Differential secretome analysis of Pseudomonas syringae pv tomato using gel-free MS proteomics

Directory of Open Access Journals (Sweden)

Jörg eSchumacher

2014-07-01

Full Text Available The plant pathogen Pseudomonas syringae pv. tomato (DC3000 causes virulence by delivering effector proteins into host plant cells through its type three secretion system (T3SS. In response to the plant environment DC3000 expresses hypersensitive response and pathogenicity genes (hrp. Pathogenesis depends on the ability of the pathogen to manipulate the plant metabolism and to inhibit plant immunity, which depends to a large degree on the plant’s capacity to recognise both pathogen and microbial determinants (PAMP/MAMP-triggered immunity. We have developed and employed MS-based shotgun and targeted proteomics to (i elucidate the extracellular and secretome composition of DC3000 and (ii evaluate temporal features of the assembly of the T3SS and the secretion process together with its dependence of pH. The proteomic screen, under hrp inducing in vitro conditions, of extracellular and cytoplasmatic fractions indicated the segregated presence of not only T3SS implicated proteins such as HopK1, HrpK1, HrpA1 and Avrpto1, but also of proteins not usually associated with the T3SS or with pathogenicity. Using multiple reaction monitoring MS (MRM-MS to quantify HrpA1 and Avrpto1, we found that HrpA1 is rapidly expressed, at a strict pH-dependent rate and is post-translationally processed extracellularly. These features appear to not interfere with rapid Avrpto1 expression and secretion but may suggest some temporal post-translational regulatory mechanism of the T3SS assembly. The high specificity and sensitivity of the MRM-MS approach should provide a powerful tool to measure secretion and translocation in infected tissues.

Resistant and susceptible responses in alfalfa (Medicago sativa) to bacterial stem blight caused by Pseudomonas syringae pv. syringae

Science.gov (United States)

Bacterial stem blight caused by Pseudomonas syringae pv. syringae is a common disease of alfalfa (Medicago sativa L.) in the central and western U.S. and has been reported in Australia and Europe. The disease is not always recognized because symptoms are often associated with frost damage. Two culti...

Transgenic tomato plants overexpressing tyramine N-hydroxycinnamoyltransferase exhibit elevated hydroxycinnamic acid amide levels and enhanced resistance to Pseudomonas syringae.

Science.gov (United States)

Campos, Laura; Lisón, Purificación; López-Gresa, María Pilar; Rodrigo, Ismael; Zacarés, Laura; Conejero, Vicente; Bellés, José María

2014-10-01

Hydroxycinnamic acid amides (HCAA) are secondary metabolites involved in plant development and defense that have been widely reported throughout the plant kingdom. These phenolics show antioxidant, antiviral, antibacterial, and antifungal activities. Hydroxycinnamoyl-CoA:tyramine N-hydroxycinnamoyl transferase (THT) is the key enzyme in HCAA synthesis and is induced in response to pathogen infection, wounding, or elicitor treatments, preceding HCAA accumulation. We have engineered transgenic tomato plants overexpressing tomato THT. These plants displayed an enhanced THT gene expression in leaves as compared with wild type (WT) plants. Consequently, leaves of THT-overexpressing plants showed a higher constitutive accumulation of the amide coumaroyltyramine (CT). Similar results were found in flowers and fruits. Moreover, feruloyltyramine (FT) also accumulated in these tissues, being present at higher levels in transgenic plants. Accumulation of CT, FT and octopamine, and noradrenaline HCAA in response to Pseudomonas syringae pv. tomato infection was higher in transgenic plants than in the WT plants. Transgenic plants showed an enhanced resistance to the bacterial infection. In addition, this HCAA accumulation was accompanied by an increase in salicylic acid levels and pathogenesis-related gene induction. Taken together, these results suggest that HCAA may play an important role in the defense of tomato plants against P. syringae infection.

Characterization of Pseudomonas syringae pv. syringae, Causal Agent of Citrus Blast of Mandarin in Montenegro.

Science.gov (United States)

Ivanović, Žarko; Perović, Tatjana; Popović, Tatjana; Blagojević, Jovana; Trkulja, Nenad; Hrnčić, Snježana

2017-02-01

Citrus blast caused by bacterium Pseudomonas syringae is a very important disease of citrus occuring in many areas of the world, but with few data about genetic structure of the pathogen involved. Considering the above fact, this study reports genetic characterization of 43 P. syringae isolates obtained from plant tissue displaying citrus blast symptoms on mandarin ( Citrus reticulata ) in Montenegro, using multilocus sequence analysis of gyrB , rpoD , and gap1 gene sequences. Gene sequences from a collection of 54 reference pathotype strains of P. syringae from the Plant Associated and Environmental Microbes Database (PAMDB) was used to establish a genetic relationship with our isolates obtained from mandarin. Phylogenetic analyses of gyrB , rpoD , and gap1 gene sequences showed that P. syringae pv. syringae causes citrus blast in mandarin in Montenegro, and belongs to genomospecies 1. Genetic homogeneity of isolates suggested that the Montenegrian population might be clonal which indicates a possible common source of infection. These findings may assist in further epidemiological studies of this pathogen and for determining mandarin breeding strategies for P. syringae control.

Characterization of Pseudomonas syringae pv. syringae, Causal Agent of Citrus Blast of Mandarin in Montenegro

Directory of Open Access Journals (Sweden)

Žarko Ivanović

2017-02-01

Full Text Available Citrus blast caused by bacterium Pseudomonas syringae is a very important disease of citrus occuring in many areas of the world, but with few data about genetic structure of the pathogen involved. Considering the above fact, this study reports genetic characterization of 43 P. syringae isolates obtained from plant tissue displaying citrus blast symptoms on mandarin (Citrus reticulata in Montenegro, using multilocus sequence analysis of gyrB, rpoD, and gap1 gene sequences. Gene sequences from a collection of 54 reference pathotype strains of P. syringae from the Plant Associated and Environmental Microbes Database (PAMDB was used to establish a genetic relationship with our isolates obtained from mandarin. Phylogenetic analyses of gyrB, rpoD, and gap1 gene sequences showed that P. syringae pv. syringae causes citrus blast in mandarin in Montenegro, and belongs to genomospecies 1. Genetic homogeneity of isolates suggested that the Montenegrian population might be clonal which indicates a possible common source of infection. These findings may assist in further epidemiological studies of this pathogen and for determining mandarin breeding strategies for P. syringae control.

Response of tobacco to the Pseudomonas syringae pv. Tomato DC3000 is mainly dependent on salicylic acid signaling pathway.

