A new external microbeam system in Fudan University

International Nuclear Information System (INIS)

Zheng, Y.; Shen, H.; Li, Y.Q.; Li, X.Y.; Yang, M.J.; Mi, Y.

2013-01-01

A cost-effective and removable external beam system is set up based on the Oxford Microbeam system in Fudan University. In our external beam system, 7.5-μm-thick Kapton film is used as exit window with a diameter of 3.5 mm. The spatial resolution is about 18 μm full width at half maximum (FWHM) on a copper grid. As an example, calcium distribution in otolith is present by the external micro-PIXE. In addition, little change can be done to the external system mentioned above for radiobiology experiments. The exit window can be changed from the focal plane to the observation window of vacuum chamber. By calculation, the beam spot size can reach less than 30 μm. Since the Oxford type octagonal target chamber is popular among the nuclear microprobe facilities, this method can be provided to easily replace the in-vacuum system with the external system, extending the in-vacuum analysis to external beam analysis

A new external microbeam system in Fudan University

Energy Technology Data Exchange (ETDEWEB)

Zheng, Y.; Shen, H., E-mail: haoshen@fudan.edu.cn; Li, Y.Q.; Li, X.Y.; Yang, M.J.; Mi, Y.

2013-07-01

A cost-effective and removable external beam system is set up based on the Oxford Microbeam system in Fudan University. In our external beam system, 7.5-μm-thick Kapton film is used as exit window with a diameter of 3.5 mm. The spatial resolution is about 18 μm full width at half maximum (FWHM) on a copper grid. As an example, calcium distribution in otolith is present by the external micro-PIXE. In addition, little change can be done to the external system mentioned above for radiobiology experiments. The exit window can be changed from the focal plane to the observation window of vacuum chamber. By calculation, the beam spot size can reach less than 30 μm. Since the Oxford type octagonal target chamber is popular among the nuclear microprobe facilities, this method can be provided to easily replace the in-vacuum system with the external system, extending the in-vacuum analysis to external beam analysis.

A new external microbeam system in Fudan University

Energy Technology Data Exchange (ETDEWEB)

Zheng, Y. [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Shen, H., E-mail: haoshen@fudan.edu.cn [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Li, Y.Q.; Li, X.Y.; Yang, M.J.; Mi, Y. [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China)

2013-02-01

A cost-effective and removable external beam system is set up based on the Oxford Microbeam system in Fudan University. In our external beam system, 7.5-μm-thick Kapton film is used as exit window with a diameter of 3.5 mm. The spatial resolution is about 18 μm full width at half maximum (FWHM) on a copper grid. As an example, calcium distribution in otolith is present by the external micro-PIXE. In addition, little change can be done to the external system mentioned above for radiobiology experiments. The exit window can be changed from the focal plane to the observation window of vacuum chamber. By calculation, the beam spot size can reach less than 30 μm. Since the Oxford type octagonal target chamber is popular among the nuclear microprobe facilities, this method can be provided to easily replace the in-vacuum system with the external system, extending the in-vacuum analysis to external beam analysis.

Onco-STS: a web-based laboratory information management system for sample and analysis tracking in oncogenomic experiments.

Science.gov (United States)

Gavrielides, Mike; Furney, Simon J; Yates, Tim; Miller, Crispin J; Marais, Richard

2014-01-01

Whole genomes, whole exomes and transcriptomes of tumour samples are sequenced routinely to identify the drivers of cancer. The systematic sequencing and analysis of tumour samples, as well other oncogenomic experiments, necessitates the tracking of relevant sample information throughout the investigative process. These meta-data of the sequencing and analysis procedures include information about the samples and projects as well as the sequencing centres, platforms, data locations, results locations, alignments, analysis specifications and further information relevant to the experiments. The current work presents a sample tracking system for oncogenomic studies (Onco-STS) to store these data and make them easily accessible to the researchers who work with the samples. The system is a web application, which includes a database and a front-end web page that allows the remote access, submission and updating of the sample data in the database. The web application development programming framework Grails was used for the development and implementation of the system. The resulting Onco-STS solution is efficient, secure and easy to use and is intended to replace the manual data handling of text records. Onco-STS allows simultaneous remote access to the system making collaboration among researchers more effective. The system stores both information on the samples in oncogenomic studies and details of the analyses conducted on the resulting data. Onco-STS is based on open-source software, is easy to develop and can be modified according to a research group's needs. Hence it is suitable for laboratories that do not require a commercial system.

Assessment of three risk evaluation systems for patients aged ≥70 in East China: performance of SinoSCORE, EuroSCORE II and the STS risk evaluation system.

Science.gov (United States)

Shan, Lingtong; Ge, Wen; Pu, Yiwei; Cheng, Hong; Cang, Zhengqiang; Zhang, Xing; Li, Qifan; Xu, Anyang; Wang, Qi; Gu, Chang; Zhang, Yangyang

2018-01-01

To assess and compare the predictive ability of three risk evaluation systems (SinoSCORE, EuroSCORE II and the STS risk evaluation system) in patients aged ≥70, and who underwent coronary artery bypass grafting (CABG) in East China. Three risk evaluation systems were applied to 1,946 consecutive patients who underwent isolated CABG from January 2004 to September 2016 in two hospitals. Patients were divided into two subsets according to their age: elderly group (age ≥70) with a younger group (age evaluation system were 0.78(0.64)%, 1.43(1.14)% and 0.78(0.77)%, respectively. SinoSCORE achieved the best discrimination (the area under the receiver operating characteristic curve (AUC) = 0.829), followed by the STS risk evaluation system (AUC = 0.790) and EuroSCORE II (AUC = 0.769) in the entire cohort. In the elderly group, the observed mortality rate was 4.82% while it was 1.38% in the younger group. SinoSCORE (AUC = .829) also achieved the best discrimination in the elderly group, followed by the STS risk evaluation system (AUC = .730) and EuroSCORE II (AUC = 0.640) while all three risk evaluation systems all had good performances in the younger group. SinoSCORE, EuroSCORE II and the STS risk evaluation system all achieved positive calibrations in the entire cohort and subsets. The performance of the three risk evaluation systems was not ideal in the entire cohort. In the elderly group, SinoSCORE appeared to achieve better predictive efficiency than EuroSCORE II and the STS risk evaluation system.

STS-121: Discovery L-2 Countdown Status Briefing

Science.gov (United States)

2006-01-01

Bruce Buckingham from NASA Public Affairs introduces Pete Nicolenko, NASA Test Director, and Kathy Winters, Shuttle Weather Officer. During this STS-121 two days before launch countdown briefing, Pete Nicolenko says that there are no issues of concern and that they are on schedule for launch. He then presents and discusses an Orbiter Processing Facility (OPF) video. The OPF topics of discussion include: 1) Wheel and tire installation; 2) Gap filler installation; 3) Booster build-up; 4) Transport of External Tank (ET) 119; 5) ET to Shuttle Rocket Booster (SRB) Mate operation; 6) Roll-over of Discovery out of OPF to the Vehicle Assembly Building (VAB); and 7) Roll-out to the pad. Kathy Winters gives her weather forecast for the STS-121 launch. The video ends with a question and answer period from the media.

33 CFR 117.829 - Northeast Cape Fear River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast Cape Fear River. 117... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.829 Northeast Cape... the Seaboard System Railroad Bridge across the Northeast Cape Fear River, mile 27.0, at Castle Hayne...

33 CFR 117.927 - Coosaw River (Whale Branch).

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Coosaw River (Whale Branch). 117.927 Section 117.927 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Whale Branch). The draw of the Seaboard System Railroad bridge, mile 5.3 at Seabrook, and the draw of...

Evaluation of STS 430 and STS 444 for SOFC Interconnect Applications

International Nuclear Information System (INIS)

Kim, S. H.; Huh, J. Y.; Jun, J. H.; Kim, D. H.; Jun, J. H.

2007-01-01

Ferritic stainless steels for the SOFC interconnect applications are required to possess not only a good oxidation resistance, but also a high electrical conductivity of te oxide scale that forms during exposure at the SOFC operating environment. In order to understand the effects of alloying elements on the oxidation behavior of ferritic stainless steels and on the electrical properties of oxide scales, two kinds of commercial ferritic stainless steels, STS 430 and STS 444, were investigated by performing isothermal oxidations at 800 .deg. C in a wet air containing 3% H 2 O. The results showed that STS 444 was superior to STS 430 in both of the oxidation resistance and the area specific resistance. Although STS 444 contained a less amount of Mn for the (Mn, Cr) 3 O 4 spinel formation than STS 430, the minor alloying elements of Al and Mo in STS 444, which were accumulated in the base metal region adjacent the scale, were suggested to reduce the scale growth rate and to enhance the scale adherence to the base metal

External costs and taxes in heat supply systems

International Nuclear Information System (INIS)

Karlsson, Aasa; Gustavsson, Leif

2003-01-01

A systems approach was used to compare different heating systems from a consumer perspective. The whole energy system was considered from natural resources to the required energy services. District heating, electric heat pumps, electric boilers, natural-gas-, oil- or pellet-fired local boilers were considered when supplying heat to a detached house. The district heat production included wood-chip-fired and natural-gas-fired cogeneration plants. Electricity other than cogenerated electricity was produced in wood-chip- and natural-gas-fired stand-alone power plants. The analysis includes four tax scenarios, as well as the external cost of environmental and health damage arising from energy conversion emission based on the ExternE study of the European Commission. The most cost-efficient systems were the natural-gas and oil boiler systems, followed by the heat pump and district heating systems, when the external cost and taxes were excluded. When including the external costs of CO 2 emission, the wood-fuel-based systems were much more cost efficient than the fossil-fuel-based systems, also when CO 2 capture and storage were applied. The external costs are, however, highly uncertain. Taxes steer towards lowering energy use and lowering CO 2 emission if they are levied solely on all the fossil-fuel-related emission and fuel use in the systems. If consumer electricity and heat taxes are used, the taxes have an impact on the total cost, regardless of the fuel used, thereby benefiting fuel-based local heating systems. The heat pump systems were the least affected by taxes, due to their high energy efficiency. The electric boiler systems were the least cost-efficient systems, also when the external cost and taxes were included

49 CFR 215.117 - Defective roller bearing adapter.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing adapter. 215.117 Section... Suspension System § 215.117 Defective roller bearing adapter. A railroad may not place or continue in service a car, if the car has a roller bearing adapter that is— (a) Cracked or broken; (b) Not in its design...

Patterning in systems driven by nonlocal external forces.

Science.gov (United States)

Luneville, L; Mallick, K; Pontikis, V; Simeone, D

2016-11-01

This work focuses on systems displaying domain patterns resulting from competing external and internal dynamics. To this end, we introduce a Lyapunov functional capable of describing the steady states of systems subject to external forces, by adding nonlocal terms to the Landau Ginzburg free energy of the system. Thereby, we extend the existing methodology treating long-range order interactions, to the case of external nonlocal forces. By studying the quadratic term of this Lyapunov functional, we compute the phase diagram in the temperature versus external field and we determine all possible modulated phases (domain patterns) as a function of the external forces and the temperature. Finally, we investigate patterning in chemical reactive mixtures and binary mixtures under irradiation, and we show that the last case opens the path toward micro-structural engineering of materials.

A new Master Events Controller is prepared for installation in STS-99 Endeavour

Science.gov (United States)

2000-01-01

A new Enhanced Main Events Controller (E-MEC) for Shuttle Endeavour sits on a table in a Quality trailer in the Launch Pad 39B area. The original E-MEC in Endeavour became suspect during the Jan. 31 launch countdown and mission STS-99 was delayed when NASA managers decided to replace it. Each Shuttle carries two enhanced master events controllers (E-MECs), which provide relays for onboard flight computers to send signals to arm and fire pyrotechnics that separate the solid rockets and external tank during assent. The E-MECs are located in the orbiter's aft compartment and both are needed for the Shuttle to be cleared for flight. Currently Endeavour and Columbia are the only two orbiters with the E-MECs. Built by Rockwell's Satellite Space Electronics Division, Anaheim, Calif., each unit weighs 65 pounds and is approximately 20 inches long, 13 inches wide and 8 inches tall. Previously, three Shuttle flights have been scrubbed or delayed due to faulty MECs: STS-73, STS-49 and STS-41-D. Before workers can begin E-MEC replacement efforts at the launch pad, cryogenic reactants must be offloaded from the orbiter and Space Shuttle ordnance disconnected. The next scheduled date for launch of STS-99 is Feb. 11 at 12:30 p.m. EST.

STS-110 Extravehicular Activity (EVA)

Science.gov (United States)

2002-01-01

STS-110 mission specialist Lee M.E. Morin carries an affixed 35 mm camera to record work which is being performed on the International Space Station (ISS). Working with astronaut Jerry L. Ross (out of frame), the duo completed the structural attachment of the S0 (s-zero) truss, mating two large tripod legs of the 13 1/2 ton structure to the station's main laboratory during a 7-hour, 30-minute space walk. The STS-110 mission prepared the Station for future space walks by installing and outfitting the 43-foot-long S0 truss and preparing the Mobile Transporter. The S0 Truss was the first of 9 segments that will make up the Station's external framework that will eventually stretch 356 feet (109 meters), or approximately the length of a football field. This central truss segment also includes a flatcar called the Mobile Transporter and rails that will become the first 'space railroad,' which will allow the Station's robotic arm to travel up and down the finished truss for future assembly and maintenance. The completed truss structure will hold solar arrays and radiators to provide power and cooling for additional international research laboratories from Japan and Europe that will be attached to the Station. Milestones of the S-110 mission included the first time the ISS robotic arm was used to maneuver space walkers around the Station and marked the first time all space walks were based out of the Station's Quest Airlock. It was also the first Shuttle to use three Block II Main Engines. The Space Shuttle Orbiter Atlantis, STS-110 mission, was launched April 8, 2002 and returned to Earth April 19, 2002.

14 CFR 171.117 - Reports.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.117 Section 171.117... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Simplified Directional Facility (SDF) § 171.117 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the time...

Effect of interstitial nitrogen on magnetism and entropy change of LaFe11.7Si1.3 compound

International Nuclear Information System (INIS)

Balli, M.; Rosca, M.; Fruchart, D.; Gignoux, D.

2009-01-01

Crystal structure, magnetism and magnetocaloric properties of LaFe 11.7 Si 1.3 N y (y=0, 1.3) compounds have been studied by X-ray diffraction and magnetic measurements. The LaFe 11.7 Si 1.3 N y compounds present a cubic NaZn 13 -type structure. Insertion of 1.3 nitrogen atoms per LaFe 11.7 Si 1.3 formula increases the lattice parameter and Curie temperature from 11.467 to 11.733 A and from 190 to ∼230 K, respectively. Besides, the absorption of nitrogen drives drastically the magnetic transition from first to second order and accordingly strongly decreases the magnetocaloric effect compared to the parent alloy. Under an external field change of 5 T, the value of isothermal entropy change -ΔS is about 28 and 3.5 J/kg K for LaFe 11.7 Si 1.3 and LaFe 11.7 Si 1.3 N 1.3 , respectively, close to their Curie temperature. However, the relative cooling power RCP(S) of the nitride is about half that of the parent alloy

33 CFR 117.841 - Smith Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smith Creek. 117.841 Section 117.841 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.841 Smith Creek. The draw of the S117-S133...

The impact of a dedicated Science-Technology-Society (STS) course on student knowledge of STS content

Science.gov (United States)

Barron, Paul E.

In the last half century, public awareness of issues such as population growth, environmental pollution and the threat of nuclear war has pressured science education to reform to increase student social responsibility. The emerging Science-Technology-Society (STS) movement addressed these concerns by developing numerous strategies and curricula. Considerable diagnostic research has been conducted on student knowledge of the nature of science, but not on the wider scope of STS content (e.g., the nature of science and technology and their interactions with society). However, researchers have not widely studied the impact of comprehensive STS curricula on students' knowledge of STS content nor the nature of STS teaching practice that influenced this knowledge gain. This study examined student success and teacher performance in a special STS course in Ontario, Canada. Research questions focused on the STS content knowledge gain by students completing this course and the impact of the STS teachers' teaching practices on this knowledge gain. Student data were collected using pre-course and post-course assessments of students' STS content knowledge. Teacher data were obtained using semi-structured interviews, classroom observations and videotapes. Statistical analysis indicated that, after completing the STS course, students significantly increased their STS content knowledge as measured by the Views on Science Technology Society instrument. Gender and academic achievement had no significant impact on this knowledge gain, implying that this course, as taught by these teachers, could appeal to a wide range of students as a general education course. The second part of the study indicated that detailed research is needed on the relationship between STS teaching practice and student STS content knowledge gain. The small sample size prevents generalizations but initial indications show that factors such constructivist teaching practices and strong teacher STS content knowledge

STS-133/ET-137 Tanking Test Photogrammetry Assessment

Science.gov (United States)

Oliver, Stanley T.

2012-01-01

Following the launch scrub of Space Shuttle mission STS-133 on November 5, 2010, an anomalous condition of cracked and raised thermal protection system (TPS) foam was observed on the External Tank (ET). Subsequent dissection of the affected TPS region revealed cracks in the feet of two Intertank (IT) metallic stringers. An extensive investigation into the cause(s) and corrective action(s) for the cracked stringers was initiated, involving a wide array of material and structural tests and nondestructive evaluations, with the intent to culminate into the development of flight rational. One such structural test was the instrumented tanking test performed on December 17, 2010. The tanking test incorporated two three-dimensional optical displacement measurement systems to measure full-field outer surface displacements of the TPS surrounding the affected region that contained the stringer cracks. The results showed that the radial displacement and rotation of the liquid oxygen (LO2) tank flange changed significantly as the fluid level of the LO2 approached and passed the LO2 tank flange.

The development of STS payload environmental engineering standards

Science.gov (United States)

Bangs, W. F.

1982-01-01

The presently reported effort to provide a single set of standards for the design, analysis and testing of Space Transportation System (STS) payloads throughout the NASA organization must be viewed as essentially experimental, since the concept of incorporating the diverse opinions and experiences of several separate field research centers may in retrospect be judged too ambitious or perhaps even naive. While each STS payload may have unique characteristics, and the project should formulate its own criteria for environmental design, testing and evaluation, a reference source document providing coordinated standards is expected to minimize the duplication of effort and limit random divergence of practices among the various NASA payload programs. These standards would provide useful information to all potential STS users, and offer a degree of standardization to STS users outside the NASA organization.

Personnel external dose monitoring system

International Nuclear Information System (INIS)

Zhao Hengyuan

1989-01-01

The status and trend of personnel external dose monitoring system are introduced briefly. Their characteristics, functions and TLD bedges of some commercially available automatic TLD system, including UD-710A (Matsushita, Japan), Harshaw-2271, 2276 (Harshaw, USA), Harshaw-8000 (Harshaw/Filtrol), Studsvik-1313 (Sweden) and Pitman-800 (UK) were depicted in detail. Finally, personnel dose management and record keeping system were presented and two examples were given

L-Area STS MTR/NRU/NRX Grapple Assembly Closure Mechanics Review

International Nuclear Information System (INIS)

Huizenga, D. J.

2016-01-01

A review of the closure mechanics associated with the Shielded Transfer System (STS) MTR/NRU/NRX grapple assembly utilized at the Savannah River Site (SRS) was performed. This review was prompted by an operational event which occurred at the Canadian Nuclear Laboratories (CNL) utilizing a DTS-XL grapple assembly which is essentially identical to the STS MTR/NRU/NRX grapple assembly used at the SRS. The CNL operational event occurred when a NRU/NRX fuel basket containing spent nuclear fuel assemblies was inadvertently released by the DTS-XL grapple assembly during a transfer. The SM review of the STS MTR/NRU/NRX grapple assembly will examine the operational aspects of the STS and the engineered features of the STS which prevent such an event at the SRS. The design requirements for the STS NRU/NRX modifications and the overall layout of the STS are provided in other documents.

Nuclear spectroscopic study of the 117In and 77Se using angular correlation technique

International Nuclear Information System (INIS)

Zamboni, C.B.

1981-01-01

The integral pertubed angular correlation technique has been used to measure the g-factor of the 587 KeV(3/2 - ) state in 117 In. The measurements were made in an external magnetic field of 26 Kg. The 1303-273 KeV gamma cascade in 117 In populated from the beta decay of 117 Cd was utilized for the measurement. The result is g(587 KeV) = -0.233+-0.057. The present result shows the 587 KeV state may not be a simple P 3/2 proton hole state but rather a complex admixture of different configurations. The g-factor of the 249 KeV state in 77 Se has also been measured by the time differential pertubed angular correlation (TDPAC) method in an external magnetic field of 25 Kg. The 755-249 KeV gamma cascade in 77 Se populated from the electron capture decay of 57h 77 Br utilized for the measurement. The g-factor is determined to be g(249 KeV) = 0.486 +- 0.009. In addition the half life of the 249 KeV state in 77 Se has also been measured by the delayed gamma-gamma coincidence method utilizing the gamma cascades 572-249 KeV and 750-249 KeV in 77 Se. The resulting value of the half life is T 1/2 (249 KeV) = (9.56 +- 0.10)ns. The experimental results are discussed in terms of nuclear models applicable for nuclei in this mass region. (author) [pt

33 CFR 117.917 - Battery Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Battery Creek. 117.917 Section 117.917 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.917 Battery Creek. The draw of...

33 CFR 117.959 - Chocolate Bayou.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chocolate Bayou. 117.959 Section 117.959 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.959 Chocolate Bayou. The draw of the Union...

32 CFR 724.117 - Discharge review.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Discharge review. 724.117 Section 724.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.117 Discharge review. A nonadversary administrative reappraisal at the level of...

33 CFR 117.457 - Houston River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of the...

33 CFR 117.324 - Rice Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Rice Creek. 117.324 Section 117.324 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.324 Rice Creek. The CSX Railroad Swingbridge, mile...

33 CFR 117.231 - Brandywine Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Brandywine Creek. 117.231 Section 117.231 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.231 Brandywine Creek. The draw of the...

7 CFR 1942.117 - General requirements.

Science.gov (United States)

2010-01-01

... § 1942.117 General requirements. (a) Reserve requirements. Loans under this subpart are subject to the... 7 Agriculture 13 2010-01-01 2009-01-01 true General requirements. 1942.117 Section 1942.117 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...

External-stimuli responsive systems for cancer theranostic

Directory of Open Access Journals (Sweden)

Jianhui Yao

2016-10-01

Full Text Available The upsurge of novel nanomaterials and nanotechnologies has inspired the researchers who are striving for designing safer and more efficient drug delivery systems for cancer therapy. Stimuli responsive nanomaterial offered an alternative to design controllable drug delivery system on account of its spatiotemporally controllable properties. Additionally, external stimuli (light, magnetic field and ultrasound could develop into theranostic applications for personalized medicine use because of their unique characteristics. In this review, we give a brief overview about the significant progresses and challenges of certain external-stimuli responsive systems that have been extensively investigated in drug delivery and theranostics within the last few years.

33 CFR 117.309 - Nassau Sound.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nassau Sound. 117.309 Section 117.309 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.309 Nassau Sound. The draw of the Fernandina Port...

33 CFR 117.331 - Snake Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake Creek. 117.331 Section 117.331 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.331 Snake Creek. The draw of the Snake Creek...

33 CFR 117.965 - Cow Bayou.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cow Bayou. 117.965 Section 117.965 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.965 Cow Bayou. The draws of the Orange County...

33 CFR 117.263 - Banana River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...

9 CFR 117.4 - Test animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Test animals. 117.4 Section 117.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED ESTABLISHMENTS § 117.4...

33 CFR 117.861 - Blind Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blind Slough. 117.861 Section 117.861 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Oregon § 117.861 Blind Slough. The draws of the Portland and...

33 CFR 117.1087 - Fox River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Fox River. 117.1087 Section 117.1087 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1087 Fox River. (a) The draws of the Canadian...

33 CFR 117.987 - Taylor Bayou.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Bayou. 117.987 Section 117.987 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.987 Taylor Bayou. The draws of the Union Pacific...

33 CFR 117.543 - Bear Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bear Creek. 117.543 Section 117.543 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.543 Bear Creek. (a) The draws of the Baltimore...

33 CFR 117.177 - Mud Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mud Slough. 117.177 Section 117.177 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.177 Mud Slough. The draw of the Union Pacific...

33 CFR 117.1095 - Root River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Root River. 117.1095 Section 117.1095 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1095 Root River. (a) The draw of the Main Street...

33 CFR 117.925 - Cooper River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.925 Section 117.925 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.925 Cooper River. The draw of the Seaboard...

33 CFR 117.713 - Cooper River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.713 Section 117.713 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.713 Cooper River. (a) The drawspans for the...

33 CFR 117.385 - Snake River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.385 Section 117.385 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.385 Snake River. The drawspan of the U.S. 12 bridge...

14 CFR 415.117 - Ground safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 415.117 Section 415.117... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.117 Ground safety. (a) General. An applicant's safety review...

28 CFR 11.7 - Salary adjustments.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Salary adjustments. 11.7 Section 11.7 Judicial Administration DEPARTMENT OF JUSTICE DEBT COLLECTION Administration of Debt Collection § 11.7 Salary adjustments. The following debts shall not be subject to the salary offset procedures of § 11.8...

33 CFR 117.335 - Taylor Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Creek. 117.335 Section 117.335 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.335 Taylor Creek. The draw of US441 bridge, mile 0...

STS-102 Onboard Photograph-The Payload Equipment Restraint System

Science.gov (United States)

2001-01-01

In this Space Shuttle STS-102 mission image, the Payload Equipment Restraint System H-Strap is shown at the left side of the U.S. Laboratory hatch and behind Astronaut James D. Weatherbee, mission specialist. PERS is an integrated modular system of components designed to assist the crew of the International Space Station (ISS) in restraining and carrying necessary payload equipment and tools in a microgravity environment. The Operations Development Group, Flight Projects Directorate at the Marshall Space Flight Center (MSFC), while providing operation support to the ISS Materials Science Research Facility (MSRF), recognized the need for an on-orbit restraint system to facilitate control of lose objects, payloads, and tools. The PERS is the offspring of that need and it helps the ISS crew manage tools and rack components that would otherwise float away in the near-zero gravity environment aboard the Space Station. The system combines Kevlar straps, mesh pockets, Velcro and a variety of cornecting devices into a portable, adjustable system. The system includes the Single Strap, the H-Strap, the Belly Pack, the Laptop Restraint Belt, and the Tool Page Case. The Single Strap and the H-Strap were flown on this mission. The PERS concept was developed by industrial design students at Auburn University and the MSFC Flight Projects Directorate.

46 CFR 117.200 - Survival craft-general.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-general. 117.200 Section 117.200 Shipping... Number and Type of Survival Craft § 117.200 Survival craft—general. (a) Each survival craft required on a... craft they replace. (c) A summary of survival craft requirements is provided in Table 117.200(c). Table...

33 CFR 117.1058 - Snake River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.1058 Section 117... OPERATION REGULATIONS Specific Requirements Washington § 117.1058 Snake River. (a) The draw of the Burlington Northern Santa Fe railroad bridge across the Snake River at mile 1.5 between Pasco and Burbank is...

33 CFR 117.537 - Townsend Gut.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Townsend Gut. 117.537 Section 117... OPERATION REGULATIONS Specific Requirements Maine § 117.537 Townsend Gut. The draw of the Southport (SR27) Bridge, at mile 0.7, across Townsend Gut between Boothbay Harbor and Southport, Maine shall open on...

42 CFR 435.117 - Newborn children.

Science.gov (United States)

2010-10-01

... 42 Public Health 4 2010-10-01 2010-10-01 false Newborn children. 435.117 Section 435.117 Public..., Children Under 8, and Newborn Children § 435.117 Newborn children. (a) The agency must provide Medicaid eligibility to a child born to a woman who has applied for, has been determined eligible and is receiving...

Coase, externalities, property rights and the legal system

NARCIS (Netherlands)

Geerdink, G.C. (Carlie); Stauvermann, P.J.

2010-01-01

In this paper we investigate the possible consequences of different institutional settings (in casu the legal system) on externalities and their effect on the efficient allocation of externalities. We investigate whether the restriction of marginally low transaction costs can be relaxed if the legal

Turning to Ontology in STS? Turning to STS through ‘Ontology’

NARCIS (Netherlands)

van Heur, B.; Leydesdorff, L.; Wyatt, S.

2012-01-01

We examine the evidence for the claim of an ‘ontological turn’ in science and technology studies (STS). Despite an increase in references to ‘ontology’ in STS since 1989, we show that there has not so much been an ontological turn as multiple discussions deploying the language of ontology,

Estimating parameters of chaotic systems synchronized by external driving signal

International Nuclear Information System (INIS)

Wu Xiaogang; Wang Zuxi

2007-01-01

Noise-induced synchronization (NIS) has evoked great research interests recently. Two uncoupled identical chaotic systems can achieve complete synchronization (CS) by feeding a common noise with appropriate intensity. Actually, NIS belongs to the category of external feedback control (EFC). The significance of applying EFC in secure communication lies in fact that the trajectory of chaotic systems is disturbed so strongly by external driving signal that phase space reconstruction attack fails. In this paper, however, we propose an approach that can accurately estimate the parameters of the chaotic systems synchronized by external driving signal through chaotic transmitted signal, driving signal and their derivatives. Numerical simulation indicates that this approach can estimate system parameters and external coupling strength under two driving modes in a very rapid manner, which implies that EFC is not superior to other methods in secure communication

21 CFR 111.117 - What quality control operations are required for equipment, instruments, and controls?

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for equipment, instruments, and controls? 111.117 Section 111.117 Food and Drugs FOOD AND DRUG ADMINISTRATION... and Process Control System: Requirements for Quality Control § 111.117 What quality control operations...

STS-95 Discovery in the VAB as launch preparations continue

Science.gov (United States)

1998-01-01

United Space Alliance Forward Shop workers stand near the orbiter Discovery in the Vehicle Assembly Building . The orbiter is being prepared for mating with the external tank. Discovery displays the recently painted NASA logo, termed the 'meatball,' on its left, or port, wing. The logo also has been painted on both sides of the aft fuselage. Discovery (OV-103), the first of the orbiters to be launched with the new art work, is scheduled for its 25th flight, from Launch Pad 39B, on Oct. 29, 1998, for the STS-95 mission.

40 CFR 117.21 - Notice.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Notice. 117.21 Section 117.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS DETERMINATION OF... knowledge of any discharge of a designated hazardous substance from such vessel or facility in quantities...

Game Design as STS Research

Directory of Open Access Journals (Sweden)

Joseph Dumit

2017-09-01

Full Text Available Game design offers a powerful pedagogical paradigm for engaging students in thinking and researching sociotechnical systems. Using the example of designing a game around fracking, this paper describes how game design grapples with emergent dynamic processes, and how students are drawn into becoming STS researchers.

Synchronization of identical chaotic systems through external chaotic driving

International Nuclear Information System (INIS)

Patidar, V.; Sud, K.K.

2005-11-01

In recent years, the study of synchronization of identical chaotic systems subjected to a common fluctuating random driving signal has drawn considerable interest. In this communication, we report that it is possible to achieve synchronization between two identical chaotic systems, which are not coupled directly but subjected to an external chaotic signal. The external chaotic signal may be obtained from any chaotic system identical or non-identical to both identical chaotic systems. Results of numerical simulations on well known Roessler and jerk dynamical systems have been presented. (author)

STS-95 Discovery undergoes vertical lift in the VAB

Science.gov (United States)

1998-01-01

In the Vehicle Assembly Building, the orbiter Discovery (viewed from below the Space Shuttle Main Engines, starboard side) is raised to a vertical position in order to be mated with the external tank. The orbiter displays the recently painted NASA logo, termed the 'meatball,' on the aft fuselage. The logo also has been painted on the left, or port, wing. Discovery (OV-103), the first of the orbiters to be launched with the new art work, is scheduled for its 25th flight, from Launch Pad 39B, on Oct. 29, 1998, for the STS-95 mission.

Nuclear spectroscopy study of the 117 Sn by the angular correlation technique

International Nuclear Information System (INIS)

Borges, Joao Baptista

1977-01-01

The directional correlation of gamma cascade (553-159) keV populated in 117 Sn through the β - decay of 117 In has been measured. An automatic gamma spectrometer utilizing Ge(Li) and NaI (Tl) detectors was used to measure the angular correlation. The results are analysed in terms of the multipole mixing ratio for the 159 keV transition in 117 Sn. The results are: A 22 = -0 064±0.005, A 44 = 0.005±0.007 with δ(E2/M1) 159keV = 0.036+0.021. The life time of the 159 keV state has also been determined by using the plastic scintillator detectors, and utilizing the delayed gamma-gamma coincidence method the resulting value of the life time is T 1/2 = 275±15 psec. Further measurements have been carried out to determine the nuclear g-factor of the 159 keV state utilizing the NaI(Tl) detectors and an external magnetic field of 25.5 k Gauss. The method of 'integral rotation with reverse field and constant angle' was utilized for the determination of the g-factor with the resulting value of g(159 keV) = +0.47±0.10. The experimental results are discussed in terms of single particle model and the pairing plus quadrupole model of Kisslinger and Sorensen. (author)

External review systems for radiation oncology facilities - clinical audit versus other review systems

International Nuclear Information System (INIS)

Bogusz-Czerniewicz, M.

2009-01-01

Background: Between 1996 and 1999 project team of ExPeRT, catalogued four external review systems of health care facilities in the European Union and countries associated with EU. Aim: The aim of this paper is a/ to identify and compare currently existing external review systems for radiation oncology facilities and b/ to distinguish main differences between clinical audit and other external evaluation models and c/ to identify where those models are currently used in European Union member states. Materials and Methods: Based on the literature review and the survey conducted between January and April 2007 among representatives of 67 national societies (for diagnostic radiology, radiotherapy and nuclear medicine) in European Union member states, the analysis of existing external review systems in radiation oncology was performed. Relevant information about purpose, scope and methodology of evaluation process for those systems were surveyed. Results: The response to the questionnaire was 72%. Only a few countries did not supply any reply in spite of repeated enquiries to several recipients. Six main categories of systems aiming at measuring the quality of service management and delivery were identified: professional peer review -based schemes, hospital accreditation, accreditation in terms of ISO standards, award seeking, certification by International Standards Organization, and clinical audit. Conclusions: Though the methodology and terminology of the five main external review systems differ, a constant movement towards collaboration and convergence of those models has been observed. Due to the social, political, and economical aspects of each European country, the different audit systems have been implemented either on voluntary or mandatory basis. (author)

33 CFR 117.225 - Yellow Mill Channel.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Yellow Mill Channel. 117.225 Section 117.225 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.225 Yellow Mill Channel. The...

STS-71 astronauts before egress training

Science.gov (United States)

1994-01-01

Astronaut Robert L. Gibson (left), STS-71 mission commander, converses with two crew mates prior to emergency egress training in the Systems Integration Facility at JSC. Astronaut Bonnie J. Dunbar and Gregory J. Harbaugh are attired in training versions o

33 CFR 117.677 - Big Sunflower River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Big Sunflower River. 117.677 Section 117.677 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Mississippi § 117.677 Big Sunflower River. The draw of...

33 CFR 117.167 - Little Potato Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw of...

7 CFR 400.117 - Determination of delinquency.

Science.gov (United States)

2010-01-01

... 7 Agriculture 6 2010-01-01 2010-01-01 false Determination of delinquency. 400.117 Section 400.117 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP INSURANCE CORPORATION... Succeeding Crop Years § 400.117 Determination of delinquency. Prior to disclosing information about a debt to...

13 CFR 117.12 - Mediation.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Mediation. 117.12 Section 117.12... Mediation. (a) SBA shall, after ensuring that the complaint falls within the coverage of this Act and all... clearly within an exception, promptly refer the complaint to the Federal Mediation and Conciliation...

33 CFR 117.1001 - Cat Point Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cat Point Creek. 117.1001 Section 117.1001 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Virginia § 117.1001 Cat Point Creek. The draw of the...

33 CFR 117.705 - Beaver Dam Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Beaver Dam Creek. 117.705 Section 117.705 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.705 Beaver Dam Creek. The draw of the...

33 CFR 117.800 - Mill Neck Creek.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mill Neck Creek. 117.800 Section 117.800 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.800 Mill Neck Creek. The draw of the...

33 CFR 117.769 - Black Rock Canal.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black Rock Canal. 117.769 Section 117.769 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.769 Black Rock Canal. The draws of the...

46 CFR 201.117 - Inclusion in record.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...

1 CFR 11.7 - Federal Register Index.

Science.gov (United States)

2010-01-01

... 1 General Provisions 1 2010-01-01 2010-01-01 false Federal Register Index. 11.7 Section 11.7... REGISTER PUBLICATIONS SUBSCRIPTIONS § 11.7 Federal Register Index. The annual subscription price for the monthly Federal Register Index, purchased separately, in paper form, is $29. The price excludes postage...

Externalities - an analysis using the EU ExternE-results

International Nuclear Information System (INIS)

2003-10-01

The EU project ExternE quantified the externalities for the different energy technologies. In this work, the ExternE results are used in a MARKAL-analysis for the Nordic countries. The analysis does not go into detail, but gives some interesting indications: The external costs are not fully covered in the Nordic energy systems, the present taxes and charges are not high enough. The emissions from the energy systems would be strongly reduced, if taxes/environmental charges were set at the level ExternE calculate. The emissions from power production would be reduced most. Renewable energy sources and natural gas dominate the energy systems in the ExternE case

46 CFR 117.175 - Survival craft equipment.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft equipment. 117.175 Section 117.175... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.175 Survival craft equipment. (a) General. Each item of survival craft equipment must be of good quality, and efficient for the purpose it...

Bi-phase CO{sub 2} cooling of the CBM STS detector

Energy Technology Data Exchange (ETDEWEB)

Lavrik, Evgeny [Physikalisches Institut der Universitaet Tuebingen (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment aims to study the properties of nuclear matter at high net-baryon densities. The Silicon Tracking System (STS) is the key detector to reconstruct charged particle tracks created in heavy-ion interactions. The foreseen interaction rate of up to 10 MHz requires radiation hard detectors as well as efficient cooling of the silicon sensors. To avoid thermal runaway the system must be kept at -5 C or below all the time. This is rather challenging because the overall thermal load in the 2 m{sup 3} STS enclosure is up to 40 kW. Because of these requirements liquid CO{sub 2} is used as a cooling agent as it is superior in terms of volumetric heat transfer coefficient compared to other agents. This contribution shows the thermal simulations and measurement results of the STS front-end electronic boxes as well as an overview of 1 kW TRACI-XL cooling plant developed at GSI and its use to perform thermal measurements of a fully heat loaded STS quarter station.

Discovery is in the VAB as STS-95 launch preparations continue

Science.gov (United States)

1998-01-01

In the Vehicle Assembly Building, the orbiter Discovery is mated with the external tank and solid rocket booster stack (seen behind the orbiter, to the left). The orbiter was recently painted with the NASA logo, termed the 'meatball,' on the left, or port, wing and both sides of the aft fuselage. Discovery (OV- 103) is the first of the orbiters to be launched with the new artwork. It is scheduled for its 25th flight, from Launch Pad 39B, on Oct. 29, 1998, for the STS-95 mission.

Dicty_cDB: SLA117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

Dicty_cDB: SFD117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

The Systemic and Global Dimension of Business Resilience in a Socio-Technical Perspective

Directory of Open Access Journals (Sweden)

Paulo Garrido

2016-02-01

Full Text Available This paper proposes to augment the concept of a business resilience improving process by enlarging such a process with a dimension of external action that addresses the vaster frame of systemic resilience of our societies. To this aim, I propose to widen the concept of socio-technical system (STS to human societies, based on the idea that the development and survival of human societies has necessary social and technical factors. I also propose a concept of resilience in terms of dealing with failures of STS. Two particular cases of very large failure avoidance are considered: nuclear war and civilizational collapse, and I propose that such cases should be present in the referred dimension of external action of any business resilience program. Because the action of public governments and their cooperation is crucial for advancing global systemic resilience, I suggest that businesses should analyze and model the decisions of governments in a wider context of naturally occurring cooperating and conflicting human groups.

ExternE transport methodology for external cost evaluation of air pollution

DEFF Research Database (Denmark)

Jensen, S. S.; Berkowicz, R.; Brandt, J.

The report describes how the human exposure estimates based on NERI's human exposure modelling system (AirGIS) can improve the Danish data used for exposure factors in the ExternE Transport methodology. Initially, a brief description of the ExternE Tranport methodology is given and it is summarised...

47 CFR 25.117 - Modification of station license.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Modification of station license. 25.117 Section 25.117 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.117...

Composite Nafion 117-TMSP membrane for Fe-Cr redox flow battery applications

Energy Technology Data Exchange (ETDEWEB)

Haryadi, E-mail: haryadi@polban.ac.id [Department of Chemical Engineering, PoliteknikNegeri Bandung Indonesia (Indonesia); Gunawan, Y. B.; Harjogi, D. [Department of Electronic Engineering, PoliteknikNegeri Bandung Indonesia (Indonesia); Mursid, S. P. [Department of Energy Engineering, PoliteknikNegeri Bandung. Jl. GegerkalongHilir, Ds, Ciwaruga, Bandung, West Java Indonesia (Indonesia)

2016-04-19

The modification of Nafion 117 - TMSP (trimethoxysylilprophanthiol) composite membrane has been conducted by in-situ sol-gel method followed by characterization of structural and properties of material using spectroscopic techniques. The performance of composite membrane has then been examined in the single stack module of Fe-Cr Redox Flow Battery. It was found that the introduction of silica from TMSP through sol-gel process within the Nafion 117 membrane produced composite membrane that has slightly higher proton conductivity values as compared to the pristine of Nafion 117 membrane observed by electrochemical impedance spectroscopy. The degree of swelling of water in the composite membrane demonstrated greatly reduced than a pristine Nafion 117 signifying low water cross over. The SEM-EDX measurements indicated that there was no phase separation occurred suggesting that silica nanoparticles are distributed homogeneously within the composite membrane. The composite membrane used as separator in the system of Fe-Cr Redox Flow Battery revealed no cross mixing (crossover) occurred between anolyte and catholyte in the system as observed from the total voltage measurements that closed to the theoretical value. The battery efficiency generally increased as the volume of the electrolytes enlarged.

