In about 1/3 of all cases apart from fibrosis, osteosclerosis and remodeling, the osteomyelitis niduses contain microabscesses indicative of suppurative inflammation as well as the authors observed small sequestration. The maximum differences in patients with various types of SHO were identified in such parameters as share of stab microphages and erythrocyte sedimentation rate (ESR. In cases of long term morbidity the fibrosing disease type is prevailing, in cases of short term lesion (1–2 years — a fibrosing type with microabscesses formation.A series of

  4. Update on diagnosis and treatment of idiopathic pulmonary fibrosis

    Directory of Open Access Journals (Sweden)

    José Baddini-Martinez

    2015-10-01

    Full Text Available Idiopathic pulmonary fibrosis is a type of chronic fibrosing interstitial pneumonia, of unknown etiology, which is associated with a progressive decrease in pulmonary function and with high mortality rates. Interest in and knowledge of this disorder have grown substantially in recent years. In this review article, we broadly discuss distinct aspects related to the diagnosis and treatment of idiopathic pulmonary fibrosis. We list the current diagnostic criteria and describe the therapeutic approaches currently available, symptomatic treatments, the action of new drugs that are effective in slowing the decline in pulmonary function, and indications for lung transplantation.

  5. Idiopathic pulmonary fibrosis in a Staffordshire bull terrier with hypothyroidism.

    Science.gov (United States)

    Corcoran, B M; Dukes-McEwan, J; Rhind, S; French, A

    1999-04-01

    Radiographic evidence of chronic interstitial lung changes, usually believed to be attributable to lung fibrosis, is readily recognised in canine practice. Furthermore, there is a body of anecdotal evidence suggesting that a specific clinical entity consistent with chronic lung fibrosis occurs in specific breeds of terrier dogs. However, there is little pathological data to confirm these radiographic and clinical findings and, therefore, chronic interstitial lung disease of dogs is poorly characterised. In this report, a case of chronic pulmonary fibrosis is described in which histopathological confirmation was possible, and suggested that the condition might be analogous to idiopathic pulmonary fibrosis (cryptogenic fibrosing alveolitis) in humans.

  6. Fibromyalgia syndrome: definition and diagnostic aspects

    Directory of Open Access Journals (Sweden)

    A. Alciati

    2011-09-01

    Full Text Available Although the term “fibromyalgia” (FM is relatively new, the condition characterised by chronic musculoskeletal pain that is accompanied by numerous extra-skeletal symptoms has been described in the medical literature for many years under different names. The term “fibrositis,” which was originally used in 1904 by Sir William Gowers to define a type of lumbalgia, became a synonym for diffuse musculoskeletal pain until 1976 (1. In the mid-1970s, Smythe and Moldofsky used the term “fibrositic syndrome” to describe the presence of tender points (TPs, sleep disturbances and other accompanying symptoms such as asthenia...

  7. Morphea: Evidence-based recommendations for treatment

    Directory of Open Access Journals (Sweden)

    Nicole M Fett

    2012-01-01

    Full Text Available Morphea is a rare fibrosing disorder of the skin. Evidence-based treatment strategies in morphea are lacking. This review summarizes the available data on morphea treatment and provides therapeutic strategies based on morphea subtypes. The Cochrane Library, Medline and Embase from inception until May of 2011 were searched using the key words "morphea" and "morphea treatment." Reference lists of the resultant articles, as well as relevant reviews, were also searched. This review focuses on randomized controlled trials, prospective interventional trials without controls and retrospective reviews with greater than five subjects.

  8. Chronic hypersensitivity pneumonitis.

    Science.gov (United States)

    Pereira, Carlos Ac; Gimenez, Andréa; Kuranishi, Lilian; Storrer, Karin

    2016-01-01

    Hypersensitivity pneumonitis (HSP) is a common interstitial lung disease resulting from inhalation of a large variety of antigens by susceptible individuals. The disease is best classified as acute and chronic. Chronic HSP can be fibrosing or not. Fibrotic HSP has a large differential diagnosis and has a worse prognosis. The most common etiologies for HSP are reviewed. Diagnostic criteria are proposed for both chronic forms based on exposure, lung auscultation, lung function tests, HRCT findings, bronchoalveolar lavage, and biopsies. Treatment options are limited, but lung transplantation results in greater survival in comparison to idiopathic pulmonary fibrosis. Randomized trials with new antifibrotic agents are necessary.

  9. The importance of mdx mouse in the pathophysiology of Duchenne's muscular distrophy

    OpenAIRE

    Seixas, Sandra Lopes; Lagrota-Cândido, Jussara; Savino, Wilson; Quirico-Santos, Thereza

    1997-01-01

    O camundongo mdx desenvolve distrofia muscular recessiva ligada ao cromossoma X (locus Xp21.1) e não expressa distrofina. Embora não apresente intensa fibrose do tecido muscular e acúmulo de tecido adiposo, é considerado o modelo animal mais adequado da distrofia muscular de Duchenne. As alterações estruturais no tecido muscular associadas à mionecrose e presença do infiltrado inflamatório com predomínio de linfócitos e monócitos/macrófagos sugerem uma participação do sistema imunológico nest...