Science.gov (United States)

Liu, Yang; Wang, Li; Cai, Guohua; Jiang, Shanshan; Sun, Liping; Li, Dequan

2013-07-01

Pseudomonas syringae pv. Tomato DC3000 (Pst DC3000) was the first pathogen to be demonstrated to infect Arabidopsis and to cause disease symptoms in the laboratory setting. However, the defense response to Pst DC3000 was unclear in tobacco. In this report, the expression profiles of twelve defense response-related genes were analyzed after treatment with salicylic acid (SA), jasmonic acid (JA), and pathogen Pst DC3000 by qRT-PCR. According to our results, it could be presented that the genes primarily induced by SA were also induced to higher levels after Pst DC3000 infection. SA accumulation could be induced to a higher level than that of JA after Pst DC3000 infection. In addition, SA could result in hypersensitive response (HR), which did not completely depend on accumulation of reactive oxygen species. These results indicated that tobacco mainly depended on SA signaling pathway rather than on JA signaling pathway in response to Pst DC3000. Further study demonstrated that JA could significantly inhibit the accumulation of SA and the generation of the HR induced by Pst DC3000. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

Redox proteomics of tomato in response to Pseudomonas syringae infection

Science.gov (United States)

Balmant, Kelly Mayrink; Parker, Jennifer; Yoo, Mi-Jeong; Zhu, Ning; Dufresne, Craig; Chen, Sixue

2015-01-01

Unlike mammals with adaptive immunity, plants rely on their innate immunity based on pattern-triggered immunity (PTI) and effector-triggered immunity (ETI) for pathogen defense. Reactive oxygen species, known to play crucial roles in PTI and ETI, can perturb cellular redox homeostasis and lead to changes of redox-sensitive proteins through modification of cysteine sulfhydryl groups. Although redox regulation of protein functions has emerged as an important mechanism in several biological processes, little is known about redox proteins and how they function in PTI and ETI. In this study, cysTMT proteomics technology was used to identify similarities and differences of protein redox modifications in tomato resistant (PtoR) and susceptible (prf3) genotypes in response to Pseudomonas syringae pv tomato (Pst) infection. In addition, the results of the redox changes were compared and corrected with the protein level changes. A total of 90 potential redox-regulated proteins were identified with functions in carbohydrate and energy metabolism, biosynthesis of cysteine, sucrose and brassinosteroid, cell wall biogenesis, polysaccharide/starch biosynthesis, cuticle development, lipid metabolism, proteolysis, tricarboxylic acid cycle, protein targeting to vacuole, and oxidation–reduction. This inventory of previously unknown protein redox switches in tomato pathogen defense lays a foundation for future research toward understanding the biological significance of protein redox modifications in plant defense responses. PMID:26504582

Transcriptional Dynamics Driving MAMP-Triggered Immunity and Pathogen Effector-Mediated Immunosuppression in Arabidopsis Leaves Following Infection with Pseudomonas syringae pv tomato DC3000.

Science.gov (United States)

Lewis, Laura A; Polanski, Krzysztof; de Torres-Zabala, Marta; Jayaraman, Siddharth; Bowden, Laura; Moore, Jonathan; Penfold, Christopher A; Jenkins, Dafyd J; Hill, Claire; Baxter, Laura; Kulasekaran, Satish; Truman, William; Littlejohn, George; Prusinska, Justyna; Mead, Andrew; Steinbrenner, Jens; Hickman, Richard; Rand, David; Wild, David L; Ott, Sascha; Buchanan-Wollaston, Vicky; Smirnoff, Nick; Beynon, Jim; Denby, Katherine; Grant, Murray

2015-11-01

Transcriptional reprogramming is integral to effective plant defense. Pathogen effectors act transcriptionally and posttranscriptionally to suppress defense responses. A major challenge to understanding disease and defense responses is discriminating between transcriptional reprogramming associated with microbial-associated molecular pattern (MAMP)-triggered immunity (MTI) and that orchestrated by effectors. A high-resolution time course of genome-wide expression changes following challenge with Pseudomonas syringae pv tomato DC3000 and the nonpathogenic mutant strain DC3000hrpA- allowed us to establish causal links between the activities of pathogen effectors and suppression of MTI and infer with high confidence a range of processes specifically targeted by effectors. Analysis of this information-rich data set with a range of computational tools provided insights into the earliest transcriptional events triggered by effector delivery, regulatory mechanisms recruited, and biological processes targeted. We show that the majority of genes contributing to disease or defense are induced within 6 h postinfection, significantly before pathogen multiplication. Suppression of chloroplast-associated genes is a rapid MAMP-triggered defense response, and suppression of genes involved in chromatin assembly and induction of ubiquitin-related genes coincide with pathogen-induced abscisic acid accumulation. Specific combinations of promoter motifs are engaged in fine-tuning the MTI response and active transcriptional suppression at specific promoter configurations by P. syringae. © 2015 American Society of Plant Biologists. All rights reserved.

Variation in extragenic repetitive DNA sequences in Pseudomonas syringae and potential use of modified REP primers in the identification of closely related isolates

Directory of Open Access Journals (Sweden)

Elif Çepni

2012-01-01

Full Text Available In this study, Pseudomonas syringe pathovars isolated from olive, tomato and bean were identified by species-specific PCR and their genetic diversity was assessed by repetitive extragenic palindromic (REP-PCR. Reverse universal primers for REP-PCR were designed by using the bases of A, T, G or C at the positions of 1, 4 and 11 to identify additional polymorphism in the banding patterns. Binding of the primers to different annealing sites in the genome revealed additional fingerprint patterns in eight isolates of P. savastanoi pv. savastanoi and two isolates of P. syringae pv. tomato. The use of four different bases in the primer sequences did not affect the PCR reproducibility and was very efficient in revealing intra-pathovar diversity, particularly in P. savastanoi pv. savastanoi. At the pathovar level, the primer BOX1AR yielded shared fragments, in addition to five bands that discriminated among the pathovars P. syringae pv. phaseolicola, P. savastanoi pv. savastanoi and P. syringae pv. tomato. REP-PCR with a modified primer containing C produced identical bands among the isolates in a pathovar but separated three pathovars more distinctly than four other primers. Although REP-and BOX-PCRs have been successfully used in the molecular identification of Pseudomonas isolates from Turkish flora, a PCR based on inter-enterobacterial repetitive intergenic concensus (ERIC sequences failed to produce clear banding patterns in this study.