Composite Nafion 117-TMSP membrane for Fe-Cr redox flow battery applications

International Nuclear Information System (INIS)

Haryadi; Gunawan, Y. B.; Harjogi, D.; Mursid, S. P.

2016-01-01

The modification of Nafion 117 - TMSP (trimethoxysylilprophanthiol) composite membrane has been conducted by in-situ sol-gel method followed by characterization of structural and properties of material using spectroscopic techniques. The performance of composite membrane has then been examined in the single stack module of Fe-Cr Redox Flow Battery. It was found that the introduction of silica from TMSP through sol-gel process within the Nafion 117 membrane produced composite membrane that has slightly higher proton conductivity values as compared to the pristine of Nafion 117 membrane observed by electrochemical impedance spectroscopy. The degree of swelling of water in the composite membrane demonstrated greatly reduced than a pristine Nafion 117 signifying low water cross over. The SEM-EDX measurements indicated that there was no phase separation occurred suggesting that silica nanoparticles are distributed homogeneously within the composite membrane. The composite membrane used as separator in the system of Fe-Cr Redox Flow Battery revealed no cross mixing (crossover) occurred between anolyte and catholyte in the system as observed from the total voltage measurements that closed to the theoretical value. The battery efficiency generally increased as the volume of the electrolytes enlarged.

Dicty_cDB: VFL117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT

40 CFR 117.14 - Demonstration projects.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Demonstration projects. 117.14 Section... DETERMINATION OF REPORTABLE QUANTITIES FOR HAZARDOUS SUBSTANCES Applicability § 117.14 Demonstration projects... research or demonstration projects relating to the prevention, control, or abatement of hazardous substance...

STS-95 crew members Duque and Mukai check out slidewire basket

Science.gov (United States)

1998-01-01

At Launch Pad 39-B, STS-95 Mission Specialist Pedro Duque of Spain (left) and Payload Specialist Chiaki Mukai look over the gate for the slidewire basket, part of the emergency egress system on the pad. Mukai represents the National Space Development Agency of Japan (NASDA), and Duque the European Space Agency (ESA). The STS-95 crew are at KSC to participate in a Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cut-off exercise. Other STS-95 crew members are Mission Specialist Stephen K. Robinson, Mission Commander Curtis L. Brown, Pilot Steven W. Lindsey, Payload Specialists John H. Glenn Jr., senator from Ohio, and Mission Specialist Scott E. Parazynski. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.

33 CFR 117.751 - Shark River (South Channel).

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Shark River (South Channel). 117.751 Section 117.751 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.751 Shark River (South...

9 CFR 3.117 - Terminal facilities.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.117 Section 3... Marine Mammals Transportation Standards § 3.117 Terminal facilities. Carriers and intermediate handlers... facility of any carrier or intermediate handler where marine mammal shipments are maintained must be...

13 CFR 117.18 - Judicial review.

Science.gov (United States)

2010-01-01

... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Judicial review. 117.18 Section 117.18 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FEDERALLY... reasonable attorney's fees, but that the complainant must demand these costs in the complaint; (iii) That...

STS-95 Day 09 Highlights

Science.gov (United States)

1998-01-01

On this ninth day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, spend a good part of their day checking out important spacecraft systems for entry and landing. The commander and pilot begin the flight control system checkout by powering up one auxiliary power unit and evaluating the performance of aerodynamic surfaces and flight controls. The flight crew conducts a reaction control system hot fire, followed by a test of the communications system.

Development of a 117mSn preparation method

International Nuclear Information System (INIS)

Moraes, Vanessa; Osso Junior, Joao Alberto

2000-01-01

117m Sn is a radioisotope with suitable characteristics to be used in nuclear medicine as radiotherapy, when labeled with DTPA. The aim of this work is the preparation of 117m Sn from irradiation of the natural tin with proton beam at the cyclotron CV-28 of IPEN-CNEN/SP via the nuclear reaction nat Sn (p, xn) 117 Sb to 117m Sn. Due to the formation of the Sb precursor it is necessary to perform a chemical separation for Sb-Sn. The separation method used was the ion exchange, due to its utilization facilities for radioactive material. Chemical, radiochemical and radionuclidic methods were also developed for the quality control of the final product, the 117m Sn. (author)

9 CFR 117.2 - Animal facilities.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal facilities. 117.2 Section 117.2 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES... Animal facilities. Animal facilities shall comply with the requirements provided in part 108 of this...

33 CFR 117.803 - Niagara River.

Science.gov (United States)

2010-07-01

... Canadian National Railway bridge, mile 33.0 at Buffalo, need not be opened for the passage of vessels. ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River. 117.803 Section 117.803 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

33 CFR 117.825 - Newport River.

Science.gov (United States)

2010-07-01

... the Atlantic and East Carolina Railway bridge, mile 13.0 at Newport, need not be opened for the... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newport River. 117.825 Section 117.825 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

Conventional external beam radiotherapy for central nervous system malignancies

International Nuclear Information System (INIS)

Halperin, E.C.; Burger, P.C.

1985-01-01

Fractionated external beam photon radiotherapy is an important component of the clinical management of malignant disease of the central nervous system. The practicing neurologist or neurosurgeon frequently relies on the consultative and treatment skills of a radiotherapist. This article provides a review for the nonradiotherapist of the place of conventional external beam radiotherapy in neuro-oncology. 23 references

41 CFR 102-117.200 - What is HAZMAT?

Science.gov (United States)

2010-07-01

... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...

STS-96 Crew Training

Science.gov (United States)

1999-01-01

The training for the crew members of the STS-96 Discovery Shuttle is presented. Crew members are Kent Rominger, Commander; Rick Husband, Pilot; Mission Specialists, Tamara Jernigan, Ellen Ochoa, and Daniel Barry; Julie Payette, Mission Specialist (CSA); and Valery Ivanovich Tokarev, Mission Specialist (RSA). Scenes show the crew sitting and talking about the Electrical Power System; actively taking part in virtual training in the EVA Training VR (Virtual Reality) Lab; using the Orbit Space Vision Training System; being dropped in water as a part of the Bail-Out Training Program; and taking part in the crew photo session.

33 CFR 117.923 - Congaree River.

Science.gov (United States)

2010-07-01

... the Southern Railway bridge, mile 4.3 at Moye's Station, shall open on signal if at least 24 hours... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Congaree River. 117.923 Section 117.923 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

A mode-locked external-cavity quantum-dot laser with a variable repetition rate

International Nuclear Information System (INIS)

Wu Jian; Jin Peng; Li Xin-Kun; Wei Heng; Wu Yan-Hua; Wang Fei-Fei; Chen Hong-Mei; Wu Ju; Wang Zhan-Guo

2013-01-01

A mode-locked external-cavity laser emitting at 1.17-μm wavelength using an InAs/GaAs quantum-dot gain medium and a discrete semiconductor saturable absorber mirror is demonstrated. By changing the external-cavity length, repetition rates of 854, 912, and 969 MHz are achieved respectively. The narrowest −3-dB radio-frequency linewidth obtained is 38 kHz, indicating that the laser is under stable mode-locking operation. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

49 CFR 214.117 - Eye and face protection.

Science.gov (United States)

2010-10-01

... corrective lenses, when required by this section to wear eye protection, shall be protected by goggles or... 49 Transportation 4 2010-10-01 2010-10-01 false Eye and face protection. 214.117 Section 214.117..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Bridge Worker Safety Standards § 214.117 Eye and face...

46 CFR 117.130 - Stowage of survival craft.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Stowage of survival craft. 117.130 Section 117.130... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.130 Stowage of survival craft. (a) Each survival craft must be: (1) Secured to the vessel by a painter with a float-free link permanently...

33 CFR 117.423 - Atchafalaya River.

Science.gov (United States)

2010-07-01

... Kansas City Southern Railway bridge, mile 133.1 (mile 5.0 on N.O.S. Chart) above the mouth of the... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Atchafalaya River. 117.423 Section 117.423 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

25 CFR 117.22 - Disbursements to legal guardians.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Disbursements to legal guardians. 117.22 Section 117.22... COMPETENCY § 117.22 Disbursements to legal guardians. Any disbursement authorized to be made to an Indian by... to the guardian. All expenditures by a guardian of the funds of his ward must be approved in writing...

Improving the Quality of Academic Services through Implementation of Internal Quality Assurance System in State Institute of Islamic Studies STS Jambi

Science.gov (United States)

Iskandar

2017-01-01

Implementation of quality assurance systems in IAIN STS Jambi implemented in early 2012, through the build system of internal quality assurance based on ISO 9001: 2008, in the process of implementation required strong reasons behind not growing atmosphere of academic standards of accreditation of study programs and institutions that are reflected…

STS-71 astronauts and cosmonauts during egress training

Science.gov (United States)

1994-01-01

Astronaut Robert L. Gibson (arms folded, near center) STS-71 mission commander, joins several crew mates during a briefing preceding emergency egress training in the Systems Integration Facility at JSC. Astronauts Bonnie J. Dunbar and Gregory J. Harbaugh

Pre-STS-3 press conference held at the JSC public affairs facility

Science.gov (United States)

1982-01-01

Astronauts Jack R. Lousma, center, and C. Gordon Fullerton, left, respond to a visual display of the Columbia and its remote manipulator system in space during a pre-STS-3 press conference. Dr. John Lawrence, public information specialist, is at the far right (25903); Astronaut Lousma, listens as a newsman directs a question his way. In the background is the STS-3 mission logo (25904); Astronaut Fullerton uses an electronic pointer to localize an area on a prjected visual of the OSS payload package to be carried in the cargo bay of the Columbia on STS-3. On far right is Dr. Lawrence (25905).

STS-27 Atlantis, Orbiter Vehicle (OV) 104, at KSC Launch Complex (LC) pad 39B

Science.gov (United States)

1988-01-01

STS-27 Atlantis, Orbiter Vehicle (OV) 104, sits atop the mobile launcher platform at Kennedy Space Center (KSC) Launch Complex (LC) pad 39B. Profile of OV-104 mounted on external tank and flanked by solid rocket boosters (SRBs) is obscured by a flock of seagulls in the foreground. The fixed service structure (FSS) with rotating service structure (RSS) retracted appears in the background. Water resevoir is visible at the base of the launch pad concrete structure.

Location of external state financial control in national control system of Ukraine

Directory of Open Access Journals (Sweden)

N.G. Vygovska

2016-12-01

Full Text Available The article estimates the theoretical basis of the external state financial control in Ukraine in the context of defining its place in the formation of the functional areas of internal and external controls in order to eliminate duplication of a single national control system. The authors have investigated the scientific approaches to the interpretation of the concept of «external state financial control», «internal financial control», «public audit» in order to eliminate terminological confusion. It were found the differences between the external and internal financial control on the basis of comparative characteristics of such features as the entity controlling entities, controlled objects, object methods, and direction control. The concept of internal and external controls are considered to expedient to communicate with the system in which this control is identified. «Internal» in this case is identical intra-control, that is located within the executive branch, while an external control is not included in it and is external to the executive bodies of the controlled institution, and is not related to them and, as a consequence, independent. The authors suggest to form a unified system of state financial control, a clear distinction between internal and external powers of species. The authors consider that appropriate in this context will be the adoption of a single legislative act «About State Financial Control», the proposed structure is introduced in the article. Implementation of this law will contribute to the clear division of functional areas of the state control (internal and external, the elimination of departmental conflicts, and promote the formation of a single integrated control system in Ukraine, able to counteract abuses and prevent the possible loss of budgetary funds.

HOST payload for STS-95 being moved into SSPF

Science.gov (United States)

1998-01-01

The Hubble Space Telescope Orbiting Systems Test (HOST) is checked out by technicians in the Space Shuttle Processing Facility. One of the payloads on the STS-95 mission, the HOST platform is carrying four experiments to validate components planned for installation during the third Hubble Space Telescope servicing mission and to evaluate new technologies in an earth orbiting environment. The STS-95 mission is scheduled to launch Oct. 29. It will carry three other payloads: the Spartan solar- observing deployable spacecraft, the International Extreme Ultraviolet Hitchhiker, and the SPACEHAB single module with experiments on space flight and the aging process.

Liquid Rocket Booster (LRB) for the Space Transportation System (STS) Systems Study; Volume 1 - Executive Summary

National Research Council Canada - National Science Library

Ware, Larry

1989-01-01

...) solid rocket boosters (SRBs) with liquid rocket boosters (LRBs), Figure 1.0-1. The main objectives of a LRB substitution for the SRB were increased STS safety and reliability and increased payload performance...

STS-51 preparation: ACTS, ORFEUS, Discovery in VAB

Science.gov (United States)

1993-01-01

In NASA's building AM on Cape Canaveral Air Force Station, STS-51 mission specialist Carl Walz (right) and Deutsche Aerospace technician Gregor Dawidowitsch check over the scientific instruments mounted on the Shuttle Pallet Satellite (SPAS) carrier (38573); The Orbiting and Retrievable Far and Extreme Ultraviolet Spectrometer (ORFEUS) and SPAS is readied for hoisting into a test cell at the Vertical Processing Facility (VPF) (38574); Mating of the Advanced Communications Technology Satellite (ACTS) with the Transfer Orbit Stage (TOS) booster is under way in the Payload Hazardous Servicing Facility (PHSF) (38575); The mated ACTS and TOS are ready to be moved from the PHSF to the Vertical Processsing Facility (VPF) (38576); The orbiter Discovery is rolled into the Vehicle Assembly Building (VAB) for mating with the external tank and twin solid rocket boosters (38577-8).

49 CFR 41.117 - Buildings built with Federal assistance.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false Buildings built with Federal assistance. 41.117 Section 41.117 Transportation Office of the Secretary of Transportation SEISMIC SAFETY § 41.117 Buildings built with Federal assistance. (a) Each DOT Operating Administration assisting in the financing, through...

41 CFR 102-117.5 - What is transportation management?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is transportation management? 102-117.5 Section 102-117.5 Public Contracts and Property Management Federal Property Management... General § 102-117.5 What is transportation management? Transportation management is agency oversight of...

33 CFR 117.11 - Unnecessary opening of the draw.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Unnecessary opening of the draw. 117.11 Section 117.11 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.11 Unnecessary opening of the draw. No...

9 CFR 117.3 - Admittance of animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Admittance of animals. 117.3 Section 117.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED...

9 CFR 117.5 - Segregation of animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Segregation of animals. 117.5 Section 117.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED...

9 CFR 117.6 - Removal of animals.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Removal of animals. 117.6 Section 117.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED ESTABLISHMENTS...

Production and application of Sn-117m

International Nuclear Information System (INIS)

Vucina, J.; Nikolic, N.; Orlic, M.

2005-01-01

For targeted therapy in nuclear medicine, besides the usually used, like 32 P, 89 Sr, 131 I, 186,188 Re, new radioisotopes are intensively investigated. Particular interest is devoted to 117m Sn. It decays by isomeric transition with the emission of low energy conversion electrons and short range. Their potent lethality, due to high LET, particularly when the emitter is located inside the cell, on or near nucleus, is well known. The accompanying gamma rays (Eγ = 159 keV) are also suitable for detection. At present, the specific activity which can be achieved in nuclear reactors is is sufficient for the production of agents for bone palliation. The best results so far were achieved with 117m Sn(IV)-DTPA. It is expected that the use of this radioisotope will increase when a method of its production in the no-carrier form will be developed. In the paper the production of 117m Sn and 117m Sn radiopharmaceuticals is briefly reviewed. (author) [sr

The adsorption of 117Snm(IV)-EDTMP on collagen

International Nuclear Information System (INIS)

Yang Yuqing; Luo Shunzhong; Pu Manfei; Bing Wenzeng; He Jiaheng; Wang Guanquan

2002-01-01

The adsorption and desorption characteristics of 117 Sn m (IV)-EDTMP on collage are studied, and compared with that on HA. The results show that the effects of pH and temperature on adsorption of 117 Sn m (IV)-EDTMP on collagen are similar to those on HA, and that the adsorption equilibrium and adsorption model of 117 Sn m (IV)-EDTMP on collagen are completely different from those on HA; 117 Sm m -EDTMP absorbed on collagen are extremely stable and almost could not be desorbed with normal saline or EDTMP

STS, symmetry and post-truth.

Science.gov (United States)

Lynch, Michael

2017-08-01

This essay takes up a series of questions about the connection between 'symmetry' in Science and Technology Studies (STS) and 'post-truth' in contemporary politics. A recent editorial in this journal by Sergio Sismondo argues that current discussions of 'post-truth' have little to do with conceptions of 'symmetry' or with concerns about 'epistemic democracy' in STS, while others, such as Steve Fuller and Harry Collins, insist that there are such connections. The present essay discusses a series of questions about the meaning of 'post-truth' and 'symmetry', and the connections of those concepts to each other and to 'epistemic democracy'. The essay ends with a series of other questions about STS and contemporary politics, and an invitation to further discussions.

CD117 expression on blast cells in acute myeloid leukemia

Directory of Open Access Journals (Sweden)

Goryainova N.V.

2015-09-01

Full Text Available The aim of the present work was to analyze the frequency of CD117 (c-KIT antigen expression on the blast cells in acute myeloid leukemia (AML, evaluation of the presence of the relationship between the expression of the c-KIT and leukemia according to the FAB classification and definition of co-expression of the antigen CD117, antigens CD33 and CD34. The data of 47 patients with AML were diagnosed. M0 AML variant was established in 3 (6% patients, M1 – in 2 (4%, M2 – in 9 (20%, M4 – in 22 (47% and M5 – in 11 (23%. For immunophenotypic stu¬dies monoclonal antibodies (mAb that detect antigens of anti-CD34, anti-CD33 and anti-CD117 (Becton Dickinson, USA were used. The presence of the antigen CD117 was detected in 39 people, accounting for 83% of all surveyed. Antigen c-KIT was present in 48.117.0% cells on average: in all 3 cases – AML M0, in2 cases of AML M1, in 6 cases – AML M2, 20 of 22 cases – AML M4 and in 8 of 11 AML M5 cases. Average levels of CD117 in investigated leukemia cases statistically differed significantly (p=0.0067. Among 39 CD117- positive patients in 25 (53% co-expression of CD117+/CD34+ was revealed. Expression of CD117+/CD34- was observed in 14 cases (30%, CD117-/CD34+ – in 4 cases (8,5%, CD117-/CD34- – in 4 cases (8.5%. CD34 had of 64% of cells of myeloid origin. A high positive cor¬relation between expression of CD117 and CD34 (r=+0,5169 was determined, being statistically significant (p0,0067.

STS-95 Day 06 Highlights

Science.gov (United States)

1998-01-01

On this sixth day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, test a device called the Video Guidance Sensor, a component of an automated docking system being prepared for use on the International Space Station. As Discovery closes in on Spartan, the astronauts will use a laser system that provides precise measurements of how far away the shuttle is from a target and how fast it is moving toward or away from the target.

25 CFR 117.33 - Signature of illiterates.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Signature of illiterates. 117.33 Section 117.33 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES DEPOSIT AND EXPENDITURE OF... Signature of illiterates. An Indian who cannot write shall be required to endorse checks payable to his...

27 CFR 479.117 - Action by Customs.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Action by Customs. 479.117... OTHER FIREARMS Importation and Exportation Exportation § 479.117 Action by Customs. Upon receipt of a... of Customs may order such inspection as deemed necessary prior to lading of the merchandise. If...

Free-space QKD system hacking by wavelength control using an external laser.

Science.gov (United States)

Lee, Min Soo; Woo, Min Ki; Jung, Jisung; Kim, Yong-Su; Han, Sang-Wook; Moon, Sung

2017-05-15

We develop a way to hack free-space quantum key distribution (QKD) systems by changing the wavelength of the quantum signal laser using an external laser. Most free-space QKD systems use four distinct lasers for each polarization, thereby making the characteristics of each laser indistinguishable. We also discover a side-channel that can distinguish the lasers by using an external laser. Our hacking scheme identifies the lasers by automatically applying the external laser to each signal laser at different intensities and detecting the wavelength variation according to the amount of incident external laser power. We conduct a proof-of-principle experiment to verify the proposed hacking structure and confirm that the wavelength varies by several gigahertzes to several nanometers, depending on the intensity of the external laser. The risk of hacking is successfully proven through the experimental results. Methods for prevention are also suggested.

33 CFR 117.9 - Delaying opening of a draw.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Delaying opening of a draw. 117.9... DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.9 Delaying opening of a draw. No person shall unreasonably delay the opening of a draw after the signals required by § 117.15 have been given. Note: Trains...

Evaluate the application of modal test and analysis processes to structural fault detection in MSFC-STS project elements

Science.gov (United States)

Springer, William T.

1988-01-01

The Space Transportation System (STS) is a very complex and expensive flight system which is intended to carry payloads into low Earth orbit and return. A catastrophic failure of the STS (such as experienced in the 51-L incident) results in the loss of both human life as well as very expensive hardware. One impact of this incident was to reaffirm the need to do everything possible to insure the integrity and reliability of the STS is sufficient to produce a safe flight. One means of achieving this goal is to expand the number of inspection technologies available for use on the STS. The purpose was to begin to evaluate the possible use of assessing the structural integrity of STS components for which Marshall Space Flight Center (MSFC) has responsibility. This entailed reviewing the available literature and determining a low-level experimental program which could be performed by MSFC and would help establish the feasibility of using this technology for structural fault detection.

Synthesis of the New Element with Z=117

International Nuclear Information System (INIS)

Hamilton, J H; Ramayya, A V; Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Itkis, M G; Lobanov, Yu V; Mezentsev, A N; Polyakov, A N; Bailey, P D; Benker, D; Ezold, J; Porter, C E; Riley, F; Roberto, J B; Bennett, M E; Henderson, R A; Moody, K J; Nelson, S L; Ryabinin, M A

2011-01-01

The synthesis of the new chemical element with atomic number Z=117 is presented. The isotopes 293 117 and 294 117were produced in fusion reactions between 48 Ca and 249 Bk. The 249 Bk was produced in the High Flux Isotope Reactor and chemically separated at Oak Ridge. Decay chains involving eleven new nuclei were identified by means of the Dubna Gas Filled Recoil Separator. The measured decay properties show a strong rise of stability for super-heavy nuclei toward N=184.

Wiring Damage Analyses for STS OV-103

Science.gov (United States)

Thomas, Walter, III

2006-01-01

This study investigated the Shuttle Program s belief that Space Transportation System (STS) wiring damage occurrences are random, that is, a constant occurrence rate. Using Problem Reporting and Corrective Action (PRACA)-derived data for STS Space Shuttle OV-103, wiring damage was observed to increase over the vehicle s life. Causal factors could include wiring physical deterioration, maintenance and inspection induced damage, and inspection process changes resulting in more damage events being reported. Induced damage effects cannot be resolved with existent data. Growth analysis (using Crow-AMSAA, or CA) resolved maintenance/inspection effects (e.g., heightened awareness) on all wire damages and indicated an overall increase since Challenger Return-to-Flight (RTF). An increasing failure or occurrence rate per flight cycle was seen for each wire damage mode; these (individual) rates were not affected by inspection process effects, within statistical error.

33 CFR 117.823 - Cape Fear River.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Fear River. 117.823 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.823 Cape Fear River. The draw of the Cape Fear Memorial Bridge, mile 26.8, at Wilmington need not open for the passage of vessel from 8...

Can we infer external effects from a study of the Irish indirect tax system?

OpenAIRE

Madden, David (David Patrick)

1992-01-01

This paper estimates implied external effects for the Irish indirect tax system for the year 1987. The study uses the inverse optimum technique of Christiansen and Jansen (1978) which estimates implied external effects, given the assumption that the economy is at an optimum with regard to the indirect tax system. External effects are estimated for three goods: tobacco, alcohol and petrol and in all cases the estimated external effects are of the expected sign. The paper also estimates the imp...

STS-95 Mission Specialist Duque suits up during TCDT

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Pedro Duque of Spain, representing the European Space Agency, suits up in the Operations and Checkout Building prior to his trip to Launch Pad 39-B. Duque and the rest of the STS-95 crew are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT) which includes mission familiarization activities, emergency egress training, and a simulated main engine cutoff. The other crew members are Payload Specialist Chiaki Mukai (M.D., Ph.D.), representing the National Space Development Agency of Japan (NASDA), Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Mission Commander Curtis L. Brown. The STS-95 mission, targeted for liftoff on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. Following the TCDT, the crew will be returning to Houston for final flight preparations.

43 CFR 4.117 - Service of papers.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Service of papers. 4.117 Section 4.117... Service of papers. A copy of all pleadings, briefs, motions, letters, or other papers filed with the Board, shall be served upon the other party at the time of filing. Service of papers may be made personally or...

Pedro Duque arrives at KSC for the STS-95 launch

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Pedro Duque, with the European Space Agency (ESA), arrives at Kennedy Space Center's Shuttle Landing Facility aboard a T-38 jet as part of final preparations for launch. The STS-95 mission, targeted for liftoff at 2 p.m. on Oct. 29, includes research payloads such as the Spartan solar- observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. The mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC on Nov. 7. The other STS-95 crew members are Mission Commander Curtis L. Brown Jr., Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Mission Specialist Stephen K. Robinson, Payload Specialist John H. Glenn Jr., senator from Ohio, and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA).

STS-96 Crew Training, Mission Animation, Crew Interviews, STARSHINE, Discovery Rollout and Repair of Hail Damage

Science.gov (United States)

1999-01-01

Live footage shows the crewmembers of STS-96, Commander Kent V. Rominger, Pilot Rick D. Husband, Mission Specialists Ellen Ochoa, Tamara E. Jernigan, Daniel T. Barry, Julie Payette and Valery Ivanovich Tokarev during various training activities. Scenes include astronaut suit-up, EVA training in the Virtual Reality Lab, Orbiter space vision training, bailout training, and crew photo session. Footage also shows individual crew interviews, repair activities to the external fuel tank, and Discovery's return to the launch pad. The engineers are seen sanding, bending, and painting the foam used in repairing the tank. An animation of the deployment of the STARSHINE satellite, International Space Station, and the STS-96 Mission is presented. Footage shows the students from Edgar Allen Poe Middle School sanding, polishing, and inspecting the mirrors for the STARSHINE satellite. Live footage also includes students from St. Michael the Archangel School wearing bunny suits and entering the clean room at Goddard Space Flight Center.

A unique corundum and refractory metal-nugget bearing micrometeorite P117

Digital Repository Service at National Institute of Oceanography (India)

Rudraswami, N.G.; Reshma, K.; ShyamPrasad, M.

Micrometeorites provide a large range of samples sourced from a wide variety of planetary materials, thereby providing a scope for expanding the known inventory of solar system materials. Here we report the micrometeorite AAS62-34-P117 having...

THE HOMOGENEOUS STUDY OF TRANSITING SYSTEMS (HoSTS). I. THE PILOT STUDY OF WASP-13

Energy Technology Data Exchange (ETDEWEB)

Gomez Maqueo Chew, Yilen; Cargile, Phillip; Hebb, Leslie; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Faedi, Francesca; Pollacco, Don [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom); Doyle, Amanda P.; Smalley, Barry [Astrophysics Group, Keele University, Staffordshire ST5 5BG (United Kingdom); Ghezzi, Luan; Cunha, Katia; Smith, Verne V. [Observatorio Nacional, Rua Gal. Jose Cristino 77, Rio de Janeiro, RJ 20921-400 (Brazil); Sousa, Sergio; Santos, Nuno C. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Barros, Susana C. C. [LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, Aix Marseille Universite, CNRS, F-13388 Marseille (France); Schuler, Simon C. [Stewart Observatory, University of Arizona, Tucson, AZ 85721 (United States); Collier Cameron, Andrew, E-mail: yilen.gomez@vanderbilt.edu [School of Physics and Astronomy, University of St Andrews, St Andrews, Fife KY16 9SS (United Kingdom)

2013-05-01

We present the fundamental stellar and planetary properties of the transiting planetary system WASP-13 within the framework of the Homogeneous Study of Transiting Systems (HoSTS). HoSTS aims to derive the fundamental stellar (T{sub eff}, [Fe/H], M{sub *}, R{sub *}) and planetary (M{sub pl}, R{sub pl}, T{sub eq}) physical properties of known transiting planets using a consistent methodology and homogeneous high-quality data set. Four spectral analysis techniques are independently applied to a Keck+HIRES spectrum of WASP-13 considering two distinct cases: unconstrained parameters and constrained log g from transit light curves. We check the derived stellar temperature against that from a different temperature diagnostic based on an INT+IDS H{alpha} spectrum. The four unconstrained analyses render results that are in good agreement, and provide an improvement of 50% in the precision of T{sub eff}, and of 85% in [Fe/H] with respect to the WASP-13 discovery paper. The planetary parameters are then derived via the Monte Carlo Markov Chain modeling of the radial velocity and light curves, in iteration with stellar evolutionary models to derive realistic uncertainties. WASP-13 (1.187 {+-} 0.065 M{sub Sun }; 1.574 {+-} 0.048 R{sub Sun }) hosts a Saturn-mass, transiting planet (0.500 {+-} 0.037 M{sub Jup}; 1.407 {+-} 0.052 R{sub Jup}), and is at the end of its main-sequence lifetime (4-5.5 Gyr). Our analysis of WASP-13 showcases that both a detailed stellar characterization and transit modeling are necessary to well determine the fundamental properties of planetary systems, which are paramount in identifying and determining empirical relationships between transiting planets and their hosts.

[Research and Design of a System for Detecting Automated External Defbrillator Performance Parameters].

Science.gov (United States)

Wang, Kewu; Xiao, Shengxiang; Jiang, Lina; Hu, Jingkai

2017-09-30

In order to regularly detect the performance parameters of automated external defibrillator (AED), to make sure it is safe before using the instrument, research and design of a system for detecting automated external defibrillator performance parameters. According to the research of the characteristics of its performance parameters, combing the STM32's stability and high speed with PWM modulation control, the system produces a variety of ECG normal and abnormal signals through the digital sampling methods. Completed the design of the hardware and software, formed a prototype. This system can accurate detect automated external defibrillator discharge energy, synchronous defibrillation time, charging time and other key performance parameters.

Optimization of transport suppression barriers generated by externally driven Alfven waves in D-shaped, low aspect ratio tokamaks

International Nuclear Information System (INIS)

Bruma, C; Cuperman, S; Komoshvili, K

2003-01-01

In an effort to optimize the internal transport barriers (ITBs) generated by externally launched mode-converted fast waves (FWs) in pre-heated spherical tokamaks (STs), we have carried out a systematic parametric investigation with respect to the rf waves and antenna characteristics; as a study case, a START-like device has been considered. Within the framework of a plasma model including both kinetic effects (collisionless Landau damping on passing electrons) and collisional damping on both trapped and passing electrons and ions, and starting with the solution of the full wave equation for a ST-plasma, we show that optimized ITBs, suitable for the stabilization of plasma turbulence (e.g. overpassing the maximum growth rate of the ITG-instability, γ ITG ) in STs can be generated by the aid of externally launched FW and mode-converted to kinetic Alfven waves. This result holds in spite of the limiting trapped-particles associated squeezing factor S present in the non-linear equation for E r (via the viscosity coefficient μ θi ∝|S| 3/2 , S = S(dE r /dr))

Sludge Treatment Project Engineered Container Retrieval And Transfer System Preliminary Design Hazard Analysis Supplement 1

International Nuclear Information System (INIS)

Franz, G.R.; Meichle, R.H.

2011-01-01

This 'What/If' Hazards Analysis addresses hazards affecting the Sludge Treatment Project Engineered Container Retrieval and Transfer System (ECRTS) NPH and external events at the preliminary design stage. In addition, the hazards of the operation sequence steps for the mechanical handling operations in preparation of Sludge Transport and Storage Container (STSC), disconnect STSC and prepare STSC and Sludge Transport System (STS) for shipping are addressed.

Health Externalities and Heat savings in Energy System Modelling

DEFF Research Database (Denmark)

Zvingilaite, Erika

Energy consumption and production can cause air pollution with global impact, such as CO2, and local/regional air pollutants, such as SO2, NOx and PM2.5, as a result of fuel combustion. Use of fossil fuels leads to global CO2 emissions and causes global warming effects, regardless place or height......-related external costs can be internalised, for instance, in energy system modelling. External costs of global warming and human health damage can be of comparable magnitude.However, in contrast to global CO2 impacts, air pollution damage to human health depends on a number of factors, related to location...... and included in an energy system optimisation model. The performed analysis of the Danish heat and power sector concludes that accounting for spatial variation of health damage costs in heat and power system optimisation model has an effect on the optimal technology mix and distribution of energy plants among...

STS-61 mission director's post-mission report

Science.gov (United States)

Newman, Ronald L.

1995-01-01

To ensure the success of the complex Hubble Space Telescope servicing mission, STS-61, NASA established a number of independent review groups to assess management, design, planning, and preparation for the mission. One of the resulting recommendations for mission success was that an overall Mission Director be appointed to coordinate management activities of the Space Shuttle and Hubble programs and to consolidate results of the team reviews and expedite responses to recommendations. This report presents pre-mission events important to the experience base of mission management, with related Mission Director's recommendations following the event(s) to which they apply. All Mission Director's recommendations are presented collectively in an appendix. Other appendixes contain recommendations from the various review groups, including Payload Officers, the JSC Extravehicular Activity (EVA) Section, JSC EVA Management Office, JSC Crew and Thermal Systems Division, and the STS-61 crew itself. This report also lists mission events in chronological order and includes as an appendix a post-mission summary by the lead Payload Deployment and Retrieval System Officer. Recommendations range from those pertaining to specific component use or operating techniques to those for improved management, review, planning, and safety procedures.

Defining the methodological challenges and opportunities for an effective science of sociotechnical systems and safety

Science.gov (United States)

Waterson, Patrick; Robertson, Michelle M.; Cooke, Nancy J.; Militello, Laura; Roth, Emilie; Stanton, Neville A.

2015-01-01

An important part of the application of sociotechnical systems theory (STS) is the development of methods, tools and techniques to assess human factors and ergonomics workplace requirements. We focus in this paper on describing and evaluating current STS methods for workplace safety, as well as outlining a set of six case studies covering the application of these methods to a range of safety contexts. We also describe an evaluation of the methods in terms of ratings of their ability to address a set of theoretical and practical questions (e.g. the degree to which methods capture static/dynamic aspects of tasks and interactions between system levels). The outcomes from the evaluation highlight a set of gaps relating to the coverage and applicability of current methods for STS and safety (e.g. coverage of external influences on system functioning; method usability). The final sections of the paper describe a set of future challenges, as well as some practical suggestions for tackling these. Practitioner Summary: We provide an up-to-date review of STS methods, a set of case studies illustrating their use and an evaluation of their strengths and weaknesses. The paper concludes with a ‘roadmap’ for future work. PMID:25832121

33 CFR 117.753 - Ship Channel, Great Egg Harbor Bay.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ship Channel, Great Egg Harbor Bay. 117.753 Section 117.753 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.753 Ship Channel, Great Egg Harbor Bay. The draw of the S52 (Ship...

STS-51B Crew Portrait

Science.gov (United States)

1985-01-01

The crew assigned to the STS-51B mission included (seated left to right) Robert F. Overmyer, commander; and Frederick D. Gregory, pilot. Standing, left to right, are Don L. Lind, mission specialist; Taylor G. Wang, payload specialist; Norman E. Thagard, mission specialist; William E. Thornton, mission specialist; and Lodewijk van den Berg, payload specialist. Launched aboard the Space Shuttle Challenger on April 29, 1985 at 12:02:18 pm (EDT), the STS-51A mission's primary payload was the Spacelab-3.

STS-82 Pilot Scott Horowitz at SLF

Science.gov (United States)

1997-01-01

STS-82 Pilot Scott J. 'Doc' Horowitz flashes a wide grin for photographers after he lands his T-38 jet at KSCs Shuttle Landing Facility. Horowitz and the other six members of the STS-82 crew came from their home base at Johnson Space Center in Houston, TX, to spend the last few days before launch at KSC. STS-82 is scheduled for liftoff on Feb. 11 during a 65-minute launch window which opens at 3:56 a.m. EST. The 10-day flight aboard the Space Shuttle Discovery will be the second Hubble Space Telescope servicing mission.

Photogrammetry Measurements During a Tanking Test on the Space Shuttle External Tank, ET-137

Science.gov (United States)

Littell, Justin D.; Schmidt, Tim; Tyson, John; Oliver, Stanley T.; Melis, Matthew E.; Ruggeri, Charles

2012-01-01

On November 5, 2010, a significant foam liberation threat was observed as the Space Shuttle STS-133 launch effort was scrubbed because of a hydrogen leak at the ground umbilical carrier plate. Further investigation revealed the presence of multiple cracks at the tops of stringers in the intertank region of the Space Shuttle External Tank. As part of an instrumented tanking test conducted on December 17, 2010, a three dimensional digital image correlation photogrammetry system was used to measure radial deflections and overall deformations of a section of the intertank region. This paper will describe the experimental challenges that were overcome in order to implement the photogrammetry measurements for the tanking test in support of STS-133. The technique consisted of configuring and installing two pairs of custom stereo camera bars containing calibrated cameras on the 215-ft level of the fixed service structure of Launch Pad 39-A. The cameras were remotely operated from the Launch Control Center 3.5 miles away during the 8 hour duration test, which began before sunrise and lasted through sunset. The complete deformation time history was successfully computed from the acquired images and would prove to play a crucial role in the computer modeling validation efforts supporting the successful completion of the root cause analysis of the cracked stringer problem by the Space Shuttle Program. The resulting data generated included full field fringe plots, data extraction time history analysis, section line spatial analyses and differential stringer peak ]valley motion. Some of the sample results are included with discussion. The resulting data showed that new stringer crack formation did not occur for the panel examined, and that large amounts of displacement in the external tank occurred because of the loads derived from its filling. The measurements acquired were also used to validate computer modeling efforts completed by NASA Marshall Space Flight Center (MSFC).

STS-74 view of ODS from Payload Changout Room

Science.gov (United States)

1995-01-01

Workers at Launch Pad 39A are preparing to close the payload bay doors on the Space Shuttle Atlantis for its upcoming launch on Mission STS-74 and the second docking with the Russian Space Station Mir. Uppermost in the payload bay is the Orbiter Docking System (ODS), which also flew on the first docking flight between the Space Shuttle and MIR. Lowermost is the primary payload of STS-74, the Russian-built Docking Module. During the mission, the Docking Module will first be attached to ODS and then to Mir. It will be left attached to Mir to become a permanent extension that will afford adequate clearance between the orbiter and the station during future dockings. At left in the payload bay, looking like a very long pole, is the Canadian-built Remote Manipulator System arm that will be used by the crew to hoist the Docking Module and attach it to the ODS.

STS-68 Mission Insignia

Science.gov (United States)

1994-01-01

This STS-68 patch was designed by artist Sean Collins. Exploration of Earth from space is the focus of the design of the insignia, the second flight of the Space Radar Laboratory (SRL-2). SRL-2 was part of NASA's Mission to Planet Earth (MTPE) project. The world's land masses and oceans dominate the center field, with the Space Shuttle Endeavour circling the globe. The SRL-2 letters span the width and breadth of planet Earth, symbolizing worldwide coverage of the two prime experiments of STS-68: The Shuttle Imaging Radar-C and X-Band Synthetic Aperture Radar (SIR-C/X-SAR) instruments; and the Measurement of Air Pollution from Satellites (MAPS) sensor. The red, blue, and black colors of the insignia represent the three operating wavelengths of SIR-C/X-SAR, and the gold band surrounding the globe symbolizes the atmospheric envelope examined by MAPS. The flags of international partners Germany and Italy are shown opposite Endeavour. The relationship of the Orbiter to Earth highlights the usefulness of human space flights in understanding Earth's environment, and the monitoring of its changing surface and atmosphere. In the words of the crew members, the soaring Orbiter also typifies the excellence of the NASA team in exploring our own world, using the tools which the Space Program developed to explore the other planets in the solar system.

33 CFR 117.734 - Navesink River (Swimming River).

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navesink River (Swimming River). 117.734 Section 117.734 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Swimming River). The Oceanic Bridge, mile 4.5, shall open on signal; except that, from December 1 through...

46 CFR 117.150 - Survival craft embarkation arrangements.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft embarkation arrangements. 117.150 Section... EQUIPMENT AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.150 Survival craft embarkation... apparatus when either— (1) The embarkation station for the survival craft is on a deck more than 4.5 meters...