  10. Metrizamide in experimental selective renal angiography

    International Nuclear Information System (INIS)

    Pokorny, L.; Kelemen, J.

    1981-01-01

    Forty-seven dogs or seventy-four kidneys, respectively, were used in studies into the activity of metrizamide (Amipaque). The angiograms were of good quality; as compared with contrast media tested before, the incidence of abnormalities was somewhat lower, and the symptoms (spasm, inhomogeneous nephrogram) were less important. Histological examination showed that plenty of homogeneous pink proteinlike substance had accumulated in many tubules as well as in the lumen of the Bowman's capsules; fibroses were seen in several parts after 7 and 28 days, respectively. However, the evaluation of the renal function showed no considerable changes in the laboratory values. (orig.) [de

  11. Hyperfractionated stereotactic reirradiation for recurrent head and neck cancer

    Energy Technology Data Exchange (ETDEWEB)

    Cvek, Jakub; Knybel, Lukas; Skacelikova, Eva; Otahal, Bretislav; Molenda, Lukas; Feltl, David [University Hospital Ostrava, Department of Oncology, Ostrava (Czech Republic); Stransky, Jiri; Res, Oldrich [University Hospital Ostrava, Department of Maxilofacial Surgery, Ostrava (Czech Republic); Matousek, Petr; Zelenik, Karol [University Hospital Ostrava, Department of Otolaryngology, Ostrava (Czech Republic)

    2016-01-15

    -RT) fuer die Behandlung von Patienten mit Lokalrezidiv von fortgeschrittenen Kopf-Hals-Tumoren (''head and neck squamous cell cancer'', HNSCC), die fuer eine systemische Therapie nicht geeignet sind, zu untersuchen. In die Studie wurden 40 Patienten mit rekurrierten oder sekundaeren HNSCC eingeschlossen. Die Patienten hatten ein medianes makroskopisches Tumorvolumen von 76 ml (Spanne 14-193 ml) und bereits Strahlentherapiedosen des primaeren Tumors von 60 Gy oder groesser erhalten. Die Fraktionierung betrug 48 Gy in 16 Fraktionen ueber 8 Tage. Die Behandlung erfolgte 2-mal taeglich mit einer Pause von minimal 6 h zwischen den Fraktionen. Die Behandlung musste 95 % des Planungszielvolumens (PTV, definiert als makroskopisches Tumorvolumen [GTV] + 3 mm zur Beruecksichtigung der mikroskopischen Streuung, ohne zusaetzlichen Saum) abdecken.Unbeteiligte Lymphknoten wurden nicht bestrahlt. Alle Patienten absolvierten die Behandlung plangemaess (mediane Behandlungsdauer 11 Tage; Spanne 9-14 Tage). Fuer die Beurteilung der Akut- und Spaettoxizitaet wurde die RTOG/EORTC-Skala verwendet. Die Inzidenz einer akuten Mukositis vom Grad 3 betrug 37 %, mit einer Heilungszeit von hoechstens 4 Wochen bei allen betroffenen Patienten. Eine akute Hauttoxizitaet war nie groesser als Grad 2. Spaettoxizitaeten wurden ebenfalls mit der RTOG/EORTC-Skala bewertet. Eine Kiefernekrose hatten 4 Patienten (10 %); allerdings wurde keine,Ruptur der Karotide bzw. keine andere Grad-4-oder Grad-5-Toxizitaetbeobachtet. Die Ein-Jahres-Gesamtueberlebensrate (OS) lag bei 33 %, das lokale progressionsfreie Ueberleben (L-PFS) bei 44 %. Patientenstatus und GTV waren signifikante prognostische Faktoren fuer die lokale Tumorkontrolle und das Ueberleben. Hyperfraktionierte akzelerierte stereotaktische re-RT ist eine interessante Wahl fuer Patienten mit rekurrierten oder sekundaeren HNSCC, die fuer eine systemische Therapie nicht geeignet sind. (orig.)