Modular Study of the Type III Effector Repertoire in Pseudomonas syringae pv. tomato DC3000 Reveals a Matrix of Effector Interplay in Pathogenesis

Directory of Open Access Journals (Sweden)

Hai-Lei Wei

2018-05-01

Full Text Available Summary: The bacterial pathogen Pseudomonas syringae pv. tomato DC3000 suppresses the two-tiered innate immune system of Nicotiana benthamiana and other plants by injecting a complex repertoire of type III secretion effector (T3E proteins. Effectorless polymutant DC3000D36E was used with a modularized system for native delivery of the 29 DC3000 T3Es singly and in pairs. Assays of the performance of this T3E library in N. benthamiana leaves revealed a matrix of T3E interplay, with six T3Es eliciting death and eight others variously suppressing the death activity of the six. The T3E library was also interrogated for effects on DC3000D36E elicitation of a reactive oxygen species burst, for growth in planta, and for T3Es that reversed these effects. Pseudomonas fluorescens and Agrobacterium tumefaciens heterologous delivery systems yielded notably different sets of death-T3Es. The DC3000D36E T3E library system highlights the importance of 13 T3Es and their interplay in interactions with N. benthamiana. : Wei et al. used a Pseudomonas syringae strain lacking all known type III effectors with a modularized library expressing the 29 active effectors in the strain’s native repertoire, individually and in pairs, to comprehensively determine effector actions and interplay in inducing and suppressing responses associated with plant pathogenesis and immunity. Keywords: effector-triggered-immunity, pattern-triggered-immunity, Hop proteins, plant immunity, mini-Tn7

Virus-induced Gene Silencing-based Functional Analyses Revealed the Involvement of Several Putative Trehalose-6-Phosphate Synthase/Phosphatase Genes in Disease Resistance against Botrytis cinerea and Pseudomonas syringae pv. tomato DC3000 in Tomato

Directory of Open Access Journals (Sweden)

Huijuan Zhang

2016-08-01

Full Text Available Trehalose and its metabolism have been demonstrated to play important roles in control of plant growth, development and stress responses. However, direct genetic evidence supporting the functions of trehalose and its metabolism in defense response against pathogens is lacking. In the present study, genome-wide characterization of putative trehalose-related genes identified 11 SlTPSs for trehalose-6-phosphate synthase, 8 SlTPPs for trehalose-6-phosphate phosphatase and one SlTRE1 for trehalase in tomato genome. Nine SlTPSs, 4 SlTPPs and SlTRE1 were selected for functional analyses to explore their involvement in tomato disease resistance. Some selected SlTPSs, SlTPPs and SlTRE1 responded with distinct expression induction patterns to Botrytis cinerea and Pseudomonas syringae pv. tomato (Pst DC3000 as well as to defense signaling hormones (e.g. salicylic acid, jasmonic acid and a precursor of ethylene. Virus-induced gene silencing-mediated silencing of SlTPS3, SlTPS4 or SlTPS7 led to deregulation of ROS accumulation and attenuated the expression of defense-related genes upon pathogen infection and thus deteriorated the resistance against B. cinerea or Pst DC3000. By contrast, silencing of SlTPS5 or SlTPP2 led to an increased expression of the defense-related genes upon pathogen infection and conferred an increased resistance against Pst DC3000. Silencing of SlTPS3, SlTPS4, SlTPS5, SlTPS7 or SlTPP2 affected trehalose level in tomato plants with or without infection of B. cinerea or Pst DC3000. These results demonstrate that SlTPS3, SlTPS4, SlTPS5, SlTPS7 and SlTPP2 play roles in resistance against B. cinerea and Pst DC3000, implying the importance of trehalose and tis metabolism in regulation of defense response against pathogens in tomato.

Modular Study of the Type III Effector Repertoire in Pseudomonas syringae pv. tomato DC3000 Reveals a Matrix of Effector Interplay in Pathogenesis.

Science.gov (United States)

Wei, Hai-Lei; Zhang, Wei; Collmer, Alan

2018-05-08

The bacterial pathogen Pseudomonas syringae pv. tomato DC3000 suppresses the two-tiered innate immune system of Nicotiana benthamiana and other plants by injecting a complex repertoire of type III secretion effector (T3E) proteins. Effectorless polymutant DC3000D36E was used with a modularized system for native delivery of the 29 DC3000 T3Es singly and in pairs. Assays of the performance of this T3E library in N. benthamiana leaves revealed a matrix of T3E interplay, with six T3Es eliciting death and eight others variously suppressing the death activity of the six. The T3E library was also interrogated for effects on DC3000D36E elicitation of a reactive oxygen species burst, for growth in planta, and for T3Es that reversed these effects. Pseudomonas fluorescens and Agrobacterium tumefaciens heterologous delivery systems yielded notably different sets of death-T3Es. The DC3000D36E T3E library system highlights the importance of 13 T3Es and their interplay in interactions with N. benthamiana. Copyright © 2018 The Author(s). Published by Elsevier Inc. All rights reserved.

Virulence of Pseudomonas syringae pv. tomato DC3000 Is Influenced by the Catabolite Repression Control Protein Crc.

Science.gov (United States)

Chakravarthy, Suma; Butcher, Bronwyn G; Liu, Yingyu; D'Amico, Katherine; Coster, Matthew; Filiatrault, Melanie J

2017-04-01

Pseudomonas syringae infects diverse plant species and is widely used as a model system in the study of effector function and the molecular basis of plant diseases. Although the relationship between bacterial metabolism, nutrient acquisition, and virulence has attracted increasing attention in bacterial pathology, it is largely unexplored in P. syringae. The Crc (catabolite repression control) protein is a putative RNA-binding protein that regulates carbon metabolism as well as a number of other factors in the pseudomonads. Here, we show that deletion of crc increased bacterial swarming motility and biofilm formation. The crc mutant showed reduced growth and symptoms in Arabidopsis and tomato when compared with the wild-type strain. We have evidence that the crc mutant shows delayed hypersensitive response (HR) when infiltrated into Nicotiana benthamiana and tobacco. Interestingly, the crc mutant was more susceptible to hydrogen peroxide, suggesting that, in planta, the mutant may be sensitive to reactive oxygen species generated during pathogen-associated molecular pattern-triggered immunity (PTI). Indeed, HR was further delayed when PTI-induced tissues were challenged with the crc mutant. The crc mutant did not elicit an altered PTI response in plants compared with the wild-type strain. We conclude that Crc plays an important role in growth and survival during infection.

Hexanoic acid is a resistance inducer that protects tomato plants against Pseudomonas syringae by priming the jasmonic acid and salicylic acid pathways.

Science.gov (United States)

Scalschi, Loredana; Vicedo, Begonya; Camañes, Gemma; Fernandez-Crespo, Emma; Lapeña, Leonor; González-Bosch, Carmen; García-Agustín, Pilar

2013-05-01

Hexanoic acid-induced resistance (Hx-IR) is effective against several pathogens in tomato plants. Our study of the mechanisms implicated in Hx-IR against Pseudomonas syringae pv. tomato DC3000 suggests that hexanoic acid (Hx) treatment counteracts the negative effect of coronatine (COR) and jasmonyl-isoleucine (JA-Ile) on the salicylic acid (SA) pathway. In Hx-treated plants, an increase in the expression of jasmonic acid carboxyl methyltransferase (JMT) and the SA marker genes PR1 and PR5 indicates a boost in this signalling pathway at the expense of a decrease in JA-Ile. Moreover, Hx treatment potentiates 12-oxo-phytodienoic acid accumulation, which suggests that this molecule might play a role per se in Hx-IR. These results support a positive relationship between the SA and JA pathways in Hx-primed plants. Furthermore, one of the mechanisms of virulence mediated by COR is stomatal re-opening on infection with P. syringae. In this work, we observed that Hx seems to inhibit stomatal opening in planta in the presence of COR, which suggests that, on infection in tomato, this treatment suppresses effector action to prevent bacterial entry into the mesophyll. © 2012 BSPP AND BLACKWELL PUBLISHING LTD.