Anticipated chaos in a nonsymmetric coupled external-cavity-laser system

International Nuclear Information System (INIS)

Rees, Paul; Spencer, Paul S.; Pierce, Iestyn; Sivaprakasam, S.; Shore, K. Alan

2003-01-01

We explain how the anticipation of chaos in a coupled external cavity laser system described by Sivaprakasam, Shahverdiev, Spencer, and Shore [Phys. Rev. Lett. 87, 154101 (2001)] is obtained. We show that the external cavity induces the required symmetry breaking necessary for the existence of a time delay between the synchronized output of the two laser diodes. The inclusion of a detuning between the two lasers causes one laser to anticipate the chaotic dynamics of the other

Complex dynamics in Josephson system with two external forcing terms

International Nuclear Information System (INIS)

Yang Jianping; Feng Wei; Jing Zhujun

2006-01-01

Josephson system with two external forcing terms is investigated. By applying Melnikov method, we prove that criterion of existence of chaos under periodic perturbation. By second-order averaging method and Melnikov method, we obtain the criterion of existence of chaos in averaged system under quasi-periodic perturbation for ω 2 =ω 1 +εν, and cannot prove the criterion of existence of chaos in averaged system under quasi-periodic perturbation for ω 2 =nω 1 +εν (n>=2 and n-bar N), where ν is not rational to ω 1 . We also study the effects of the parameters of system on dynamical behaviors by using numerical simulation. The numerical simulations, including bifurcation diagram of fixed points, bifurcation diagram of system in three- and two-dimensional space, homoclinic and heteroclinic bifurcation surface, Maximum Lyapunov exponent, phase portraits, Poincare map, are also plotted to illustrate theoretical analysis, and to expose the complex dynamical behaviors, including the period-n (n=1,2,5,7) orbits in different chaotic regions, cascades of period-doubling bifurcation from period-1, 2 and 5 orbits, reverse period-doubling bifurcation, onset of chaos which occurs more than once for two given external frequencies and chaos suddenly converting to periodic orbits, transient chaos with complex periodic windows and crisis, reverse period-5 bubble, non-attracting chaotic set and nice attracting chaotic set. In particular, we observe that the system can leave chaotic region to periodic motion by adjusting damping α, amplitude f 1 and frequency ω 2 of external forcing which can be considered as a control strategy

The ExternE project: methodology, objectives and limitations

International Nuclear Information System (INIS)

Rabl, A.; Spadaro, J.V.

2002-01-01

This paper presents a summary of recent studies on external costs of energy systems, in particular the ExternE (External Costs of Energy) Project of the European Commission. To evaluate the impact and damage cost of a pollutant, one needs to carry out an impact pathway analysis; this involves the calculation of increased pollutant concentrations in all affected regions due to an incremental emission (e.g. μg/m 3 of particles, using models of atmospheric dispersion and chemistry), followed by the calculation of physical impacts (e.g. number of cases of asthma due to these particles, using a dose-response function). The entire so-called fuel chain (or fuel cycle) is evaluated and compared on the basis of delivered end use energy. Even though the uncertainties are large, the results provide substantial evidence that the classical air pollutants (particles, NO x and SO x ) from the combustion of fossil fuels impose a heavy toll, in addition to the cost of global warming. The external costs are especially large for coal; even for 'good current technology' they may be comparable to the price of electricity. For natural gas the external costs are about a third to a half of coal. The external costs of nuclear are small compared to the price of electricity (at most a few %), and so are the external costs of most renewable energy systems. (authors)

Stephen K. Robinson arrives at KSC for the STS-95 launch

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Stephen K. Robinson, arrives at Kennedy Space Center's Shuttle Landing Facility aboard a T-38 jet as part of final preparations for launch. The STS-95 mission, targeted for liftoff at 2 p.m. on Oct. 29, includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process. The mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC on Nov. 7. The other STS-95 crew members are Mission Commander Curtis L. Brown Jr., Pilot Steven W. Lindsey, Mission Specialist Scott E. Parazynski, Payload Specialist John H. Glenn Jr., senator from Ohio, Mission Specialist Pedro Duque, with the European Space Agency (ESA), and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA).

29 CFR 779.117 - Salesmen and sales clerks.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Salesmen and sales clerks. 779.117 Section 779.117 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... sales clerks. A salesman or a sales clerk who regularly and recurrently takes orders for, or sells, or...

Two interacting spins in external fields. Four-level systems

Energy Technology Data Exchange (ETDEWEB)

Bagrov, V.G.; Baldiotti, M.C.; Gitman, D.M. [Instituto de Fisica, Universidade de Sao Paulo, Caixa Postal 66318-CEP, 05315-970 Sao Paulo, S.P. (Brazil); Levin, A.D. [Dexter Research Center (United States)

2007-04-15

In the present article, we consider the so-called two-spin equation that describes four-level quantum systems. Recently, these systems attract attention due to their relation to the problem of quantum computation. We study general properties of the two-spin equation and show that the problem for certain external backgrounds can be identified with the problem of one spin in an appropriate background. This allows one to generate a number of exact solutions for two-spin equations on the basis of already known exact solutions of the one-spin equation. Besides, we present some exact solutions for the two-spin equation with an external background different for each spin but having the same direction. We study the eigenvalue problem for a time-independent spin interaction and a time-independent external background. A possible analogue of the Rabi problem for the two-spin equation is defined. We present its exact solution and demonstrate the existence of magnetic resonances in two specific frequencies, one of them coinciding with the Rabi frequency, and the other depending on the rotating field magnitude. The resonance that corresponds to the second frequency is suppressed with respect to the first one. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

Effects of External Loads on Human Head Movement Control Systems

Science.gov (United States)

Nam, M. H.; Choi, O. M.

1984-01-01

The central and reflexive control strategies underlying movements were elucidated by studying the effects of external loads on human head movement control systems. Some experimental results are presented on dynamic changes weigh the addition of aviation helmet (SPH4) and lead weights (6 kg). Intended time-optimal movements, their dynamics and electromyographic activity of neck muscles in normal movements, and also in movements made with external weights applied to the head were measured. It was observed that, when the external loads were added, the subject went through complex adapting processes and the head movement trajectory and its derivatives reached steady conditions only after transient adapting period. The steady adapted state was reached after 15 to 20 seconds (i.e., 5 to 6 movements).

Impulsive Flocking of Dynamical Multiagent Systems with External Disturbances

Directory of Open Access Journals (Sweden)

Fujun Han

2017-01-01

Full Text Available Flocking motion of multiagent systems is influenced by various external disturbances in complex environment. By applying disturbance observer, flocking of multiagent systems with exogenous disturbances is studied. Based on the robust features of impulsive control, a distributed impulsive control protocol is presented with disturbance observer, and flocking motion of multiagent systems is analyzed. Moreover, a sufficient condition is obtained to ensure the flocking motion of multiagent systems following a leader. Finally, simulation results show the validity of the theoretical conclusion.

40 CFR 81.117 - Southeast Missouri Intrastate Air Quality Control Region.

Science.gov (United States)

2010-07-01

... Quality Control Region. 81.117 Section 81.117 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.117 Southeast Missouri Intrastate Air Quality Control Region. The Southeast Missouri Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

External costs related to power production technologies. ExternE national implementation for Denmark

Energy Technology Data Exchange (ETDEWEB)

Schleisner, L; Sieverts Nielsen, P [eds.

1997-12-01

The objective of the ExternE National Implementation project has been to establish a comprehensive and comparable set of data on externalities of power generation for all EU member states and Norway. The tasks include the application of the ExternE methodology to the most important fuel cycles for each country as well as to update the already existing results, to aggregate these site- and technology-specific results to more general figures. The current report covers the detailed information concerning the ExternE methodology. Importance is attached to the computer system used in the project and the assessment of air pollution effects on health, materials and ecological effects. Also the assessment of global warming damages are described. Finally the report covers the detailed information concerning the national implementation for Denmark for an offshore wind farm and a wind farm on land, a decentralised CHP plant based on natural gas and a decentralised CHP plant base on biogas. (au) EU-JOULE 3. 79 tabs., 11 ills., 201 refs.

External costs related to power production technologies. ExternE national implementation for Denmark

International Nuclear Information System (INIS)

Schleisner, L.; Sieverts Nielsen, P.

1997-12-01

The objective of the ExternE National Implementation project has been to establish a comprehensive and comparable set of data on externalities of power generation for all EU member states and Norway. The tasks include the application of the ExternE methodology to the most important fuel cycles for each country as well as to update the already existing results, to aggregate these site- and technology-specific results to more general figures. The current report covers the detailed information concerning the ExternE methodology. Importance is attached to the computer system used in the project and the assessment of air pollution effects on health, materials and ecological effects. Also the assessment of global warming damages are described. Finally the report covers the detailed information concerning the national implementation for Denmark for an offshore wind farm and a wind farm on land, a decentralised CHP plant based on natural gas and a decentralised CHP plant base on biogas. (au) EU-JOULE 3. 79 tabs., 11 ills., 201 refs

L-System model for the growth of arbuscular mycorrhizal fungi, both within and outside of their host roots

Czech Academy of Sciences Publication Activity Database

Schnepf, A.; Leitner, D.; Schweiger, P.F.; Scholl, P.; Jansa, Jan

2016-01-01

Roč. 13, č. 117 (2016), s. 20160129 ISSN 1742-5689 R&D Projects: GA MŠk(CZ) LK11224 Institutional support: RVO:61388971 Keywords : L-system * arbuscular mycorrhiza * external hyphae Subject RIV: EE - Microbiology, Virology Impact factor: 3.579, year: 2016

STS-90 Pilot Scott Altman is suited up for launch

Science.gov (United States)

1998-01-01

STS-90 Pilot Scott Altman is assisted during suit-up activities by Lockheed Suit Technician Valerie McNeil from Johnson Space Center in KSC's Operations and Checkout Building. Altman and the rest of the STS-90 crew will shortly depart for Launch Pad 39B, where the Space Shuttle Columbia awaits a second liftoff attempt at 2:19 p.m. EDT. His first trip into space, Altman is participating in a life sciences research flight that will focus on the most complex and least understood part of the human body - - the nervous system. Neurolab will examine the effects of spaceflight on the brain, spinal cord, peripheral nerves and sensory organs in the human body.

STS-74 Mission Specialists McArther and Ross in OPF

Science.gov (United States)

1995-01-01

In Orbiter Processing Facility Bay 2, STS-74 Mission Specialist William 'Bill' McArthur Jr. (left) and Jerry L. Ross are reviewing the configuration of payload elements in the orbiter Atlantis' payload bay. Ross and McArthur are participating in the Crew Equipment Interface Test (CEIT), an opportunity for flight crew members to become familiar with the payload hardware they will be working with on-orbit. Located in Atlantis' payload bay are the Orbiter Docking System and the Docking Module, two pieces of flight hardware that will play a crucial role in the second docking of the Space Shuttle to the Russian Space Station Mir. STS-74 is currently targeted for an early November launch

Two-stream instability for a light ion beam-plasma system with external magnetic field

International Nuclear Information System (INIS)

Okada, T.; Tazawa, H.

1992-12-01

For inertial confinement fusion, a focused light ion beam (LIB) is required to propagate stably through a chamber to a target. We have pointed out that the applied external magnetic field is important for LIB propagation. To investigate the influence of the external magnetic field on the LIB propagation, we analysed the electrostatic dispersion relation of magnetized light ion beam-plasma system. The particle in-cell (PIC) simulation results are presented for a light ion beam-plasma system with external magnetic field. (author)

Environmental externalities related to power production on biogas and natural gas based on the EU ExternE methodology

DEFF Research Database (Denmark)

Nielsen, Per Sieverts; Ibsen, Liselotte Schleisner

1998-01-01

This paper assesses the environmental impacts and external costs from selected electricity generation systems in Denmark. The assessment is carried out as part of the ExternE National Implementation, which is the second phase of the ExternE project and involves case studies from all Western...... European countries. The project use a “bottom-up” methodology to evaluate the external costs associated with a wide range of different fuel cycles. The project has identified priority impacts, where most are impacts from air emissions. Externalities due to atmospheric emissions are calculated through...

STS and Researcher Intervention Strategies

Directory of Open Access Journals (Sweden)

Brian Martin

2016-06-01

Full Text Available When I learned about a concerted campaign against Australian vaccination critics, I decided to intervene in the debate. As a result, some proponents of vaccination turned on me, making abusive comments and complaining to university officials. At several points in this experience, I had to make choices about how to intervene or respond. STS perspectives offered valuable insights for understanding the dynamics of the controversy but provided little guidance for making decisions. Some reasons are offered for why STS lacks tools for guiding practical action in such situations.

SOPHIE velocimetry of Kepler transit candidates: a joint photometric, spectroscopic and dynamical analysis of the Kepler-117 system

Directory of Open Access Journals (Sweden)

Bruno G.

2015-01-01

Full Text Available We present the analysis of the multi-planetary system Kepler-117, which is part of our program of observations of Kepler planets. This system is composed of a ~ 30 MEarth planet in a ~ 19 days orbit and a ~ 2 MJ planet orbiting in ~ 51 days. Both the orbits have low eccentricity. The planets are not close to an exact low-order mean motion resonance, but exhibit significant transit timing variations (TTVs nevertheless. We perform a combined Markov Chain Monte Carlo fit on all the available data: the Kepler photometry, the TTVs, the radial velocities we obtained with SOPHIE/OHP and the stellar parameters. The prime result is that the modelling of the TTVs allows to increase the precision on the system parameters which are not constrained by the radial velocities alone.

117 - 122 Omoniyi et al

African Journals Online (AJOL)

User

Bayero Journal of Pure and Applied Sciences, 8(2): 117 – 122. Received: ... FOLLOWING MILD EXPOSURE. Omoniyi ... People who work with materials containing mere traces .... obscured physical effect in the animal model (Omoniyi et al.

Sprint: The first flight demonstration of the external work system robots

Science.gov (United States)

Price, Charles R.; Grimm, Keith

1995-01-01

The External Works Systems (EWS) 'X Program' is a new NASA initiative that will, in the next ten years, develop a new generation of space robots for active and participative support of zero g external operations. The robotic development will center on three areas: the assistant robot, the associate robot, and the surrogate robot that will support external vehicular activities (EVA) prior to and after, during, and instead of space-suited human external activities respectively. The EWS robotics program will be a combination of technology developments and flight demonstrations for operational proof of concept. The first EWS flight will be a flying camera called 'Sprint' that will seek to demonstrate operationally flexible, remote viewing capability for EVA operations, inspections, and contingencies for the space shuttle and space station. This paper describes the need for Sprint and its characteristics.

Building materials and systems with vacuum insulation panels for external walls; Bauelemente und Systeme mit VIP fuer Aussenwandkonstruktionen - Schlussbericht

Energy Technology Data Exchange (ETDEWEB)

Binz, A; Steinke, G

2007-07-01

This final report for the Swiss Federal Office of Energy (SFOE) takes a look at materials and systems using vacuum insulation panels (VIP) for the construction of external walls. The aim of this research project was the development, practical use and market introduction of VIP systems that take account of the special properties of VIP. Along with partners in industry, applications involving external and internal insulation were examined. The need for protecting the vacuum panels against mechanical damage is stressed. The specific needs for the protection of external and internal applications are discussed. The dynamic developments in this relatively new area are commented on. Various mounting systems are examined and commented on. The thermal properties of such insulation systems and applications are noted and commented on.

A decay heat removal system requiring no external energy

International Nuclear Information System (INIS)

Costes, D.; Fermandjian, J.

1983-12-01

A new Decay heat Removal System is described for PWR's with dry containment, i.e. a containment building which encloses no permanent reserve of cooling water. This new system is intended to provide a high level of safety since it uses no external energy, but only the thermodynamic energy of the air-steam-liquid water mixture generated in the containment after the failure of the primary circuit (''LOCA'') or of the secondary circuit. Thermodynamics of the system is evaluated first: after some design considerations, the use of the system for protecting actual PWR's is addressed

External injection systems applied in modern cyclotrons designed and manufactured in NIIEFA

International Nuclear Information System (INIS)

Bogdanov, P.V.; Vasilchenko, I.N.; Veresov, O.L.; Gavrish, Yu.N.; Grigorenko, S.V.; Zuev, Yu.V.; Kozienko, M.T.; Mudrolyubov, V.G.; Strokach, A.P.; Tsygankov, S.S.

2012-01-01

The main parameters and design features of the external injection systems applied in modern cyclotrons designed and manufactured in NIIEFA and intended for production of radionuclides for medicine are presented. The use of these external injection systems instead of a traditional internal source allows the current of the accelerated beam to be significantly increased and the in-leakage of the working gas to the acceleration chamber to be reduced, which results in reduced beam losses in the process of acceleration and lower equipment activation.

STS-95 Day 05 Highlights

Science.gov (United States)

1998-01-01

On this fifth day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, check the status of components of the Hubble Space Telescope Orbital Systems Test (HOST) payload, which provides an on-orbit test bed for hardware that will be used during the third Hubble servicing mission. Then Parazynski and Pilot Steve Lindsey set up some of the tools that will be used during the rendezvous and subsequent capture and reberthing of the Spartan satellite.

Optimization of transport suppression barriers generated by externally driven Alfven waves in D-shaped, low aspect ratio tokamaks

Energy Technology Data Exchange (ETDEWEB)

Bruma, C [School of Physics and Astronomy, Tel Aviv University, 69978 Tel Aviv (Israel); Cuperman, S [School of Physics and Astronomy, Tel Aviv University, 69978 Tel Aviv (Israel); Komoshvili, K [School of Physics and Astronomy, Tel Aviv University, 69978 Tel Aviv (Israel)

2003-04-01

In an effort to optimize the internal transport barriers (ITBs) generated by externally launched mode-converted fast waves (FWs) in pre-heated spherical tokamaks (STs), we have carried out a systematic parametric investigation with respect to the rf waves and antenna characteristics; as a study case, a START-like device has been considered. Within the framework of a plasma model including both kinetic effects (collisionless Landau damping on passing electrons) and collisional damping on both trapped and passing electrons and ions, and starting with the solution of the full wave equation for a ST-plasma, we show that optimized ITBs, suitable for the stabilization of plasma turbulence (e.g. overpassing the maximum growth rate of the ITG-instability, {gamma}{sub ITG}) in STs can be generated by the aid of externally launched FW and mode-converted to kinetic Alfven waves. This result holds in spite of the limiting trapped-particles associated squeezing factor S present in the non-linear equation for E{sub r} (via the viscosity coefficient {mu}{sub {theta}}{sub i}{proportional_to}|S|{sup 3/2}, S = S(dE{sub r}/dr))

Group Recommendation Systems Based on External Social-Trust Networks

Directory of Open Access Journals (Sweden)

Guang Fang

2018-01-01

Full Text Available With the development of social networks and online mobile communities, group recommendation systems support users’ interaction with similar interests or purposes with others. We often provide some advices to the close friends, such as listening to favorite music and sharing favorite dishes. However, users’ personalities have been ignored by the traditional group recommendation systems while the majority is satisfied. In this paper, a method of group recommendation based on external social-trust networks is proposed, which builds a group profile by analyzing not only users’ preferences, but also the social relationships between members inside and outside of the group. We employ the users’ degree of disagreement to adjust group preference rating by external information of social-trust network. Moreover, having a discussion about different social network utilization ratio, we proposed a method to work for smaller group size. The experimental results show that the proposed method has consistently higher precision and leads to satisfactory recommendations for groups.

41 CFR 102-117.110 - What is satisfactory service?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...

Synthesis of a New Element with Atomic Number Z=117

International Nuclear Information System (INIS)

Oganessian, Yu. Ts.; Abdullin, F. Sh.; Dmitriev, S. N.; Itkis, M. G.; Lobanov, Yu. V.; Mezentsev, A. N.; Polyakov, A. N.; Sagaidak, R. N.; Shirokovsky, I. V.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu. S.; Utyonkov, V. K.; Voinov, A. A.; Vostokin, G. K.; Bailey, P. D.; Benker, D. E.; Ezold, J. G.; Porter, C. E.; Riley, F. D.

2010-01-01

The discovery of a new chemical element with atomic number Z=117 is reported. The isotopes 293 117 and 294 117 were produced in fusion reactions between 48 Ca and 249 Bk. Decay chains involving 11 new nuclei were identified by means of the Dubna gas-filled recoil separator. The measured decay properties show a strong rise of stability for heavier isotopes with Z≥111, validating the concept of the long sought island of enhanced stability for superheavy nuclei.

Determination of specific alpha-radioactivity of flora samples from semipalatinsk test site (STS)

International Nuclear Information System (INIS)

Blekhman, A.M.; Dujsenbaev, A.; Orazova, A.O.

1999-01-01

For further rehabilitation of soil earlier contaminated with radioactive fallout, the method of radionuclide absorption by plants is vital. The last updating of electronic system of the facility meant to analyze impulse shape /2/ helped to enlarge dynamical range of registration and reduction of identification threshold for alpha particles up to 50 keV. We have developed methods for STS flora samples preparation and performed first measurements of their specific alpha activity. Measurement results are in table 1. Measurement results analysis shows that STS flora samples can accumulate considerable concentrations of alpha active nuclides

Externalities of energy. Swedish implementation of the ExternE methodology

International Nuclear Information System (INIS)

Nilsson, Maans; Gullberg, M.

1998-01-01

The growing interest for developing economic instruments for efficient environmental policies has opened up a large area of multi-disciplinary research. ExternE is an example of this research, combining disciplines such as engineering, ecology, immunology and economics expertise to create new knowledge about how environmental pressures from energy production affect our nature and society. The ExternE Project aims to identify and, as far as possible quantify the externalities of energy production in Europe. The Stockholm Environment Institute has carried out a preliminary aggregation: -Coal Fuel Cycle: centred around Vaesteraas Kraftvaermeverk, Vaesteraas. This is the largest co-generation plant in Sweden, with four blocks and a maximum co-generation output of 520 MW electricity and 950 MW heat. The analysis is carried out on boiler B4. -Biomass Fuel Cycle: centred around Haendeloeverket, Norrkoeping. This plant predominately burns forestry residues, but a variety of fuels are combusted. Haendeloeverket has an installed capacity of 100 MW electricity and 375 MW heat, in a total of three boilers and two back-pressure turbines. The analysis is carried out on boiler P13. -Hydro Fuel Cycle: Klippens Kraftstation, Storuman. Built in 1990-1994, it is the youngest hydro power station in Sweden. It has been designed and built with significant efforts to account for and protect environmental values. Installed capacity is 28 MW. The environmental impact assessment from the construction of this plant is carried out, but the evaluation is still not finalized. The preliminary aggregation aimed to test whether ExternE results could be used to make estimates for the entire Swedish electricity production system. Hence, national results as well as results from other partner countries in ExternE has been applied

28 CFR 0.117 - Office of Chief Immigration Judge.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Office of Chief Immigration Judge. 0.117... Executive Office for Immigration Review § 0.117 Office of Chief Immigration Judge. The Chief Immigration Judge shall provide general supervision to the Immigration Judges in performance of their duties in...

42 CFR 84.117 - Gas mask containers; minimum requirements.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Gas mask containers; minimum requirements. 84.117... SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Gas Masks § 84.117 Gas mask containers; minimum requirements. (a) Gas masks shall be equipped with a substantial...

Retrospective dose assessment for the population living in areas of local fallout from the Semipalatinsk nuclear test site. Part 1: external exposure

International Nuclear Information System (INIS)

Gordeev, Konstantin; Shinkarev, Sergey; Ilyin, Leonid; Bouville, Andre; Luckyanov, Nickolas; Simon, Steven L.; Hoshi, Masaharu

2006-01-01

A short analysis of all 111 atmospheric events conducted at the Semipalatinsk Test Site (STS) in 1949-1962 with regard to significant off-site exposure (more than 5 mSv of the effective dose during the first year after the explosion) has been made. The analytical method used to assess external exposure to the residents living in settlements near the STS is described. This method makes used of the archival data on the radiological conditions, including the measurements of exposure rate. Special attention was given to the residents of Dolon and Kanonerka villages exposed mainly as a result of the first test, detonated on August 29, 1949. For the residents of those settlements born in 1935, the dose estimates calculated according to the analytical method, are compared to those derived from the thermoluminescence measurements in bricks and electron paramagnetic resonance measurements in teeth. The methods described in this paper were used for external dose assessment for the cohort members at an initial stage of an ongoing epidemiological study conducted by the U.S. National Cancer Institute in the Republic of Kazakhstan. Recently revised methods and estimates of external exposure for that cohort are given in another paper (Simon et al.) in this conference. (author)

External cues challenging the internal appetite control system-Overview and practical implications.

Science.gov (United States)

Bilman, Els; van Kleef, Ellen; van Trijp, Hans

2017-09-02

Inadequate regulation of food intake plays an important role in the development of overweight and obesity, and is under the influence of both the internal appetite control system and external environmental cues. Especially in environments where food is overly available, external cues seem to override and/or undermine internal signals, which put severe challenges on the accurate regulation of food intake. By structuring these external cues around five different phases in the food consumption process this paper aims to provide an overview of the wide range of external cues that potentially facilitate or hamper internal signals and with that influence food intake. For each of the five phases of the food consumption process, meal initiation, meal planning, consumption phase, end of eating episode and time till next meal, the most relevant internal signals are discussed and it is explained how specific external cues exert their influence.

Inverse kinetics for subcritical systems with external neutron source

International Nuclear Information System (INIS)

Carvalho Gonçalves, Wemerson de; Martinez, Aquilino Senra; Carvalho da Silva, Fernando

2017-01-01

Highlights: • It was developed formalism for reactivity calculation. • The importance function is related to the system subcriticality. • The importance function is also related with the value of the external source. • The equations were analyzed for seven different levels of sub criticality. • The results are physically consistent with others formalism discussed in the paper. - Abstract: Nuclear reactor reactivity is one of the most important properties since it is directly related to the reactor control during the power operation. This reactivity is influenced by the neutron behavior in the reactor core. The time-dependent neutrons behavior in response to any change in material composition is important for the reactor operation safety. Transient changes may occur during the reactor startup or shutdown and due to accidental disturbances of the reactor operation. Therefore, it is very important to predict the time-dependent neutron behavior population induced by changes in neutron multiplication. Reactivity determination in subcritical systems driven by an external neutron source can be obtained through the solution of the inverse kinetics equation for subcritical nuclear reactors. The main purpose of this paper is to find the solution of the inverse kinetics equation the main purpose of this paper is to device the inverse kinetics equations for subcritical systems based in a previous paper published by the authors (Gonçalves et al., 2015) and by (Gandini and Salvatores, 2002; Dulla et al., 2006). The solutions of those equations were also obtained. Formulations presented in this paper were tested for seven different values of k eff with external neutrons source constant in time and for a powers ratio varying exponentially over time.

CD117 expression in operable oesophageal squamous cell carcinomas predicts worse clinical outcome

Science.gov (United States)

Fan, Huijie; Yuan, Yuan; Wang, Junsheng; Zhou, Fuyou; Zhang, Mingzhi; Giercksky, Karl-Erik; Nesland, Jahn M; Suo, Zhenhe

2013-01-01

Aims To investigate the aberrant expression of CD117 in oesophageal squamous cell carcinoma (SCC) and its prognostic significance. Methods and results Immunohistochemical staining for CD117 was performed on tissue microarray and routine tissue sections from 157 oesophageal SCC patients and 10 normal oesophageal epithelia adjacent to tumour. The positive rate of CD117 expression was 29.9% in oesophageal SCC tissues, whereas no CD117 expression was detected in the 10 normal oesophageal epithelia. CD117 expression was significantly associated with T stage (P < 0.001), distant metastasis (P = 0.015), lymph node metastasis (P = 0.019), and clinical stage (P = 0.021). Progression-free survival in the patients with CD117-positive tumours was shorter than that in the patients with CD117-negative tumours (P = 0.010). In univariate analyses, CD117 expression was the most significant factor for overall survival of oesophageal SCC patients (P < 0.001), followed by lymph node metastasis (P = 0.001), T stage (P = 0.002), clinical stage (P = 0.006), distant metastasis (P = 0.020), and histological grade (P = 0.027). Multivariate analyses verified that CD117 expression was an independent prognostic marker for oesophageal SCC patients (P = 0.002). In addition, CD117 expression predicted poorer survival in patients without distant metastases. Conclusions CD117 expression in operable oesophageal SCC may be a valuable prognostic marker, and detection of its expression in clinical samples may be useful in defining a subclass of oesophageal SCCs with extremely poor clinical outcome, which may require a specially targeted treatment modality. PMID:23570416

Applicability of a desiccant dew-point cooling system independent of external water sources

DEFF Research Database (Denmark)

Bellemo, Lorenzo; Elmegaard, Brian; Kærn, Martin Ryhl

2015-01-01

The applicability of a technical solution for making desiccant cooling systems independent of external water sources is investigated. Water is produced by condensing the desorbed water vapour in a closed regeneration circuit. Desorbed water recovery is applied to a desiccant dew-point cooling...... system, which includes a desiccant wheel and a dew point cooler. The system is simulated during the summer period in the Mediterranean climate of Rome and it results completely independent of external water sources. The seasonal thermal COP drops 8% in comparison to the open regeneration circuit solution...

External Periodic Force Control of a Single-Degree-of-Freedom Vibroimpact System

Directory of Open Access Journals (Sweden)

Jingyue Wang

2013-01-01

Full Text Available A single-degree-of-freedom mechanical model of vibro-impact system is established. Bifurcation and chaos in the system are revealed with the time history diagram, phase trajectory map, and Poincaré map. According to the bifurcation and chaos of the actual vibro-impact system, the paper puts forward external periodic force control strategy. The method of controlling chaos by external periodic force feedback controller is developed to guide chaotic motions towards regular motions. The stability of the control system is also analyzed especially by theory. By selecting appropriate feedback coefficients, the unstable periodic orbits of the original chaotic orbit can be stabilized to the stable periodic orbits. The effectiveness of this control method is verified by numerical simulation.

STS-84 Insignia

Science.gov (United States)

1996-01-01

The STS-84 emblem depicts the Space Shuttle Atlantis launching into Earth orbit to join the Russian Space Station Mir as part of Phase One of the International Space Station program. The names of the eight astronauts who flew onboard Atlantis, including the two who changed their positions onboard Mir for a long duration flight, are shown along the border of the patch. The STS-84/Mir-23 team will transfer 7,000 pounds of experiments, Station hardware, food and clothing to and from Mir during the five-day period of docking. The Phase One program is represented by the rising Sun and by the Greek letter Phi followed by one star. This sixth Shuttle-Mir docking mission is symbolized by the six stars surrounding the word Mir in Cyrillic characters. Combined, the seven stars symbolize the current configuration of Mir, composed of six modules launched by the Russians and one module brought up by Atlantis on a previous docking flight.

33 CFR 117.181 - Oakland Inner Harbor Tidal Canal.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oakland Inner Harbor Tidal Canal. 117.181 Section 117.181 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Tidal Canal. The draws of the Alameda County highway drawbridges at Park Street, mile 5.2; Fruitvale...

7 CFR 800.117 - Who shall perform original services.

Science.gov (United States)

2010-01-01

... 7 Agriculture 7 2010-01-01 2010-01-01 false Who shall perform original services. 800.117 Section... REGULATIONS Original Services § 800.117 Who shall perform original services. (a) General. Original services... official agency is not available on a regular basis to provide original services, and no official agency...

HSPC117 deficiency in cloned embryos causes placental abnormality and fetal death

International Nuclear Information System (INIS)

Wang, Yingying; Hai, Tang; Liu, Zichuan; Zhou, Shuya; Lv, Zhuo; Ding, Chenhui; Liu, Lei; Niu, Yuyu; Zhao, Xiaoyang; Tong, Man; Wang, Liu; Jouneau, Alice; Zhang, Xun; Ji, Weizhi; Zhou, Qi

2010-01-01

Somatic cell nuclear transfer (SCNT) has been successfully used in many species to produce live cloned offspring, albeit with low efficiency. The low frequency of successful development has usually been ascribed to incomplete or inappropriate reprogramming of the transferred nuclear genome. Elucidating the genetic differences between normal fertilized and cloned embryos is key to understand the low efficiency of SCNT. Here, we show that expression of HSPC117, which encodes a hypothetical protein of unknown function, was absent or very low in cloned mouse blastocysts. To investigate the role of HSPC117 in embryo development, we knocked-down this gene in normal fertilized embryos using RNA interference. We assessed the post-implantation survival of HSPC117 knock-down embryos at 3 stages: E9 (prior to placenta formation); E12 (after the placenta was fully functional) and E19 (post-natal). Our results show that, although siRNA-treated in vivo fertilized/produced (IVP) embryos could develop to the blastocyst stage and implanted without any difference from control embryos, the knock-down embryos showed substantial fetal death, accompanied by placental blood clotting, at E12. Furthermore, comparison of HSPC117 expression in placentas of nuclear transfer (NT), intracytoplasmic sperm injection (ICSI) and IVP embryos confirmed that HSPC117 deficiency correlates well with failures in embryo development: all NT embryos with a fetus, as well as IVP and ICSI embryos, had normal placental HSPC117 expression while those NT embryos showing reduced or no expression of HSPC117 failed to form a fetus. In conclusion, we show that HSPC117 is an important gene for post-implantation development of embryos, and that HSPC117 deficiency leads to fetal abnormalities after implantation, especially following placental formation. We suggest that defects in HSPC117 expression may be an important contributing factor to loss of cloned NT embryos in vivo.

32 CFR 536.117 - Statutory authority for maritime claims.

Science.gov (United States)

2010-07-01

... 32 National Defense 3 2010-07-01 2010-07-01 true Statutory authority for maritime claims. 536.117... ACCOUNTS CLAIMS AGAINST THE UNITED STATES Maritime Claims § 536.117 Statutory authority for maritime claims. The Army Maritime Claims Settlement Act (AMCSA) (10 U.S.C. 4801-04, 4806, as amended) authorizes the...

25 CFR 117.23 - Transactions between guardian and ward.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Transactions between guardian and ward. 117.23 Section... COMPETENCY § 117.23 Transactions between guardian and ward. Business dealings between the guardian and his ward involving the sale or purchase of any property, real or personal, by the guardian to or from the...

STS 63: Post flight presentation

Science.gov (United States)

1995-02-01

At a post flight conference, Captain Jim Wetherbee, of STS Flight 63, introduces each of the other members of the STS 63 crew (Eileen Collins, Pilot; Dr. Bernard Harris, Payload Commander; Dr. Michael Foale, Mission Specialist from England; Dr. Janice Voss, Mission Specialist; and Colonel Vladimir Titor, Mission Specialist from Russia), gave a short autobiography of each member and a brief description of their assignment during this mission. A film was shown that included the preflight suit-up, a view of the launch site, the actual night launch, a tour of the Space Shuttle and several of the experiment areas, several views of earth and the MIR Space Station and cosmonauts, the MlR-Space Shuttle rendezvous, the deployment of the Spartan Ultraviolet Telescope, Foale and Harris's EVA and space walk, the retrieval of Spartan, and the night entry home, including the landing. Several spaceborne experiments were introduced: the radiation monitoring experiment, environment monitoring experiment, solid surface combustion experiment, and protein crystal growth and plant growth experiments. This conference ended with still, color pictures, taken by the astronauts during the entire STS 63 flight, being shown.

External radiation exposure control system in accelerator facilities

International Nuclear Information System (INIS)

Ogawa, Tatsuhiko; Iimoto, Takeshi; Kosako, Toshiso

2011-01-01

The external exposure control systems in KEK and CERN are discussed to find out good practices and unreasonableness of radiation control in accelerator facilities, which plays an important role in optimizing national and/or site specific radiological regulations, referring to relevant ICRP publications. Personal dose limits and radiation area classifications were analyzed and their reasonableness were explored. Good example of supervised areas, area classification based on realistic assumptions on working time etc are found. On the other hand, unreasonable systems, that are often attributed to the national regulation or ideas presented in the old publications are also found. (author)

Desiccant Dewpoint Cooling System Independent of External Water Sources

DEFF Research Database (Denmark)

Bellemo, Lorenzo; Elmegaard, Brian; Markussen, Wiebke B.

2015-01-01

the air that regenerates the desiccant dehumidifier, and using it for running the evaporative coolers in the system. A closed regeneration circuit is used for maximizing the amount of condensed water. This solution is applied to a system with a desiccant wheel dehumidifier and a dew point cooler, termed...... desiccant dew-point cooling system, for demonstrating its function and applicability. Simulations are carried out for varying outdoor conditions under constant supply conditions. The results show that the system is independent of external water supply for the majority of simulated conditions. In comparison...... to the desiccant dew-point system without water recovery, the required regeneration temperature increases and the system thermal efficiency decreases....

STS-Astro: Astronomy in the focus of Science, Technology and Society and Case Study in Education Distance

Science.gov (United States)

Ferreira, O. R.

2014-02-01

The dissertation addresses the focus of Astronomy in Science, Technology and Society [STS}, which the author calls the STS-Astro. Observes the International Year of the Astronomy 2009 [IYA 2009] as one of the greatest experiences STS worldwide, causing unprecedented integration between science, technology and humanities, with positive impacts in many sectors of society and are still worthy of study, specially in Brazil due to the implementation of the International Year of Astronomy, Brazil 2009 [IYABrazil-2009}. Astronomy is also investigated in the area of Education, based mainly on theoretical aspects of educational socio-interacionist of Lev Semenovich Vygotsky (Vygotsky, 1991, 2008 and 2012, p. 103-117) and socio-historical cultural of Paulo Reglus Neves Freire (1979, 1982 and 1996), but when necessary and still keeping the field of constructivism, properly taking advantage of the interactionism and transdisciplinarity of Jean William Fritz Piaget (1983). Concerning Distance Education [DE], it is noted significant growth at the graduate and postgraduate courses. New challenges arise, with the establishment of an increasingly accustomed to Information and Communication Technologies [ICT] and the teaching methodologies to be used and developed, with Astronomy becoming an important instrument in the teaching-learning process associated technologies. Using the methodology of action research, we proceeded with a case study involving 26 students of the discipline of Astronomy Topics applied to Education, between November 1 and December 17, 2012, of the postgraduation courses in Distance Education at the Universidade Cruzeiro do Sul [Southern Cross University]. The results obtained permit statistical surveys therefore quantitative, but also qualitative information about the teaching-learning Astronomy by DE. Analyses of performance and progress of each student and set permit a finding interaction among those involved in the mediation of the teacher-tutor who, in turn

STS-95 Mission Specialist Pedro Duque suits up for launch

Science.gov (United States)

1998-01-01

STS-95 Mission Specialist Pedro Duque of Spain, with the European Space Agency, is helped with his flight suit by suit tech Tommy McDonald in the Operations and Checkout Building. The final fitting takes place prior to the crew walkout and transport to Launch Pad 39B. Targeted for launch at 2 p.m. EST on Oct. 29, the mission is expected to last 8 days, 21 hours and 49 minutes, and return to KSC at 11:49 a.m. EST on Nov. 7. The STS-95 mission includes research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process.

ExternE National Implementation Finland

Energy Technology Data Exchange (ETDEWEB)

Pingoud, K; Maelkki, H; Wihersaari, M; Pirilae, P [VTT Energy, Espoo (Finland); Hongisto, M [Imatran Voima Oy, Vantaa (Finland); Siitonen, S [Ekono Energy Ltd, Espoo (Finland); Johansson, M [Finnish Environment Institute, Helsinki (Finland)

1999-07-01

ExternE National Implementation is a continuation of the ExternE Project, funded in part by the European Commission's Joule III Programme. This study is the result of the ExternE National Implementation Project for Finland. Three fuel cycles were selected for the Finnish study: coal, peat and wood-derived biomass, which together are responsible for about 40% of total electricity generation in Finland and about 75% of the non-nuclear fuel based generation. The estimated external costs or damages were dominated by the global warming (GW) impacts in the coal and peat fuel cycles, but knowledge of the true GW impacts is still uncertain. From among other impacts that were valued in monetary terms the human health damages due to airborne emissions dominated in all the three fuel cycles. Monetary valuation for ecosystem impacts is not possible using the ExternE methodology at present. The Meri-Pori power station representing the coal fuel cycle is one of the world's cleanest and most efficient coal-fired power plants with a condensing turbine. The coal is imported mainly from Poland. The estimated health damages were about 4 mECU/kWh, crop damages an order of magnitude lower and damages caused to building materials two orders of magnitude lower. The power stations of the peat and biomass fuel cycles are of CHP type, generating electricity and heat for the district heating systems of two cities. Their fuels are of domestic origin. The estimated health damages allocated to electricity generation were about 5 and 6 mECU/kWh, respectively. The estimates were case-specific and thus an generalisation of the results to the whole electricity generation in Finland is unrealistic. Despite the uncertainties and limitations of the methodology, it is a promising tool in the comparison of similar kinds of fuel cycles, new power plants and pollution abatement technologies and different plant locations with each other. (orig.)

ExternE National Implementation Finland

Energy Technology Data Exchange (ETDEWEB)

Pingoud, K.; Maelkki, H.; Wihersaari, M.; Pirilae, P. [VTT Energy, Espoo (Finland); Hongisto, M. [Imatran Voima Oy, Vantaa (Finland); Siitonen, S. [Ekono Energy Ltd, Espoo (Finland); Johansson, M. [Finnish Environment Institute, Helsinki (Finland)

1999-07-01

ExternE National Implementation is a continuation of the ExternE Project, funded in part by the European Commission's Joule III Programme. This study is the result of the ExternE National Implementation Project for Finland. Three fuel cycles were selected for the Finnish study: coal, peat and wood-derived biomass, which together are responsible for about 40% of total electricity generation in Finland and about 75% of the non-nuclear fuel based generation. The estimated external costs or damages were dominated by the global warming (GW) impacts in the coal and peat fuel cycles, but knowledge of the true GW impacts is still uncertain. From among other impacts that were valued in monetary terms the human health damages due to airborne emissions dominated in all the three fuel cycles. Monetary valuation for ecosystem impacts is not possible using the ExternE methodology at present. The Meri-Pori power station representing the coal fuel cycle is one of the world's cleanest and most efficient coal-fired power plants with a condensing turbine. The coal is imported mainly from Poland. The estimated health damages were about 4 mECU/kWh, crop damages an order of magnitude lower and damages caused to building materials two orders of magnitude lower. The power stations of the peat and biomass fuel cycles are of CHP type, generating electricity and heat for the district heating systems of two cities. Their fuels are of domestic origin. The estimated health damages allocated to electricity generation were about 5 and 6 mECU/kWh, respectively. The estimates were case-specific and thus an generalisation of the results to the whole electricity generation in Finland is unrealistic. Despite the uncertainties and limitations of the methodology, it is a promising tool in the comparison of similar kinds of fuel cycles, new power plants and pollution abatement technologies and different plant locations with each other. (orig.)

ExternE National Implementation Finland

International Nuclear Information System (INIS)

Pingoud, K.; Maelkki, H.; Wihersaari, M.; Pirilae, P.; Hongisto, M.; Siitonen, S.; Johansson, M.