  12. Therapeutic management of radiation-induced oral mucositis; Therapeutische Beeinflussung der radiogenen oralen Mukositis

    Energy Technology Data Exchange (ETDEWEB)

    Doerr, W. [Klinik und Poliklinik fuer Strahlentherapie, Universitaetsklinikum Carl Gustav Carus, Technische Univ. Dresden (Germany); Doelling-Jochem, I. [Klinik und Poliklinik fuer Strahlentherapie, Universitaetsklinikum Carl Gustav Carus, Technische Univ. Dresden (Germany); Baumann, M. [Klinik und Poliklinik fuer Strahlentherapie, Universitaetsklinikum Carl Gustav Carus, Technische Univ. Dresden (Germany); Herrmann, T. [Klinik und Poliklinik fuer Strahlentherapie, Universitaetsklinikum Carl Gustav Carus, Technische Univ. Dresden (Germany)

    1997-04-01

    Proliferation von Tumorstammzellen, die in der Folge die Tumorheilungsaussichten drastisch verringern kann. Zudem fuehren ueberschiessende Akutreaktionen in vielen Faellen zu einer Verstaerkung von spaeten Strahlenfolgen. Die Verminderung der Schleimhautreaktion mit dem Ziel der Vermeidung von Bestrahlungspausen und der Verminderung von Spaetschaeden kann den therapeutischen Erfolg der Radiotherapie entscheidend verbessern. Verschiedene Ansaetze zur Beeinflussung der strahleninduzierten Mukositis auf symptomatischer oder strahlen- und epithelbiologischer Grundlage wurden zusammengefass und systematisch dargestellt. Es existiert eine Vielzahl prophylaktischer und therapeutischer Ansaetze zur Verminderung akuter radiogener Reaktionen der Mundschleimhaut. Haeufig ist die Wirksamkeit jedoch nur fuer Chemotherapie oder im Zusammenhang mit einer immunsuppressiven Therapie nachgewiesen, so dass oft eher ein systemischer als ein lokaler Effekt angenommen werden muss. Als allgemeine Mukositisprophylaxe koennen neben einer Zahnsanierung regelmaessige mundhygienische Massnahmen sowie antiseptische Spuelungen herangezogen werden. Die Bedeutung einer engmaschigen persoenlichen Betreuung der Patienten ist zu betonen. Das Anlegen eines perkutanen endoskopischen Gastrostoma muss am Zustand des Patienten sowie an der Ausdehnung und Lage des Bestrahlungsfeldes und damit der zu erwartenden Beeintraechtigung der Nahrungsaufnahme orientiert werden. Als therapeutische Massnahmen bei manifesten Schleimhautreaktionen kommen eine lokale bzw. systemische Schmerzbehandlung sowie die lokale Applikation von Antimykotika und Antibiotika in Betracht. (orig./VHE)

  13. Snow-atmosphere Transfer Function for Reversibly Deposited Chemical Species in West Antarctica, Version 1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set is part of the West Antarctic Ice Sheet Cores (WAISCORES) project, an NSF-funded project to understand the influence of the West Antarctic Ice Sheet on...

  14. April 2016 Milwaukee Engineer | College of Engineering & Applied Science

    Science.gov (United States)

    Olympiad Girls Who Code Club FIRST Tech Challenge NSF I-Corps Site of Southeastern Wisconsin UW-Milwaukee with up and coming engineering talent. Read more. merc-sm Register for the Milwaukee Engineering

  15. Catalyst Grants: Charged Up: Testing Batteries for CT Scanners | College of

    Science.gov (United States)

    Olympiad Girls Who Code Club FIRST Tech Challenge NSF I-Corps Site of Southeastern Wisconsin UW-Milwaukee multiple industries and building a talent pipeline for companies in Southeastern Wisconsin. Business

  16. Product Realization | College of Engineering & Applied Science

    Science.gov (United States)

    Olympiad Girls Who Code Club FIRST Tech Challenge NSF I-Corps Site of Southeastern Wisconsin UW-Milwaukee Product Realization Course Companies need time and talent to develop new product prototypes. Students need

  17. ANSYS Institute | College of Engineering & Applied Science

    Science.gov (United States)

    Olympiad Girls Who Code Club FIRST Tech Challenge NSF I-Corps Site of Southeastern Wisconsin UW-Milwaukee facilities and talent with a small investment Ability to investigate new markets or pet projects without

  18. 76 FR 77852 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2011-12-14

    ... teaching and learning. Method of Collection Teachers who have registered to use NSDL resources through... NATIONAL SCIENCE FOUNDATION Agency Information Collection Activities: Proposed Collection; Comment Request AGENCY: National Science Foundation. ACTION: Notice. SUMMARY: The National Science Foundation (NSF...

  19. Lightning talk slide for "SLACKHA: Software Library for Accelerating Chemical Kinetics on Hybrid Architectures"

    OpenAIRE

    Niemeyer, Kyle; Sung, Chih-Jen

    2018-01-01

    Lightning talk slide describing the "SLACKHA: Software Library for Accelerating Chemical Kinetics on Hybrid Architectures" project at the 2018 NSF SI2 PI meeting: https://si2-pi-community.github.io/2018-meeting/

  20. 75 FR 50009 - Advisory Committee for Environmental Research and Education; Notice of Meeting

    Science.gov (United States)

    2010-08-16

    ... NATIONAL SCIENCE FOUNDATION Advisory Committee for Environmental Research and Education; Notice of... support for environmental research and education. Agenda September 8, 2010 Update on recent NSF... Science Foundation announces the following meeting: Name: Advisory Committee for Environmental Research...