The Arabidopsis thaliana cysteine-rich receptor-like kinase CRK20 modulates host responses to Pseudomonas syringae pv. tomato DC3000 infection.

Science.gov (United States)

Ederli, Luisa; Madeo, Laura; Calderini, Ornella; Gehring, Chris; Moretti, Chiaraluce; Buonaurio, Roberto; Paolocci, Francesco; Pasqualini, Stefania

2011-10-15

In plants, the cysteine-rich repeat kinases (CRKs) are a sub-family of receptor-like protein kinases that contain the DUF26 motif in their extracellular domains. It has been shown that in Arabidopsis thaliana, CRK20 is transcriptionally induced by pathogens, salicylic acid and ozone (O(3)). However, its role in responses to biotic and abiotic stress remains to be elucidated. To determine the function of CRK20 in such responses, two CRK20 loss-of-function mutants, crk20-1 and crk20-2, were isolated from public collections of Arabidopsis T-DNA tagged lines and examined for responses to O(3) and Pseudomonas syringae pv. tomato (Pst) DC3000. crk20-1 and crk20-2 showed similar O(3) sensitivities and no differences in the expression of defense genes when compared with the wild-type. However, pathogen growth was significantly reduced, while there were no differences in the induction of salicylic acid related defense genes or salicylic acid accumulation. Furthermore, correlation analysis of CRK20 gene expression suggests that it has a role in the control of H(2)O and/or nutrient transport. We therefore propose that CRK20 promotes conditions that are favorable for Pst DC3000 growth in Arabidopsis, possibly through the regulation of apoplastic homeostasis, and consequently, of the environment of this biotrophic pathogen. Copyright © 2011 Elsevier GmbH. All rights reserved.

The Arabidopsis thaliana cysteine-rich receptor-like kinase CRK20 modulates host responses to Pseudomonas syringae pv. tomato DC3000 infection

KAUST Repository

Ederli, Luisa

2011-10-01

In plants, the cysteine-rich repeat kinases (CRKs) are a sub-family of receptor-like protein kinases that contain the DUF26 motif in their extracellular domains. It has been shown that in Arabidopsis thaliana, CRK20 is transcriptionally induced by pathogens, salicylic acid and ozone (O3). However, its role in responses to biotic and abiotic stress remains to be elucidated. To determine the function of CRK20 in such responses, two CRK20 loss-of-function mutants, crk20-1 and crk20-2, were isolated from public collections of Arabidopsis T-DNA tagged lines and examined for responses to O3 and Pseudomonas syringae pv. tomato (Pst) DC3000. crk20-1 and crk20-2 showed similar O3 sensitivities and no differences in the expression of defense genes when compared with the wild-type. However, pathogen growth was significantly reduced, while there were no differences in the induction of salicylic acid related defense genes or salicylic acid accumulation. Furthermore, correlation analysis of CRK20 gene expression suggests that it has a role in the control of H2O and/or nutrient transport. We therefore propose that CRK20 promotes conditions that are favorable for Pst DC3000 growth in Arabidopsis, possibly through the regulation of apoplastic homeostasis, and consequently, of the environment of this biotrophic pathogen. © 2011 Elsevier GmbH.

Arabidopsis AtERF15 positively regulates immunity against Pseudomonas syringae pv. tomato DC3000 and Botrytis cinerea

Directory of Open Access Journals (Sweden)

Huijuan eZhang

2015-09-01

Full Text Available Upon pathogen infection, activation of immune response requires effective transcriptional reprogramming that regulates inducible expression of a large set of defense genes. A number of ethylene-responsive factor transcription factors have been shown to play critical roles in regulating immune responses in plants. In the present study, we explored the functions of Arabidopsis AtERF15 in immune responses against Pseudomonas syringae pv. tomato (Pst DC3000, a (hemibiotrophic bacterial pathogen, and Botrytis cinerea, a necrotrophic fungal pathogen. Expression of AtERF15 was induced by infection of Pst DC3000 and B. cinerea and by treatments with salicylic acid (SA and methyl jasmonate. Biochemical assays demonstrated that AtERF15 is a nucleus-localized transcription activator. The AtERF15-overexpressing (AtERF15-OE plants displayed enhanced resistance while the AtERF15-RNAi plants exhibited decreased resistance against Pst DC3000 and B. cinerea. Meanwhile, Pst DC3000- or B. cinerea-induced expression of defense genes was upregulated in AtERF15-OE plants but downregulated in AtERF15-RNAi plants, as compared to the expression in wild type plants. In response to infection with B. cinerea, the AtERF15-OE plants accumulated less reactive oxygen species (ROS while the AtERF15-RNAi plants accumulated more ROS. The flg22- and chitin-induced oxidative burst was abolished and expression levels of the pattern-triggered immunity-responsive genes AtFRK1 and AtWRKY53 were suppressed in AtER15-RNAi plants upon treatment with flg22 or chitin. Furthermore, SA-induced defense response was also partially impaired in the AtERF15-RNAi plants. These data demonstrate that AtERF15 is a positive regulator of multiple layers of the immune responses in Arabidopsis.

Defining essential processes in plant pathogenesis with Pseudomonas syringae pv. tomato DC3000 disarmed polymutants and a subset of key type III effectors.

Science.gov (United States)

Wei, Hai-Lei; Collmer, Alan

2017-12-25

Pseudomonas syringae pv. tomato DC3000 and its derivatives cause disease in tomato, Arabidopsis and Nicotiana benthamiana. The primary virulence factors include a repertoire of 29 effector proteins injected into plant cells by the type III secretion system and the phytotoxin coronatine. The complete repertoire of effector genes and key coronatine biosynthesis genes have been progressively deleted and minimally reassembled to reconstitute basic pathogenic ability in N. benthamiana, and in Arabidopsis plants that have mutations in target genes that mimic effector actions. This approach and molecular studies of effector activities and plant immune system targets have highlighted a small subset of effectors that contribute to essential processes in pathogenesis. Most notably, HopM1 and AvrE1 redundantly promote an aqueous apoplastic environment, and AvrPtoB and AvrPto redundantly block early immune responses, two conditions that are sufficient for substantial bacterial growth in planta. In addition, disarmed DC3000 polymutants have been used to identify the individual effectors responsible for specific activities of the complete repertoire and to more effectively study effector domains, effector interplay and effector actions on host targets. Such work has revealed that AvrPtoB suppresses cell death elicitation in N. benthamiana that is triggered by another effector in the DC3000 repertoire, highlighting an important aspect of effector interplay in native repertoires. Disarmed DC3000 polymutants support the natural delivery of test effectors and infection readouts that more accurately reveal effector functions in key pathogenesis processes, and enable the identification of effectors with similar activities from a broad range of other pathogens that also defeat plants with cytoplasmic effectors. © 2017 BSPP AND JOHN WILEY & SONS LTD.