1999-01-01

ExternE National Implementation is a continuation of the ExternE Project, funded in part by the European Commission's Joule III Programme. This study is the result of the ExternE National Implementation Project for Finland. Three fuel cycles were selected for the Finnish study: coal, peat and wood-derived biomass, which together are responsible for about 40% of total electricity generation in Finland and about 75% of the non-nuclear fuel based generation. The estimated external costs or damages were dominated by the global warming (GW) impacts in the coal and peat fuel cycles, but knowledge of the true GW impacts is still uncertain. From among other impacts that were valued in monetary terms the human health damages due to airborne emissions dominated in all the three fuel cycles. Monetary valuation for ecosystem impacts is not possible using the ExternE methodology at present. The Meri-Pori power station representing the coal fuel cycle is one of the world's cleanest and most efficient coal-fired power plants with a condensing turbine. The coal is imported mainly from Poland. The estimated health damages were about 4 mECU/kWh, crop damages an order of magnitude lower and damages caused to building materials two orders of magnitude lower. The power stations of the peat and biomass fuel cycles are of CHP type, generating electricity and heat for the district heating systems of two cities. Their fuels are of domestic origin. The estimated health damages allocated to electricity generation were about 5 and 6 mECU/kWh, respectively. The estimates were case-specific and thus an generalisation of the results to the whole electricity generation in Finland is unrealistic. Despite the uncertainties and limitations of the methodology, it is a promising tool in the comparison of similar kinds of fuel cycles, new power plants and pollution abatement technologies and different plant locations with each other. (orig.)

Possible Deformed States in 115In and 117ln

International Nuclear Information System (INIS)

Baecklin, A.; Fogelberg, B.; Malmskog, S.G.

1967-01-01

Levels and transitions in 115 In and 117 In have been studied from the beta decay of 2.3-day 115g Cd and 2.5-h 117g Cd. Using a Ge(Li) detector and a double focussing beta spectrometer energies, intensities, conversion coefficients and multipolarities were obtained for the following transitions (energies in keV and multipolarities are given): 115 In: 35.63 (97.0 % M1 + 3.0 % E2), 231.47 (E1), 260.80 (M1), 267, 336. 23 (M4 + 117 In: 71.0, 89.80 (E2 + 115 In and for 3 levels in 117 In. Energies, spins, parities and half lives are given for the following levels: In: 597.03, 3/2 - ; 828.39, 3/2 + , 5.4 ns; 863.95, l/2 + or 3/2 + , 1.1 ns. 117 In: 588.59, 3/2 - ; 0.20 ns; 659.56, 3/2 + , 58.7 ns; 749.37, 1/2 + or 3/2 + , 4.3 ns. Reduced transition probabilities are given for several transitions in both nuclei. The E2 transition rates between the two excited positive parity states in both nuclei were found to be about 100 s. p. u. indicating a possible deformation of these states. The energy spacing and transition rates between these states can be well accounted for within the Nilsson model assuming the states to form a K = 1/2 + rotational band. A deformation δ of about 0.20 is obtained for both nuclei

29 CFR 570.117 - General.

Science.gov (United States)

2010-07-01

... to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS CHILD LABOR REGULATIONS, ORDERS AND STATEMENTS OF INTERPRETATION General Statements of Interpretation of the Child Labor Provisions of the Fair Labor Standards Act of 1938, as Amended Oppressive Child Labor § 570.117 General. (a...

7 CFR 28.117 - Fee for new memorandum or certificate.

Science.gov (United States)

2010-01-01

... 28.117 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD... Standards Act Fees and Costs § 28.117 Fee for new memorandum or certificate. For each new memorandum or...

STS-91 Launch of Discovery from Launch Pad 39-A

Science.gov (United States)

1998-01-01

Searing the early evening sky with its near sun-like rocket exhaust, the Space Shuttle Discovery lifts off from Launch Pad 39A at 6:06:24 p.m. EDT June 2 on its way to the Mir space station. On board Discovery are Mission Commander Charles J. Precourt; Pilot Dominic L. Gorie; and Mission Specialists Wendy B. Lawrence, Franklin R. Chang-Diaz, Janet Lynn Kavandi and Valery Victorovitch Ryumin. The nearly 10-day mission will feature the ninth and final Shuttle docking with the Russian space station Mir, the first Mir docking for the Space Shuttle orbiter Discovery, the first on-orbit test of the Alpha Magnetic Spectrometer (AMS), and the first flight of the new Space Shuttle super lightweight external tank. Astronaut Andrew S. W. Thomas will be returning to Earth as a STS-91 crew member after living more than four months aboard Mir.

A proposed approach for the derivation of a system transfer function by the use of an external network

Energy Technology Data Exchange (ETDEWEB)

Guppy, C B [Control and Instrumentation Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)

1961-10-15

This report outlines a method which might have some application for Transfer Function analysis of a given system. It consists of using the system itself in a general external feed-back, feed-forward circuit. The coefficients of the external circuit are set up one at a time to produce recognisable steady states at the output terminals of the external circuit. In effect step by step neutralisation of the system under test is achieved in the external circuit by setting up the inverse transfer function. (author)

A proposed approach for the derivation of a system transfer function by the use of an external network

International Nuclear Information System (INIS)

Guppy, C.B.

1961-10-01

This report outlines a method which might have some application for Transfer Function analysis of a given system. It consists of using the system itself in a general external feed-back, feed-forward circuit. The coefficients of the external circuit are set up one at a time to produce recognisable steady states at the output terminals of the external circuit. In effect step by step neutralisation of the system under test is achieved in the external circuit by setting up the inverse transfer function. (author)

STS-100 MS Parazynski looks over Destiny in SSPF

Science.gov (United States)

2000-01-01

In the Space Station Processing Facility, STS-100 Mission Specialist Scott Parazynski looks over part of the U.S. Lab, Destiny. Mission STS-100 will be the ninth construction flight for the International Space Station. It is scheduled to launch April 19, 2001.

sY116, a human Y-linked polymorphic STS

Indian Academy of Sciences (India)

linked STS, showed different electrophoretic mobilities in three males, two infertile and one fertile. A study of this STS among 35 other normal males showed that this locus is polymorphic. sY116 has a poly A-rich stretch whose instability ...

Triaxiality in the odd-A nuclei 109−117I studied through a microscopic rotationparticle coupling

Directory of Open Access Journals (Sweden)

Modi Swati

2018-01-01

Full Text Available A systematic study of ground state spectrum with the triaxial deformation γ for odd-A Iodine isotopes 109−117I is carried out with the nonadiabatic quasiparticle approach. The rotation-particle coupling is accomplished microscopically such that the matrix elements of a particle-plus-rotor system are written in terms of the rotor energies. The 5/2+ state is confirmed as ground state for odd-A 111−117I and also coming out as lowest in energy for 109I.

STS-93 Commander Eileen Collins waves to her family

Science.gov (United States)

1999-01-01

STS-93 Commander Eileen M. Collins waves to her family nearby, a last meeting before launch of mission STS-93 on July 20. Liftoff is scheduled for 12:36 a.m. EDT. The primary mission of STS-93 is the release of the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected to unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Steven A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

37 CFR 1.17 - Patent application and reexamination processing fees.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application and reexamination processing fees. 1.17 Section 1.17 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions Fees...

View of the starboard OMS pod of the STS-6 Challenger

Science.gov (United States)

1983-01-01

This view centers on the starboard orbital maneuvering system (OMS) pod of the shuttle Challenger during its STS-6 mission. Two pieces of thermal protection system tile appear to have loosened. The view also shows one of the cargo bay television cameras, part of the extravehicular activity (EVA) slide wire system, three handrails and other features on the aft bulkhead. Part of the airborne support equipment (ASE) is in the lower right foreground.

Diagnostic value of CD117 in differential diagnosis of acute leukemias.

Science.gov (United States)

Ahmadi, Abbas; Poorfathollah, Ali-Akbar; Aghaiipour, Mahnaz; Rezaei, Mansour; Nikoo-ghoftar, Mahin; Abdi, Mohammad; Gharib, Alireza; Amini, Amir

2014-07-01

C-kit receptor (CD117) and its ligand, stem cell factor, play a key role in normal hematopoiesis. It has been demonstrated that its expression extremely increases in leukemias with myeloid commitment. We analyzed findings on CD117 expression together with other myeloid related markers in 203 de novo acute leukemias, referred to Iranian immunophenotyping centers: Iranian Blood Transfusion Organization (IBTO) and Baghiatallah Hospital (BH). All cases were characterized based on the French American British cooperative group (FAB) and European Group for Immunological Classification of Leukemias (EGIL). The cases comprised of 111 acute myeloblastic leukemia (AML), 86 acute lymphoblastic leukemia (ALL), and 6 acute undifferentiated leukemia (AUL). CD117 was positive in 75 % of AML and 50 % of AUL, whereas none of the ALL cases was positive for this marker. Although CD117 was positive in 100 % of M5a cases, no M5b positive was found (p = 0.036). The calculated specificity for myeloid involvement was 100 % for CD117 and CD33, and 98 % for CD13 and CD15 (p acute leukemias.

External field-induced chaos in classical and quantum Hamiltonian systems

International Nuclear Information System (INIS)

Lin, W.C.

1986-01-01

Classical nonlinear nonintegrable systems exhibit dense sets of resonance zones in phase space. Global chaotic motion appears when neighboring resonance zones overlap. The chaotic motion signifies the destruction of a quasi constant of motion. The motion of a particle, trapped in one of the wells of a sinusoidal, potential driven by a monochromatic external field was studied. Global chaotic behavior sets in when the amplitude of the external field reaches a critical value. The particle then escapes the well. The critical values are found to be in good agreement with a resonance overlap criterion rather than a renormalization-group scheme. A similar system was then studied, but with the particle being confined in an infinite square well potential instead. A stochastic layer is found in the low-energy part of the phase space. The resonance zone structure is found to be in excellent agreement with predictions. The critical values for the onset of global chaotic behavior are found to be in excellent agreement with the renormalization group scheme. The quantum version of the second model above was then considered. In a similar fashion, the external field induces quantum resonance zones. The spectral statistics were computed, and a transition of statistics from Poissonian to Wigner-like was found as overlap of quantum resonances occurs. This also signifies the destruction of a quasi-constant of motion

STS-72 Flight Day 2

Science.gov (United States)

1996-01-01

On this second day of the STS-72 mission, the flight crew, Cmdr. Brian Duffy, Pilot Brent W. Jett, and Mission Specialists Leroy Chiao, Daniel T. Barry, Winston E. Scott, and Koichi Wakata (NASDA), awakened to music from the motion picture 'Star Wars.' The crew performed a systems checkout, prepared for the retrieval of the Japanese Space Flyer Unit (SFU), tested the spacesuits for the EVA, and activated some of the secondary experiments. An in-orbit news interview was conducted with the crew via satellite downlinking. Questions asked ranged from the logistics of the mission to the avoidance procedures the Endeavour Orbiter performed to miss hitting the inactive Air Force satellite, nicknamed 'Misty' (MSTI). Earth views included cloud cover, several storm systems, and various land masses with several views of the shuttle's open cargo bay in the foreground.

Quality electricity lines of external power systems electric traction DC

Directory of Open Access Journals (Sweden)

A.V. Petrov

2012-08-01

Full Text Available The results of studies that compare and analyze the numerical values of some key indicators quality electricity in the lines of the external power supply system the electric traction DC. As a supplement are additional and fundamental values of energy losses in them.

STS-87 Mission Specialist Winston E. Scott suits up

Science.gov (United States)

1997-01-01

STS-87 Mission Specialist Winston Scott dons his launch and entry suit with the assistance of a suit technician in the Operations and Checkout Building. This is Scotts second space flight. He and the five other crew members will depart shortly for Launch Pad 39B, where the Space Shuttle Columbia awaits liftoff on a 16-day mission to perform microgravity and solar research. Scott is scheduled to perform an extravehicular activity spacewalk with Mission Specialist Takao Doi, Ph.D., of the National Space Development Agency of Japan, during STS-87. He also performed a spacewalk on STS-72.

Communicative Signals Promote Object Recognition Memory and Modulate the Right Posterior STS.

Science.gov (United States)

Redcay, Elizabeth; Ludlum, Ruth S; Velnoskey, Kayla R; Kanwal, Simren

2016-01-01

Detection of communicative signals is thought to facilitate knowledge acquisition early in life, but less is known about the role these signals play in adult learning or about the brain systems supporting sensitivity to communicative intent. The current study examined how ostensive gaze cues and communicative actions affect adult recognition memory and modulate neural activity as measured by fMRI. For both the behavioral and fMRI experiments, participants viewed a series of videos of an actress acting on one of two objects in front of her. Communicative context in the videos was manipulated in a 2 × 2 design in which the actress either had direct gaze (Gaze) or wore a visor (NoGaze) and either pointed at (Point) or reached for (Reach) one of the objects (target) in front of her. Participants then completed a recognition memory task with old (target and nontarget) objects and novel objects. Recognition memory for target objects in the Gaze conditions was greater than NoGaze, but no effects of gesture type were seen. Similarly, the fMRI video-viewing task revealed a significant effect of Gaze within right posterior STS (pSTS), but no significant effects of Gesture. Furthermore, pSTS sensitivity to Gaze conditions was related to greater memory for objects viewed in Gaze, as compared with NoGaze, conditions. Taken together, these results demonstrate that the ostensive, communicative signal of direct gaze preceding an object-directed action enhances recognition memory for attended items and modulates the pSTS response to object-directed actions. Thus, establishment of a communicative context through ostensive signals remains an important component of learning and memory into adulthood, and the pSTS may play a role in facilitating this type of social learning.

Dosimetry quality assurance in Martin Marietta Energy Systems' centralized external dosimetry system

International Nuclear Information System (INIS)

Souleyrette, M.L.

1992-01-01

External dosimetry needs at the four Martin Marietta Energy Systems facilities are served by Energy Systems Centralized External Dosimetry System (CEDS). The CEDS is a four plant program with four dosimeter distribution centers and two dosimeter processing centers. Each plant has its own distribution center, while processing centers are located at ORNL and the Y-12 Plant. The program has been granted accreditation by the Department of Energy Laboratory Accreditation Program (DOELAP). The CEDS is a TLD based system which is responsible for whole-body beta-gamma, neutron, and extremity monitoring. Beta-gamma monitoring is performed using the Harshaw/Solon Technologies model 8805 dosimeter. Effective October 1, 1992 the standard silver mylar has been replaced with an Avery mylar foil blackened on the underside with ink. This was done in an effort to reduce the number of light induced suspect readings. At this time we have little operational experience with the new blackened mylars-The CEDS neutron dosimeter is the Harshaw model 8806B. This card/holder configuration contains two TLD-600/TLD-700 chip pairs; one pair is located beneath a cadmium filter and one pair is located beneath a plastic filter. In routine personnel monitoring the CEDS neutron dosimeter is always paired with a CEDS beta-gamma dosimeter.The CEDS extremity dosimeter is composed of a Harshaw thin TLD-700 dosiclip placed inside a Teledyne RB-4 finger sachet. The finger sachet provides approximately 7 mg/cm 2 filtration over the chip. A teflon ring surrounds the dosiclip to help prevent tearing of the vinyl sachet

33 CFR 117.458 - Inner Harbor Navigation Canal, New Orleans.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Inner Harbor Navigation Canal, New Orleans. 117.458 Section 117.458 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Harbor Navigation Canal, New Orleans. (a) The draws of the SR 46 (St. Claude Avenue) bridge, mile 0.5...

29 CFR 794.117 - Effect of franchises and other arrangements.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Effect of franchises and other arrangements. 794.117... âindependently Owned and Controlled Local Enterpriseâ § 794.117 Effect of franchises and other arrangements. Whether a franchise or other contractual arrangement affects the status of the enterprise as “an...

Teacher beliefs about teaching science through Science-Technology-Society (STS)

Science.gov (United States)

Massenzio, Lynn

2001-07-01

Statement of the problem. As future citizens, students will have the enormous responsibility of making decisions that will require an understanding of the interaction of science and technology and its interface with society. Since many societal issues today are grounded in science and technology, learning science in its social context is vital to science education reform. Science-Technology-Society (STS) has been strongly identified with meeting this goal, but despite its benefits, putting theory into practice has been difficult. Research design and methodology. The purpose of this study was to explore teacher beliefs about teaching science through STS. The following broad research questions guided the study: (1) What are the participants' initial beliefs about teaching science through STS? (2) What beliefs emerge as participants reflect upon and share their STS instructional experiences with their peers? A social constructivist theoretical framework was developed to plan interactions and collect data. Within this framework, a qualitative methodology was used to interpret the data and answer the research questions. Three provisionally certified science teachers engaged in a series of qualitative tasks including a written essay, verbal STS unit explanation, reflective journal writings, and focus group interviews. After implementing their STS unit, the participants engaged in meaningful dialogue with their peers as they reflected upon, shared, and constructed their beliefs. Conclusions. The participants strongly believed in STS as a means for achieving scientific and technological literacy, developing cognition, enhancing scientific habits of mind and affective qualities, and fostering citizen responsibility. Four major assertions were drawn: (a) Participants' initial belief in teaching for citizen responsibility did not fully align with practice, (b) Educators at the administrative level should be made aware of the benefits of teaching science through STS, (c

Explorations of Tenth-Grade STS[E] Curricula across Three Provincial Political Landscapes

Science.gov (United States)

Phillips, Christina Ann

This thesis focuses on explorations of science, technology, society and the environment (i.e., STS[E]) outcomes/expectations in tenth-grade level science curricula across three Canadian provinces (i.e., Alberta, Manitoba & Ontario) with distinctive provincial political environments at the time of curriculum construction and/or implementation. Document analysis, discourse analysis and a range of theoretical frameworks (i.e., Levinson, 2010; Pedretti & Nazir, 2011 & Krathwohl, 2002) were used to aid in explorations of STS[E] curriculum segments and discourses in each provincial region. More detailed analysis and thematic exploration is presented for each unit associated with climate change as some interesting patterns emerged following initial analysis. My findings are presented as three comparative case studies and represent a small and original contribution to the large body of scholarly research devoted to studies of STS[E] education, where each province represents a unique case that has been explored regarding some aspects the STS[E] curriculum outcomes/expectations and general political culture as well as some other theoretical factors. Findings from this study indicate that Alberta's STS[E] outcomes may be related to Levinson's (2010) 'deliberative' citizenship focus. The following currents from Pedretti and Nazir (2011) appear to be emphasized: logical reasoning, historical, application & design and socio-cultural aligned outcomes when STS[E] is considered as an entity separate from the Alberta curriculum combination of STS and Knowledge. Ontario's STS[E] expectations may align with Levinson's (2010) 'deliberative' or in some select cases a 'deliberative'/'praxis' framework category with some emphasis related to logical reasoning and socio-cultural awareness (Pedretti & Nazir, 2011) in their STS[E] curriculum. The Manitoba STS[E] outcomes may be aligned with a more 'deliberative' approach with some associations that could intersect with the framework

Life cycle assessment of waste management systems: Assessing technical externalities

DEFF Research Database (Denmark)

Brogaard, Line Kai-Sørensen

The life cycle assessment (LCA) of a waste management system relies on many internal characteristics such as pollution control systems and recovery efficiencies. It also relies on technical externalities supporting the waste management system in terms of capital goods and energy and material...... for the primary and secondary production of materials, 366 datasets were gathered. The materials in focus were: paper, newsprint, cardboard, corrugated board, glass, aluminium, steel and plastics (HDPE, LDPE, LLDPE, PET, PS, PVC). Only one quarter of these data concerned secondary production, thus underlining...

Internalising external costs of electricity and heat production in a municipal energy system

International Nuclear Information System (INIS)

Holmgren, Kristina; Amiri, Shahnaz

2007-01-01

Both energy supply and waste treatment give rise to negative effects on the environment, so-called external effects. In this study, monetary values on external costs collected from the EU's ExternE project are used to evaluate inclusion of these costs in comparison with an energy utility perspective including present policy instruments. The studied object is a municipal district heating system with a waste incineration plant as the base supplier of heat. The evaluation concerns fuels used for heat production and total electricity production, for scenarios with external costs included and for a scenario using the present policy instrument. Impacts of assumptions on marginal power producers (coal or natural gas power plants) are investigated, since locally produced electricity is assumed to replace marginal power and thus is credited for the avoided burden. Varying levels of external costs for carbon dioxide emissions are analysed. The method used is an economic optimisation model, MODEST. The conclusion is that present policy instruments are strong incentives for cogeneration, even when external costs are included. Waste is fully utilised in all scenarios. In cases where coal is the marginal power producer, more electricity is produced; when natural gas is the marginal power producer, less is produced. There are several uncertainties in the data for external costs, both methodological and ethical. In the ExternE data, not all environmental impacts are included. For waste incineration, ashes are not included, and another difficulty is how to treat the avoided burden of other waste treatment methods

BDD-based reliability evaluation of phased-mission systems with internal/external common-cause failures

International Nuclear Information System (INIS)

Xing, Liudong; Levitin, Gregory

2013-01-01

Phased-mission systems (PMS) are systems in which multiple non-overlapping phases of operations (or tasks) are accomplished in sequence for a successful mission. Examples of PMS abound in applications such as aerospace, nuclear power, and airborne weapon systems. Reliability analysis of a PMS must consider statistical dependence across different phases as well as dynamics in system configuration, failure criteria, and component behavior. This paper proposes a binary decision diagrams (BDD) based method for the reliability evaluation of non-repairable binary-state PMS with common-cause failures (CCF). CCF are simultaneous failure of multiple system elements, which can be caused by some external factors (e.g., lightning strikes, sudden changes in environment) or by propagated failures originating from some elements within the system. Both the external and internal CCF is considered in this paper. The proposed method is combinatorial, exact, and is applicable to PMS with arbitrary system structures and component failure distributions. An example with different CCF scenarios is analyzed to illustrate the application and advantages of the proposed method. -- Highlights: ► Non-repairable phased-mission systems with common-cause failures are analyzed. ► Common-cause failures caused by internal or external factors are considered. ► A combinatorial algorithm based on binary decision diagrams is suggested

A monograph of the National Space Transportation System Office (NSTSO) integration activities conducted at the NASA Lyndon B. Johnson Space Center for the EASE/ACCESS payload flown on STS 61-B

Science.gov (United States)

Chassay, Charles

1987-01-01

The integration process of activities conducted at the NASA Lyndon B. Johnson Space Center (JSC) for the Experimental Assembly of Structures in Extravehicular activity (EASE)/Assembly Concept for Construction of Erectable Space Structures (ACCESS) payload is provided as a subset to the standard payload integration process used by the NASA Space Transportation System (STS) to fly payloads on the Space Shuttle. The EASE/ACCESS payload integration activities are chronologically reviewed beginning with the initiation of the flight manifesting and integration process. The development and documentation of the EASE/ACCESS integration requirements are also discussed along with the implementation of the mission integration activities and the engineering assessments supporting the flight integration process. In addition, the STS management support organizations, the payload safety process leading to the STS 61-B flight certification, and the overall EASE/ACCESS integration schedule are presented.

14 CFR 65.117 - Military riggers or former military riggers: Special certification rule.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Military riggers or former military riggers: Special certification rule. 65.117 Section 65.117 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... Riggers § 65.117 Military riggers or former military riggers: Special certification rule. In place of the...

26 CFR 521.117 - Claims in cases of double taxation.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Claims in cases of double taxation. 521.117...) REGULATIONS UNDER TAX CONVENTIONS DENMARK General Income Tax Taxation of Nonresident Aliens Who Are Residents of Denmark and of Danish Corporations § 521.117 Claims in cases of double taxation. Under Article XX...

Symmetries, conservation laws, and time reversibility for Hamiltonian systems with external forces

NARCIS (Netherlands)

Schaft, A.J. van der

1983-01-01

A system theoretic framework is given for the description of Hamiltonian systems with external forces and partial observations of the state. It is shown how symmetries and conservation laws can be defined within this framework. A generalization of Noether's theorem is obtained. Finally a precise

Morphology Effect on Proton Dynamics in Nafion® 117 and Sulfonated Polyether Ether Ketone

Science.gov (United States)

Leong, Jun Xing; Diño, Wilson Agerico; Ahmad, Azizan; Daud, Wan Ramli Wan; Kasai, Hideaki

2016-09-01

We report results of our experimental and theoretical studies on the dynamics of proton conductivity in Nafion® 117 and self-fabricated sulfonated polyether ether ketone (SPEEK) membranes. Knowing that the presence of water molecules in the diffusion process results in a lower energy barrier, we determined the diffusion barriers and corresponding tunneling probabilities of Nafion® 117 and SPEEK system using a simple theoretical model that excludes the medium (water molecules) in the initial calculations. We then propose an equation that relates the membrane conductivity to the tunneling probability. We recover the effect of the medium by introducing a correction term into the proposed equation, which takes into account the effect of the proton diffusion distance and the hydration level. We have also experimentally verified that the proposed equation correctly explain the difference in conductivity between Nafion® 117 and SPEEK. We found that membranes that are to be operated in low hydration environments (high temperatures) need to be designed with short diffusion distances to enhance and maintain high conductivity.

33 CFR 117.921 - Broad River.

Science.gov (United States)

2010-07-01

... OPERATION REGULATIONS Specific Requirements South Carolina § 117.921 Broad River. (a) The draw of the S170 bridge, mile 14.0 near Beaufort, shall open on signal if at least 24 hours notice is given. (b) The draw...

0+ analogue state in 118Sb from 117Sn(p,nγ) reaction

International Nuclear Information System (INIS)

Pal, J.; Dey, C.C.; Bose, S.; Sinha, B.K.; Chatterjee, M.B.; Mahapatra, D.P.

1996-01-01

The analogue of the 0 + ground state in 118 Sn has been observed in the compound nucleus 118 Sb through 117 Sn(p,nγ) 117 Sb reaction. The neutron decays of this analogue resonance have been studied from the deexciting γ-rays of the residual nucleus 117 Sb. From off resonance excitation functions, spin assignments have been made to states in 117 Sb, on the basis of Hauser-Feshbach formalism. The resonance parameters of the isobaric analogue resonance have been determined, including the total, proton and neutron decay widths. (orig.)

Central retinal and posterior ciliary artery occlusion after particle embolization of the external carotid artery system.

Science.gov (United States)

Mames, R N; Snady-McCoy, L; Guy, J

1991-04-01

A 15-year-old boy underwent neuroradiologic embolization of the left internal maxillary artery with polyvinyl alcohol to stop traumatic epistaxis after failure of surgical clipping and nasal packing. Selective catheterization of the external carotid artery before embolization showed a faint choroidal blush. Although the procedure provided hemostasis, embolization to the central retinal artery and ciliary arteries resulted in loss of vision. The route of the emboli to the eye was via the anastomotic network of the lacrimal artery supplied by the external carotid artery system. Neuroradiologic embolization of the external carotid artery is an effective mode of therapy for dural-cavernous fistulas when fed by the external carotid artery system. Because the blood flow to the brain and eye is predominantly supplied by the internal carotid artery, embolization of the external carotid artery is considered relatively safe. The authors document the importance of recognition of the choroidal blush during selective external carotid artery angiography as a sign of collateral blood flow to the eye. Physicians and patients need to be aware of the risk of blindness as a complication of external carotid artery embolization when this sign is present.

Implementation of a system for external audits beam radiation therapy in terms of reference no

International Nuclear Information System (INIS)

Alonso Samper, Jose Luis; Dominguez, Lourdes; Alert Silva, Jose; Alfonso Laguardia, Rodolfo; Larrinaga Cortina, Eduardo; Garcia Yip, Fernando; Rodriguez Machado, Jorge; Morales Lopez, Jorge Luis; Silvestre Patallo, Ileana

2009-01-01

This paper presents our experience in implementing a external audit system for radiotherapy beam in no reference conditions with the use of CIRS and a summary of the measurements with him made.This paper presents our experience in implementing a external audit system for radiotherapy beam in no reference conditions with the use of CIRS and a summary of the measurements with him made. Centers were audited with external beam high-energy Co-60, 6 MV and 15 MV and were considered 4 treatment planning systems (TPS): AMEPLAN, Theraplan Plus, Precise Plan and MIRS to calculate doses prescribed in each test case. All measurements were acquired by the audit team using the anthropomorphic phantom CIRS, Semiflex chamber PTW 31010 and PTW electrometer STATES. The implementation and development of the external audits of beams radiotherapy in terms of 'no reference' has brought an improvement in both clinical aspects of treatment and the radiation safety and the quality control, has given us greater confidence and for this reason we believe has become essential. (Author)

Climate change in the framework of external costs of energy systems

International Nuclear Information System (INIS)

Mayerhofer, P.

1994-01-01

Due to the continuing controversies concerning external costs of energy systems, the Commission of the European Union and the US-Department of Energy initiated a common project, External Costs of Fuel Cycles. The purpose of this project is to develop methodologies for the assessment of site-specific external costs on a marginal basis using a damage-function approach. For the assessment of climate change itself physical models are available. Here, the PC-model IMAGE developed by RIVM has been used for the time period up to 2100. Beyond this year, the carbon cycle is modeled with a response function. For the derivation of damage costs, a linear relationship between the global temperature change and the damage costs has been assumed. Thus, damage costs in the range of 0.10 to 0.53 US-cents/kWh for a discount rate of 3% are assessed for typical German fossil energy systems. The highest uncertainties are attached to the discount rate, the range for the climate sensitivity, and the forms of the global warming damage function. These points also have the strongest influence on the results. Hence, future research should be directed to the further analysis of these points. 30 refs., 5 figs., 5 tabs

A review of privacy and usability issues in mobile health systems: Role of external factors.

Science.gov (United States)

Katusiime, Jane; Pinkwart, Niels

2017-10-01

The increased penetration of mobile devices has created opportunities in the health sector and led to emerging of mobile health systems. As much as the mobile health systems have registered tremendous progress, they have been faced with privacy and usability issues. Due to the sensitivity of health information, there is an ethical need to equip mobile health systems with adequate privacy measures. However, these systems should also be useable by the intended users. Even though many researchers are working on solutions, the issues still persist. External factors such as cultural differences have also contributed to the issues, yet they have been under researched. In this article, we conduct a systematic literature review of 22 articles, categorize and present privacy and usability issues and possible solutions. We then discuss the relevance and implications of external factors to the findings on privacy and usability. We end with recommendations to address these external factors.

Recovery of sperm after epididymal refrigeration from domestic cats using ACP-117c and Tris extenders

Directory of Open Access Journals (Sweden)

D.B.C. Lima

2016-08-01

Full Text Available ABSTRACT We aimed to compare fresh sperm and sperm cooled to 4ºC that had been recovered from the epididymides of cats using powdered coconut water (ACP-117c and Tris extenders. Sixty epididymides were divided into 6 groups: 10 fresh epididymides were recovered using Tris (T0h; 10 were kept at 4°C/2h and recovered using Tris (T2h; 10 were kept at 4°C/4h and recovered using Tris (T4h; 10 fresh were recovered using ACP-117c (A0h; 10 were kept at 4°C/2h and recovered using ACP-117c (A2h, and 10 were kept at 4°C/4h and recovered using ACP-117c (A4h. The testis-epididymis complexes (TEC control were not cooled. The others were cooled at 4°C for 2 or 4h. The epididymis was separated and the sperm was recovered by the modified flotation method. Sperm kinetic parameters were evaluated by a computer-system analysis, and vigor, viability, concentration, membrane function and morphology of the sperm were assessed under a light microscope. The progressive motility with ACP-117c declined after 2h of cooling, but did not differ between fresh and 4h. The vigor and membrane function were higher in A4h than A0h. The vigor at T2h and T4h were decreased compared to T0h. T0h was higher than A0h for vigor and sperm membrane function. However, after 4h of cooling, ACP-117c maintained a higher percentage of living cells. Feline epididymal sperm quality can be maintained to the degree necessary for artificial breeding programs following cooling and ACP-117c may be successfully used to recover cat sperm that have been cooled for up to 4h.

Characterization of hospitalizations due to external causes in the public health system, Brazil, 2011.

Science.gov (United States)

Mascarenhas, Márcio Dênis Medeiros; Barros, Marilisa Berti de Azevedo

2015-01-01

The aim of this work is to describe the characteristics of hospital admissions owing to external causes in the public health system in Brazil in 2011. Data from the Hospital Information System of the Unified Health System (SIH/SUS) were analyzed to obtain the frequency, coefficient of hospitalization, and hospital morbidity indicators. Of the 973,015 admissions, falls (38.4%) predominated, followed by traffic accidents (15.8%). The estimated coefficient of hospitalization owing to external causes increased with the age, and it was higher in male patients and in the midwest region of the country. The average stay was higher in hospitalizations for traffic accidents (6.1 days) and assaults (6.0 days), while the hospital mortality rate reached higher values in hospitalizations for assaults (4.7%) and self-harms (4.0%). It is evident from the knowledge of the characteristics described the usefulness of hospital morbidity data for planning care actions and prevention of the external causes.

41 CFR 301-10.117 - May I keep compensation an airline gives me for voluntarily vacating my seat on my scheduled...

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false May I keep compensation an airline gives me for voluntarily vacating my seat on my scheduled airline flight when the airline asks for volunteers? 301-10.117 Section 301-10.117 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY)...

Systems engineering and integration of control centers in support of multiple programs. [ground control for STS payloads and unmanned vehicles

Science.gov (United States)

Miller, David N.

1989-01-01

The NASA Johnson Space Center's new Multiprogram Control Center (MPCC) addresses the control requirements of complex STS payloads as well as unmanned vehicles. An account is given of the relationship of the MPCC to the STS Mission Control Center, with a view to significant difficulties that may be encountered and solutions thus far devised for generic problems. Examples of MPCC workstation applications encompass telemetry decommutation, engineering unit conversion, data-base management, trajectory processing, and flight design.

33 CFR 25.117 - Proof of amount claimed for personal injury or death.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Proof of amount claimed for personal injury or death. 25.117 Section 25.117 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL CLAIMS General § 25.117 Proof of amount claimed for personal injury or death. The following evidence must be presented...

STS-93 Commander Collins suits up for launch

Science.gov (United States)

1999-01-01

During the third launch preparations in the Operations and Checkout Building, STS-93 Commander Eileen M. Collins waves while having her launch and entry suit checked. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

Prognostic Value of External Beam Radiation Therapy in Patients Treated With Surgical Resection and Intraoperative Electron Beam Radiation Therapy for Locally Recurrent Soft Tissue Sarcoma: A Multicentric Long-Term Outcome Analysis

Energy Technology Data Exchange (ETDEWEB)

Calvo, Felipe A. [Department of Oncology, Hospital General Universitario Gregorio Marañón, Madrid (Spain); School of Medicine, Complutense University, Madrid (Spain); Sole, Claudio V., E-mail: cvsole@uc.cl [Department of Oncology, Hospital General Universitario Gregorio Marañón, Madrid (Spain); School of Medicine, Complutense University, Madrid (Spain); Service of Radiation Oncology, Instituto de Radiomedicina, Santiago (Chile); Cambeiro, Mauricio [Service of Radiation Oncology, Clínica Universitaria, Universidad de Navarra, Pamplona (Spain); Montero, Angel; Polo, Alfredo [Service of Radiation Oncology, Hospital Universitario Ramón y Cajal, Universidad de Alcala, Madrid (Spain); Gonzalez, Carmen [School of Medicine, Complutense University, Madrid (Spain); Service of Radiation Oncology, Instituto de Radiomedicina, Santiago (Chile); Service of Radiation Oncology, Clínica Universitaria, Universidad de Navarra, Pamplona (Spain); Service of Radiation Oncology, Hospital Universitario Ramón y Cajal, Universidad de Alcala, Madrid (Spain); Service of Radiation Oncology, Hospital General Universitario Gregorio Marañón, Madrid (Spain); Cuervo, Miguel [Service of Orthopedics and Traumatology, Hospital General Universitario Gregorio Marañón, Madrid (Spain); San Julian, Mikel [Service of Orthopedics and Traumatology, Clínica Universitaria, Universidad de Navarra, Pamplona (Spain); and others

2014-01-01

Background: A joint analysis of data from centers involved in the Spanish Cooperative Initiative for Intraoperative Electron Radiotherapy was performed to investigate long-term outcomes of locally recurrent soft tissue sarcoma (LR-STS) patients treated with a multidisciplinary approach. Methods and Materials: Patients with a histologic diagnosis of LR-STS (extremity, 43%; trunk wall, 24%; retroperitoneum, 33%) and no distant metastases who underwent radical surgery and intraoperative electron radiation therapy (IOERT; median dose, 12.5 Gy) were considered eligible for participation in this study. In addition, 62% received external beam radiation therapy (EBRT; median dose, 50 Gy). Results: From 1986 to 2012, a total of 103 patients from 3 Spanish expert IOERT institutions were analyzed. With a median follow-up of 57 months (range, 2-311 months), 5-year local control (LC) was 60%. The 5-year IORT in-field control, disease-free survival (DFS), and overall survival were 73%, 43%, and 52%, respectively. In the multivariate analysis, no EBRT to treat the LR-STS (P=.02) and microscopically involved margin resection status (P=.04) retained significance in relation to LC. With regard to IORT in-field control, only not delivering EBRT to the LR-STS retained significance in the multivariate analysis (P=.03). Conclusion: This joint analysis revealed that surgical margin and EBRT affect LC but that, given the high risk of distant metastases, DFS remains modest. Intensified local treatment needs to be further tested in the context of more efficient concurrent, neoadjuvant, and adjuvant systemic therapy.

Prognostic Value of External Beam Radiation Therapy in Patients Treated With Surgical Resection and Intraoperative Electron Beam Radiation Therapy for Locally Recurrent Soft Tissue Sarcoma: A Multicentric Long-Term Outcome Analysis

International Nuclear Information System (INIS)

Calvo, Felipe A.; Sole, Claudio V.; Cambeiro, Mauricio; Montero, Angel; Polo, Alfredo; Gonzalez, Carmen; Cuervo, Miguel; San Julian, Mikel

2014-01-01

Background: A joint analysis of data from centers involved in the Spanish Cooperative Initiative for Intraoperative Electron Radiotherapy was performed to investigate long-term outcomes of locally recurrent soft tissue sarcoma (LR-STS) patients treated with a multidisciplinary approach. Methods and Materials: Patients with a histologic diagnosis of LR-STS (extremity, 43%; trunk wall, 24%; retroperitoneum, 33%) and no distant metastases who underwent radical surgery and intraoperative electron radiation therapy (IOERT; median dose, 12.5 Gy) were considered eligible for participation in this study. In addition, 62% received external beam radiation therapy (EBRT; median dose, 50 Gy). Results: From 1986 to 2012, a total of 103 patients from 3 Spanish expert IOERT institutions were analyzed. With a median follow-up of 57 months (range, 2-311 months), 5-year local control (LC) was 60%. The 5-year IORT in-field control, disease-free survival (DFS), and overall survival were 73%, 43%, and 52%, respectively. In the multivariate analysis, no EBRT to treat the LR-STS (P=.02) and microscopically involved margin resection status (P=.04) retained significance in relation to LC. With regard to IORT in-field control, only not delivering EBRT to the LR-STS retained significance in the multivariate analysis (P=.03). Conclusion: This joint analysis revealed that surgical margin and EBRT affect LC but that, given the high risk of distant metastases, DFS remains modest. Intensified local treatment needs to be further tested in the context of more efficient concurrent, neoadjuvant, and adjuvant systemic therapy

STS-95 Day 04 Highlights

Science.gov (United States)

1998-01-01

On this forth day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, are seen performing an evaluation of bone cell activity under microgravity conditions. Glenn then provides blood samples as part of the Protein Turnover Experiment, which is looking at the balance between the building and breakdown of muscle. He also works with the Advanced Organic Separations (ADSEP) experiment, to provides the capability to separate and purify biological materials in microgravity; and with the Microencapsulation Electrostatic Processing System (MEPS), that studies the formation of anti-tumor capsules containing two kinds of drugs.

STS-82 Pilot Scott Horowitz arrives for TCDT

Science.gov (United States)

1997-01-01

STS-82 Pilot Scott J. 'Doc' Horowitz arrives at KSCs Shuttle Landing Facility in a T-38 jet from Houston, TX. Horowitz and the other six crew members are at KSC to participate in the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch. The crew aboard the Space Shuttle Discovery on STS-82 will conduct the second Hubble Space Telescope servicing mission. The 10-day flight is targeted for a Feb. 11 liftoff.

Piezosurgery in External Dacryocystorhinostomy.

Science.gov (United States)

Czyz, Craig N; Fowler, Amy M; Dutton, Jonathan J; Cahill, Kenneth V; Foster, Jill A; Hill, Robert H; Everman, Kelly R; Nabavi, Cameron B

Dacryocystorhinostomy (DCR) can be performed via an external or endoscopic approach. The use of ultrasonic or piezosurgery has been well described for endoscopic DCRs but is lacking for external DCRs. This study presents a case series of external DCRs performed using piezosurgery evaluating results and complications. Prospective, consecutive case series of patients undergoing primary external DCR for lacrimal drainage insufficiency. A standard external DCR technique was used using 1 of 2 piezosurgery systems for all bone incision. All patients received silicone intubation to the lacrimal system. Surgical outcome was measured in terms of patient-reported epiphora as follows: 1) complete resolution, 2) improvement >50%, 3) improvement 50% improvement. There were 4 patients (7%) who had <50% improvement. There was 1 (2%) intraoperative complication and 2 (4%) postoperative complications recorded. Piezourgery is a viable modality for performing external DCRs. The lack of surgical complications shows a potential for decreased soft tissues damage. The surgical success rate based on patient-reported epiphora is similar to those published for mechanical external DCRs. This modality may benefit the novice surgeon in the reduction of soft and mucosal tissue damage.