Expression of Vitis amurensis VaERF20 in Arabidopsis thaliana Improves Resistance to Botrytis cinerea and Pseudomonas syringae pv. Tomato DC3000

Directory of Open Access Journals (Sweden)

Mengnan Wang

2018-03-01

Full Text Available Ethylene response factor (ERF transcription factors play important roles in regulating immune responses in plants. In our study, we characterized a member of the ERF transcription factor family, VaERF20, from the Chinese wild Vitis genotype, V. amurensis Rupr “Shuangyou”. Phylogenetic analysis indicated that VaERF20 belongs to group IXc of the ERF family, in which many members are known to contribute to fighting pathogen infection. Consistent with this, expression of VaERF20 was induced by treatment with the necrotrophic fungal pathogen Botrytis cinerea (B. cinerea in “Shuangyou” and V. vinifera “Red Globe”. Arabidopsis thaliana plants over-expressing VaERF20 displayed enhanced resistance to B. cinerea and the bacterium Pseudomonas syringae pv. tomato (Pst DC3000. Patterns of pathogen-induced reactive oxygen species (ROS accumulation were entirely distinct in B. cinerea and PstDC3000 inoculated plants. Examples of both salicylic acid (SA and jasmonic acid/ethylene (JA/ET responsive defense genes were up-regulated after B. cinerea and PstDC3000 inoculation of the VaERF20-overexpressing transgenic A. thaliana plants. Evidence of pattern-triggered immunity (PTI, callose accumulation and stomatal defense, together with increased expression of PTI genes, was also greater in the transgenic lines. These data indicate that VaERF20 participates in various signal transduction pathways and acts as an inducer of immune responses.

Self-protection of Pseudomonas syringae pv. tabaci from its toxin, tabtoxinine-β-lactam

International Nuclear Information System (INIS)

Knight, T.J.; Durbin, R.D.; Langston-Unkefer, P.J.

1987-01-01

An extracellular toxin, tabtoxinine-β-lactam (TβL), is produced by Pseudomonas syringae pv. tabaci. This toxin irreversibly inhibits its target, glutamine synthetase; yet P. syringae pv. tabaci retains significant amounts of glutamine synthetase activity during toxin production in culture. As part of our investigation of the self-protection of P. syringae pv. tabaci, the authors compared the effects of TβL on Tox + (TβL-producing, insensitive to TβL) and Tox - (TβL nonproducing, sensitive to TΛ) strains. The extent of protection afforded to the Tox - strain when induced to adenylylate glutamine synthetase was tested. It was concluded that an additional protection mechanism was required. A detoxification activity was found in the Tox + strain which opens the ε-lactam ring to TβL to produce the inactive, open-chain form, tabtoxinine. Whole cells of the Tox + strain incubated for 24 h with [ 14 C]TβL (0.276 μmol/3 x 10 10 cells) contained [ 14 C]tabtoxinine (0.056 μmol), and the medium contained TβL (0.226 μmol). Extracts of spheroplasts of the Tox + stain also converted TβL to tabtoxinine, whereas extracts of the Tox - strain did not alter TβL. The conversion was time dependent and stoichiometric and was destroyed by boiling for 30 min or by the addition of 5mM EDTA. Penicillin, a possible substrate and competitive inhibitor of this lactamase activity, inhibited the conversion of TΛ to tabtoxinine. Periplasmic fluid did not catalyze the conversion of TβL

The Arabidopsis lectin receptor kinase LecRK-V.5 represses stomatal immunity induced by Pseudomonas syringae pv. tomato DC3000.

Directory of Open Access Journals (Sweden)

Marie Desclos-Theveniau

2012-02-01

Full Text Available Stomata play an important role in plant innate immunity by limiting pathogen entry into leaves but molecular mechanisms regulating stomatal closure upon pathogen perception are not well understood. Here we show that the Arabidopsis thaliana L-type lectin receptor kinase-V.5 (LecRK-V.5 negatively regulates stomatal immunity. Loss of LecRK-V.5 function increased resistance to surface inoculation with virulent bacteria Pseudomonas syringae pv tomato DC3000. Levels of resistance were not affected after infiltration-inoculation, suggesting that LecRK-V.5 functions at an early defense stage. By contrast, lines overexpressing LecRK-V.5 were more susceptible to Pst DC3000. Enhanced resistance in lecrk-V.5 mutants was correlated with constitutive stomatal closure, while increased susceptibility phenotypes in overexpression lines were associated with early stomatal reopening. Lines overexpressing LecRK-V.5 also demonstrated a defective stomatal closure after pathogen-associated molecular pattern (PAMP treatments. LecRK-V.5 is rapidly expressed in stomatal guard cells after bacterial inoculation or treatment with the bacterial PAMP flagellin. In addition, lecrk-V.5 mutants guard cells exhibited constitutive accumulation of reactive oxygen species (ROS and inhibition of ROS production opened stomata of lecrk-V.5. LecRK-V.5 is also shown to interfere with abscisic acid-mediated stomatal closure signaling upstream of ROS production. These results provide genetic evidences that LecRK-V.5 negatively regulates stomatal immunity upstream of ROS biosynthesis. Our data reveal that plants have evolved mechanisms to reverse bacteria-mediated stomatal closure to prevent long-term effect on CO(2 uptake and photosynthesis.

Atmospheric CO2 Alters Resistance of Arabidopsis to Pseudomonas syringae by Affecting Abscisic Acid Accumulation and Stomatal Responsiveness to Coronatine

NARCIS (Netherlands)

Zhou, Y.; Vroegop-Vos, I.; Schuurink, R.C.; Pieterse, C.M.J.; Van Wees, S.C.M.

Atmospheric CO2 influences plant growth and stomatal aperture. Effects of high or low CO2 levels on plant disease resistance are less well understood. Here, resistance of Arabidopsis thaliana against the foliar pathogen Pseudomonas syringae pv. tomato DC3000 (Pst) was investigated at three different

The stealth episome: suppression of gene expression on the excised genomic island PPHGI-1 from Pseudomonas syringae pv. phaseolicola.

Directory of Open Access Journals (Sweden)

Scott A C Godfrey

2011-03-01

Full Text Available Pseudomonas syringae pv. phaseolicola is the causative agent of halo blight in the common bean, Phaseolus vulgaris. P. syringae pv. phaseolicola race 4 strain 1302A contains the avirulence gene avrPphB (syn. hopAR1, which resides on PPHGI-1, a 106 kb genomic island. Loss of PPHGI-1 from P. syringae pv. phaseolicola 1302A following exposure to the hypersensitive resistance response (HR leads to the evolution of strains with altered virulence. Here we have used fluorescent protein reporter systems to gain insight into the mobility of PPHGI-1. Confocal imaging of dual-labelled P. syringae pv. phaseolicola 1302A strain, F532 (dsRFP in chromosome and eGFP in PPHGI-1, revealed loss of PPHGI-1::eGFP encoded fluorescence during plant infection and when grown in vitro on extracted leaf apoplastic fluids. Fluorescence-activated cell sorting (FACS of fluorescent and non-fluorescent PPHGI-1::eGFP F532 populations showed that cells lost fluorescence not only when the GI was deleted, but also when it had excised and was present as a circular episome. In addition to reduced expression of eGFP, quantitative PCR on sub-populations separated by FACS showed that transcription of other genes on PPHGI-1 (avrPphB and xerC was also greatly reduced in F532 cells harbouring the excised PPHGI-1::eGFP episome. Our results show how virulence determinants located on mobile pathogenicity islands may be hidden from detection by host surveillance systems through the suppression of gene expression in the episomal state.

Immunocytochemical localization of HrpA and HrpZ supports a role for the Hrp pilus in the transfer of effector proteins from Pseudomonas syringae pv. tomato across the host plant cell wall.

Science.gov (United States)

Brown, I R; Mansfield, J W; Taira, S; Roine, E; Romantschuk, M

2001-03-01

The Hrp pilus, composed of HrpA subunits, is an essential component of the type III secretion system in Pseudomonas syringae. We used electron microscopy (EM) and immunocytochemistry to examine production of the pilus in vitro from P. syringae pv. tomato strain DC3000 grown under hrp-inducing conditions on EM grids. Pili, when labeled with antibodies to HrpA, developed rapidly in a nonpolar manner shortly after the detection of the hrpA transcript and extended up to 5 microm into surrounding media. Structures at the base of the pilus were clearly differentiated from the basal bodies of flagella. The HrpZ protein, also secreted via the type III system, was found by immunogold labeling to be associated with the pilus in vitro. Accumulation and secretion of HrpA and HrpZ were also examined quantitatively after the inoculation of wild-type DC3000 and hrpA and hrpZ mutants into leaves of Arabidopsis thaliana. The functional pilus crossed the plant cell wall to generate tracks of immunogold labeling for HrpA and HrpZ. Mutants that produced HrpA but did not assemble pili were nonpathogenic, did not secrete HrpA protein, and were compromised for the accumulation of HrpZ. A model is proposed in which the rapidly elongating Hrp pilus acts as a moving conveyor, facilitating transfer of effector proteins from bacteria to the plant cytoplasm across the formidable barrier of the plant cell wall.

Pseudomonas syringae pv. phaseolicola isolated from weeds in bean crop fields.

Science.gov (United States)

Fernández-Sanz, A M; Rodicio, M R; González, A J

2016-04-01

Pseudomonas syringae pv. phaseolicola, the causative agent of halo blight in common bean (Phaseolus vulgaris L.), was isolated from weeds associated with bean crops in Spain. The bacterium was recovered from Fumaria sp, Mercurialis annua, Solanum nigrum and Sonchus oleraceus. Ps. s. pv. phaseolicola had previously been isolated from leguminous plants and S. nigrum, but to our knowledge, this is the first time it was recovered from the other three species. The isolates were phenotypically and genetically characterized, and they were compared with isolates recovered from common beans. Five different genotypic profiles were detected by PmeI-PFGE, two of them being of new description. Weed isolates were as pathogenic on bean plants as bean isolates, but they were not pathogenic on S. nigrum. Regarding the survival of the pathogen in weeds, Ps. s. pv. phaseolicola was isolated from So. oleraceus 11 weeks after the end of the bean crop. These results strongly support the idea of weeds as a potential source of inoculum for halo blight in bean. It has traditionally been considered that the main source of inoculum of Pseudomonas syringae pv. phaseolicola causing halo blight disease in Phaseolus vulgaris are the bean seeds, and that the host range of the bacterium is almost restricted to leguminous plants. In this study, the bacterium was recovered from four nonleguminous weed species collected in bean fields, and its permanence in weeds for at least 11 weeks after the harvesting of the beans was demonstrated. We have also proved that the strains isolated from weeds were pathogenic on bean plants. Accordingly, the host range of Ps. s. pv. phaseolicola could be broader than previously thought and weeds appear to be acting as a reservoir of the pathogen until the next crop. © 2016 The Society for Applied Microbiology.

NH4+ protects tomato plants against Pseudomonas syringae by activation of systemic acquired acclimation.

Science.gov (United States)

Fernández-Crespo, Emma; Scalschi, Loredana; Llorens, Eugenio; García-Agustín, Pilar; Camañes, Gemma

2015-11-01

NH4 (+) nutrition provokes mild toxicity by enhancing H2O2 accumulation, which acts as a signal activating systemic acquired acclimation (SAA). Until now, induced resistance mechanisms in response to an abiotic stimulus and related to SAA were only reported for exposure to a subsequent abiotic stress. Herein, the first evidence is provided that this acclimation to an abiotic stimulus induces resistance to later pathogen infection, since NH4 (+) nutrition (N-NH4 (+))-induced resistance (NH4 (+)-IR) against Pseudomonas syringae pv tomato DC3000 (Pst) in tomato plants was demonstrated. N-NH4 (+) plants displayed basal H2O2, abscisic acid (ABA), and putrescine (Put) accumulation. H2O2 accumulation acted as a signal to induce ABA-dependent signalling pathways required to prevent NH4 (+) toxicity. This acclimatory event provoked an increase in resistance against later pathogen infection. N-NH4 (+) plants displayed basal stomatal closure produced by H2O2 derived from enhanced CuAO and rboh1 activity that may reduce the entry of bacteria into the mesophyll, diminishing the disease symptoms as well as strongly inducing the oxidative burst upon Pst infection, favouring NH4 (+)-IR. Experiments with inhibitors of Put accumulation and the ABA-deficient mutant flacca demonstrated that Put and ABA downstream signalling pathways are required to complete NH4 (+)-IR. The metabolic profile revealed that infected N-NH4 (+) plants showed greater ferulic acid accumulation compared with control plants. Although classical salicylic acid (SA)-dependent responses against biotrophic pathogens were not found, the important role of Put in the resistance of tomato against Pst was demonstrated. Moreover, this work revealed the cross-talk between abiotic stress acclimation (NH4 (+) nutrition) and resistance to subsequent Pst infection. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Gaseous 3-pentanol primes plant immunity against a bacterial speck pathogen, Pseudomonas syringae pv. tomato via salicylic acid and jasmonic acid-dependent signaling pathways in Arabidopsis.