Method for palliation of pain in human bone cancer using therapeutic tin-117m compositions

International Nuclear Information System (INIS)

Srivastava, S.C.; Meinken, G.E.; Mausner, L.F.; Atkins, H.L.

1998-01-01

The invention provides a method for the palliation of bone pain due to cancer by the administration of a unique dosage of a tin-117m (Sn-117m) stannic chelate complex in a pharmaceutically acceptable composition. In addition, the invention provides a method for simultaneous palliation of bone pain and radiotherapy in cancer patients using compositions containing Sn-117m chelates. The invention also provides a method for palliating bone pain in cancer patients using Sn-117m-containing compositions and monitoring patient status by imaging the distribution of the Sn-117m in the patients. Also provided are pharmaceutically acceptable compositions containing Sn-117m chelate complexes for the palliation of bone pain in cancer patients. 5 figs

20 Plus Years of Chimera Grid Development for the Space Shuttle. STS-107, Return to Flight, End of the Program

Science.gov (United States)

Gomez, Reynaldo J., III

2010-01-01

This slide presentation reviews the progress in grid development for the space shuttle, with particular focus on the development from the los of STS-107 and the return to flight, to the end of the program. Included are views from the current Space Shuttle Launch Vehicle (SSLV) grid system, containing 1.8 million surface points, and 95+ million volume points. Charts showing wind tunnel tests comparisons, and Computational fluid dynamics (CFD) vs 1A613B wing pressures, wind tunnel test comparison with CFD of the proposed ice/frost ramp configuration are shown. The use of pressure sensitive paint and particle imaging velocimetry was used to support debris transport tools, The actual creation of the grids and the use of overset CFD to assess the external tank redesign was also reviewed. It also asks was the use of the overset tool the right choice. The presentation ends with a review of the work to be done still.

Disease burden and mental health system capacity: WHO Atlas study of 117 low- and middle-income countries.

Science.gov (United States)

McBain, Ryan; Salhi, Carmel; Morris, Jodi E; Salomon, Joshua A; Betancourt, Theresa S

2012-12-01

Treatment coverage for mental disorders ranges from less than 10% to more than 90% across low- and middle-income (LAMI) countries. Studies have yet to examine whether the capacity of mental health systems might be adversely affected by the burdens of unrelated conditions such as HIV/AIDS. To examine whether the magnitude of disease burden from communicable, perinatal, maternal and nutritional conditions - commonly referred to as Group 1 diseases - is inversely associated with mental health system capacity in LAMI countries. Multiple regression analyses were undertaken using data from 117 LAMI countries included in the 2011 World Health Organization (WHO) Mental Health Atlas. Capacity was defined in terms of human resources and infrastructure. Regressions controlled for effects of political stability, government health expenditures, income inequality and neuropsychiatric disease burden. Higher Group 1 disease burden was associated with fewer psychiatrists, psychologists and nurses in the mental health sector, as well as reduced numbers of out-patient facilities and psychiatric beds in mental hospitals and general hospitals (t = -2.06 to -7.68, Pmental health system capacity in LAMI countries may be adversely affected by the magnitude of their Group 1 disease burden.

Aspects of two-level systems under external time-dependent fields

Energy Technology Data Exchange (ETDEWEB)

Bagrov, V.G.; Wreszinski, W.F. [Tomsk State University and Tomsk Institute of High Current Electronics (Russian Federation); Barata, J.C.A.; Gitman D.M. [Universidade de Sao Paulo, Instituto de Fisica (Brazil)]. E-mails: jbarata@fma.if.usp.br; gitman@fma.if.usp.br

2001-12-14

The dynamics of two-level systems in time-dependent backgrounds is under consideration. We present some new exact solutions in special backgrounds decaying in time. On the other hand, following ideas of Feynman et al, we discuss in detail the possibility of reducing the quantum dynamics to a classical Hamiltonian system. This, in particular, opens the possibility of directly applying powerful methods of classical mechanics (e.g. KAM methods) to study the quantum system. Following such an approach, we draw conclusions of relevance for 'quantum chaos' when the external background is periodic or quasi-periodic in time. (author)

46 CFR 117.202 - Survival craft-vessels operating on oceans routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on oceans routes. 117... LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.202 Survival craft—vessels... number of overnight persons allowed, the survival craft requirements contained in paragraph (e) of this...

Human health-related externalities in energy system modelling the case of the Danish heat and power sector

DEFF Research Database (Denmark)

Zvingilaite, Erika

2011-01-01

and power sector verifies that it is cheaper for the society to include externalities in the planning of an energy system than to pay for the resulting damages later. Total health costs decrease by around 18% and total system costs decrease by nearly 4% when health externalities are included...

Field Evaluation of the System Identification Approach for Tension Estimation of External Tendons

Directory of Open Access Journals (Sweden)

Myung-Hyun Noh

2015-01-01

Full Text Available Various types of external tendons are considered to verify the applicability of tension estimation method based on the finite element model with system identification technique. The proposed method is applied to estimate the tension of benchmark numerical example, model structure, and field structure. The numerical and experimental results show that the existing methods such as taut string theory and linear regression method show large error in the estimated tension when the condition of external tendon is different with the basic assumption used during the derivation of relationship between tension and natural frequency. However, the proposed method gives reasonable results for all of the considered external tendons in this study. Furthermore, the proposed method can evaluate the accuracy of estimated tension indirectly by comparing the measured and calculated natural frequencies. Therefore, the proposed method can be effectively used for field application of various types of external tendons.

Investigation of external and internal shock in the stability of Indonesia’s financial system

Directory of Open Access Journals (Sweden)

Maulina Vinus

2017-07-01

Full Text Available The objective of this research is to develop a financial system stability index and analyze the internal and external factors that we expect to affect the stability of the Indonesian financial system. We measured the single model of financial system stability index (FSSI from year 2004M03 to2014M09 in Indonesia, and compiled a single quantitative measure based on aggregate internal factors and external factors to capture and predict the shocks of the financial system stability. Stability parameters were composed of composite indicators on different bases. In addition, we developed a comprehensive index component associated with the relevant market conditions, including banking soundness index, financial vulnerability index, and regional economic climate index. Results stated that US economic growth and economic growth of ASEAN countries positively affected financial stability. In addition, current account, exchange rate, inflation, interest rate were shown to negatively affect financial stability. The results of this study imply that internal factors have a strong influence on the financial stability. Therefore, the central bank should give a fast and correct response to the changes of external and internal financial environment, especially for internal factors through monetary policy.

41 CFR 102-117.105 - What does best value mean when routing a shipment?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does best value mean when routing a shipment? 102-117.105 Section 102-117.105 Public Contracts and Property Management... 117-TRANSPORTATION MANAGEMENT Business Rules To Consider Before Shipping Freight or Household Goods...

Computer simulation model of reflex e-beam systems coupled to an external circuit

International Nuclear Information System (INIS)

Jungwirth, K.; Stavinoha, P.

1982-01-01

Dynamics of ions and relativistic electrons in various high-voltage reflexing systems (reflex diodes and triodes) was investigated numerically by means of 1 1/2-dimensional PIC simulation model OREBIA. Its perfected version OREBIA-REX also accounts for system coupling to an external power source circuit, thus yielding the currents and applied voltage self-consistently. Various modes of operation of reflex diode and triode were studied using both models. It is shown that neglecting the influence of the external circuit can lead to seve--re overestimation of both ion currents and electron accumulation rates. In coupled systems with ions repeated collapses of impedance due to electron-ion relaxation processes are observed. The current and voltage pulses calculated for several reflex diodes and triodes with and without ions are presented. (J.U.)

STS-95 Payload Specialist Glenn and his wife pose before their return flight to JSC

Science.gov (United States)

1998-01-01

At the Skid Strip at Cape Canaveral Air Station, STS-95 Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts, poses with his wife Annie before their return flight to the Johnson Space Center in Houston, Texas. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The STS-95 crew also includes Mission Commander Curtis L. Brown Jr.; Pilot Steven W. Lindsey; Mission Specialist Scott E. Parazynski; Mission Specialist Stephen K. Robinson; Mission Specialist Pedro Duque, with the European Space Agency (ESA); and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA). The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

STS-84 M.S. Kondakova with husband Ryumin at SLF

Science.gov (United States)

1997-01-01

STS-84 Mission Specialist Elena V. Kondakova, a cosmonaut with the Russian Space Agency, and her husband, Valery Ryumin, greet press represenatives and other well wishers after her arrival at KSCs Shuttle Landing Facility. Ryumin is director of the Mir- Shuttle program for RSC Energia in Russia. This will be Kondakovas first flight on a U.S. Space Shuttle, but her second trip into space. She spent 169 days in space as flight engineer of the 17th main mission on Mir from October 1994 to March 1995. STS-84 will be the sixth docking of the Space Shuttle with the Russian Space Station Mir. During the docking, STS-84 Mission Specialist C. Michael Foale will transfer to the Russian space station to become a member of the Mir 23 crew, replacing U.S. astronaut Jerry M. Linenger, who will return to Earth on Atlantis. Foale is scheduled to remain on Mir about four months until his replacement arrives on STS-86 in September.

STS-114: Crew Interviews: 1. Jim Kelly 2. Charlie Camarda

Science.gov (United States)

2005-01-01

1) STS-114 Pilot James Kelly mentions his primary job as the Pilot is to back up Commander Eileen Collins all through the flight. James discusses in detail his robotics operations for all of the extravehicular activities and spacewalk work, as well as moving the logistics module back and forth, onto the station and back in the payload bay. He shares his thoughts on the Columbia, the STS-114 mission as a new chapter in space exploration, and the International Space Station. 2) STS-114 Mission Specialist Charlie Camarda discusses his major role in the mission, his feelings for this being his first Space Shuttle flight; shares his thoughts on the Columbia; mentioned that STS-114 is a baby step to what is needed to do for the next step in space exploration, and gave some examples on how the International Space Station can help pave the path to future space exploration.

STS-47 MS Davis trains at Payload Crew Training Complex at Marshall SFC

Science.gov (United States)

1992-01-01

STS-47 Endeavour, Orbiter Vehicle (OV) 105, Mission Specialist (MS) N. Jan Davis, wearing the Autogenic Feedback Training System 2 suit and lightweight headset, reviews a Payload Systems Handbook in the Spacelab Japan (SLJ) mockup during training at the Payload Crew Training Complex at Marshall Space Flight Center (MSFC) in Huntsville, Alabama. View provided with alternate number 92P-137.

32 CFR 842.117 - Delegations of authority.

Science.gov (United States)

2010-07-01

... LITIGATION ADMINISTRATIVE CLAIMS Hospital Recovery Claims (42 U.S.C. 2651-2653) § 842.117 Delegations of... USAFE, and the SJAs of each Air Force base, station, or fixed installation have delegated authority to...

STS-93 Pilot Ashby suits up for launch

Science.gov (United States)

1999-01-01

In the Operations and Checkout Building during final launch preparations for the third time, STS-93 Pilot Jeffrey S. Ashby pulls on his glove, part of his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

33 CFR 117.1049 - Lake Washington.

Science.gov (United States)

2010-07-01

... Evergreen Point Floating Bridge between Seattle and Bellevue shall operate as follows: (a) The draw shall open on signal if at least two hours notice is given. (b) Telephone requests for bridge opening may be... 117.1049 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...

33 CFR 117.417 - Ohio River.

Science.gov (United States)

2010-07-01

....417 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kentucky § 117.417 Ohio River. The draw of the Southern Railway railroad bridge, mile 607.4 at New Albany, Indiana, need not be opened for the passage of vessels. [CGD 82...

33 CFR 117.213 - New Haven Harbor, Quinnipiac and Mill Rivers.

Science.gov (United States)

2010-07-01

... Mill Rivers. 117.213 Section 117.213 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Haven Harbor, Quinnipiac and Mill Rivers. The draws of the Tomlinson bridge, mile 0.0, the Ferry Street... bridge, mile 0.4 across Mill River, shall operate as follows: (a) The draws shall open on signal; except...

46 CFR 117.208 - Survival craft-vessels operating on rivers routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on rivers routes. 117... LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.208 Survival craft—vessels... vessel certificated to operate on a rivers route in warm water is not required to carry survival craft...

STS-95 Payload Specialist Glenn participates in a media briefing before returning to JSC

Science.gov (United States)

1998-01-01

STS-95 Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts, participates in a media briefing at the Kennedy Space Center Press Site Auditorium before returning to the Johnson Space Center in Houston, Texas. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. Also participating in the briefing were the other STS-95 crew members: Mission Commander Curtis L. Brown Jr.; Pilot Steven W. Lindsey; Mission Specialist and Payload Commander Stephen K. Robinson; Mission Specialist Scott E. Parazynski; Mission Specialist Pedro Duque, with the European Space Agency (ESA); and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA). The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

The STS-95 crew and their families prepare for their return flight to JSC

Science.gov (United States)

1998-01-01

At the Skid Strip at Cape Canaveral Air Station, STS-95 Pilot Steven W. Lindsey (left), Lindsey's daughter (front), and Payload Specialist John H. Glenn Jr. (right), a senator from Ohio and one of the original seven Project Mercury astronauts, give a thumbs up on the success of the mission. Members of the STS-95 crew and their families prepared for their return flight to the Johnson Space Center in Houston, Texas. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. Others returning were Mission Commander Curtis L. Brown Jr.; Mission Specialist Scott E. Parazynski; Mission Specialist Stephen K. Robinson; Mission Specialist Pedro Duque, with the European Space Agency (ESA); and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA). The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

CD117 immunoexpression in canine mast cell tumours: correlations with pathological variables and proliferation markers

Directory of Open Access Journals (Sweden)

Pires Maria A

2007-08-01

Full Text Available Abstract Background Cutaneous mast cell tumours are one of the most common neoplasms in dogs and show a highly variable biologic behaviour. Several prognosis tools have been proposed for canine mast cell tumours, including histological grading and cell proliferation markers. CD117 is a receptor tyrosine kinase thought to play a key role in human and canine mast cell neoplasms. Normal (membrane-associated and aberrant (cytoplasmic, focal or diffuse CD117 immunoexpression patterns have been identified in canine mast cell tumours. Cytoplasmic CD117 expression has been found to correlate with higher histological grade and with a worsened post-surgical prognosis. This study addresses the role of CD117 in canine mast cell tumours by studying the correlations between CD117 immunoexpression patterns, two proliferation markers (Ki67 and AgNORs histological grade, and several other pathological variables. Results Highly significant (p Conclusion These findings highlight the key role of CD117 in the biopathology of canine MCTs and confirm the relationship between aberrant CD117 expression and increased cell proliferation and higher histological grade. Further studies are needed to unravel the cellular mechanisms underlying focal and diffuse cytoplasmic CD117 staining patterns, and their respective biopathologic relevance.

Complete Genome Sequences of Isolates of Enterococcus faecium Sequence Type 117, a Globally Disseminated Multidrug-Resistant Clone

Science.gov (United States)

Tedim, Ana P.; Lanza, Val F.; Manrique, Marina; Pareja, Eduardo; Ruiz-Garbajosa, Patricia; Cantón, Rafael; Baquero, Fernando; Tobes, Raquel

2017-01-01

ABSTRACT The emergence of nosocomial infections by multidrug-resistant sequence type 117 (ST117) Enterococcus faecium has been reported in several European countries. ST117 has been detected in Spanish hospitals as one of the main causes of bloodstream infections. We analyzed genome variations of ST117 strains isolated in Madrid and describe the first ST117 closed genome sequences. PMID:28360174

STS-32 Commander Brandenstein adjusts IMAX camera during training session

Science.gov (United States)

1989-01-01

STS-32 Commander Daniel C. Brandenstein adjusts IMAX camera setting during briefing and training session as technician looks on. The session was conducted in the JSC Mockup and Integration Laboratory (MAIL) Bldg 9B. The IMAX camera will be used onboard Columbia, Orbiter Vehicle (OV) 102, during the STS-32 mission.

STS-9 crewmembers in training session in bldg 9A

Science.gov (United States)

1983-01-01

Members of the STS-9 crew discuss flight procedures with a trainer in bldg 9A before the STS-9 mission. From left to right are Brewster Shaw, pilot; John Young, crew commander; Robert Parker, mission specialist; and unidentified trainer. They are reviewing procedures manuals on the shuttle mock-up hatch.

33 CFR 117.833 - Pasquotank River.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.833 Pasquotank River. (a) The draw of the Albemarle & Chesapeake railroad bridge, mile 47.7, at Elizabeth City, North Carolina, shall... the train has cleared the bridge. (b) The draw of the US 158 Highway Bridge, mile 50.7, at Elizabeth...

Mutated PET117 causes complex IV deficiency and is associated with neurodevelopmental regression and medulla oblongata lesions.

Science.gov (United States)

Renkema, G H; Visser, G; Baertling, F; Wintjes, L T; Wolters, V M; van Montfrans, J; de Kort, G A P; Nikkels, P G J; van Hasselt, P M; van der Crabben, S N; Rodenburg, R J T

2017-06-01

The genetic basis of the many progressive, multi systemic, mitochondrial diseases that cause a lack of cellular ATP production is heterogeneous, with defects found both in the mitochondrial genome as well as in the nuclear genome. Many different mutations have been found in the genes encoding subunits of the enzyme complexes of the oxidative phosphorylation system. In addition, mutations in genes encoding proteins involved in the assembly of these complexes are known to cause mitochondrial disorders. Here we describe two sisters with a mitochondrial disease characterized by lesions in the medulla oblongata, as demonstrated by brain magnetic resonance imaging, and an isolated complex IV deficiency and reduced levels of individual complex IV subunits. Whole exome sequencing revealed a homozygous nonsense mutation resulting in a premature stop codon in the gene encoding Pet117, a small protein that has previously been predicted to be a complex IV assembly factor. PET117 has not been identified as a mitochondrial disease gene before. Lentiviral complementation of patient fibroblasts with wild-type PET117 restored the complex IV deficiency, proving that the gene defect is responsible for the complex IV deficiency in the patients, and indicating a pivotal role of this protein in the proper functioning of complex IV. Although previous studies had suggested a possible role of this protein in the insertion of copper into complex IV, studies in patient fibroblasts could not confirm this. This case presentation thus implicates mutations in PET117 as a novel cause of mitochondrial disease.

Survival and compound nucleus probability of super heavy element Z = 117

Energy Technology Data Exchange (ETDEWEB)

Manjunatha, H.C. [Government College for Women, Department of Physics, Kolar, Karnataka (India); Sridhar, K.N. [Government First grade College, Department of Physics, Kolar, Karnataka (India)

2017-05-15

As a part of a systematic study for predicting the most suitable projectile-target combinations for heavy-ion fusion experiments in the synthesis of {sup 289-297}Ts, we have calculated the transmission probability (T{sub l}), compound nucleus formation probabilities (P{sub CN}) and survival probability (P{sub sur}) of possible projectile-target combinations. We have also studied the fusion cross section, survival cross section and fission cross sections for different projectile-target combination of {sup 289-297}Ts. These theoretical parameters are required before the synthesis of the super heavy element. The calculated probabilities and cross sections show that the production of isotopes of the super heavy element with Z = 117 is strongly dependent on the reaction systems. The most probable reactions to synthetize the super heavy nuclei {sup 289-297}Ts are worked out and listed explicitly. We have also studied the variation of P{sub CN} and P{sub sur} with the mass number of projectile and target nuclei. This work is useful in the synthesis of the super heavy element Z = 117. (orig.)

STS-29 Landing Approach at Edwards

Science.gov (United States)

1989-01-01

The STS-29 Space Shuttle Discovery mission approaches for a landing at NASA's then Ames-Dryden Flight Research Facility, Edwards AFB, California, early Saturday morning, 18 March 1989. Touchdown was at 6:35:49 a.m. PST and wheel stop was at 6:36:40 a.m. on runway 22. Controllers chose the concrete runway for the landing in order to make tests of braking and nosewheel steering. The STS-29 mission was very successful, completing the launch a Tracking and Data Relay communications satellite, as well as a range of scientific experiments. Discovery's five man crew was led by Commander Michael L. Coats, and included pilot John E. Blaha and mission specialists James P. Bagian, Robert C. Springer, and James F. Buchli. Space Shuttles are the main element of America's Space Transportation System and are used for space research and other space applications. The shuttles are the first vehicles capable of being launched into space and returning to Earth on a routine basis. Space Shuttles are used as orbiting laboratories in which scientists and mission specialists conduct a wide variety of scientific experiments. Crews aboard shuttles place satellites in orbit, rendezvous with satellites to carry out repair missions and return them to space, and retrieve satellites and return them to Earth for refurbishment and reuse. Space Shuttles are true aerospace vehicles. They leave Earth and its atmosphere under rocket power provided by three liquid-propellant main engines with two solid-propellant boosters attached plus an external liquid-fuel tank. After their orbital missions, they streak back through the atmosphere and land like airplanes. The returning shuttles, however, land like gliders, without power and on runways. Other rockets can place heavy payloads into orbit, but, they can only be used once. Space Shuttles are designed to be continually reused. When Space Shuttles are used to transport complete scientific laboratories into space, the laboratories remain inside the payload

41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure?

Science.gov (United States)

2010-07-01

...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP performance...) Percentage of customer satisfaction reports on carrier performance. ...

[An information system for injuries from external causes (SILEX): a successful project in El Salvador].

Science.gov (United States)

Salinas, Oscar; de Cosío, Gerardo; Clavel-Arcas, Carme; Montoya, Jeannette; Serpas, Mario; Morán de García, Silvia; Concha-Eastman, Alberto

2008-12-01

This article examines the stages in developing an information system for injuries from external causes (Sistema de Información de Lesiones de Causa Externa-SILEX), as well as its limitations and achievements. SILEX is a Web-based application for collection, quality control, presentation, and analysis of data available from the hospital system for surveillance of injuries from external causes created by Ministry of Health of El Salvador with data from the hospital emergency services. This system maintains comprehensive information on the injured person-type of injury, intention, injury site, activity being performed at the time of injury, risk factors, etc.-in the form of tables, graphs, and maps, which streamlines the development of intervention plans and prevention initiatives for these types of injuries in El Salvador. This experience is an example of what can be done to close the information gap on injuries by external causes in the Region of the Americas.

STS-95 Day 07 Highlights

Science.gov (United States)

1998-01-01

On this seventh day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, again test the Orbiter Space Vision System. OSVS uses special markings on Spartan and the shuttle cargo bay to provide an alignment aid for the arm's operator using shuttle television images. It will be used extensively on the next Space Shuttle flight in December as an aid in using the arm to join together the first two modules of the International Space Station. Specialist John Glenn will complete a daily back-pain questionnaire by as part of a study of how the muscle, intervertebral discs and bone marrow change after exposure to microgravity.

STS-95 Payload Specialist Duque arrives at KSC to participate in a SPACEHAB familiarization exercise

Science.gov (United States)

1998-01-01

STS-95 Payload Specialist Pedro Duque of Spain, who represents the European Space Agency (ESA), waves after arriving in a T-38 jet aircraft at the Shuttle Landing Facility at KSC. He is joining other STS-95 crew members in a familiarization tour of the SPACEHAB module and the equipment that will fly with them on the Space Shuttle Discovery scheduled to launch Oct. 29, 1998. The mission includes research payloads such as the Spartan solar- observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process.

Science-Technology-Society (STS): A New Paradigm in Science Education

Science.gov (United States)

Mansour, Nasser

2009-01-01

Changes in the past two decades of goals for science education in schools have induced new orientations in science education worldwide. One of the emerging complementary approaches was the science-technology-society (STS) movement. STS has been called the current megatrend in science education. Others have called it a paradigm shift for the field…

Assessment of health-cost externalities of air pollution at the national level using the EVA model system

Energy Technology Data Exchange (ETDEWEB)

Brandt, J.; Silver, J.D.; Frohn, L.M. (and others)

2011-07-15

Air pollution has significant negative impacts on human health and well-being, which entail substantial economic consequences. We have developed an integrated model system, EVA (External Valuation of Air pollution; Frohn et al., 2005; Andersen et al., 2007; Brandt et al., 2010), to assess health-related economic externalities of air pollution resulting from specific emission sources or sectors. The EVA system was initially developed to assess externalities from power production, but in this study it is extended to evaluate costs at the national level from all major emission sectors. In this study, we estimate the impacts and total externality costs from the main emission sectors in Denmark, representing the 10 major SNAP codes. Furthermore, we assess the impacts and externality costs of all emissions simultaneously from the whole of Europe as well as from international ship traffic in general, since this sector seems to be very important but is currently unregulated. (Author)

STS-52 Mission Specialist (MS) Jernigan during food planning session at JSC

Science.gov (United States)

1992-01-01

STS-52 Columbia, Orbiter Vehicle (OV) 102, Mission Specialist (MS) Tamara E. Jernigan sips a beverage from a plastic container using a straw. She appears to be pondering what beverages she would like to have on her 10-day flight this coming autumn. Other crewmembers joined Jernigan for this food planning session conducted by JSC's Man-Systems Division.

Low-level multicounter {beta}/{gamma} systems with external guards in surface and shallow underground laboratories

Energy Technology Data Exchange (ETDEWEB)

Theodorsson, P [Iceland Univ. (Iceland). Science Inst.

1997-03-01

When weak samples are measured it is important that they can be given ample counting time in order to obtain satisfactory accuracy and that the background count rate can be checked well. This calls for a high counting capacity, which multidetectors can bring us. I will discuss development possibilities of low-level {beta}/{gamma} multidetector systems with an external anticosmic shield that will in many cases be operated in underground laboratories. These simple and low-cost system can frequently help us in increasing the number of detectors. Three concepts are combined in these systems: (1) multidetectors, (2) an external anticosmic (or guard) detector arrangement and (3) overburden shielding. (orig.)

Low-level multicounter β/γ systems with external guards in surface and shallow underground laboratories

International Nuclear Information System (INIS)

Theodorsson, P.

1997-01-01

When weak samples are measured it is important that they can be given ample counting time in order to obtain satisfactory accuracy and that the background count rate can be checked well. This calls for a high counting capacity, which multidetectors can bring us. I will discuss development possibilities of low-level β/γ multidetector systems with an external anticosmic shield that will in many cases be operated in underground laboratories. These simple and low-cost system can frequently help us in increasing the number of detectors. Three concepts are combined in these systems: (1) multidetectors, (2) an external anticosmic (or guard) detector arrangement and (3) overburden shielding. (orig.)

STS-93 Commander Eileen Collins suits up for launch

Science.gov (United States)

1999-01-01

For the third time, in the Operations and Checkout Building, STS- 93 Commander Eileen M. Collins tries on her helmet with her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS-49 Endeavour/Intelsat Briefing

Science.gov (United States)

1992-01-01

Lak Virdee of Intelsat, summarizes Intelsat's role in the STS-49 Endeavour mission. He discusses the reboost hardware, giving details on the capture arm and docker adapter assembly. He describes the rendezvous between Intelsat and the Endeavour Orbiter. Mr. Virdee then answers questions from the press.

Interfacial scanning tunneling spectroscopy (STS) of chalcogenide/metal hybrid nanostructure

Energy Technology Data Exchange (ETDEWEB)

Saad, Mahmoud M.; Abdallah, Tamer [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt); Easawi, Khalid; Negm, Sohair [Department of Physics and Mathematics, Faculty of Engineering (Shoubra), Benha University (Egypt); Talaat, Hassan, E-mail: hassantalaat@hotmail.com [Physics Department, Faculty of Science, Ain Shams University, Abbassia, Cairo (Egypt)

2015-05-15

Graphical abstract: - Highlights: • Comparing band gaps values obtained optically with STS. • Comparing direct imaging with calculated dimensions. • STS determination of the interfacial band bending of metal/chalcogenide. - Abstract: The electronic structure at the interface of chalcogenide/metal hybrid nanostructure (CdSe–Au tipped) had been studied by UHV scanning tunneling spectroscopy (STS) technique at room temperature. This nanostructure was synthesized by a phase transfer chemical method. The optical absorption of this hybrid nanostructure was recorded, and the application of the effective mass approximation (EMA) model gave dimensions that were confirmed by the direct measurements using the scanning tunneling microscopy (STM) as well as the high-resolution transmission electron microscope (HRTEM). The energy band gap obtained by STS agrees with the values obtained from the optical absorption. Moreover, the STS at the interface of CdSe–Au tipped hybrid nanostructure between CdSe of size about 4.1 ± 0.19 nm and Au tip of size about 3.5 ± 0.29 nm shows a band bending about 0.18 ± 0.03 eV in CdSe down in the direction of the interface. Such a result gives a direct observation of the electron accumulation at the interface of CdSe–Au tipped hybrid nanostructure, consistent with its energy band diagram. The presence of the electron accumulation at the interface of chalcogenides with metals has an important implication for hybrid nanoelectronic devices and the newly developed plasmon/chalcogenide photovoltaic solar energy conversion.

Teachers' learning on the workshop of STS approach as a way of enhancing inventive thinking skills

Science.gov (United States)

Ngaewkoodrua, Nophakun; Yuenyong, Chokchai

2018-01-01

To improve science teachers to develop the STS lesson plans for enhancing the students' inventive thinking skills, the workshop of improving science teachers to develop the STS lesson plans for enhancing the Inventive thinking skills were organized. The paper aimed to clarify what teachers learn from the workshop. The goal of the activity of the workshop aimed to: 1) improve participants a better understanding of the relationship between the Inquiry based learning with STS approach, 2) understand the meaning and importance of the STS approach and identify the various stages of Yuenyong (2006) STS learning process, 3) discuss what they learned from the examples of Yuenyong (2006) lesson plan, 4) develop some activities for each stage of Yuenyong (2006) STS approach, and 5) ideas of providing STS approach activities for enhancing inventive thinking skills. Participants included 3 science teachers who work in Khon Kaen, Thailand. Methodology regarded interpretive paradigm. Teachers' learning about pedagogy of enhancing the students' inventive thinking skills will be interpreted through participant observation, teachers' tasks, and interview. The finding revealed that all participants could demonstrate their ideas how to generate the STS lesson plans as a way of enhancing inventive thinking skills. Teachers could mention some element of inventive thinking skills which could be generated on their STS learning activities.

33 CFR 117.824 - Neuse River.

Science.gov (United States)

2010-07-01

... OPERATION REGULATIONS Specific Requirements North Carolina § 117.824 Neuse River. (a) The draw of the U.S... for public vessels of the United States. (4) Shall open on signal at all other times. (b) The draw of the Atlantic and East Carolina Railway bridge, mile 80.0 at Kinston, shall open on signal if at least...

Search for positive parity bands in 117Xe

International Nuclear Information System (INIS)

Liu, Z.; Sun, X.; Zhou, X.; Lei, X.; Zhang, Y.; Jin, H.; Pan, Q.; Guo, Y.; Chen, X.; Luo, Y.; Wen, S.; Yuan, G.; Yang, C.; Luo, W.; Chen, Y.S.; Xing, Z.; Chen, X.Q.

1995-01-01

Excited states of 117 Xe were populated via the reaction 28 Si+ 92 Mo at 100-120MeV. More than 40 new γ-transitions and three new positive parity bands have been observed by means of in-beam γ-ray spectroscopy. The previously known νh 11/2 bands were confirmed, and the νg 7/2 favored band was extended up to 47/2 + in which two bandcrossings have been observed at hω=0.33 and 0.44MeV, respectively. The band structures have been discussed by means of TRS and CSM calculations. A newly observed rotational band consisting of five γ-transitions has been considered as the πh 11/2 band of 117 Cs. ((orig.))

Basic requirements of dosemeter systems for individual monitoring of external radiation

International Nuclear Information System (INIS)

Boehm, J.; Ambrosi, P.

1985-01-01

A plea is made for detailed detector independent requirements for dosemeter systems for individual monitoring of external radiation. These requirements should have their origin in the fundamental aspects and concepts of radiation protection for workers, and should be something like a translation of the general principles of individual monitoring into a language easily understandable by producers and users. This work comprises a summary of the general objectives of individual monitoring and discussion of some relevant requirements for dosemeter systems. (orig.) [de

Production of Sn-117m in the BR2 high-flux reactor.

Science.gov (United States)

Ponsard, B; Srivastava, S C; Mausner, L F; Russ Knapp, F F; Garland, M A; Mirzadeh, S

2009-01-01

The BR2 reactor is a 100MW(th) high-flux 'materials testing reactor', which produces a wide range of radioisotopes for various applications in nuclear medicine and industry. Tin-117m ((117m)Sn), a promising radionuclide for therapeutic applications, and its production have been validated in the BR2 reactor. In contrast to therapeutic beta emitters, (117m)Sn decays via isomeric transition with the emission of monoenergetic conversion electrons which are effective for metastatic bone pain palliation and radiosynovectomy with lesser damage to the bone marrow and the healthy tissues. Furthermore, the emitted gamma photons are ideal for imaging and dosimetry.

CD117 expression in fibroblasts-like stromal cells indicates unfavorable clinical outcomes in ovarian carcinoma patients.

Directory of Open Access Journals (Sweden)

Ruixia Huang

Full Text Available The stem cell factor (SCF receptor CD117 (c-kit, is widely used for identification of hematopoietic stem cells and cancer stem cells. Moreover, CD117 expression in carcinoma cells indicates a poor prognosis in a variety of cancers. However the potential expression in tumor microenvironment and the biological and clinical impact are currently not reported. The expression of CD117 was immunohistochemically evaluated in a serial of 242 epithelial ovarian cancer (EOC cases. Thirty-eight out of 242 cases were CD117 positive in fibroblast-like stromal cells and 22 cases were positive in EOC cells. Four cases were both positive in fibroblast-like stromal cells and EOC cells for CD117. CD117 expression in fibroblast-like stromal cells in ovarian carcinoma was closely linked to advanced FIGO stage, poor differentiation grade and histological subtype (p<0.05, and it was significantly associated with poor overall survival (OS and progression free survival (PFS (Kaplan-Meier analysis; p<0.05, log-rank test. CD117 expression in ovarian carcinoma cells was not associated with these clinicopathological variables. The CD117 positive fibroblast-like stromal cells were all positive for mesenchymal stem/stromal cell (MSC marker CD73 but negative for fibroblast markers fibroblast activation protein (FAP and α smooth muscle actin (α-SMA, indicating that the CD117+/CD73+ fibroblast-like stromal cells are a subtype of mesenchymal stem cells in tumor stroma, although further characterization of these cells are needed. It is concluded herewith that the presence of CD117+/CD73+ fibroblast-like stromal cells in ovarian carcinoma is an unfavorable clinical outcome indication.

Modeling dynamic behavior of superconducting maglev systems under external disturbances

Science.gov (United States)

Huang, Chen-Guang; Xue, Cun; Yong, Hua-Dong; Zhou, You-He

2017-08-01

For a maglev system, vertical and lateral displacements of the levitation body may simultaneously occur under external disturbances, which often results in changes in the levitation and guidance forces and even causes some serious malfunctions. To fully understand the effect of external disturbances on the levitation performance, in this work, we build a two-dimensional numerical model on the basis of Newton's second law of motion and a mathematical formulation derived from magnetoquasistatic Maxwell's equations together with a nonlinear constitutive relation between the electric field and the current density. By using this model, we present an analysis of dynamic behavior for two typical maglev systems consisting of an infinitely long superconductor and a guideway of different arrangements of infinitely long parallel permanent magnets. The results show that during the vertical movement, the levitation force is closely associated with the flux motion and the moving velocity of the superconductor. After being disturbed at the working position, the superconductor has a disturbance-induced initial velocity and then starts to periodically vibrate in both lateral and vertical directions. Meanwhile, the lateral and vertical vibration centers gradually drift along their vibration directions. The larger the initial velocity, the faster their vibration centers drift. However, the vertical drift of the vertical vibration center seems to be independent of the direction of the initial velocity. In addition, due to the lateral and vertical drifts, the equilibrium position of the superconductor in the maglev systems is not a space point but a continuous range.

47 CFR 15.117 - TV broadcast receivers.

Science.gov (United States)

2010-10-01

... Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES Unintentional Radiators § 15.117... approximately the same degree of tuning accuracy with approximately the same expenditure of time and effort... to simplify, expedite or perfect the reception of television signals (e.g., AFC, visual aids, remote...

33 CFR 117.822 - Beaufort Channel, NC.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

STS-93 Commander Collins suits up before launch

Science.gov (United States)

1999-01-01

In the Operations and Checkout Building, STS-93 Commander Eileen M. Collins gets help donning her launch and entry suit. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

Astronaut Heidemarie M. Stefanyshyn-Piper During STS-115 Training

Science.gov (United States)

2005-01-01

Wearing a training version of the shuttle launch and entry suit, STS-115 astronaut and mission specialist, Heidemarie M. Stefanyshyn-Piper, puts the final touches on her suit donning process prior to the start of a water survival training session in the Neutral Buoyancy Laboratory (NBL) near Johnson Space Center. Launched on September 9, 2006, the STS-115 mission continued assembly of the International Space Station (ISS) with the installation of the truss segments P3 and P4.

STS-93 Mission Specialist Hawley suits up for launch

Science.gov (United States)

1999-01-01

For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Steven A. Hawley (Ph.D.) waves after donning his launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Hawley, Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

EuroSCORE II and STS as mortality predictors in patients undergoing TAVI

Directory of Open Access Journals (Sweden)

Vitor Emer Egypto Rosa

2016-02-01

Full Text Available SUMMARY Introduction: the EuroSCORE II and STS are the most used scores for surgical risk stratification and indication of transcatheter aortic valve implantation (TAVI. However, its role as a tool for mortality prediction in patients undergoing TAVI is still unclear. Objective: to evaluate the performance of the EuroSCORE II and STS as predictors of in-hospital and 30-day mortality in patients undergoing TAVI. Methods: we included 59 symptomatic patients with severe aortic stenosis that underwent TAVI between 2010 and 2014. The variables were analyzed using Student's t-test and Fisher's exact test and the discriminative power was evaluated using receiver operating characteristic curve (ROC and area under the curve (AUC with a 95% confidence interval. Results: mean age was 81±7.3 years, 42.3% men. The mean EuroSCORE II was 7.6±7.3 % and STS was 20.7±10.3%. Transfemoral procedure was performed in 88.13%, transapical in 3.38% and transaortic in 8.47%. In-hospital mortality was 10.1% and 30-day mortality was 13.5%. Patients who died had EuroSCORE II and STS higher than the survivors (33.7±16.7vs. 18.6±7.3% p=0,0001 for STS and 13.9±16.1 vs. 4.8±3.8% p=0.0007 for EuroSCORE II. The STS showed an AUC of 0.81 and the EuroSCORE II of 0.77 and there were no differences in the discrimination ability using ROC curves (p=0.72. Conclusion: in this cohort, the STS and EuroSCORE II were predictors of in-hospital and 30-days mortality in patients with severe aortic stenosis undergoing TAVI.

46 CFR 117.205 - Survival craft-vessels operating on limited coastwise routes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on limited coastwise... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.205 Survival craft... the survival craft required by §§ 117.204 (a) through (d) of this part, as applicable. (b) Each vessel...

Modeling external constraints: Applying expert systems to nuclear plants

International Nuclear Information System (INIS)

Beck, C.E.; Behera, A.K.

1993-01-01

Artificial Intelligence (AI) applications in nuclear plants have received much attention over the past decade. Specific applications that have been addressed include development of models and knowledge-bases, plant maintenance, operations, procedural guidance, risk assessment, and design tools. This paper examines the issue of external constraints, with a focus on the use of Al and expert systems as design tools. It also provides several suggested methods for addressing these constraints within the Al framework. These methods include a State Matrix scheme, a layered structure for the knowledge base, and application of the dynamic parameter concept

Marital conflict and children's externalizing behavior: interactions between parasympathetic and sympathetic nervous system activity

National Research Council Canada - National Science Library

El-Sheikh, Mona; Beauchaine, Theodore P; Moore, Ginger A

2009-01-01

"Toward greater specificity in the prediction of externalizing problems in the context of interparental conflict, interactions between children's parasympathetic and sympathetic nervous system (PNS and SNS...

Accounting for external costs in a study of a Swedish district-heating system - An assessment of environmental policies

International Nuclear Information System (INIS)

Fahlen, E.; Ahlgren, E.O.

2010-01-01

Sweden has historically had strict emission control by implementation of economic policy instruments with the aim of internalising the external costs of air pollution. This study aims to evaluate how well current Swedish policy instruments reflect the environmental costs associated with heat generation in several district-heating (DH) plants in the DH system of Goeteborg. Furthermore, it aims to simulate and evaluate the operation of the DH system based on its social cost-effectiveness which takes into account the DH system's private and external costs (non-internalised environmental costs). The study shows that the economic policy instruments do not fully internalise all external costs whereas for certain technologies, the costs in terms of taxes, emission permits, environmental fees, etc. are higher than the environmental costs caused by the pollutants, given the environmental cost estimates used in the study. The simulation results show that the deviating internalisation of external costs affects the economic ranking of the different plants within the studied DH system. The estimated loss in social-cost effectiveness of the operation of the DH system of Goeteborg is noticable but relatively small if compared to the variable heat generation costs for most of the studied DH plants.

STS-90 Pilot Scott Altman in white room before launch

Science.gov (United States)

1998-01-01

STS-90 Pilot Scott Altman is assisted by NASA and USA closeout crew members immediately preceding launch for the nearly 17-day Neurolab mission. Investigations during the Neurolab mission will focus on the effects of microgravity on the nervous system. Linnehan and six fellow crew members will shortly enter the orbiter at KSC's Launch Pad 39B, where the Space Shuttle Columbia will lift off during a launch window that opens at 2:19 p.m. EDT, April 17.

Survival and compound nucleus probability of super heavy element Z = 117

International Nuclear Information System (INIS)

Manjunatha, H.C.; Sridhar, K.N.