Science.gov (United States)

Song, Geun C; Choi, Hye K; Ryu, Choong-Min

2015-01-01

3-Pentanol is an active organic compound produced by plants and is a component of emitted insect sex pheromones. A previous study reported that drench application of 3-pentanol elicited plant immunity against microbial pathogens and an insect pest in crop plants. Here, we evaluated whether 3-pentanol and the derivatives 1-pentanol and 2-pentanol induced plant systemic resistance using the in vitro I-plate system. Exposure of Arabidopsis seedlings to 10 μM and 100 nM 3-pentanol evaporate elicited an immune response to Pseudomonas syringae pv. tomato DC3000. We performed quantitative real-time PCR to investigate the 3-pentanol-mediated Arabidopsis immune responses by determining Pathogenesis-Related (PR) gene expression levels associated with defense signaling through salicylic acid (SA), jasmonic acid (JA), and ethylene signaling pathways. The results show that exposure to 3-pentanol and subsequent pathogen challenge upregulated PDF1.2 and PR1 expression. Selected Arabidopsis mutants confirmed that the 3-pentanol-mediated immune response involved SA and JA signaling pathways and the NPR1 gene. Taken together, this study indicates that gaseous 3-pentanol triggers induced resistance in Arabidopsis by priming SA and JA signaling pathways. To our knowledge, this is the first report that a volatile compound of an insect sex pheromone triggers plant systemic resistance against a bacterial pathogen.

Gaseous 3-pentanol primes plant immunity against a bacterial speck pathogen, Pseudomonas syringae pv. tomato via salicylic acid and jasmonic acid-dependent signaling pathways in Arabidopsis

Directory of Open Access Journals (Sweden)

Geun Cheol eSong

2015-10-01

Full Text Available 3-Pentanol is an active organic compound produced by plants and is a component of emitted insect sex pheromones. A previous study reported that drench application of 3-pentanol elicited plant immunity against microbial pathogens and an insect pest in crop plants. Here, we evaluated whether 3-pentanol and the derivatives 1-pentanol and 2-pentanol induced plant systemic resistance using the in vitro I-plate system. Exposure of Arabidopsis seedlings to 10 M and 100 nM 3-pentanol evaporate elicited an immune response to Pseudomonas syringae pv. tomato DC3000. We performed quantitative real-time PCR to investigate the 3-pentanol-mediated Arabidopsis immune responses by determining Pathogenesis-Related (PR gene expression levels associated with defense signaling through SA, JA, and ethylene signaling pathways. The results show that exposure to 3-pentanol and subsequent pathogen challenge upregulated PDF1.2 and PR1 expression. Selected Arabidopsis mutants confirmed that the 3-pentanol-mediated immune response involved salicylic acid (SA and jasmonic acid (JA signaling pathways and the NPR1 gene. Taken together, this study indicates that gaseous 3-pentanol triggers induced resistance in Arabidopsis by priming SA and JA signaling pathways. To our knowledge, this is the first report that a volatile compound of an insect sex pheromone triggers plant systemic resistance against a bacterial pathogen.

HOPM1 mediated disease resistance to Pseudomonas syringae in Arabidopsis

Science.gov (United States)

He, Sheng Yang [Okemos, MI; Nomura, Kinya [East Lansing, MI

2011-11-15

The present invention relates to compositions and methods for enhancing plant defenses against pathogens. More particularly, the invention relates to enhancing plant immunity against bacterial pathogens, wherein HopM1.sub.1-300 mediated protection is enhanced, such as increased protection to Pseudomonas syringae pv. tomato DC3000 HopM1 and/or there is an increase in activity of an ATMIN associated plant protection protein, such as ATMIN7. Reagents of the present invention further provide a means of studying cellular trafficking while formulations of the present inventions provide increased pathogen resistance in plants.

AtMIN7 mediated disease resistance to Pseudomonas syringae in Arabidopsis

Science.gov (United States)

He, Sheng Yang [Okemos, MI; Nomura, Kinya [East Lansing, MI

2011-07-26

The present invention relates to compositions and methods for enhancing plant defenses against pathogens. More particularly, the invention relates to enhancing plant immunity against bacterial pathogens, wherein AtMIN7 mediated protection is enhanced and/or there is a decrease in activity of an AtMIN7 associated virulence protein such as a Pseudomonas syringae pv. tomato DC3000 HopM1. Reagents of the present invention provide a means of studying cellular trafficking while formulations of the present inventions provide increased pathogen resistance in plants.

Differentiation of Pseudomonas syringae Pathovars Originating from Stone Fruits

Directory of Open Access Journals (Sweden)

Katarina Gašić

2012-01-01

Full Text Available Due to an overlapping host range, similar symptomatology and many common characteristics,Pseudomonas syringae pathovars originating from stone fruits can easily be misidentified.In order to select tests for rapid and efficient differentiation of P. s. pvs. syringae,morsprunorum and persicae, we studied the suitability and differentiating potential ofsome standard bacteriological and molecular methods. Differentiation of the strains wasperformed using LOPAT, GATTa and ice nucleation tests, nutrient sucrose broth growthand utilization of various carbon sources. PCR method enabled the detection of toxin-producinggenes: syrB and syrD in P. s. pv. syringae, and cfl gene in P. s. pv. morsprunorum race1. Syringomycin production by pv. syringae was confirmed in bioassay using Geotrichumcandidum, Saccharomyces cerevisiae and Rhodotorula pilimanae as indicator organisms.Pathogenicity test on lemon and immature nectarine fruits, as well as on string bean pods,showed different intensity of reaction of the inoculated material which could separate pv.syringae from the other two pathovars. PCR-based repetitive sequences, Rep-PCR withREP, ERIC and BOX primers revealed different genetic profiles within P. syringae pathovars.

The levels of nitrite and nitrate, proline and protein profiles in tomato plants infected with pseudomonas syringae

International Nuclear Information System (INIS)

Berber, I.; Onlu, H.

2012-01-01

In this study, the contents of nitrite-nitrate and free L-proline, and pathogenesis-related (PR) proteins in tomato plants following inoculation with Pseudomonas syringae pv. tomato strain were examined. The results of the nitrite and nitrate indicated that there was a reduction in the levels of nitrate in the infected tomato plants through 1-8 study days, compared with the healthy plants. On the other hands, when the nitrite amounts increased in the first and second days, the nitrite concentrations reduced in infected plants at subsequent time periods, compared with uninfected plants. The accumulation of free proline increased in the infected plants, according to control plants. The whole-cell protein profiles displayed that the levels of the protein bands of molecular masses 204.6 kDa and 69.9 kDa significantly increased in infected and uninfected plants during 2-10 study days. In additionally, in the quantities of the protein bands of molecular weights 90.3 and 79.4 kDa were observed an increase in the infected and healthy plants after the fourth day. However, the protein band of molecular weight 54.3 kDa was visible only in uninfected plants for the fourth and eighth days. Finally, the study suggest that there were the sophisticate relationships among the proline accumulation, the conversion of nitrate to nitrite and the induction of PR protein genes in the regulation of defense mechanisms toward microbial invaders. Our results also indicated that the increases in nitrite and proline contents might be useful indicator for the response toward pathogen attacks. (author)