2017-01-01

As a part of a systematic study for predicting the most suitable projectile-target combinations for heavy-ion fusion experiments in the synthesis of "2"8"9"-"2"9"7Ts, we have calculated the transmission probability (T_l), compound nucleus formation probabilities (P_C_N) and survival probability (P_s_u_r) of possible projectile-target combinations. We have also studied the fusion cross section, survival cross section and fission cross sections for different projectile-target combination of "2"8"9"-"2"9"7Ts. These theoretical parameters are required before the synthesis of the super heavy element. The calculated probabilities and cross sections show that the production of isotopes of the super heavy element with Z = 117 is strongly dependent on the reaction systems. The most probable reactions to synthetize the super heavy nuclei "2"8"9"-"2"9"7Ts are worked out and listed explicitly. We have also studied the variation of P_C_N and P_s_u_r with the mass number of projectile and target nuclei. This work is useful in the synthesis of the super heavy element Z = 117. (orig.)

Development of a real-time internal and external marker tracking system for particle therapy: a phantom study using patient tumor trajectory data.

Science.gov (United States)

Cho, Junsang; Cheon, Wonjoong; Ahn, Sanghee; Jung, Hyunuk; Sheen, Heesoon; Park, Hee Chul; Han, Youngyih

2017-09-01

Target motion-induced uncertainty in particle therapy is more complicated than that in X-ray therapy, requiring more accurate motion management. Therefore, a hybrid motion-tracking system that can track internal tumor motion and as well as an external surrogate of tumor motion was developed. Recently, many correlation tests between internal and external markers in X-ray therapy have been developed; however, the accuracy of such internal/external marker tracking systems, especially in particle therapy, has not yet been sufficiently tested. In this article, the process of installing an in-house hybrid internal/external motion-tracking system is described and the accuracy level of tracking system was acquired. Our results demonstrated that the developed in-house external/internal combined tracking system has submillimeter accuracy, and can be clinically used as a particle therapy system as well as a simulation system for moving tumor treatment. © The Author 2017. Published by Oxford University Press on behalf of The Japan Radiation Research Society and Japanese Society for Radiation Oncology.

41 CFR 102-117.100 - What business rules must I consider before acquiring transportation or related services?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What business rules must... Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 117-TRANSPORTATION MANAGEMENT Business Rules To Consider...

STS-46 Atlantis', OV-104's, vertical tail and OMS pods lit up by RCS jet firing

Science.gov (United States)

1992-01-01

STS-46 Atlantis', Orbiter Vehicle (OV) 104's, vertical tail and orbital maneuvering system (OMS) pods are highlighted by the glow of the reaction control system (RCS) jet firings. OV-104 was at an altitude of 128 nautical miles. The remote manipulator system (RMS) arm is partially visible stowed along the port side sill longeron.

STS-101 Crew Interview / Scott Horowitz

Science.gov (United States)

2000-01-01

Live footage of a preflight interview with Pilot Scott J. Horowitz is seen. The interview addresses many different questions including why Horowitz became an astronaut, the events that led to his interest, any role models that he had, and his inspiration. Other interesting information that this one-on-one interview discusses is the reaction and reasons for the splitting-up of the objectives for STS-101 with STS-106. Horowitz also mentions the scheduled space-walk, docking with the International Space Station (ISS), the new glass cockpit of Atlantis, the repairs of equipment and change of the batteries. Horowitz also discusses his responsibilities during the space-walk, and docking of the spacecraft. He stresses that he will have an added challenge during the space-walk, his inability to see where he needs to place the Extravehicular Activities (EVA) crew.

Biologically inspired information theory: Adaptation through construction of external reality models by living systems.

Science.gov (United States)

Nakajima, Toshiyuki

2015-12-01

Higher animals act in the world using their external reality models to cope with the uncertain environment. Organisms that have not developed such information-processing organs may also have external reality models built in the form of their biochemical, physiological, and behavioral structures, acquired by natural selection through successful models constructed internally. Organisms subject to illusions would fail to survive in the material universe. How can organisms, or living systems in general, determine the external reality from within? This paper starts with a phenomenological model, in which the self constitutes a reality model developed through the mental processing of phenomena. Then, the it-from-bit concept is formalized using a simple mathematical model. For this formalization, my previous work on an algorithmic process is employed to constitute symbols referring to the external reality, called the inverse causality, with additional improvements to the previous work. Finally, as an extension of this model, the cognizers system model is employed to describe the self as one of many material entities in a world, each of which acts as a subject by responding to the surrounding entities. This model is used to propose a conceptual framework of information theory that can deal with both the qualitative (semantic) and quantitative aspects of the information involved in biological processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Next Generation Qualification: Kinemetrics STS-5A Seismometer Evaluation

Energy Technology Data Exchange (ETDEWEB)

Merchant, Bion John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Slad, George William [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2017-10-01

Sandia National Laboratories has tested and evaluated two seismometers, the STS-5A, manufactured by Kinemetrics. These seismometers measure three axes of broadband ground velocity using a UVW configuration with feedback control in a mechanically levelled borehole package. The purpose of the seismometer evaluation was to determine a measured sensitivity, response, self-noise, dynamic range, and self-calibration ability. The Kinemetrics STS-5A seismometers are being evaluated for the U.S. Air Force as part of their Next Generation Qualification effort.

Sheehan Suicidality Tracking Scale (S-STS): reliability, convergent and discriminative validity in young Italian adults.

Science.gov (United States)

Preti, Antonio; Sheehan, David V; Coric, Vladimir; Distinto, Marco; Pitanti, Mirko; Vacca, Irene; Siddi, Alessandra; Masala, Carmelo; Petretto, Donatella Rita

2013-10-01

The Sheehan Suicidality Tracking Scale (S-STS) is a patient self-report or clinician-administered rating scale that tracks spontaneous and treatment-emergent suicidal ideation and behaviors. This study set out to evaluate the reliability, convergent and divergent validity of the S-STS in a sample of college students, a population with a high risk of completed and attempted suicide. Cross-sectional, survey design. Participants (303 undergraduate students; males: 42%) completed several measures assessing psychological distress (General Health Questionnaire; GHQ); self-esteem (Rosenberg Self Esteem Scale; RSES); social support (Modified Social Support Survey; MOSSS); and suicidal behavior, including ideation and attempts (S-STS). Both internal consistency and test-retest stability were excellent for the S-STS-global score. The S-STS subscale on suicide ideation also showed good reliability, while the subscale on suicidal behavior showed some inconsistency at retest. Convergent and divergent validity of S-STS was confirmed. All S-STS items loaded on a single factor, which had an excellent fit for the unidimensional model, thus justifying the use of the S-STS as a screening tool. In a mediation model, self-esteem and social support explained 45% of the effects of psychological distress on suicide ideation and behavior as measured by the S-STS-global score. This study provided promising evidence on the convergent, divergent, internal consistency and test-retest stability of the Sheehan Suicidality Tracking Scale. The cross-sectional design and lack of measures of hopelessness and helplessness prevent any conclusion about the links of suicidal behavior with self-esteem and social support. Copyright © 2013 Elsevier Inc. All rights reserved.

Complex dynamics in three-well duffing system with two external forcings

International Nuclear Information System (INIS)

Jing Zhujun; Huang Jicai; Deng Jin

2007-01-01

Three-well duffing system with two external forcing terms is investigated. The criterion of existence of chaos under the periodic perturbation is given by using Melnikov's method. By using second-order averaging method and Melnikov's method we proved the criterion of existence of chaos in averaged systems under quasi-periodic perturbation for ω 2 = nω 1 + εν, n = 1, 3, 5, and cannot prove the criterion of existence of chaos in second-order averaged system under quasi-periodic perturbation for ω 2 = nω 1 + εν, n = 2, 4, 6, 7, 8, 9, 10, 11, 12, where ν is not rational to ω 1 , but can show the occurrence of chaos in original system by numerical simulation. Numerical simulations including heteroclinic and homoclinic bifurcation surfaces, bifurcation diagrams, maximum Lyapunov exponents and Poincare map are given to illustrate the theoretical analysis, and to expose the more new complex dynamical behaviors. We show that cascades of period-doubling bifurcations from period-one to four orbits, cascades of interlocking period-doubling bifurcations from period-two orbits of two sets, from quasi-periodicity leading to chaos, onset of chaos which occurs more than one, interleaving occurrences of chaotic behavior and invariant torus, transient chaos with complex period windows and interior crisis, chaos converting to torus, different kind of chaotic attractors. Our results shows that the dynamical behaviors are different from the dynamics of duffing equation with two-well and two external forcings

19 CFR 200.735-117 - Supplementary statements.

Science.gov (United States)

2010-04-01

... under this section, each employee shall at all times avoid acquiring a financial interest that could... CONDUCT Provisions Governing Statements of Employment and Financial Interests § 200.735-117 Supplementary... and financial interests shall be reported in a supplementary statement as of June 30 each year. If no...

Astronaut Terry J. Hart in training session RMS for STS-2 bldg 29

Science.gov (United States)

1981-01-01

Astronaut Terry J. Hart in training session with the Remote Manipulator System (RMS) for STS-2 bldg 29. Views show Truly working at the command console while watching out the windows. Karen Ehlers, an RMS procedures specialist, can be seen at left side of frame while Astronaut Sally Ride waits on right for her time at the RMS.

The sustainability paradigm and the STS approach: mediations for science education

Directory of Open Access Journals (Sweden)

Elizandra Rêgo de Vasconcelos

2012-12-01

Full Text Available The society has been confronted with issues that involve interactions between science, technology and society (STS, which reveal social, economic, environmental, ethical implications, among others. The sustainability paradigm occupies a prominent position in this area. We understand that the STS guidelines are an important instrument for building the concept of sustainability in science education, whose perspectives consistent with the formation of citizens with environmental sensitivity-citizens who are able to analyze and evaluate critically issues related to the social, environmental and economic field, among other aspects. We propose, in this article, to discuss the possible links between the sustainability paradigm, the STS approach and the process of teaching and learning in science. This articulation certainly helps to think the implications of the current development model and the relationships STS, inserted, for example, on various issues, contexts, dimensions, knowledge and teaching strategies. Certainly, we must undertake the effort to approximate the natural and social fields, in the apprehension of the complex reality as it stands nowadays

Views of STS-4 crew during a training session in the SMS

Science.gov (United States)

1982-01-01

Views of STS-4 crew during a training session in the Shuttle Mission Simulator (SMS) in bldg 5. Astronauts Thomas K. Mattingly, II. (left) and Henry W. Hartsfield, Jr., commander and pilot respectively for STS-4 get in some training time in the SMS.

Views of STS-5 crew during a training session in the SMS

Science.gov (United States)

1982-01-01

Views of STS-5 crew during a training session in the Shuttle Mission Simulator (SMS). Astronaut Robert F. Overmyer, STS-5 pilot, participates in training session wearing a communications kit assembly (ASSY). He is dressed in regular flight suit and is studying flight documentation.

33 CFR 117.801 - Newtown Creek, Dutch Kills, English Kills and their tributaries.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newtown Creek, Dutch Kills, English Kills and their tributaries. 117.801 Section 117.801 Navigation and Navigable Waters COAST GUARD....801 Newtown Creek, Dutch Kills, English Kills and their tributaries. (a) The following requirements...

Impulsive synchronization of Roessler systems with parameter driven by an external signal

International Nuclear Information System (INIS)

Zhang Rong; Hu Manfeng; Xu Zhenyuan

2007-01-01

In this Letter, an impulsive control scheme is presented to control two uncoupled identical Roessler systems. By driving the parameter of Roessler systems using external chaotic signal or periodic signal, chaotic synchronization and periodic synchronization can be implemented. This is a special impulsive control, but by using the existing results of impulsive control theory, a less conservative estimation of the upper bound of the impulse interval is given, which can guarantee the global asymptotical stability for the impulsive synchronization of Roessler systems. Numerical results are in accord with our estimation

RESTOP: Retaining External Peripheral State in Intermittently-Powered Sensor Systems.

Science.gov (United States)

Rodriguez Arreola, Alberto; Balsamo, Domenico; Merrett, Geoff V; Weddell, Alex S

2018-01-10

Energy harvesting sensor systems typically incorporate energy buffers (e.g., rechargeable batteries and supercapacitors) to accommodate fluctuations in supply. However, the presence of these elements limits the miniaturization of devices. In recent years, researchers have proposed a new paradigm, transient computing, where systems operate directly from the energy harvesting source and allow computation to span across power cycles, without adding energy buffers. Various transient computing approaches have addressed the challenge of power intermittency by retaining the processor's state using non-volatile memory. However, no generic approach has yet been proposed to retain the state of peripherals external to the processing element. This paper proposes RESTOP, flexible middleware which retains the state of multiple external peripherals that are connected to a computing element (i.e., a microcontroller) through protocols such as SPI or I 2 C. RESTOP acts as an interface between the main application and the peripheral, which keeps a record, at run-time, of the transmitted data in order to restore peripheral configuration after a power interruption. RESTOP is practically implemented and validated using three digitally interfaced peripherals, successfully restoring their configuration after power interruptions, imposing a maximum time overhead of 15% when configuring a peripheral. However, this represents an overhead of only 0.82% during complete execution of our typical sensing application, which is substantially lower than existing approaches.

STS-93 Mission Specialist Cady Coleman suits up for launch

Science.gov (United States)

1999-01-01

For the third time, during final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Catherine G. Coleman (Ph.D.) dons her launch and entry suit. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Coleman, and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS-93 Pilot Ashby suits up before launch

Science.gov (United States)

1999-01-01

In the Operations and Checkout Building during final launch preparations for the second time, STS-93 Pilot Jeffrey S. Ashby waves after donning his launch and entry suit while a suit tech adjusts his boot. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS- 93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X-ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Eileen M. Collins, Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

THE ROLE OF THE EUROPEAN EXTERNAL ACTION SERVICE IN THE EU’S INSTITUTIONAL SYSTEM

Directory of Open Access Journals (Sweden)

DAN VATAMAN

2012-05-01

Full Text Available European External Action Service (EEAS is a new institution of the European Union, whose foundation was laid by the Treaty of Lisbon with the role to support the High Representative of the Union for Foreign Affairs and Security Policy in fulfilling his mandate and, also to assist the President of the European Council, European Commission, President and other Commissioners to exercise their powers in international relations. Since the establishment of the European External Action Service (EEAS is relatively recent, this article tries to highlight the crucial role of the European External Action Service (EEAS in the European Union's institutional system and its contribution to strengthening the coherence and increasing impact and visibility of European Union action at international level and thus the one of the Member States.

Hardness Enhancement of STS304 Deposited with Yttria Stabilized Zirconia by Aerosol Deposition Method

Energy Technology Data Exchange (ETDEWEB)

Lim, Il-Ho; Park, Chun-Kil; Kim, Hyung Sun; Jeong, Dea-Yong [Inha University, Incheon (Korea, Republic of); Lee, Yong-Seok [Sodoyeon Co., Yeoju (Korea, Republic of); Kong, Young-Min [University of Ulsan, Ulsan (Korea, Republic of); Kang, Kweon Ho [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2016-03-15

To improve the surface hardness of the STS304, Yttria stabilized zirconia (YSZ) films with nano-sized grain were deposited by an aerosol-deposition (AD) method. Coating layers showed dense structure and had -5µm thickness. When 3 mol% YSZ powders with tetragonal phase were deposited on STS304 substrate, tetragonal structure was transformed to cubic structure due to the high impact energy during the AD process. At the same time, strong impact by YSZ particles allowed the austenite phase in STS304 to be transformed into martensite phase. Surface hardness measured with nano indentor showed that YSZ coated film had 11.5 GPa, which is larger value than 7 GPa of STS304.

STS-76 Payload Cmdr Ronald Sega suits up

Science.gov (United States)

1996-01-01

STS-76 Payload Commander Ronald M. Sega is donning his launch/entry suit in the Operations and Checkout Building with assistance from a suit technician. The third docking between the Russian Space Station Mir and the U.S. Space Shuttle marks the second trip into space for Sega, who recently served a five-month assignment in Russia as operations director for NASA activities there. Once suitup activities are completed the six-member STS-76 flight crew will depart for Launch Pad 39B, where the Space Shuttle Atlantis is undergoing final preparations for liftoff during an approximately seven-minute launch window opening around 3:13 a.m. EST, March 22.

STS-114: Discovery TCDT Flight Crew Test Media Event at Pad 39-B

Science.gov (United States)

2005-01-01

The STS-114 Space Shuttle Discovery Terminal Countdown Demonstration Test (TCDT) flight crew is shown at Pad 39-B. Eileen Collins, Commander introduces the astronauts. Andrew Thomas, mission specialist talks about his primary responsibility of performing boom inspections, Wendy Lawrence, Mission Specialist 4 (MS4) describes her role as the robotic arm operator supporting Extravehicular Activities (EVA), Stephen Robinson, Mission Specialist 3 (MS3) talks about his role as flight engineer, Charlie Camarda, Mission Specialist 5 (MS5) says that his duties are to perform boom operations, transfer operations from the space shuttle to the International Space Station and spacecraft rendezvous. Soichi Noguchi, Mission Specialist 1 (MS1) from JAXA, introduces himself as Extravehicular Activity 1 (EVA1), and Jim Kelley, Pilot will operate the robotic arm and perform pilot duties. Questions from the news media about the safety of the external tank, going to the International Space Station and returning, EVA training, and thoughts about the Space Shuttle Columbia crew are answered.

Externality or sustainability economics?

International Nuclear Information System (INIS)

Bergh, Jeroen C.J.M. van den

2010-01-01

In an effort to develop 'sustainability economics' Baumgaertner and Quaas (2010) neglect the central concept of environmental economics-'environmental externality'. This note proposes a possible connection between the concepts of environmental externality and sustainability. In addition, attention is asked for other aspects of 'sustainability economics', namely the distinction weak/strong sustainability, spatial sustainability and sustainable trade, distinctive sustainability policy, and the ideas of early 'sustainability economists'. I argue that both sustainability and externalities reflect a systems perspective and propose that effective sustainability solutions require that more attention is given to system feedbacks, notably other-regarding preferences and social interactions, and energy and environmental rebound. The case of climate change and policy is used to illustrate particular statements. As a conclusion, a list of 20 insights and suggestions for research is offered. (author)

Functional study of the novel multidrug resistance gene HA117 and its comparison to multidrug resistance gene 1

Directory of Open Access Journals (Sweden)

Chen Tingfu

2010-07-01

Full Text Available Abstract Background The novel gene HA117 is a multidrug resistance (MDR gene expressed by all-trans retinoic acid-resistant HL-60 cells. In the present study, we compared the multidrug resistance of the HA117 with that of the classical multidrug resistance gene 1 (MDR1 in breast cancer cell line 4T1. Methods Transduction of the breast cancer cell line 4T1 with adenoviral vectors encoding the HA117 gene and the green fluorescence protein gene (GFP (Ad-GFP-HA117, the MDR1 and GFP (Ad-GFP-MDR1 or GFP (Ad-GFP was respectively carried out. The transduction efficiency and the multiplicity of infection (MOI were detected by fluorescence microscope and flow cytometry. The transcription of HA117 gene and MDR1 gene were detected by reverse transcription polymerase chain reaction (RT-PCR. Western blotting analysis was used to detect the expression of P-glycoprotein (P-gp but the expression of HA117 could not be analyzed as it is a novel gene and its antibody has not yet been synthesized. The drug-excretion activity of HA117 and MDR1 were determined by daunorubicin (DNR efflux assay. The drug sensitivities of 4T1/HA117 and 4T1/MDR1 to chemotherapeutic agents were detected by Methyl-Thiazolyl-Tetrazolium (MTT assay. Results The transducted efficiency of Ad-GFP-HA117 and Ad-GFP-MDR1 were 75%-80% when MOI was equal to 50. The transduction of Ad-GFP-HA117 and Ad-GFP-MDR1 could increase the expression of HA117 and MDR1. The drug resistance index to Adriamycin (ADM, vincristine (VCR, paclitaxel (Taxol and bleomycin (BLM increased to19.8050, 9.0663, 9.7245, 3.5650 respectively for 4T1/HA117 and 24.2236, 11.0480, 11.3741, 0.9630 respectively for 4T1/MDR1 as compared to the control cells. There were no significant differences in drug sensitivity between 4T1/HA117 and 4T1/MDR1 for the P-gp substrates (ADM, VCR and Taxol (P Conclusions These results confirm that HA117 is a strong MDR gene in both HL-60 and 4T1 cells. Furthermore, our results indicate that the MDR

STS-95 Mission Specialist Pedro Duque in white room

Science.gov (United States)

1998-01-01

In the environmental chamber known as the white room, STS-95 Mission Specialist Pedro Duque of Spain, with the European Space Agency, is prepared by white room crew members Danny Wyatt (left) and Travis Thompson (right) for entry into the Space Shuttle Discovery for his first flight into space. The STS-95 mission, targeted for launch at 2 p.m. EST on Oct. 29, is expected to last 8 days, 21 hours and 49 minutes, and return to KSC at 11:49 a.m. EST on Nov. 7.

External Beam Radiotherapy for Carcinoma of the Extrahepatic Biliary System

International Nuclear Information System (INIS)

Chun, Ha Chung; Lee, Myung Za

1996-01-01

Purpose : To evaluate the effectiveness and tolerance of patients of external beam radiotherapy of carcinoma of the extrahepatic biliary system (EHBS) including gall bladder (GB) and extrahepatic bile ducts (EHBD) and to define the role of radiotherapy for these tumors. Methods and Materials : We retrospectively analyzed the records of 43 patients with carcinoma of the EHBS treated with external beam radiotherapy at our institution between April, 1986 and July, 1994. Twenty three patients had GB cancers and remaining 20 patients did EHBD cancers. Of those 23 GB cancers, 2 had Stage II, 12 did Stage III and 9 did Stage IV disease, respectively. Male to female ratio was 11 to 12. Fifteen patients underwent radical surgery with curative intent and 8 patients did biopsy and bypass surgery alone. Postoperatively 16 patients were irradiated with 4500 cGy or higher doses and 4 patients with 3180 to 4140 cGy. Follow up periods ranged from 8 to 34 months. Results : overall median survival time of patients with GB cancer was 11 months. Median survival time for patients with Stage III and IV disease were 14 months and 5 months, respectively. Corresponding two year survival rates were 36%(4/11) and 13%(1/8), respectively. Those who underwent surgery with curative intent showed significantly better survival at 12 months than those who underwent bypass surgery alone(67% vs 13%). None of the patients died of treatment related complications. Median survival time for entire group of 20 EHBD patients was 10 months. Median survivals of 10 Stage III and 7 Stage IV disease were 10 and 8 months, respectively. Two patients who underwent Whipple's procedure had 11 and 14 month survival and those treated with resection and drainage showed median survival of 10 month. Conclusion : Postoperative external beam radiotherapy for carcinoma of the extrahepatic billary system is well tolerated and might improve survival of patients. especially those with respectable lesions with microscopic or

The external leadership of self-managing teams: intervening in the context of novel and disruptive events.

Science.gov (United States)

Morgeson, Frederick P

2005-05-01

Relatively little empirical research has been conducted on external leaders of self-managing teams. The integration of functional leadership theory with research on team routines suggests that leaders can intervene in teams in several different ways, and the effectiveness of this intervention depends on the nature of the events the team encounters. External team leaders from 3 organizations first described a series of events (N=117), and leaders and team members then completed surveys to quantitatively describe the events. Results indicated that leader preparation and supportive coaching were positively related to team perceptions of leader effectiveness, with preparation becoming more strongly related to effectiveness as event novelty increased. More active leader intervention activities (active coaching and sense making) were negatively related to satisfaction with leadership yet were positively related to effectiveness as events became more disruptive.

Space Shuttle RCS Oxidizer Leak Repair for STS-26

Science.gov (United States)

Delventhal, R. A.; Faget, N. M.

1989-01-01

Following propellant loading of the Space Shuttle's reaction control system (RCS) for mission STS 26, an oxidizer leak was detected in the left orbital maneuvering system (OMS) pod, where the RCS is located. Subsequent investigation determined that the leak was isolated at a mechanical Dynatube fitting near the RCS nitrogen tetroxide tank. An intense effort was initiated to design, fabricate, and qualify a sealing device to stop the oxidizer leak externally so that the Space Shuttle launch could proceed. It was discovered that sealing devices called clamshells were widely used throughout the petrochemical and power generation industries to stop leaks developed in large diameter pipes which carry steam or other hazardous fluids. These clamshells are available in different diameters and strengths and are placed around the pipe at the location of the leak. A sealing compound is then injected under high pressure into the clamshell to stop the leak. This technology was scaled down and applied to the problem of stopping the leak on the Orbiter, which was on a half-inch diameter line in a nearly inaccessible location. Many obstacles had to be overcome such as determining that the sealing material would be compatible with the nitrogen tetroxide and ensuring that the clamshell would actually fit around the Dynatube fitting without interfering with other lines which were in close proximity. The effort at the NASA Johnson Space Center included materials compatibility testing of several sealants, design of a clamshell to fit in the confined compartment, and manufacture and qualification of the flight hardware. A clamshell was successfully placed around the Dynatube fitting on the Orbiter and the oxidizer leak was terminated. Then it was decided to apply this technology further and design clamshells for other mechanical fittings onboard the Orbiter and develop sealing compounds which will be compatible with fuels such as monomethyl hydrazine (MMH). The potential exists for

Economic effect of fusion in energy market. Various externalities of energy systems and the integrated evaluation

International Nuclear Information System (INIS)

Ito, Keishiro

2002-01-01

The primacy of a nuclear fusion reactor in a competitive energy market remarkably depends on to what extent the reactor contributes to reduce the externalities of energy. The reduction effects are classified into two effects, which have quite dissimilar characteristics. One is an effect of environmental dimensions. The other is related to energy security. In this study I took up the results of EC's ExternE project studies as a representative example of the former effect. Concerning the latter effect, I clarified the fundamental characteristics of externalities related to energy security and the conceptual framework for the purpose of evaluation. In the socio-economical evaluation of research into and development investments in nuclear fusions reactors, the public will require the development of integrated evaluation systems to support the cost-effect analysis of how well the reduction effects of externalities have been integrated with the effects of technological innovation, learning, spillover, etc. (author)

23 CFR 635.117 - Labor and employment.

Science.gov (United States)

2010-04-01

... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.117 Labor and employment. (a) No construction work shall... construction project from the time of award of the contract or the start of work on force account until final... outside the reservation. (f) The advertisement or call for bids on any contract for the construction of a...

Supernatant treatment system design through testing

International Nuclear Information System (INIS)

Ploetz, D.K.; Leonard, I.M.

1988-12-01

The main purpose of the Supernatant Treatment System (STS) is to remove more than 99.9 percent of the radioactive cesium (Cs-137) from the high-level waste stored in tank 8D-2. Cesium removal is accomplished in the STS by processing the supernatant (liquid) portion of the high-level waste through three or four ion exchange columns filled with zeolite. After treatment in the STS, the decontaminated supernatant is processed as low-level waste and finally encapsulated in cement for eventual disposal. The Cs-137 removed from the waste and absorbed onto zeolite ion exchange material is temporarily stored in tank 8D-1 until it can be encapsulated in glass and disposed of as high-level waste. This report discusses construction and testing of the STS. Design of the STS was started in 1982 in parallel with the selection of the ion exchange material. The construction of this system was accomplished in five phase in parallel with completion of design to allow for faster completion of the project. The existing high-level waste storage tanks -- 8D-1, 8D-2, and 8D-3 -- required major renovations to permit transfer of the high-level waste from tank 8D-2 to tank 8D-1, to house the components that comprise the STS in tank 8D-1, and to store decontaminated wastes in tank 8D-3. Testing in the STS started before construction was complete and was accomplished by first testing components individually. Then the system was retested using simulated supernatant. Integrated testing of the whole Integrated Radwaste Treatment System (IRTS), which includes the STS, Liquid Waste Treatment System (LWTS), Cement Solidification System (CSS), and the Drum Cell, was also performed using simulated supernatant. Finally, slightly radioactive condensate water from tank 8D-1 was processed. After successfully completing this testing, the STS started operations with radioactive supernatant on May 23, 1988. 21 refs., 33 figs., 21 tabs

STS-93 M.S. Michel Tognini suits up before launch

Science.gov (United States)

1999-01-01

For the third time, in the Operations and Checkout Building, STS- 93 Mission Specialist Michel Tognini of France, who represents the Centre National d'Etudes Spatiales (CNES), waves after donning his launch and entry suit during final launch preparations. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Tognini. Collins is the first woman to serve as commander of a shuttle mission.

The κ parameter and κ-distribution in κ-deformed statistics for the systems in an external field

International Nuclear Information System (INIS)

Guo, Lina; Du, Jiulin

2007-01-01

It is naturally important question for us to ask under what physical situation should the κ-deformed statistics be suitable for the statistical description of a system and what should the κ parameter stand for. In this Letter, a formula expression of κ parameter is derived on the basis of the κ-H theorem, the κ-velocity distribution and the generalized Boltzmann equation in the framework of κ-deformed statistics. We thus obtain a physical interpretation for the parameter κ 0 with regard to the temperature gradient and the external force field. We show, as the q-statistics based on Tsallis entropy, the κ-deformed statistics may also be the candidate one suitable for the statistical description of the systems in external fields when being in the nonequilibrium stationary state, but has different physical characteristics. Namely, the κ-distribution is found to describe the nonequilibrium stationary state of the system where the external force should be vertical to the temperature gradient

PID Based on Attractive Ellipsoid Method for Dynamic Uncertain and External Disturbances Rejection in Mechanical Systems

Directory of Open Access Journals (Sweden)

Jesus Patricio Ordaz Oliver

2015-01-01

Full Text Available This paper presents a stability analysis for LNDS (Lagrangian nonlinear dynamical systems with dynamic uncertain using a PID controller with external disturbances rejection based on attractive ellipsoid methods, since the PID-CT (proportional integral derivative computed torque compensator has been used for the nonlinear trajectory tracking of an LNDS, when there are external perturbations and system uncertainties. The global system convergence of the trivial solution has not been proved. In this sense, we propose an approach to find the gains of the nonlinear PID-CT controller to guarantee the boundedness of the trivial solution by means of the concept of the UUB (uniform-ultimately bounded stability. In order to show the effectiveness of the methodology proposed, we applied it in a real 2-DoF robot system.

33 CFR 165.117 - Regulated Navigation Areas, Safety and Security Zones: Deepwater Ports, First Coast Guard District.

Science.gov (United States)

2010-07-01

..., Safety and Security Zones: Deepwater Ports, First Coast Guard District. 165.117 Section 165.117... Limited Access Areas First Coast Guard District § 165.117 Regulated Navigation Areas, Safety and Security... section are designated as regulated navigation areas. (2) Safety and security zones. All waters within a...

Prevention of Crevice Corrosion of STS 304 Stainless Steel by a Mg-alloy Galvanic Anode

International Nuclear Information System (INIS)

Lim, U. J.; Yun, B. D.; Kim, J. J.

2006-01-01

Prevention of crevice corrosion was studied for STS 304 stainless steel using a Mg-alloy galvanic anode in solutions with various specific resistivity. The crevice corrosion and corrosion protection characteristics of the steel was investigated by the electrochemical polarization and galvanic corrosion tests. Experimental results show that the crevice corrosion of STS 304 stainless steel does not occur in solutions of high specific resistivity, but it occurs in solutions of low specific resistivity like in solutions with resistivities of 30, 60 and 115 Ω · m. With decreasing specific resistivity of the solution, the electrode potential of STS 304 stainless steel in the crevice is lowered. The potential of STS 304 stainless steel in the crevice after coupling is cathodically polarized more by decreasing specific resistivity indicating that the crevice corrosion of STS 304 stainless steel is prevented by the Mg-alloy galvanic anode

STS-30 Pilot Ronald J. Grabe during preflight press conference at JSC

Science.gov (United States)

1989-01-01

During preflight press conference, STS-30 Pilot Ronald J. Grabe answers a question from the news media. The event was held in the JSC Auditorium and Public Affairs Facility Bldg 2 briefing room. STS-30 mission will fly onboard Atlantis, Orbiter Vehicle (OV) 104, and is scheduled for an April 28 liftoff.

Astronaut Richard H. Truly in training session RMS for STS-2 bldg 9A

Science.gov (United States)

1981-01-01

Astronaut Richard H. Truly in training session with the Remote Manipulator System (RMS) for STS-2 bldg 9A. Views show Truly working at the command console while watching out the windows. Karen Ehlers, an RMS procedures specialist, can be seen at left side of frame (34314); view from behind Truly as he trains at the RMS console (34315).

External Thermal Insulation Composite Systems: Critical Parameters for Surface Hygrothermal Behaviour

Directory of Open Access Journals (Sweden)

Eva Barreira

2014-01-01

Full Text Available External Thermal Insulation Composite Systems (ETICS are often used in Europe. Despite its thermal advantages, low cost, and ease of application, this system has serious problems of biological growth causing the cladding defacement. Recent studies pointed that biological growth is due to high values of surface moisture content, which mostly results from the combined effect of exterior surface condensation, wind-driven rain, and drying process. Based on numerical simulation, this paper points the most critical parameters involved in hygrothermal behaviour of ETICS, considering the influence of thermal and hygric properties of the external rendering, the effect of the characteristics of the façade, and the consequences of the exterior and interior climate on exterior surface condensation, wind-driven rain, and drying process. The model used was previously validated by comparison with the results of an “in situ” campaign. The results of the sensitivity analyses show that relative humidity and temperature of the exterior air, atmospheric radiation, and emissivity of the exterior rendering are the parameters that most influence exterior surface condensation. Wind-driven rain depends mostly on horizontal rain, building’s height, wind velocity, and orientation. The drying capacity is influenced by short-wave absorbance, incident solar radiation, and orientation.

STS-49 ASEM activities illustrated with PLAID computer graphics

Science.gov (United States)

1992-01-01

STS-49 Endeavour, Orbiter Vehicle (OV) 105, Assembly of Station by Extravehicular Activity (EVA) Methods (ASEM) activities are illustrated with PLAID computer graphics. Two extravehicular mobility unit (EMU) suited crewmembers work on multipurpose experiment support structure (MPESS) (with legs attached) grappled by remote manipulator system (RMS) end effector and positioned in the over-the-nose location (above OV-105's crew compartment). This position has been designated as the assembly area for Space Station Freedom (SSF). This procedure will evaluate the ability to use the RMS to position MPESS carrier and EVA crewmembers forward and above the PLB.

Magnetic resonance imaging of the pulleys of the flexor tendons of the toes at 11.7 T

Energy Technology Data Exchange (ETDEWEB)

Tafur, Monica; Iwasaki, Kenyu; Statum, Sheronda; Szeverenyi, Nikolaus M.; Bydder, Graeme M. [University of California, San Diego, School of Medicine, Department of Radiology, San Diego, CA (United States); Chung, Christine B. [Department of Radiology, Veterans Administration San Diego Healthcare System, San Diego, CA (United States); University of California, San Diego, School of Medicine, Department of Radiology, San Diego, CA (United States)

2015-01-15

We obtained high-resolution 11.7-T MR images of the pulleys of the flexor tendons in cadaveric toe specimens. A detailed understanding of toe pulley anatomy as seen with MR is likely to be of benefit in recognizing disease and the effects of trauma. Six cadaveric toes were imaged with an 11.7-T small-bore MR imaging system using optimized coils. Two-dimensional dual-echo SE scans were obtained in three planes (40 x 40 x 400-μm{sup 3} voxel size, TE = 7/14 ms, TR = 3,500 ms, fat saturation). Three-dimensional spoiled gradient echo scans were obtained (90-150 μm{sup 3} isotropic voxel size, TE = 6 ms, TR = 25 ms, with and without fat saturation). Specimen orientation was with the long axis of the toe either parallel or perpendicular to B{sub 0}. All the annular (A) pulleys were demonstrated in the great and lesser toes. The A2 pulley in the great and lesser toes and the A4 pulley in the lesser toes were the most substantial pulleys. The A5 pulley, which has not previously been described in the toes, was demonstrated. The cruciform pulleys were also seen and were smaller and thinner. Three tissue layers were seen, and there was evidence of different fiber directions in annular pulleys producing different magic angle effects. Detailed anatomy of the pulley system of the flexor tendons was seen on the 11.7-T MR images showing new features and providing a basis for image interpretation. Similarities and differences between the pulley systems in the toes and the fingers were identified. (orig.)

STS-61B Crew Portrait

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included (kneeling left to right) Bryan D. O'conner, pilot; and Brewster H. Shaw, commander. On the back row, left to right, are Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Autralia); and SATCOM KU-2 (RCA Americom. Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, VA and Marshall Space Flight Center (MSFC), the Assembly Concept for Construction of Erectable Space Structures (ACCESS) was developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). The primary objective of this experiment was to test the ACCESS structural assembly concept for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

STS-103 Pilot Scott Kelly during TCDT activities

Science.gov (United States)

1999-01-01

STS-103 Pilot Scott J. Kelly is ready to take his turn at driving a small armored personnel carrier that is part of emergency egress training during Terminal Countdown Demonstration Test (TCDT) activities. Behind him (left) is Mission Specialist Jean-Frangois Clervoy of France, who is with the European Space Agency. At right is Mission Specialist Steven L. Smith. The tracked vehicle could be used by the crew in the event of an emergency at the pad during which the crew must make a quick exit from the area. The TCDT also provides simulated countdown exercises and opportunities to inspect the mission payloads in the orbiter's payload bay. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope. Although Hubble is operating normally and conducting its scientific observations, only three of its six gyroscopes are working properly. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The other STS-103 crew members are Commander Curtis L. Brown Jr. and Mission Specialists C. Michael Foale (Ph.D.), John M. Grunsfeld (Ph.D.), and Claude Nicollier of Switzerland, who also is with the European Space Agency. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

Performance Targets and External Benchmarking

DEFF Research Database (Denmark)

Friis, Ivar; Hansen, Allan; Vámosi, Tamás S.

Research on relative performance measures, transfer pricing, beyond budgeting initiatives, target costing, piece rates systems and value based management has for decades underlined the importance of external benchmarking in performance management. Research conceptualises external benchmarking...... as a market mechanism that can be brought inside the firm to provide incentives for continuous improvement and the development of competitive advances. However, whereas extant research primarily has focused on the importance and effects of using external benchmarks, less attention has been directed towards...... the conditions upon which the market mechanism is performing within organizations. This paper aims to contribute to research by providing more insight to the conditions for the use of external benchmarking as an element in performance management in organizations. Our study explores a particular type of external...

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153Sm(113,117Snm) complexes

International Nuclear Information System (INIS)

Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin

2004-01-01

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA

External GSM phone calls now made simpler

CERN Multimedia

2007-01-01

On 2 July, the IT/CS Telecom Service introduced a new service making external calls from CERN GSM phones easier. A specific prefix is no longer needed for calls outside CERN. External calls from CERN GSM phones are to be simplified. It is no longer necessary to use a special prefix to call an external number from the CERN GSM network.The Telecom Section of the IT/CS Group is introducing a new system that will make life easier for GSM users. It is no longer necessary to use a special prefix (333) to call an external number from the CERN GSM network. Simply dial the number directly like any other Swiss GSM customer. CERN currently has its own private GSM network with the Swiss mobile operator, Sunrise, covering the whole of Switzerland. This network was initially intended exclusively for calls between CERN numbers (replacing the old beeper system). A special system was later introduced for external calls, allowing them to pass thr...

STS-54 DSO 802, Educational activities 'Physics of Toys', equipment

Science.gov (United States)

1993-01-01

Toys for STS-54 Detailed Supplementary Objective (DSO) 802, Educational activities 'Physics of Toys', are displayed on a table top. Part of the educational activities onboard Endeavour, Orbiter Vehicle (OV) 105, will include several experiments with these toys. DSO 802 will allow the crewmembers to experiment with the various types of toys in a microgravity environment while talking to pupils who will be able to monitor (via classroom television (TV) sets) the onboard activities at their schools. NOTE: Also labeled the Application Specific Preprogrammed Experiment Culture System Physic of Toys (ASPEC).

STS-26 MS Lounge in fixed based (FB) shuttle mission simulator (SMS)

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) John M. Lounge, wearing comunications kit assembly headset and crouched on the aft flight deck, performs checklist inspection during training session. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

STS-54 Physics of Toys

Science.gov (United States)

1993-01-01

Greg Vogt, NASA Headquarters Education Specialist, and Carolyn Sumners, Houston Museum of Natural Science, give an overview of the spaceborne experiments that will take place on the STS-54 Endeavour mission. Mr. Vogt discusses the objectives and procedures of the experiments, which are structured around using toys to show the effects of microgravity. Mr. Vogt and Ms. Sumners then answer questions from the press.

The influence of external source intensity in accelerator/target/blanket system on conversion ratio and fuel cycle

Energy Technology Data Exchange (ETDEWEB)

Kochurov, B.P. [Institute for Theoretical and Experimental Physics, Moscow (Russian Federation)

1995-10-01

The analysis of neutron balance relation for a subcritical system with external source shows that a high ratio of neutron utilization (conversion ratio, breeding ratio) much exceeding similar values for nuclear reactors (both thermal or fast spectrum) is reachable in accelerator/target/blanket system with high external neutron source intensity. An accelerator/target/blanket systems with thermal power in blanket about 1850 Mwt and operating during 30 years have been investigated. Continual feed up by plutonium (fissile material) and Tc-99 (transmuted material) was assumed. Accelerator beam intensity differed 6.3 times (16 mA - Case 1, and 100 mA-Case 2). Conversion ratio (CR) was defined as the ratio of Tc-99 nuclei transmuted to the number of Pu nuclei consumed. High value of conversion ratio considerably exceeding 1 (CR=1.66) was obtained in the system with high source intensity as compared with low source system (CR=0.77). Net output of electric power of high source intensity system is about twice lower due to consumption of electric power for accelerator feed up. The loss of energy for Tc-99 transmutation is estimated as 40 Mev(el)/nuclei. Yet high conversion ratio (or breeding ratio) achievable in electronuclear installations with high intensity of external source can effectively be used to close fuel cycle (including incineration of wastes) or to develop growing nuclear power production system.

Possible Deformed States in {sup 115}In and {sup 117}ln

Energy Technology Data Exchange (ETDEWEB)

Baecklin, A; Fogelberg, B [Inst. of Physics, Univ. of Uppsala (Sweden); Swedish Research Councils' Laboratory, Studsvik, Nykoeping (Sweden); Malmskog, S G [AB Atomenergi, Nykoeping (Sweden)

1967-01-15

Levels and transitions in {sup 115}In and {sup 117}In have been studied from the beta decay of 2.3-day {sup 115g}Cd and 2.5-h {sup 117g}Cd. Using a Ge(Li) detector and a double focussing beta spectrometer energies, intensities, conversion coefficients and multipolarities were obtained for the following transitions (energies in keV and multipolarities are given): {sup 115}In: 35.63 (97.0 % M1 + 3.0 % E2), 231.47 (E1), 260.80 (M1), 267, 336. 23 (M4 + < 5 % E5), 492. 4 (96 % El +4 % M2), 527.70 (E1). {sup 117}In: 71.0, 89.80 (E2 + < 20 % M1), 273.32 (M1, E2), 315.27 (M4 + < 7 % E2), 344.29 (E1), 434.12 (E1). Using the delayed coincidence technique, half lives were measured for 2 levels in {sup 115}In and for 3 levels in {sup 117}In. Energies, spins, parities and half lives are given for the following levels: In: 597.03, 3/2{sup -}; 828.39, 3/2{sup +}, 5.4 ns; 863.95, l/2{sup +} or 3/2{sup +}, 1.1 ns. {sup 117}In: 588.59, 3/2{sup -}; 0.20 ns; 659.56, 3/2{sup +}, 58.7 ns; 749.37, 1/2{sup +} or 3/2{sup +}, 4.3 ns. Reduced transition probabilities are given for several transitions in both nuclei. The E2 transition rates between the two excited positive parity states in both nuclei were found to be about 100 s. p. u. indicating a possible deformation of these states. The energy spacing and transition rates between these states can be well accounted for within the Nilsson model assuming the states to form a K = 1/2{sup +} rotational band. A deformation {delta} of about 0.20 is obtained for both nuclei.

Integral of notion for a quantum Sutherland-Calogero system in the external field

International Nuclear Information System (INIS)

Meshcheryakov, D.V.; Tverskoj, V.B.

2000-01-01

The Sutherland-Calogero three-particle system in the external field is considered. The formula for ordering non-commutating variables in the motion integrals is proposed. The motion integrals are obtained in an obvious form. The problem on analytical evidence of the system complete integration by arbitrary N remains open. The formula, proposed in this paper for ordering non-commutating variables in the I n , may be applied by conducting the total evidence [ru

Engaging boundary objects in OMS and STS? Exploring the subtleties of layered engagement

NARCIS (Netherlands)

Zeiss, R.; Groenewegen, P.

2009-01-01

This paper considers STS aspirations to engage with the field of Organization and Management Studies (OMS). It does so by investigating the employability of the concept of boundary object in OMS. Through an extensive literature review, the paper shows that rather than a simple engagement between STS

European protection principles against external hazards by means of Emergency Power Supply and Control Safety System Building in Nuclear Power Plants

Energy Technology Data Exchange (ETDEWEB)

Gallinat, Dipl Ing [Max Aicher Engineering GmbH, Freilassing (Germany)

2016-10-15

One of the most important nuclear power plant safety requirements is a redundant and independent power system. This requires such a design of emergency power systems that failure of one will not adversely impact the other. External hazards of natural origin or linked to human activity could potentially affect plant safety. The general objective of the design provisions is to ensure that the safety functions of the systems and components required to return the plant to a safe shutdown state and to prevent and limit radioactive release are not adversely affected. As external hazards are site dependent, Technical Guidelines specify that 'it is not necessary to take all of the hazards in a standardized design; such external hazards as external flooding, drought, ice formation and toxic, corrosive or combustible gases may be dealt with only for a specific plant, on a plant specific basis'. In accordance with the Technical Guidelines, external hazards are taken into consideration at the design stage consistently with internal events or hazards. The basic design principle is to protect against external hazards in accordance with the Technical Guidelines using a 'load case' procedure.

STS-86 crew addresses the press during TCDT activities at LC 39A

Science.gov (United States)

1997-01-01

STS-86 Commander James D. Wetherbee, with microphone, and other crew members of the Space Shuttle Atlantis speak to media representatives and other onlookers at Launch Pad 39A during the Terminal Countdown Demonstration Test (TCDT), a dress rehearsal for launch From right, after Wetherbee, are Pilot Michael J. Bloomfield, Mission Specialist Vladimir Georgievich Titov of the Russian Space Agency, Mission Specialist Scott E. Parazynski, Mission Specialist Jean-Loup J.M. Chretien of the French Space Agency, CNES, and Mission Specialists Wendy B. Lawrence and David A. Wolf. STS-86 will be the seventh docking of the Space Shuttle with the Russian Space Station Mir. During the docking, Wolf will transfer to the orbiting Russian station and become a member of the Mir 24 crew, replacing U.S. astronaut C. Michael Foale, who has been on the Mir since the last docking mission, STS-84, in May. Launch of Mission STS-86 aboard the Space Shuttle Atlantis is targeted for Sept. 25.

41 CFR 102-117.35 - What are the advantages and disadvantages of using GSA's tender of service?

Science.gov (United States)

2010-07-01

... and disadvantages of using GSA's tender of service? 102-117.35 Section 102-117.35 Public Contracts and...-117.35 What are the advantages and disadvantages of using GSA's tender of service? (a) It is an... damage claims. (b) It is a disadvantage to use GSA's tender of service when: (1) You want an agreement...

Fatigue Crack Growth Characteristics of Cold Stretched STS 304 Welded Joint

Energy Technology Data Exchange (ETDEWEB)

Lee, Jeong Won; Na, Seong Hyeon; Yoon, Dong Hyun; Kim, Jae Hoon [Chungnam Nat’l Univ., Daejeon (Korea, Republic of); Kim, Young Kyun; Kim, Ki Dong [Korea Gas Coporation R& D Division, Daejeon (Korea, Republic of)

2017-09-15

STS 304 steel is used as pressure vessel material, and although it exhibits excellent mechanical characteristics at a low temperature, it is heavier than other materials. To address this issue, a method using cold-stretching techniques for STS 304 can be applied. In this study, a cold-stretching part and welded joint specimen were directly obtained from a cold-stretching pressure vessel manufactured according to ASME code. Fatigue crack propagation tests were carried out at room temperature and -170℃ using the compliance method for stress ratios of 0.1 and 0.5. The results indicate that crack growth rate of the welded joint is higher than that of the cold-stretching part within the same stress intensity factor range. The outcome of this work is expected to serve as a basis for the development of a cold-stretched STS 304 pressure vessel.

Accounting for External Turbulence of Logistics Organizations via Performance Measurement Systems

DEFF Research Database (Denmark)

Bühler, Andreas; Wallenburg, Carl Marcus; Wieland, Andreas

2016-01-01

Purpose: This paper aims to investigate the role of upper management in designing performance measurement systems (PMS) that account for external turbulence of the organization and to show how this PMS design for turbulence impacts organizational resilience and distribution service performance....... Design/methodology/approach: Hypotheses are developed by integrating management accounting and strategic management perspectives into supply chain management and subsequently tested based on data from 431 logistics organizations (i.e. both logistics companies and internal logistics departments...

John Glenn and rest of STS-95 crew exit Crew Transport Vehicle

Science.gov (United States)

1998-01-01

Following touchdown at 12:04 p.m. EST at the Shuttle Landing Facility, the mission STS-95 crew leave the Crew Transport Vehicle. Payload Specialist John H. Glenn Jr. (center), a senator from Ohio, shakes hands with NASA Administrator Daniel S. Goldin. At left is Center Director Roy Bridges. Other crew members shown are Pilot Steven W. Lindsey (far left) and, behind Glenn, Mission Specialists Scott E. Parazynski and Stephen K. Robinson, and Payload Specialist Chiaki Mukai, Ph.D., M.D., with the National Space Development Agency of Japan. Not seen are Mission Commander Curtis L. Brown Jr. and Mission Specialist Pedro Duque of Spain, with the European Space Agency (ESA). The STS-95 crew completed a successful mission, landing at the Shuttle Landing Facility at 12:04 p.m. EST, after 9 days in space, traveling 3.6 million miles. The mission included research payloads such as the Spartan solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as the SPACEHAB single module with experiments on space flight and the aging process.

38 CFR 1.17 - Evaluation of studies relating to health effects of radiation exposure.

Science.gov (United States)

2010-07-01

... relating to health effects of radiation exposure. 1.17 Section 1.17 Pensions, Bonuses, and Veterans' Relief... health effects of radiation exposure. (a) From time to time, the Secretary shall publish evaluations of scientific or medical studies relating to the adverse health effects of exposure to ionizing radiation in the...

STS-93 M.S. Hawley suits up for launch

Science.gov (United States)

1999-01-01

During final launch preparations in the Operations and Checkout Building, STS-93 Mission Specialist Steven A. Hawley (Ph.D.)gets help donning his launch and entry suit from a suit tech. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X- ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Hawley, Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS-61B Astronaut Ross During ACCESS Extravehicular Activity

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included Bryan D. O'Conner, pilot; Brewster H. Shaw, commander; Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Australia); and SATCOM KU-2 (RCA Americom). Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, VA and the Marshall Space Flight Center (MSFC), ACCESS and EASE were developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). In this STS-61B onboard photo, astronaut Ross was working on the ACCESS experiment during an Extravehicular Activity (EVA). The primary objective of this experiment was to test the ACCESS structural assembly concept for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

STS-114: Discovery Crew Arrival

Science.gov (United States)

2005-01-01

George Diller of NASA Public Affairs narrates the STS-114 Crew arrival at Kennedy Space Center aboard a Gulf Stream aircraft. They were greeted by Center Director Jim Kennedy. Commander Eileen Collins introduced each of her crew members and gave a brief description of their roles in the mission. Mission Specialist 3, Andrew Thomas will be the lead crew member on the inspection on flight day 2; he is the intravehicular (IV) crew member that will help and guide Mission Specialists Souichi Noguchi and Stephen Robinson during their spacewalks. Pilot James Kelly will be operating the shuttle systems in flying the Shuttle; he will be flying the space station robotic arm during the second extravehicular activity and he will be assisting Mission Specialist Wendy Lawrence during the other two extravehicular activities; he will be assisting on the rendezvous on flight day three, and landing of the shuttle. Commander Collins also mentioned Pilot Kelly's recent promotion to Colonel by the United States Air Force. Mission Specialist 1, Souichi Noguchi from JAXA (The Japanese Space Agency) will be flying on the flight deck for ascent; he will be doing three spacewalks on day 5, 7, and 9; He will be the photo/TV lead for the different types of cameras on board to document the flight and to send back the information to the ground for both technical and public affairs reasons. Mission Specialist 5, Charles Camada will be doing the inspection on flight day 2 with Mission Specialist Thomas and Pilot Kelly; he will be transferring the logistics off the shuttle and onto the space station and from the space station back to the shuttle; He will help set up eleven lap tops on board. Mission Specialist 4, Wendy Lawrence will lead the transfer of logistics to the space station; she is the space station arm operator during extravehicular activities 1 and 3; she will be carrying the 6,000 pounds of external storage platform from the shuttle payload bay over to the space station; she is also

External Dacryocystorhinostomy; Success Rate and Causes of Failure in Endoscopic and Pathologic Evaluations.

Science.gov (United States)

Ghasemi, Hassan; Asghari Asl, Sajedeh; Yarmohammadi, Mohammad Ebrahim; Jafari, Farhad; Izadi, Pupak

2017-01-01

External dacryocystorhinostomy (DCR) is the method of choice to treat nasolacrimal duct (NLD) obstruction and the other approaches are compared with it, with a failure rate of 4% to 13%. The current study aimed to assess the causes of failure in external DCR by postoperative endoscopic and pathological evaluation. The current retrospective cross sectional study followed-up113 patients with external DCR and silicone intubation for three months. Silicone tubes were removed after the third months. Failure was confirmed based on the clinical findings and irrigation test. Paranasal sinus computed tomography (CT) scanning, and endoscopic and pathological evaluations were performed in the failed cases. Totally, 113 patients underwent external DCR. The patients included 71 females and 42 males. The mean age of the patients was 55.91 years; ranged from 18 to 86. Epiphora was the most common complaint before surgery (90.3%). Clinically, epiphora continued in 17 cases (15%), of which 94.11% had at least one sinus CT abnormality and 82.35% had at least one endoscopic abnormality. The most common endoscopic findings were deviated septum (70.6%), scar tissue (52.94%), concha bullosa (46.9%), septal adhesion (47.05%), enlarged middle turbinate (41.2%), and sump syndrome (11.7%). The failure was significantly associated with the chronicity of the initial symptoms (P-value=0.00). Pathologically, there were significant relationship amongst the failure rate, scar formation, and allergic rhinitis (P-values =0.00 and <0.05, respectively). Preoperative endonasal evaluation and consultation with an otolaryngologist can improve surgical outcomes and help to have a better conscious to intranasal abnormalities before external DCR surgery.

The functional organization of the left STS: a large scale meta-analysis of PET and fMRI studies of healthy adults

Science.gov (United States)

Liebenthal, Einat; Desai, Rutvik H.; Humphries, Colin; Sabri, Merav; Desai, Anjali

2014-01-01

The superior temporal sulcus (STS) in the left hemisphere is functionally diverse, with sub-areas implicated in both linguistic and non-linguistic functions. However, the number and boundaries of distinct functional regions remain to be determined. Here, we present new evidence, from meta-analysis of a large number of positron emission tomography (PET) and functional magnetic resonance imaging (fMRI) studies, of different functional specificity in the left STS supporting a division of its middle to terminal extent into at least three functional areas. The middle portion of the left STS stem (fmSTS) is highly specialized for speech perception and the processing of language material. The posterior portion of the left STS stem (fpSTS) is highly versatile and involved in multiple functions supporting semantic memory and associative thinking. The fpSTS responds to both language and non-language stimuli but the sensitivity to non-language material is greater. The horizontal portion of the left STS stem and terminal ascending branches (ftSTS) display intermediate functional specificity, with the anterior-dorsal ascending branch (fatSTS) supporting executive functions and motor planning and showing greater sensitivity to language material, and the horizontal stem and posterior-ventral ascending branch (fptSTS) supporting primarily semantic processing and displaying greater sensitivity to non-language material. We suggest that the high functional specificity of the left fmSTS for speech is an important means by which the human brain achieves exquisite affinity and efficiency for native speech perception. In contrast, the extreme multi-functionality of the left fpSTS reflects the role of this area as a cortical hub for semantic processing and the extraction of meaning from multiple sources of information. Finally, in the left ftSTS, further functional differentiation between the dorsal and ventral aspect is warranted. PMID:25309312

The functional organization of the left STS: a large scale meta-analysis of PET and fMRI studies of healthy adults

Directory of Open Access Journals (Sweden)

Einat eLiebenthal

2014-09-01

Full Text Available The superior temporal sulcus (STS in the left hemisphere is functionally diverse, with sub-areas implicated in both linguistic and non-linguistic functions. However, the number and boundaries of distinct functional regions remain to be determined. Here, we present new evidence, from meta-analysis of a large number of positron emission tomography (PET and functional magnetic resonance imaging (fMRI studies, of different functional specificity in the left STS supporting a division of its middle to terminal extent into at least three functional areas. The middle portion of the left STS stem (fmSTS is highly specialized for speech perception and the processing of language material. The posterior portion of the left STS stem (fpSTS is highly versatile and involved in multiple functions supporting semantic memory and associative thinking. The fpSTS responds to both language and non-language stimuli but the sensitivity to non-language material is greater. The horizontal portion of the left STS stem and terminal ascending branches (ftSTS display intermediate functional specificity, with the anterior ascending branch adjoining the supramarginal gyrus (fatSTS supporting executive functions and motor planning and showing greater sensitivity to language material, and the horizontal stem and posterior ascending branch adjoining the angular gyrus (fptSTS supporting primarily semantic processing and displaying greater sensitivity to non-language material. We suggest that the high functional specificity of the left fmSTS for speech is an important means by which the human brain achieves exquisite affinity and efficiency for native speech perception. In contrast, the extreme multi-functionality of the left fpSTS reflects the role of this area as a cortical hub for semantic processing and the extraction of meaning from multiple sources of information. Finally, in the left ftSTS, further functional differentiation between the dorsal and ventral aspect is warranted.

STS-95 Day 03 Highlights

Science.gov (United States)

1998-01-01

On this third day of the STS-95 mission, the flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn, are seen checking out equipment that will be used for the deployment of the Spartan, a small, Shuttle-launched and retrieved satellite, whose mission is to study the Sun.

STS: Adding Value To Research and Practice.

Science.gov (United States)

Kumar, David D.; Chubin, Daryl E.

2000-01-01

Introduces the Kumar and Chubin-edited collection, "Science, Technology, and Society: A Sourcebook on Research and Practice". Presents an outline of the 12 chapters that examine STS trends, curriculum, teaching, learning, mentoring, advocacy, public policy, and issues for further research. (Author/WRM)

Complex dynamics in Duffing system with two external forcings

International Nuclear Information System (INIS)

Jing Zhujun; Wang Ruiqi

2005-01-01

Duffing's equation with two external forcing terms have been discussed. The threshold values of chaotic motion under the periodic and quasi-periodic perturbations are obtained by using second-order averaging method and Melnikov's method. Numerical simulations not only show the consistence with the theoretical analysis but also exhibit the interesting bifurcation diagrams and the more new complex dynamical behaviors, including period-n (n=2,3,6,8) orbits, cascades of period-doubling and reverse period doubling bifurcations, quasi-periodic orbit, period windows, bubble from period-one to period-two, onset of chaos, hopping behavior of chaos, transient chaos, chaotic attractors and strange non-chaotic attractor, crisis which depends on the frequencies, amplitudes and damping. In particular, the second frequency plays a very important role for dynamics of the system, and the system can leave chaotic region to periodic motions by adjusting some parameter which can be considered as an control strategy of chaos. The computation of Lyapunov exponents confirm the dynamical behaviors

Description of Fracture Systems for External Criticality Reports

International Nuclear Information System (INIS)

Nicot, Jean-Philippe

2001-01-01

The purpose of this Analysis/Model Report (AMR) is to describe probabilistically the main features of the geometry of the fracture system in the vicinity of the repository. They will be used to determine the quantity of fissile material that could accumulate in the fractured rock underneath a waste package as it degrades. This AMR is to feed the geochemical calculations for external criticality reports. This AMR is done in accordance with the technical work plan (BSC (Bechtel SAIC Company) 2001 b). The scope of this AMR is restricted to the relevant parameters of the fracture system. The main parameters of interest are fracture aperture and fracture spacing distribution parameters. The relative orientation of the different fracture sets is also important because of its impact on criticality, but they will be set deterministically. The maximum accumulation of material depends primarily on the fracture porosity, combination of the fracture aperture, and fracture intensity. However, the fracture porosity itself is not sufficient to characterize the potential for accumulation of a fracture system. The fracture aperture is also important because it controls both the flow through the fracture and the potential plugging of the system. Other features contributing to the void space such as lithophysae are also investigated. On the other hand, no analysis of the matrix porosity is done. The parameters will be used in sensitivity analyses of geochemical calculations providing actinide accumulations and in the subsequent Monte Carlo criticality analyses

STS-26 crew on fixed based (FB) shuttle mission simulator (SMS) flight deck

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck (left) and Pilot Richard O. Covey review checklists in their respective stations on the foward flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

Virtual reconstruction of the Australopithecus africanus pelvis Sts 65 with implications for obstetrics and locomotion.

Science.gov (United States)

Claxton, Alexander G; Hammond, Ashley S; Romano, Julia; Oleinik, Ekaterina; DeSilva, Jeremy M

2016-10-01

Characterizing australopith pelvic morphology has been difficult in part because of limited fossilized pelvic material. Here, we reassess the morphology of an under-studied adult right ilium and pubis (Sts 65) from Member 4 of Sterkfontein, South Africa, and provide a hypothetical digital reconstruction of its overall pelvic morphology. The small size of the pelvis, presence of a preauricular sulcus, and shape of the sciatic notch allow us to agree with past interpretations that Sts 65 likely belonged to a female. The morphology of the iliac pillar, while not as substantial as in Homo, is more robust than in A.L. 288-1 and Sts 14. We created a reconstruction of the pelvis by digitally articulating the Sts 65 right ilium and a mirrored copy of the left ilium with the Sts 14 sacrum in Autodesk Maya. Points along the arcuate line were used to orient the ilia to the sacrum. This reconstruction of the Sts 65 pelvis looks much like a "classic" australopith pelvis, with laterally flared ilia and an inferiorly deflected pubis. An analysis of the obstetric dimensions from our reconstruction shows similarity to other australopiths, a likely transverse or oblique entrance of the neonatal cranium into the pelvic inlet, and a cephalopelvic ratio similar to that found in humans today. Copyright © 2016 Elsevier Ltd. All rights reserved.

The efficacy and safety of external cephalic version after a previous caesarean delivery.

Science.gov (United States)

Weill, Yishay; Pollack, Raphael N

2017-06-01

External cephalic version (ECV) in the presence of a uterine scar is still considered a relative contraindication despite encouraging studies of the efficacy and safety of this procedure. We present our experience with this patient population, which is the largest cohort published to date. To evaluate the efficacy and safety of ECV in the setting of a prior caesarean delivery. A total of 158 patients with a fetus presenting as breech, who had an unscarred uterus, had an ECV performed. Similarly, 158 patients with a fetus presenting as breech, and who had undergone a prior caesarean delivery also underwent an ECV. Outcomes were compared. ECV was successfully performed in 136/158 (86.1%) patients in the control group. Of these patients, 6/136 (4.4%) delivered by caesarean delivery. In the study group, 117/158 (74.1%) patients had a successful ECV performed. Of these patients, 12/117 (10.3%) delivered by caesarean delivery. There were no significant complications in either of the groups. ECV may be successfully performed in patients with a previous caesarean delivery. It is associated with a high success rate, and is not associated with an increase in complications. © 2016 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.

Environmental external effects from wind power based on the EU ExternE methodology

DEFF Research Database (Denmark)

Ibsen, Liselotte Schleisner; Nielsen, Per Sieverts

1998-01-01

of the Danish part of the project is to implement the framework for externality evaluation, for three different power plants located in Denmark. The paper will focus on the assessment of the impacts of the whole fuel cycles for wind, natural gas and biogas. Priority areas for environmental impact assessment......The European Commission has launched a major study project, ExternE, to develop a methodology to quantify externalities. A “National Implementation Phase”, was started under the Joule II programme with the purpose of implementing the ExternE methodology in all member states. The main objective...

Playing the Indicator Game: Reflections on Strategies to Position an STS Group in a Multi-disciplinary Environment

Directory of Open Access Journals (Sweden)

Roland Bal

2017-02-01

Full Text Available Roland Bal analyzes the strategies his research group developed to deal with the interlinked dynamics of research evaluation in a multi-disciplinary institutional environment characteristic of much STS research. Scholars in such environments constantly need to navigate and negotiate the standards of evaluation, in complex choreographies of cooperation and competition with other disciplinary groups. Bal describes strategies his group has successfully used, and how these strategies have both shifted the way research quality is assessed within the department as well as changed the way his group works and publishes. In conclusion, he describes performance management systems and research practices as co-constituted and calls for a debate on which forms of evaluation infrastructures allow for better ways of doing research in STS.

Regional Externalities

NARCIS (Netherlands)

Heijman, W.J.M.

2007-01-01

The book offers practical and theoretical insights in regional externalities. Regional externalities are a specific subset of externalities that can be defined as externalities where space plays a dominant role. This class of externalities can be divided into three categories: (1) externalities

External effects in Swiss hydropower

International Nuclear Information System (INIS)

Hauenstein, W.; Bonvin, J.; Vouillamoz, J.

1999-01-01

The article discusses the external costs and benefits of hydropower that are not internalised in normal book-keeping. Several negative and positive effects are discussed. The results of a study that addressed the difficult task of quantifying these external effects are presented. An assessment of the results gained shows that difficulties are to be met regarding system limits, methods of expressing the effects in monetary terms and ethical factors. The report also examines the consideration of external effects as a correction factor for falsified market prices for electricity

STS-47 Mission Specialist (MS) Jemison conducts AFTE in SLJ module on OV-105

Science.gov (United States)

1992-01-01

STS-47 Mission Specialist (MS) Mae C. Jemison, wearing autogenic feedback training system 2 suit, conducts the Autogenic Feedback Training Experiment (AFTE) in Spacelab Japan (SLJ) science module aboard Endeavour, Orbiter Vehicle (OV) 105. AFTE's objective is to teach astronauts to use biofeedback rather than drugs to combat nausea and other effects of space motion sickness. Jemison's physical responses are monitored by sensors attached to the suit.

3D FE Analysis of RC Beams Externally Strengthened with SRG/SRP Systems

Directory of Open Access Journals (Sweden)

Francesco Bencardino

2016-05-01

Full Text Available The purpose of this study is to evaluate, through a nonlinear Finite Element (FE analysis, the structural behavior of Reinforced Concrete (RC beams externally strengthened by using Steel Reinforced Grout (SRG and Steel Reinforced Polymer (SRP systems. The parameters taken into account were the external strengthening configuration, with or without U-wrap end anchorages, as well as the strengthening materials. The numerical simulations were carried out by using a three-dimensional (3D FE model. The linear and nonlinear behavior of all materials was modeled by appropriate constitutive laws and the connection between concrete substrate and external reinforcing layer was simulated by means of cohesive surfaces with appropriate bond-slip laws. In order to overcome convergence difficulties, to simulate the quasi-static response of the strengthened RC beams, a dynamic approach was adopted. The numerical results in terms of load-displacement curves, failure modes, and load and strain values at critical stages were validated against some experimental data. As a result, the proposed 3D FE model can be used to predict the structural behavior up to ultimate stage of similar strengthened beams without carrying out experimental tests.

Marital Conflict and Children's Externalizing Behavior: Interactions between Parasympathetic and Sympathetic Nervous System Activity

Science.gov (United States)

El-Sheikh, Mona; Kouros, Chrystyna D.; Erath, Stephen; Cummings, E. Mark; Keller, Peggy; Staton, Lori

2009-01-01

Toward greater specificity in the prediction of externalizing problems in the context of interparental conflict, interactions between children's parasympathetic and sympathetic nervous system (PNS and SNS) activity were examined as moderators. PNS activity was indexed by respiratory sinus arrhythmia (RSA) and RSA reactivity (RSA-R) to lab…

40 CFR 51.117 - Additional provisions for lead.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Additional provisions for lead. 51.117... Additional provisions for lead. In addition to other requirements in §§ 51.100 through 51.116 the following requirements apply to lead. To the extent they conflict, there requirements are controlling over those of the...

Equivalent to Represent Inertial and Primary Frequency Control Effects of an External System

DEFF Research Database (Denmark)

Weckesser, Johannes Tilman Gabriel; Van Cutsem, Thierry

2017-01-01

This paper presents a novel equivalent, which is suitable for simulation of inertial and primary frequency control effects. In the model reduction procedure, dynamic power injectors are used to replace the external system and to mimic its dynamic behavior. The parameters of the equivalents...... are tuned with a simple approach presented in this paper. The effectiveness of the proposed method is demonstrated on a modified version of the ENTSO-E Dynamic Study Model. The results show that the system frequency response of the unreduced system is retained and a speedup of the simulations of around 4...

STS-26 MS Hilmers on fixed based (FB) shuttle mission simulator (SMS) middeck

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) David C. Hilmers prepares to ascend a ladder representing the interdeck access hatch from the shuttle middeck to the flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

Astronaut training for STS 41-G mission

Science.gov (United States)

1984-01-01

Astronauts training for STS 41-G mission. Payload specialist Paul Scully-Power sits in an office near the space shuttle simulator reviewing a diagram. He is wearging a communications head set. At his elbow is an example of food packets to be used aboard the shuttle.

ExternE: Externalities of energy Vol. 1. Summary

International Nuclear Information System (INIS)

Holland, M.; Berry, J.

1995-01-01

There is a growing requirement for policy analysts to take account of the environment in their decision making and to undertake the specified cost-benefit analysis. Within the European Union this is reflected in the 5th Environmental Action Programme, and the Commission's White Paper entitled 'Growth, competitiveness, employment and the ways forward to the 21st century'. This has led to a need for evaluation of environmental externalities. The ExternE Project commenced in 1991 as the European part of a collaborative study between the European Commission and the US Department of Energy. It aims to be the first systematic approach to the evaluation of external costs of a wide range of different fuel cycles. The project will result in an operational accounting framework for the quantification and monetarisation of priority environmental and other externalities. This framework will allow the calculation of the marginal external costs and benefits for specific power plants, at specific sites using specified technologies. There are three major phases in the project. Phase 1 was undertaken in collaboration with the US Department of Energy. In this phase the teams jointly developed the conceptual approach and methodology and shared scientific information for application to a number of fuel cycles. On the European side work concentrated on the nuclear and coal fuel cycles which together were expected to raise many of the fundamental issues in fuel cycle analysis. The project is currently nearing completion of Phase 2. During this phase the methodology has been applied to a wide range of different fossil, nuclear and renewable fuel cycles for power generation and energy conservation options. Also a series of National Implementation Programmes is underway in which the methodology and accounting framework are being applied to reference sites throughout Europe. In addition the general methodology is being extended to address the evaluation of externalities associated with

ExternE: Externalities of energy Vol. 2. Methodology

International Nuclear Information System (INIS)

Berry, J.; Holland, M.; Watkiss, P.

1995-01-01

This report describes the methodology used by the ExternE Project of the European Commission (DGXII) JOULE Programme for assessment of the external costs of energy. It is one of a series of reports describing analysis of nuclear, fossil and renewable fuel cycles for assessment of the externalities associated with electricity generation. Part I of the report deals with analysis of impacts, and Part II with the economic valuation of those impacts. Analysis is conducted on a marginal basis, to allow the effect of an incremental investment in a given technology to be quantified. Attention has been paid to the specificity of results with respect to the location of fuel cycle activities, the precise technologies used, and the type and source of fuel. The main advantages of this detailed approach are as follows: It takes full and proper account of the variability of impacts that might result from different power projects; It is more transparent than analysis based on hypothetically 'representative' cases for each of the different fuel cycles; It provides a framework for consistent comparison between fuel cycles. A wide variety of impacts have been considered. These include the effects of air pollution on the natural and human environment, consequences of accidents in the workplace, impacts of noise and visual intrusion on amenity, and the effects of climate change arising from the release of greenhouse gases. Wherever possible we have used the 'impact pathway' or 'damage function' approach to follow the analysis from identification of burdens (e.g. emissions) through to impact assessment and then valuation in monetary terms. This has required a detailed knowledge of the technologies involved, pollutant dispersion, analysis of effects on human and environmental health, and economics. In view of this the project brought together a multi-disciplinary team with experts from many European countries and the USA. The spatial and temporal ranges considered in the analysis are

Flight physiology training experiences and perspectives: survey of 117 pilots.

Science.gov (United States)

Patrão, Luís; Zorro, Sara; Silva, Jorge; Castelo-Branco, Miguel; Ribeiro, João

2013-06-01

Human factors and awareness of flight physiology play a crucial role in flight safety. Even so, international legislation is vague relative to training requirements in hypoxia and altitude physiology. Based on a previously developed survey, an adapted questionnaire was formulated and released online for Portuguese pilots. Specific questions regarding the need for pilot attention monitoring systems were added to the original survey. There were 117 pilots, 2 of whom were women, who completed the survey. Most of the pilots had a light aviation license and flew in unpressurized cabins at a maximum ceiling of 10,000 ft (3048 m). The majority of the respondents never experienced hypoxic symptoms. In general, most of the individuals agreed with the importance of an introductory hypoxia course without altitude chamber training (ACT) for all pilot populations, and with a pilot monitoring system in order to increase flight safety. Generally, most of the pilots felt that hypoxia education and training for unpressurized aircraft is not extensive enough. However, almost all the respondents were willing to use a flight physiology monitoring system in order to improve flight safety.

STS-26 Commander Hauck in fixed based (FB) shuttle mission simulator (SMS)

Science.gov (United States)

1988-01-01

STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck, wearing comunications kit assembly headset and seated in the commanders seat on forward flight deck, looks over his shoulder toward the aft flight deck. A flight data file (FDF) notebook rests on his lap. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

The read-out chain of the CBM STS detector

Energy Technology Data Exchange (ETDEWEB)

Lehnert, Joerg; Emschermann, David [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment at FAIR will explore the QCD phase diagram at high baryon densities during nucleus-nucleus collisions in a fixed target setup. Its physics goals require interaction rates up to 10 MHz, which can be exploited with fast and radiation hard detectors equipped with free-streaming front-end and readout electronics, connected to a common Data Aquisition (DAQ) system to forward data to the First Level Event Selector (FLES). The core component of the CBM DAQ system is the Data Processing Board (DPB) implementing three important functionalities: - The incoming data via multiple lower-speed, short distance links is preprocessed, concentrated and forwarded to the FLES via higher-speed, long distance links. - The DPBs provide an interface for the Detector Control System (DCS) to configure readout and front-end electronics (FEE). - As part of the Timing and Fast Control (TFC) system the DPBs ensure transmission of the reference clock and synchronous commands necessary to synchronize the FEE. This contribution presents the readout and DAQ chain on the example of the core subdetector, the Silicon Tracking System (STS).

Charting Multidisciplinary Team External Dynamics Using a Systems Thinking Approach

Science.gov (United States)

Barthelemy, Jean-Francois; Waszak, Martin R.; Jones, Kenneth M.; Silcox, Richard J.; Silva, Walter A.; Nowaczyk, Ronald H.

1998-01-01

Using the formalism provided by the Systems Thinking approach, the dynamics present when operating multidisciplinary teams are examined in the context of the NASA Langley Research and Technology Group, an R&D organization organized along functional lines. The paper focuses on external dynamics and examines how an organization creates and nurtures the teams and how it disseminates and retains the lessons and expertise created by the multidisciplinary activities. Key variables are selected and the causal relationships between the variables are identified. Five "stories" are told, each of which touches on a different aspect of the dynamics. The Systems Thinking Approach provides recommendations as to interventions that will facilitate the introduction of multidisciplinary teams and that therefore will increase the likelihood of performing successful multidisciplinary developments. These interventions can be carried out either by individual researchers, line management or program management.

STS-84 oxygen generator for Mir installation

Science.gov (United States)

1997-01-01

In the SPACEHAB Payload Processing Facility, McDonnell Douglas- SPACEHAB technicians prepare a Russian-made oxygen generator for flight in a SPACEHAB Double Module. The oxygen generator, manufactured in Russia by RSC Energia, will be carried aboard the Space Shuttle Atlantis on Mission STS-84 for the Shuttles scheduled docking with the Russian Space Station Mir next month. The nearly 300-pound generator will replace one of two Mir units that have been malfunctioning recently. The generator functions by electrolysis, which separates water into its oxygen and hydrogen components. The hydrogen is vented and the oxygen is used for breathing by the Mir crew. The generator is 4.2 feet in length and 1.4 feet in diameter. STS-84, which is planned to include a Mir crew exchange of astronaut C. Michael Foale for Jerry M. Linenger, is targeted for a May 15 liftoff. It will be the sixth Shuttle-Mir docking.

STS-95 Post Flight Presentation

Science.gov (United States)

1998-01-01

The STS-95 flight crew, Cmdr. Curtis L. Brown, Pilot Steven W. Lindsey, Mission Specialists Scott E. Parazynski, Stephen K. Robinson, and Pedro Duque, and Payload Specialists Chiaki Mukai and John H. Glenn present a video mission over-view of their space flight. Images include prelaunch activities such as eating the traditional breakfast, crew suit-up, and the ride out to the launch pad. Also, included are various panoramic views of the shuttle on the pad. The crew can be seen being readied in the "whiteroom" for their mission. After the closing of the hatch and arm retraction, launch activities are shown including countdown, engine ignition, launch, and the separation of the Solid Rocket Boosters. The primary objectives, which include the conducting of a variety of science experiments in the pressurized SPACEHAB module, the deployment and retrieval of the Spartan free-flyer payload, and operations with the HST Orbiting Systems Test (HOST) and the International Extreme Ultraviolet Hitchhiker (IEH) payloads are discussed in both the video and still photo presentation.

Improving epistemological beliefs and moral judgment through an STS-based science ethics education program.

Science.gov (United States)

Han, Hyemin; Jeong, Changwoo

2014-03-01

This study develops a Science-Technology-Society (STS)-based science ethics education program for high school students majoring in or planning to major in science and engineering. Our education program includes the fields of philosophy, history, sociology and ethics of science and technology, and other STS-related theories. We expected our STS-based science ethics education program to promote students' epistemological beliefs and moral judgment development. These psychological constructs are needed to properly solve complicated moral and social dilemmas in the fields of science and engineering. We applied this program to a group of Korean high school science students gifted in science and engineering. To measure the effects of this program, we used an essay-based qualitative measurement. The results indicate that there was significant development in both epistemological beliefs and moral judgment. In closing, we briefly discuss the need to develop epistemological beliefs and moral judgment using an STS-based science ethics education program.

STS-90 Pilot Scott Altman arrives at KSC for TCDT

Science.gov (United States)

1998-01-01

STS-90 Pilot Scott Altman poses in the cockpit of his T-38 jet trainer aircraft after arriving at the KSC Shuttle Landing Facility along with other members of the crew from NASAs Johnson Space Center to begin Terminal Countdown Demonstration Test (TCDT) activities. The TCDT is held at KSC prior to each Space Shuttle flight to provide crews with the opportunity to participate in simulated countdown activities. Columbia is targeted for launch of STS-90 on April 16 at 2:19 p.m. EST and will be the second mission of 1998. The mission is scheduled to last nearly 17 days.

The STS-95 crew addresses KSC employees in the Training Auditorium

Science.gov (United States)

1998-01-01

In the Kennedy Space Center (KSC) Training Auditorium, STS-95 Commander Curtis L. Brown Jr. (at podium) addresses KSC employees who were invited to hear the STS-95 crew describe their experiences during their successful mission dedicated to microgravity research and to view a videotape of the highlights of the mission. The other STS-95 crew members are (seated, from left to right) Pilot Steven W. Lindsey; Mission Specialist and Payload Commander Stephen K. Robinson; Mission Specialists Scott E. Parazynski and Pedro Duque, with the European Space Agency (ESA); and Payload Specialists Chiaki Mukai, with the National Space Development Agency of Japan (NASDA), and John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts. Later in the afternoon, the crew will participate in a parade down State Road A1A in nearby Cocoa Beach, reminiscent of those held after missions during the Mercury Program.

N reactor external events probabilistic risk assessment

International Nuclear Information System (INIS)

Baxter, J.T.

1989-01-01

An external events probabilistic risk assessment of the N Reactor has been completed. The methods used are those currently being proposed for external events analysis in NUREG-1150. Results are presented for the external hazards that survived preliminary screening. They are earthquake, fire, and external flood. Core damage frequencies for these hazards are shown to be comparable to those for commercial pressurized water reactors. Dominant fire sequences are described and related to 10 CFR 50, Appendix R design requirements. Potential remedial measures that reduce fire core damage risk are described including modifications to fire protection systems, procedure changes, and addition of new administrative controls. Dominant seismic sequences are described. The effect of non-safety support system dependencies on seismic risk is presented

Cryogenics around the 11.7 T MRI Iseult magnet

International Nuclear Information System (INIS)

Bredy, P.; Belorgey, J.; Chesny, P.; Hervieu, B.; Lannou, H.; Juster, F. P.; Abdel-Maksoud, W.; Mayri, C.; Molinie, F.; Payn, A.

2010-01-01

As part of the Iseult/Inumac project, the development of a 500 MHz whole body MRI magnet has been launched in 2006. This magnet with a central field of 11.7 T in a warm bore of 900 mm has outstanding specifications with respect to usual MRI systems. The normal operation of this magnet will need the construction of a cryo-plant able to cool its superconducting coils with pressurized HeII 1.8 K. A helium liquefier and 4.2 K/1.8 K refrigeration stage will be installed in the vicinity of the magnet. Before that, a magnet test facility (Seht-'station d'essais huit teslas') installed at CEA/Saclay has been built in order to validate technical and control-process aspects during all operating phases: cooling down, nominal operation, quench event. The cryogenic system has been designed according to the principles foreseen for Iseult. The facility integration, commissioning, and operating results will be presented. The design of the final cryogenic installation for Iseult magnet, adapted to the facility experiences, is previously described. (authors)

External validation of a clinical scoring system for the risk of gestational diabetes mellitus

NARCIS (Netherlands)

van Leeuwen, M.; Opmeer, B. C.; Zweers, E. J. K.; van Ballegooie, E.; ter Brugge, H. G.; de Valk, H. W.; Visser, G. H. A.; Mol, B. W. J.

Aim: A prediction rule for gestational diabetes mellitus (GDM) could be helpful in early detection and increased efficiency of screening. A prediction rule by means of a clinical scoring system is available, but has never been validated externally. The aim of this study was to validate the scoring

STS-98 Crew Interview: Tom Jones

Science.gov (United States)

2001-01-01

The STS-98 Mission Specialist Tom Jones is seen being interviewed. He answers questions about his inspiration to become an astronaut, his career path, and his training. He gives details on the mission's goals and significance, and the payload and hardware it brings to the International Space Station (ISS). Mr. Jones discusses his role in the mission's spacewalks and activities.

Gas Turbine Engine Starting Applicated on TV2-117 Turboshaft

Directory of Open Access Journals (Sweden)

R. M. Catana

2017-10-01

Full Text Available The paper presents the examination of two different types of engine starting configurations, applicated on TV2-117A turboshaft, running into the test bench. The first type of starting configuration is a normal starting, with the engine connected to the dynamometer which controls the free turbine speed by the dynamometer load. The second type of starting is a different one, the engine is not connected with the dynamometer, therefore it results that there is no control of the free turbine speed from the dynamometer, only from the engine but in particular conditions. To achieve the starting phase an instrumentation scheme is created, to control and monitor the engine, and a starting sequence with all the parameters, confirmations and commands that are involved into the starting phase. The engine starting is performed by the test bench operating system, composed of an acquisition system and a programmable controller, wherewith is running the starting sequence.

41 CFR 102-117.120 - To what extent must I equally distribute orders for transportation and related services among TSPs?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false To what extent must I....120 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 117-TRANSPORTATION MANAGEMENT Business Rules To Consider...

77 FR 75628 - STS Hydropower, Ltd., Dan River, Inc., and City of Danville, VA; Notice of Application for...

Science.gov (United States)

2012-12-21

..., Ltd., Dan River, Inc., and City of Danville, VA; Notice of Application for Partial Transfer of License... Bankruptcy Trustee for Dan River, Inc. and STS Hydropower, Ltd (co-licensees) transferors and the City of... Project from Dan River, Inc. and STS Hydropower, Ltd. to STS Hydropower, Ltd. and the City of Danville...

Characterization of Volume F Trash from the Three FY11 STS Missions: Trash Weights and Categorization and Microbial Characterization

Science.gov (United States)

Strayer, Richard F.; Hummerick, Mary E.; Richards, Jeffrey T.; McCoy, LaShelle E.; Roberts, Michael S.; Wheller, Raymond M.

2011-01-01

The project reported here provides microbial characterization support to the Waste Management Systems (WMS) element of NASA's Life Support and Habitation Systems (LSHS) program. Conventional microbiological methods were used to detect and enumerate microorganisms in STS Volume F Compartment trash for three shuttle missions: STS 133, 134, and 135. This trash was usually made available within 2 days of landing at KSC. The Volume F bag was weighed, opened and the contents were cataloged and placed into categories: personal hygiene items - inclUding EVA maximum absorbent garments (MAGs) and Elbow packs (daily toilet wipes, etc), drink containers, food waste (and containers), office waste (paper), and packaging materials - plastic film and duct tape. The average wet trash generation rate for the three STS missions was 0.362 % 0.157 kgwet crew 1 d-1 . This was considerably lower and more variable than the average rate for 4 STS missions reported for FY10. Trash subtotals by category: personal hygiene wastes, 56%; drink items, 11 %; food wastes, 18%; office waste, 3%; and plastic film, 12%. These wastes have an abundance of easily biodegraded compounds that can support the growth of microorganisms. Microbial characterization of trash showed that large numbers of bacteria and fungi have taken advantage of this readily available nutrient source to proliferate. Exterior and interior surfaces of plastic film bags containing trash were sampled and counts of cultivatable microbes were generally low and mostly occurred on trash bundles within the exterior trash bags. Personal hygiene wastes, drink containers, and food wastes and packaging all contained high levels of, mostly, aerobic heterotrophic bacteria and lower levels of yeasts and molds. Isolates from plate count media were obtained and identified .and were mostly aerobic heterotrophs with some facultative anaerobes. These are usually considered common environmental isolates on Earth. However, several pathogens were also

Modeling the Activities of Scientists: Prospective Science Teachers' Poster Presentations in An STS Course

Science.gov (United States)

Dogan, Alev; Kaya, Osman Nafiz; Kilic, Ziya; Kilic, Esma; Aydogdu, Mustafa

2004-01-01

In this study, prospective science teachers' (PSTs) views about their poster presentations were investigated. These posters were developed through PSTs' online and library research and scientific mini-symposiums in chemistry related topics in the framework of science, technology and society course (STS). During the first four weeks of STS course,…

REPORT FROM THE STS NATIONAL DATABASE WORK FORCE

Science.gov (United States)

Overman, David M.; Jacobs, Jeffrey P.; Prager, Richard L.; Wright, Cameron D.; Clarke, David R.; Pasquali, Sara; O’Brien, Sean M.; Dokholyan, Rachel S.; Meehan, Paul; McDonald, Donna E.; Jacobs, Marshall L.; Mavroudis, Constantine; Shahian, David M.

2013-01-01

Several distinct definitions of postoperative death have been used in various quality reporting programs. Some have defined a postoperative mortality as a patient who expires while still in the hospital, while others have considered all deaths occurring within a predetermined, standardized time interval after surgery. While if continues to collect mortality data using both these individual definitions, the Society of Thoracic Surgeons (STS) believes that either alone may be inadequate. Accordingly, the STS prefers a more encompassing metric, Operative Mortality, which is defined as (1) all deaths occurring during the hospitalization in which the operation was performed, even if after 30 days; and (2) all deaths occurring after discharge from the hospital, but before the end of the thirtieth postoperative day. This manuscript provides clarification for some uncommon but important scenarios where the correct application of this definition may be problematic. PMID:23799748

Bifurcation and Nonlinear Dynamic Analysis of Externally Pressurized Double Air Films Bearing System

Directory of Open Access Journals (Sweden)

Cheng-Chi Wang

2014-01-01

Full Text Available This paper studies the chaotic and nonlinear dynamic behaviors of a rigid rotor supported by externally pressurized double air films (EPDAF bearing system. A hybrid numerical method combining the differential transformation method and the finite difference method is used to calculate pressure distribution of EPDAF bearing system and bifurcation phenomenon of rotor center orbits. The results obtained for the orbits of the rotor center are in good agreement with those obtained using the traditional finite difference approach. The results presented summarize the changes which take place in the dynamic behavior of the EPDAF bearing system as the rotor mass and bearing number are increased and therefore provide a useful guideline for the bearing system.

Comparison between externally fired gas turbine and gasifier-gas turbine system for the olive oil industry

International Nuclear Information System (INIS)

Vera, D.; Jurado, F.; Mena, B. de; Schories, G.

2011-01-01

The olive oil industry generates during the extraction process several solid wastes as olive tree leaves and prunings, exhausted pomace and olive pits. These renewable wastes could be used for power and heat applications. The aim of this paper is to compare the performance of two small-scale CHP systems: a gasification- gas turbine system and an EFGT (externally fired gas turbine system). For this reason, several parameters have been calculated: generated heat and power, electric and overall efficiencies, biomass consumption, exergy efficiency, optimum pressure ratio, etc. These systems provide 30 kW e and about 60kW th . Simulation results show that the electrical and overall efficiencies achieved in EFGT system (19.1% and 59.3%, respectively) are significantly higher than those obtained in the gasification plant (12.3% and 45.4%). The proposed CHP systems have been modeled using Cycle-Tempo ® software. -- Highlights: ► Comparison between externally fired gas turbine and gasifier-gas turbine system. ► Olive oil industry generates several solid wastes as olive tree leaves and prunings. ► Thermodynamic parameters have been calculated. ► Systems have been modeled using Cycle-Tempo ® software. ► Simulation results show electrical and overall efficiencies achieved in the systems.

Description and characterization of systems for external insulation and retrofitting for Denmark with emphasis on the thermal performance

DEFF Research Database (Denmark)

Rudbeck, Claus Christian; Svendsen, Sv Aa Højgaard

1998-01-01

Lately there has been quite a large focus on retrofitting of the Danish buildings. The retrofitting of the building is done in order to solve one or more of the following problems: bad indoor climate, large use of energy for heating, insufficient durability or architectural unsatisfactory.In order...... to solve these problems insulation is often part of the retrofitting. As internal insulation has many disadvantages with regards to heat and moisture only systems for external insulation will be mentioned here.As there are several different systems for external insulation, each with different properties......, there is a need for a systematic approach when the building designer chooses which system should be used on the building which is to be retrofitted....

Major Decisions Ahead: Implementing SFAA Nos. 116 and 117.

Science.gov (United States)

Williams, Kenneth; Turner, Robert

1994-01-01

Issues that colleges and universities must address in implementing the Financial Accounting Standards Board's Statements of Financial Accounting Standards 116 (concerning contributions received and made) and 117 (for nonprofit organizations) are outlined. The overall objective is to present a financial statement in a format that tells the…

25 CFR 117.28 - Payment of claims against estates.

Science.gov (United States)

2010-04-01

... COMPETENCY § 117.28 Payment of claims against estates. The superintendent may disburse to the executor or... the Indian. (b) Expenses incurred pending the qualifications of an executor or administrator under... executor or administrator, transcript fees and appraiser fees. (d) Living expenses incurred within 90 days...

33 CFR 117.591 - Charles River and its tributaries.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Charles River and its tributaries... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.591 Charles River and its tributaries. (a) The following requirements apply to all bridges across the Charles River and it's...

STS-3 medical report

Science.gov (United States)

Pool, S. L. (Editor); Johnson, P. C., Jr. (Editor); Mason, J. A. (Editor)

1982-01-01

The medical operations report for STS-3, which includes a review of the health of the crew before, during, and immediately after the third Shuttle orbital flight is presented. Areas reviewed include: health evaluation, medical debriefing of crewmembers, health stabilization program, medical training, medical 'kit' carried in flight, tests and countermeasures for space motion sickness, cardiovascular profile, biochemistry and endocrinology results, hematology and immunology analyses, medical microbiology, food and nutrition, potable water, shuttle toxicology, radiological health, and cabin acoustic noise. Environmental effects of shuttle launch and landing medical information management, and management, planning, and implementation of the medical program are also dicussed.

A method for aggregating external operating conditions in multi-generation system optimization models

DEFF Research Database (Denmark)

Lythcke-Jørgensen, Christoffer Ernst; Münster, Marie; Ensinas, Adriano Viana

2016-01-01

This paper presents a novel, simple method for reducing external operating condition datasets to be used in multi-generation system optimization models. The method, called the Characteristic Operating Pattern (CHOP) method, is a visually-based aggregation method that clusters reference data based...... on parameter values rather than time of occurrence, thereby preserving important information on short-term relations between the relevant operating parameters. This is opposed to commonly used methods where data are averaged over chronological periods (months or years), and extreme conditions are hidden...... in the averaged values. The CHOP method is tested in a case study where the operation of a fictive Danish combined heat and power plant is optimized over a historical 5-year period. The optimization model is solved using the full external operating condition dataset, a reduced dataset obtained using the CHOP...

STS-49 Endeavour, Orbiter Vehicle (OV) 105, Planning Team in MCC Bldg 30 FCR

Science.gov (United States)

1992-01-01

STS-49 Endeavour, Orbiter Vehicle (OV) 105, Planning Team with Flight Director (FD) James M. Heflin, Jr (front right next to ship model) poses in JSC's Mission Control Center (MCC) Bldg 30 Flight Control Room (FCR). The group stands in front of visual displays projecting STS-49 data and ground track map.

Improving Indicators in a Brazilian Hospital Through Quality-Improvement Programs Based on STS Database Reports

Directory of Open Access Journals (Sweden)

Pedro Gabriel Melo de Barros e Silva

2015-12-01

Full Text Available ABSTRACT OBJECTIVE: To report the initial changes after quality-improvement programs based on STS-database in a Brazilian hospital. METHODS: Since 2011 a Brazilian hospital has joined STS-Database and in 2012 multifaceted actions based on STS reports were implemented aiming reductions in the time of mechanical ventilation and in the intensive care stay and also improvements in evidence-based perioperative therapies among patients who underwent coronary artery bypass graft surgeries. RESULTS: All the 947 patients submitted to coronary artery bypass graft surgeries from July 2011 to June 2014 were analyzed and there was an improvement in all the three target endpoints after the implementation of the quality-improvement program but the reduction in time on mechanical ventilation was not statistically significant after adjusting for prognostic characteristics. CONCLUSION: The initial experience with STS registry in a Brazilian hospital was associated with improvement in most of targeted quality-indicators.

Health, environmental risks and externalities of nuclear and other energy systems of Russia

International Nuclear Information System (INIS)

Vasiliev, A.P.; Demin, V.F.

2000-01-01

Due to different reasons the structure of electricity production systems of Russia should be reconsidered and changed. In this reconsideration the results of comparative risk assessment (CRA) and external cost assessment (ECA) are needed. CRA and ECA study has been carried out in the frame of the research program of International Center of Environmental Safety of Ministry of Atomic Energy of Russia. Main directions of this study are: 1) developing CRA and ECA methodology and data base ; 2) performing CRA and ECA for nuclear and other energy systems. Some tendencies in development of electricity production systems in Russia and preliminary results of CRA and ECA are described. (author)

[Treatment type C fracture of the distal radius with locking compression plate and external fixators].

Science.gov (United States)

Yang, Xiang; Zhao, You-ming; Chen, Lin; Ye, Cong-cong; Guo, Wei-jun; Wang, Bo

2013-12-01

To compare efficacy of unilateral external fixators and locking compression plates in treating type C fractures of the distal radius. From January 2009 to June 2010, 76 patients with distal radius fracture were treated with LCP and external fixators, 54 patients were followed up. Among them, 29 cases were male and 25 cases were female with an average age of 45.31 (ranged, 24 to 68) years old. There were 29 patients in LCP group. According to AO classification, 8 cases were type C1, 7 cases were type C2 and 14 cases were type C3. There were 25 cases in external fixators group. According to AO classification, 6 cases were type C1, 8 cases were type C2 and 11 cases were type C3. Radial height, volar tilt and radial inclination were compared, advanced Gartland-Werley scoring were used to assessed wrist joint function after 6 and 12 months' following up. Two cases were suffered from nail infection in external fixators group. Fifty-four patients were followed up from 12 to 24 months with an average of 21.3 months. Radial height was (9.60 +/- 0.72) mm, volar tilt was (9.55 +/- 0.80) degrees and radial inclination was (21.40 +/- 0.78) degrees in LCP group,while those were (9.40 +/- 0.70) mm, (9.47 +/- 0.71) degrees and (21.20 +/- 0.73) degrees in external fixtors group, and with no statistical significance (P>0.05). Advanced Gartland-Werley score after 6 months' following up was 3.31 +/- 1.17 in LCP group, 5.56 +/- 1.58 in external fixtors group, and with significant difference (t=-5.99,Pmeaning (t=-1.55, P>0.05). LCP and external fixtors can receive good curative effects in treating type C distal radius fracture, and LCP can obtain obviously short-term efficacy, while there is no significant difference between two groups in long-term results. For serious distal radius comminuted fracture which unable to plate internal fixation, external fixators is a better choice.

STS-93 Commander Collins waves after suiting up before launch

Science.gov (United States)

1999-01-01

During final launch preparations in the Operations and Checkout Building, STS-93 Commander Eileen M. Collins waves after donning her launch and entry suit. After Space Shuttle Columbia's July 20 launch attempt was scrubbed at the T-7 second mark in the countdown, the launch was rescheduled for Thursday, July 22, at 12:28 a.m. EDT. The target landing date is July 26, 1999, at 11:24 p.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The new telescope is 20 to 50 times more sensitive than any previous X-ray telescope and is expected unlock the secrets of supernovae, quasars and black holes. The STS-93 crew numbers five: Commander Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a shuttle mission.

STS-61B Astronaut Spring During EASE Extravehicular Activity (EVA)

Science.gov (United States)

1985-01-01

The crew assigned to the STS-61B mission included Bryan D. O'Conner, pilot; Brewster H. Shaw, commander; Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Australia); and SATCOM KU-2 (RCA Americom). Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, Virginia, and the Marshall Space Flight Center (MSFC), the EASE and ACCESS were developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). In this STS-61B onboard photo, astronaut Spring was working on the EASE during an Extravehicular Activity (EVA). The primary objective of this experiment was to test the structural assembly concepts for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

49 CFR 1540.117 - Threat assessments regarding aliens holding or applying for FAA certificates, ratings, or...

Science.gov (United States)

2010-10-01

... applying for FAA certificates, ratings, or authorizations. 1540.117 Section 1540.117 Transportation Other... applying for FAA certificates, ratings, or authorizations. (a) Applicability. This section applies when TSA... applying for, an airman certificate, rating, or authorization issued by the FAA Administrator, poses a...

Controlled transport of solitons and bubbles using external perturbations

International Nuclear Information System (INIS)

Gonzalez, J.A.; Marcano, A.; Mello, B.A.; Trujillo, L.

2006-01-01

We investigate generalized soliton-bearing systems in the presence of external perturbations. We show the possibility of the transport of solitons using external waves, provided the waveform and its velocity satisfy certain conditions. We also investigate the stabilization and transport of bubbles using external perturbations in 3D-systems. We also present the results of real experiments with laser-induced vapor bubbles in liquids

33 CFR 117.40 - Advance notice for drawbridge opening.

Science.gov (United States)

2010-07-01

... of the advanced notice for the drawbridge will be added to subpart B of this part. [USCG-2001-10881... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Advance notice for drawbridge... SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.40 Advance notice for...

7 CFR 457.117 - Forage production crop insurance provisions.

Science.gov (United States)

2010-01-01

... INSURANCE CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.117 Forage..., or a mixture thereof, or other species as shown in the Actuarial Documents. Harvest—Removal of forage... different price elections by type, in which case you may select one price election for each forage type...

Stochastic Control - External Models

DEFF Research Database (Denmark)

Poulsen, Niels Kjølstad

2005-01-01

This note is devoted to control of stochastic systems described in discrete time. We are concerned with external descriptions or transfer function model, where we have a dynamic model for the input output relation only (i.e.. no direct internal information). The methods are based on LTI systems...

STS-118 Astronaut Tracy Caldwell During Training

Science.gov (United States)

2006-01-01

Tracy E. Caldwell, STS-118 astronaut and mission specialist, participates in a training session on the usage of a special device, used to lower oneself from a troubled shuttle, in the Space Vehicle Mockup Facility at the Johnson Space Center. Caldwell is wearing a training version of her shuttle launch and entry suit.

The R117A variant of the Escherichia coli transacylase FabD synthesizes novel acyl-(acyl carrier proteins).

Science.gov (United States)

Marcella, Aaron M; Barb, Adam W

2017-12-01

The commercial impact of fermentation systems producing novel and biorenewable chemicals will flourish with the expansion of enzymes engineered to synthesize new molecules. Though a small degree of natural variability exists in fatty acid biosynthesis, the molecular space accessible through enzyme engineering is fundamentally limitless. Prokaryotic fatty acid biosynthesis enzymes build carbon chains on a functionalized acyl carrier protein (ACP) that provides solubility, stability, and a scaffold for interactions with the synthetic enzymes. Here, we identify the malonyl-coenzyme A (CoA)/holo-ACP transacylase (FabD) from Escherichia coli as a platform enzyme for engineering to diversify microbial fatty acid biosynthesis. The FabD R117A variant produced novel ACP-based primer and extender units for fatty acid biosynthesis. Unlike the wild-type enzyme that is highly specific for malonyl-CoA to produce malonyl-ACP, the R117A variant synthesized acetyl-ACP, succinyl-ACP, isobutyryl-ACP, 2-butenoyl-ACP, and β-hydroxybutyryl-ACP among others from holo-ACP and the corresponding acyl-CoAs with specific activities from 3.7 to 120 nmol min -1  mg -1 . FabD R117A maintained K M values for holo-ACP (~ 40 μM) and displayed small changes in K M for acetoacetyl-CoA (110 ± 30 μM) and acetyl-CoA (200 ± 70 μM) when compared to malonyl-CoA (80 ± 30 μM). FabD R117A represents a novel catalyst that synthesizes a broad range of acyl-acyl-ACPs.

Externalities of fuel cycles 'ExternE' project. Summary report

International Nuclear Information System (INIS)

Holland, M.; Berry, J.

1994-01-01

There is a growing requirement for policy analysts to take account of the environment in their decision making and to undertake the specified cost-benefit analysis. Within the European Union this is reflected in the 5th Environmental Action Programme, and the Commission's White Paper entitled 'Growth, competitiveness, employment and the ways forward to the 21st century'. This has led to a need for evaluation of environmental externalities. The ExternE Project commenced in 1991 as the European part of a collaborative study between the European Commission and the US Department of Energy. It aims to be the first systematic approach to the evaluation of external costs of a wide range of different fuel cycles. The project will result in an operational accounting framework for the quantification and monetarisation of priority environmental and other externalities. This framework will allow the calculation of the marginal external costs and benefits for specific power plants, at specific sites using specified technologies. There are three major phases in the project. Phase I was undertaken in collaboration with the US Department of Energy. In this phase the teams jointly developed the conceptual approach and methodology and shared scientific information for application to a number of fuel cycles. On the European side work concentrated on the nuclear and coal fuel cycles which together were expected to raise many of the fundamental issues in fuel cycle analysis. The project is currently nearing completion of Phase 2. During this phase the methodology has been applied to a wide range of different fossil, nuclear and renewable fuel cycles for power generation and energy conservation options. Also a series of National Implementation Programmes are underway in which the methodology and accounting framework are being applied to reference sites throughout Europe. In addition the general methodology is being extended to address the evaluation of externalities associated with

The system of personal monitoring and the evaluation of occupational exposure to external ionizing radiation in Cuba

International Nuclear Information System (INIS)

Molina, Daniel; Castro, Ailza; Martinez, Ernesto; Pernas, Rene

2008-01-01

Full text: Personal monitoring of workers is recommended or required by the International Basic Safety Standards for Protection against Ionizing Radiation and for the Safety of Radiation Sources. In our country the personal monitoring of external exposure to ionizing radiation is carried out by External Dosimetry Laboratory (LDE) of the Center for Radiation Protection and Hygiene (CPHR). We have implemented an individual monitoring service based on thermoluminescence dosimetry system. The service includes whole body and extremity dosimeters. We have two systems; one is base on a manual Toledo TLD reader and the other on an automatic RADOS TLD system. This service is recognized by the National Regulatory Authority in the field of radiation protection and safety. We have implemented a quality assurance (QA) programme designed according to the recommendations of the ISO/IEC 17025 standards. The papers deals with the presentation of these QA programme which includes administrative data and information, technical checking of the equipment, acceptance tests of new dosimeters and equipment, issuing and processing of the dosimeters, dose evaluation, record keeping and reporting, traceability, handling of complaints, internal reviews and external audits. The papers also describe the results of occupational exposure for the different practices during 2006-2007 period. (author)

External post-operational checks for the LHC beam dumping system

International Nuclear Information System (INIS)

Magnin, N.; Baggiolini, V.; Carlier, E.; Goddard, B.; Gorbonosov, R.; Khasbulatov, D.; Uythoven, J.; Zerlauth, M.

2012-01-01

The LHC Beam Dumping System (LBDS) is a critical part of the LHC machine protection system. After every LHC beam dump action the various signals and transient data recordings of the beam dumping control systems and beam instrumentation measurements are automatically analysed by the external Post-Operational Checks (XPOC) system to verify the correct execution of the dump action and the integrity of the related equipment. This software system complements the LHC machine protection hardware, and has to ascertain that the beam dumping system is 'as good as new' before the start of the next operational cycle. This is the only way by which the stringent reliability requirements can be met. The XPOC system has been developed within the framework of the LHC 'Post-Mortem' system, allowing highly dependable data acquisition, data archiving, live analysis of acquired data and replay of previously recorded events. It is composed of various analysis modules, each one dedicated to the analysis of measurements coming from specific equipment. This paper describes the global architecture of the XPOC system and gives examples of the analyses performed by some of the most important analysis modules. It explains the integration of the XPOC into the LHC control infrastructure along with its integration into the decision chain to allow proceeding with beam operation. Finally, it discusses the operational experience with the XPOC system acquired during the first years of LHC operation, and illustrates examples of internal system faults or abnormal beam dump executions which it has detected. (authors)

Hysteresis-induced bifurcation and chaos in a magneto-rheological suspension system under external excitation

International Nuclear Information System (INIS)

Zhang Hailong; Zhang Ning; Wang Enrong; Min Fuhong

2016-01-01

The magneto-rheological damper (MRD) is a promising device used in vehicle semi-active suspension systems, for its continuous adjustable damping output. However, the innate nonlinear hysteresis characteristic of MRD may cause the nonlinear behaviors. In this work, a two-degree-of-freedom (2-DOF) MR suspension system was established first, by employing the modified Bouc–Wen force–velocity (F–v) hysteretic model. The nonlinear dynamic response of the system was investigated under the external excitation of single-frequency harmonic and bandwidth-limited stochastic road surface. The largest Lyapunov exponent (LLE) was used to detect the chaotic area of the frequency and amplitude of harmonic excitation, and the bifurcation diagrams, time histories, phase portraits, and power spectrum density (PSD) diagrams were used to reveal the dynamic evolution process in detail. Moreover, the LLE and Kolmogorov entropy (K entropy) were used to identify whether the system response was random or chaotic under stochastic road surface. The results demonstrated that the complex dynamical behaviors occur under different external excitation conditions. The oscillating mechanism of alternating periodic oscillations, quasi-periodic oscillations, and chaotic oscillations was observed in detail. The chaotic regions revealed that chaotic motions may appear in conditions of mid-low frequency and large amplitude, as well as small amplitude and all frequency. The obtained parameter regions where the chaotic motions may appear are useful for design of structural parameters of the vibration isolation, and the optimization of control strategy for MR suspension system. (paper)

27 CFR 478.117 - Function outside a customs territory.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Function outside a customs... Importation § 478.117 Function outside a customs territory. In the insular possessions of the United States outside customs territory, the functions performed by U.S. Customs officers under this subpart within a...

Impact of STS Issue Oriented Instruction on Pre-Service Elementary Teachers' Views and Perceptions of Science, Technology, and Society

Science.gov (United States)

Amirshokoohi, Aidin

2016-01-01

The purpose of the study was to investigate the impact of Science, Technology, Society (STS) issue oriented science methods course on pre-service teachers' views and perceptions toward STS issues and instruction as well as their levels of environmental literacy. The STS issue oriented curriculum was designed to help pre-service teachers improve…

Optical quality assurance procedures for the sensors of CBM STS detector

Energy Technology Data Exchange (ETDEWEB)

Lavrik, Evgeny [Physikalisches Institut der Universitaet Tuebingen (Germany); Collaboration: CBM-Collaboration

2016-07-01

The Compressed Baryonic Matter (CBM) experiment at FAIR aims to study the properties of nuclear matter at high net-baryon densities. The Silicon Tracking System (STS) is the key detector to reconstruct charged particle tracks created in heavy-ion interactions. In order to assure the quality of about 1300 silicon sensors, highly efficient and highly automated procedures need to be developed. In this contribution we report on a microscope camera based optical inspection system, used to scan along the individual sensors to recognize and classify sensor defects. Examples of these defects are: photo-resist residues, top metallization layer lithography defects, surface scratches. In order to separate and classify these defects various image-processing algorithms are used, including: pattern recognition, object classification etc.

STS-79 Ku-band antenna, ODS and Spacehab module at PCR

Science.gov (United States)

1996-01-01

The orbiter Ku-band antenna looms large in this view of the Space Shuttle Atlantis' payload bay. Visible just past the antenna system -- stowed on the starboard side of the payload bay wall -- is the Orbiter Docking System (ODS), and connected to the ODS via a tunnel is the Spacehab Double Module in the aft area of the payload bay. This photograph was taken from the starboard wing platform on the fifth level of the Payload Changeout Room (PCR) at Launch Pad 39A. Work is under way in the PCR to close Atlantis' payload bay doors for flight. Atlantis currently is being targeted for liftoff on Mission STS-79, the fourth docking of the U.S. Shuttle to the Russian Space Station Mir, around September 12.

The mini-company: a specification of sociotechnical business systems

NARCIS (Netherlands)

de Leede, Jan; Looise, Jan C.; Verkerk, Maarten

2002-01-01

Sociotechnical systems theory (STS) does not address in full the implications of the team-context relations, despite its open systems character. There is a need to open STS into a sociotechnical business systems (STBS) theory and practice. We observe three interrelated aspects that are important for

The Estimation of Externalities Resulting from the Electricity Generation

Energy Technology Data Exchange (ETDEWEB)

Jeong, Jong Tae; Ha, Jae Joo

2003-03-15

The methodology, program, and the representative results for the estimation of externalities was reviewed. The review of them are based on the ExternE Project which is a representative research project for the estimation of externalities resulting from the various energy generating systems. The results for the study will be used as basic data for the comparative study on the integrated risk estimation for various energy generating systems including nuclear power plants. Also, these results will be used as comparative data in the establishment of a integrated comparative risk assessment tool and in the comparative study of the impacts resulting from the various electricity generating systems. These studies make it possible to compare the environmental impacts of nuclear power generation and other electricity generation systems. Therefore, this will of use in the enhancement of public acceptance of nuclear power generation.

The Estimation of Externalities Resulting from the Electricity Generation

International Nuclear Information System (INIS)

Jeong, Jong Tae; Ha, Jae Joo

2003-03-01

The methodology, program, and the representative results for the estimation of externalities was reviewed. The review of them are based on the ExternE Project which is a representative research project for the estimation of externalities resulting from the various energy generating systems. The results for the study will be used as basic data for the comparative study on the integrated risk estimation for various energy generating systems including nuclear power plants. Also, these results will be used as comparative data in the establishment of a integrated comparative risk assessment tool and in the comparative study of the impacts resulting from the various electricity generating systems. These studies make it possible to compare the environmental impacts of nuclear power generation and other electricity generation systems. Therefore, this will of use in the enhancement of public acceptance of nuclear power generation

Proceedings: National conference on environmental externalities

International Nuclear Information System (INIS)

1990-01-01

This report is the proceedings of the National Conference on Environmental Externalities. A environmental externality is the environmental impact of a process or a plant that society must endure. It is a social cost and is paid, but not by the company who produced it or the company's customers who endure it. The main purpose of this report is to gather the many designs and ideas of how and why to internalize the externalities into the pricing systems of the public utility commissions, especially that of the electric utilities. Economic and sociological aspects of the internalization of these externalities are given in these proceedings. Individual papers are processed separately for databases. (MB)

Proceedings: National conference on environmental externalities

Energy Technology Data Exchange (ETDEWEB)

1990-12-31

This report is the proceedings of the National Conference on Environmental Externalities. A environmental externality is the environmental impact of a process or a plant that society must endure. It is a social cost and is paid, but not by the company who produced it or the company`s customers who endure it. The main purpose of this report is to gather the many designs and ideas of how and why to internalize the externalities into the pricing systems of the public utility commissions, especially that of the electric utilities. Economic and sociological aspects of the internalization of these externalities are given in these proceedings. Individual papers are processed separately for databases. (MB)

STS-40 Mission Insignia

Science.gov (United States)

1990-01-01

The STS-40 patch makes a contemporary statement focusing on human beings living and working in space. Against a background of the universe, seven silver stars, interspersed about the orbital path of Columbia, represent the seven crew members. The orbiter's flight path forms a double-helix, designed to represent the DNA molecule common to all living creatures. In the words of a crew spokesman, ...(the helix) affirms the ceaseless expansion of human life and American involvement in space while simultaneously emphasizing the medical and biological studies to which this flight is dedicated. Above Columbia, the phrase Spacelab Life Sciences 1 defines both the Shuttle mission and its payload. Leonardo Da Vinci's Vitruvian man, silhouetted against the blue darkness of the heavens, is in the upper center portion of the patch. With one foot on Earth and arms extended to touch Shuttle's orbit, the crew feels, he serves as a powerful embodiment of the extension of human inquiry from the boundaries of Earth to the limitless laboratory of space. Sturdily poised amid the stars, he serves to link scentists on Earth to the scientists in space asserting the harmony of efforts which produce meaningful scientific spaceflight missions. A brilliant red and yellow Earth limb (center) links Earth to space as it radiates from a native American symbol for the sun. At the frontier of space, the traditional symbol for the sun vividly links America's past to America's future, the crew states. Beneath the orbiting Shuttle, darkness of night rests peacefully over the United States. Drawn by artist Sean Collins, the STS 40 Space Shuttle patch was designed by the crewmembers for the flight.

STS-93 M.S. Michel Tognini in white room

Science.gov (United States)

1999-01-01

STS-93 Mission Specialist Michel Tognini of France is checked out by white room closeout crew members before entering the orbiter Columbia. Tognini is with the Centre National d'Etudes Spatiales (CNES). The white room is an environmental chamber at the end of the orbiter access arm that provides entry to the orbiter crew compartment. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. After Space Shuttle Columbia's July 20 and 22 launch attempts were scrubbed, the launch was again rescheduled for Friday, July 23, at 12:24 a.m. EDT. The target landing date is July 27 at 11:20 p.m. EDT.

Liftoff of Space Shuttle Columbia on mission STS-93

Science.gov (United States)

1999-01-01

The fiery launch of Space Shuttle Columbia lights up the night sky on its successful liftoff from Launch Pad 39-B on mission STS-93. Liftoff occurred at 12:31 a.m. EDT. STS-93 is a five-day mission primarily to release the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. The crew numbers five: Commander Eileen M. Collins, Pilot Jeffrey S. Ashby, and Mission Specialists Stephen A. Hawley (Ph.D.), Catherine G. Coleman (Ph.D.) and Michel Tognini of France, with the Centre National d'Etudes Spatiales (CNES). Collins is the first woman to serve as commander of a Shuttle mission. The target landing date is July 27, 1999, at 11:20 p.m. EDT.

STS-98 U.S. Lab Destiny rests in Atlantis' payload bay

Science.gov (United States)

2001-01-01

KENNEDY SPACE CENTER, Fla. -- The U.S. Lab Destiny rests in the payload bay of Space Shuttle Atlantis. A key element in the construction of the International Space Station, Destiny is 28 feet long and weighs 16 tons. This research and command-and-control center is the most sophisticated and versatile space laboratory ever built. It will ultimately house a total of 23 experiment racks for crew support and scientific research. Destiny will fly on STS-98, the seventh construction flight to the ISS. Launch of STS-98 is scheduled for Jan. 19 at 2:11 a.m. EST.

External costs of energy - do the answers match the questions? Looking back at 10 years of ExternE

International Nuclear Information System (INIS)

Krewitt, W.

2002-01-01

While the claim for 'getting prices right' is quite popular in conceptual policy papers, the implementation of appropriate internalisation strategies is still hampered by a lack of reliable external cost data. Great expectations were set into the ExternE project, a major research programme launched by the European Commission at the beginning of the 1990s to provide a scientific basis for the quantification of energy related externalities and to give guidance supporting the design of internalisation measures. After more than a decade of research, the ExternE label became a well recognised standard source for external cost data. Looking back into the ExternE history, the paper pursues how emerging new scientific insights and changing background assumptions affected external cost estimates and related recommendations to policy over time. Based on ExternE results, the usefulness and inherent limitations of external cost estimates for impact categories like climate change or nuclear waste disposal is discussed. The paper also gives examples on how external costs in spite of remaining uncertainties are successfully used to support environmental policy. (Author)

STS-65 Columbia, OV-102, IML-2 Official crew portrait

Science.gov (United States)

1994-01-01

STS-65 Columbia, Orbiter Vehicle (OV) 102, International Microgravity Laboratory 2 (IML-2) Official crew portrait shows its seven crewmembers wearing launch and entry suits (LESs). The six NASA astronauts and a Japanese payload specialist take a break from STS-65 training to pose for their portrait. Left to right are Mission Specialist (MS) and Payload Commander (PLC) Richard J. Hieb, holding mission insignia, MS Leroy Chiao, Pilot James D. Halsell, Jr, Commander Robert D. Cabana, Payload Specialist Chiaki Mukai, MS Donald A. Thomas, holding launch and entry helmet (LEH), and Carl E. Walz. Mukai represents the National Space Development Agency (NASDA) of Japan.Portrait made by NASA JSC contract photographer Scott A. Wickes.

STS-44 Atlantis, OV-104, MS Musgrave on FB-SMS middeck during JSC training

Science.gov (United States)

1991-01-01

STS-44 Atlantis, Orbiter Vehicle (OV) 104, Mission Specialist (MS) F. Story Musgrave, wearing lightweight headset (HDST), adjusts controls on communications module mounted on a middeck overhead panel. Musgrave is on the middeck of the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. The STS-44 crewmembers are participating in a flight simulation.

Reduction of external noise of mobile energy facilities by using active noise control system in muffler

Science.gov (United States)

Polivaev, O. I.; Kuznetsov, A. N.; Larionov, A. N.; Beliansky, R. G.

2018-03-01

The paper describes a method for the reducing emission of low-frequency noise of modern automotive vehicles into the environment. The importance of reducing the external noise of modern mobile energy facilities made in Russia is substantiated. Standard methods for controlling external noise in technology are of low efficiency when low-frequency sound waves are reduced. In this case, it is in the low-frequency zone of the sound range that the main power of the noise emitted by the machinery lies. The most effective way to reduce such sound waves is to use active noise control systems. A design of a muffler using a similar system is presented. This muffler allowed one to reduce the emission of increased noise levels into the environment by 7-11 dB and to increase acoustic comfort at the operator's workplace by 3-5 dB.

The STS-95 crew poses with a Mercury capsule model before returning to JSC

Science.gov (United States)

1998-01-01

Before returning to the Johnson Space Center in Houston, Texas, members of the STS-95 crew pose with a model of a Mercury capsule following a media briefing at the Kennedy Space Center Press Site Auditorium . From left to right are Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA); Pilot Steven W. Lindsey; Mission Commander Curtis L. Brown Jr.; Friendship 7; Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts; Mission Specialist Scott E. Parazynski; and Mission Specialist Pedro Duque, with the European Space Agency (ESA). Also on the crew is Mission Specialist and Payload Commander Stephen K. Robinson (not shown). The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

76 FR 35104 - Safety Zone; Waterway Closure, Atchafalaya River From Mile Marker 117 (Morgan City Railroad...

Science.gov (United States)

2011-06-16

...-AA00 Safety Zone; Waterway Closure, Atchafalaya River From Mile Marker 117 (Morgan City Railroad Bridge... with rising flood water in the Atchafalaya River. Basis and Purpose Captain of the Port Morgan City... safety zone is located on the specified waters of the Atchafalaya River between MM 117 (Morgan City...

STS-107 M.S. Laurel Clark during TCDT M113 training activities

Science.gov (United States)

2002-01-01

KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark (in yellow cap) is instructed on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.

The impact of a STS/Constructivist learning approach on the beliefs and attitudes of preservice science teachers

Science.gov (United States)

Akcay, Hakan

The purpose of this study was to determine the impact of an Science-Technology-Society (STS) course for preservice science teachers. The course was designed to change not only preservice science teachers' attitudes toward science, scientists and science courses, but also the awareness and use of STS/Constructivist approaches in teaching. It also focuses on changes in preservice science teachers regarding the effectiveness of an STS/Constructivist learning environment. Both qualitative and quantitative research methods were used with and a one-group pretest-posttest design. The instruments were administered to the preservice science teachers at the beginning of the semester as pre-tests and again at the end of the semester as post-tests. Data gathered from pre- and post-administration were analyzed for each of the instruments that provide answers to the research questions. The sample consists of forty-one pre-service science teachers who were enrolled in the Societal & Educational Applications of Biological Concepts course during the spring semester of the 2004 and 2005 academic years at the University of Iowa. The major findings for the study include the following: (1) Preservice science teachers showed significantly growth over the semester in their perceptions concerning STS/Constructivism, beliefs about science teaching and learning, and attitudes toward science and technology, and their implications for society. These significant changes were not affected by gender nor grade (elementary vs secondary) level. (2) Preservice science teachers gain in understanding of how students learn with STS/Constructivist approaches. They also increased their use of STS/Constructivist approaches which were developed and applied to teaching science for all students. (3) Preservice science teachers showed statistically significant growth toward an STS/Constructivist philosophy of science teaching and learning in terms of student actions in the classroom, as well as their

STS-49 ASEM activity illustrated with PLAID computer graphics

Science.gov (United States)

1992-01-01

STS-49 Endeavour, Orbiter Vehicle (OV) 105, Assembly of Station by Extravehicular Activity (EVA) Methods (ASEM) activity is illustrated with PLAID computer graphics. An extravehicular mobility unit (EMU) suited crewmember, positioned on the remote manipulator system (RMS) manipulator foot restraint (MFR), grabs and maneuvers the multipurpose experiment support structure (MPESS) with truss assembly attached above OV-105's payload bay (PLB) using the steer wheel assembly. The MPESS/ASEM truss structure has been lifted out the sill-mounted payload retention latch assemblies (PRLAs) and will be repositioned in the PRLAs upon completion of handling procedures. Also seen in this illustration are the empty INTELSAT perigee stage cradle structure (aft PLB) and the capture bar grapple fixture stowed on the port side sill longeron.

Development of the Systems Thinking Scale for Adolescent Behavior Change.

Science.gov (United States)

Moore, Shirley M; Komton, Vilailert; Adegbite-Adeniyi, Clara; Dolansky, Mary A; Hardin, Heather K; Borawski, Elaine A

2018-03-01

This report describes the development and psychometric testing of the Systems Thinking Scale for Adolescent Behavior Change (STS-AB). Following item development, initial assessments of understandability and stability of the STS-AB were conducted in a sample of nine adolescents enrolled in a weight management program. Exploratory factor analysis of the 16-item STS-AB and internal consistency assessments were then done with 359 adolescents enrolled in a weight management program. Test-retest reliability of the STS-AB was .71, p = .03; internal consistency reliability was .87. Factor analysis of the 16-item STS-AB indicated a one-factor solution with good factor loadings, ranging from .40 to .67. Evidence of construct validity was supported by significant correlations with established measures of variables associated with health behavior change. We provide beginning evidence of the reliability and validity of the STS-AB to measure systems thinking for health behavior change in young adolescents.

The effect of multiple external representations (MERs) worksheets toward complex system reasoning achievement

Science.gov (United States)

Sumarno; Ibrahim, M.; Supardi, Z. A. I.