Phenotypic and Genotypic Evaluation of Pseudomonas syringae pv. syringae Strains, Causing Citrus Blast in the West of Mazandaran and the East of Guilan

Directory of Open Access Journals (Sweden)

S. Sameie-Shirkadeh

2017-01-01

Full Text Available Introduction: P. syringae pv. syringae (P.s.s, the causal agent of blast of citrus trees, is one of the most important plant pathogens in the world. P.s.s is unique among most P. syringae pathovars according to its ability to cause disease in over 180 species of plants in several unrelated genera. Traditionally, Strains of P.s.s are identified on the basis of biochemical and nutritional tests and symptom expression in host plants. Genomic fingerprinting methods based on the polymerase chain reaction (PCR have been applied for identification and classification of plant-associated bacteria to the subspecies level. The objectives of this study were the phenotypic and molecular evaluation of P.s. pv. syringae strains causing citrus blast in the West of Mazandaran and the East of Guilan, and study of genetic diversity of P.s.s isolates of citrus by using ERIC and REP-PCR markers. Materials and Methods: During 2011 to 2012, citrus infected tissues were sampled from different orchards in the West of Mazandaran and the East of Guilan. Bacterial phenotypes were studied based on standard physiological and biochemical tests. Gram reaction was determined by potassium hydroxide solubility test (KOH test. Strains were grown on King'B medium (KB and fluorescent pigment production was evaluated. Levan formation, oxidase reaction, potato soft rot, Arginine dihydrolase and induction of the hypersensitive reaction in tobacco leaves (LOPAT tests, were done as described by Schadd et al. The standard strains of P.s. pv. syringae form IVIA were used as reference strains in this study. Pathogenicity Test was done as described by Yessad et al. Citrus seedlings were maintained in a greenhouse at 20°C. In addition, a PCR-based method was used to confirm the genus and species of bacteria by using bacterial specific primer pair’s designed for a specific gene of syringomycin B. Genetic diversity among the strains, was studied by rep-PCR fingerprinting. Genomic

Characterization of five ECF sigma factors in the genome of Pseudomonas syringae pv. syringae B728a.

Directory of Open Access Journals (Sweden)

Poulami Basu Thakur

Full Text Available Pseudomonas syringae pv. syringae B728a, a bacterial pathogen of bean, utilizes large surface populations and extracellular signaling to initiate a fundamental change from an epiphytic to a pathogenic lifestyle. Extracytoplasmic function (ECF sigma (σ factors serve as important regulatory factors in responding to various environmental signals. Bioinformatic analysis of the B728a genome revealed 10 ECF sigma factors. This study analyzed deletion mutants of five previously uncharacterized ECF sigma factor genes in B728a, including three FecI-type ECF sigma factors (ECF5, ECF6, and ECF7 and two ECF sigma factors placed in groups ECF11 and ECF18. Transcriptional profiling by qRT-PCR analysis of ECF sigma factor mutants was used to measure expression of their associated anti-sigma and outer membrane receptor proteins, and expression of genes associated with production of extracellular polysaccharides, fimbriae, glycine betaine and syringomycin. Notably, the B728aΔecf7 mutant displayed reduced swarming and had decreased expression of CupC fimbrial genes. Growth and pathogenicity assays, using a susceptible bean host, revealed that none of the tested sigma factor genes are required for in planta growth and lesion formation.

The Ca2+ induced two-component system, CvsSR regulates the Type III secretion system and the extracytoplasmic function sigma-factor AlgU in Pseudomonas syringae pv. tomato DC3000.

Science.gov (United States)

Fishman, Maxwell R; Zhang, Johnson; Bronstein, Philip A; Stodghill, Paul; Filiatrault, Melanie J

2017-12-20

Two-component systems (TCSs) of bacteria regulate many different aspects of the bacterial life cycle including pathogenesis. Most TCSs remain uncharacterized with no information about the signal(s) or regulatory targets and/or role in bacterial pathogenesis. Here, we characterized a TCS in the plant-pathogenic bacterium Pseudomonas syringae pv. tomato DC3000 ( Pto ) composed of the histidine kinase, CvsS, and the response regulator, CvsR. CvsSR is necessary for virulence of Pto , since ΔcvsS and ΔcvsR strains produced fewer symptoms and demonstrated reduced growth on multiple hosts as compared to WT. We discovered that expression of cvsSR is induced by Ca 2+ concentrations found in leaf apoplastic fluid. Thus, Ca 2+ can be added to the list of signals that promote pathogenesis of Pto during host colonization. Through chromatin immunoprecipitation followed by next generation sequencing (ChIP-seq) and global transcriptome analysis (RNA-seq) we discerned the CvsR regulon. CvsR directly activated expression of the type III secretion system regulators, hrpR and hrpS , that regulates Pto virulence in a type III secretion system dependent manner. CvsR also indirectly repressed transcription of the extracytoplasmic sigma factor algU and production of alginate. Phenotypic analysis determined that CvsSR inversely regulated biofilm formation, swarming motility, and cellulose production in a Ca 2+ -dependent manner. Overall, our results show that CvsSR is a key regulatory hub critical for interaction with host plants. Importance Pathogenic bacteria must be able to react and respond to the surrounding environment, make use of available resources, and avert or counter host immune responses. Often, these abilities rely on two-component systems (TCSs) composed of interacting proteins that modulate gene expression. We identified a TCS in the plant-pathogenic bacterium Pseudomonas syringae that responds to the presence of calcium, which is an important signal during the plant

Pseudomonas syringae evades host Immunity by degrading flagellin monomers with alkaline protease AprA

OpenAIRE

Pel, M.J.C.; Van Dijken, A.J.H.; Bardoel, B.W.; Seidl, M.F; Van der Ent, S.; Van Strijp, J.A.G.

2014-01-01

Bacterial flagellin molecules are strong inducers of innate immune responses in both mammals and plants. The opportunistic pathogen Pseudomonas aeruginosa secretes an alkaline protease called AprA that degrades flagellin monomers. Here, we show that AprA is widespread among a wide variety of bacterial species. In addition, we investigated the role of AprA in virulence of the bacterial plant athogen P. syringae pv. tomato DC3000. The AprA-deficient DC3000 ΔaprA knockout mutant was significantl...

Pseudomonas syringae pv. actinidiae: a re-emerging, multi-faceted, pandemic pathogen.

Science.gov (United States)

Scortichini, Marco; Marcelletti, Simone; Ferrante, Patrizia; Petriccione, Milena; Firrao, Giuseppe

2012-09-01

Pseudomonas syringae pv. actinidiae is the causal agent of bacterial canker of green-fleshed kiwifruit (Actinidia deliciosa) and yellow-fleshed kiwifruit (A. chinensis). A recent, sudden, re-emerging wave of this disease has occurred, almost contemporaneously, in all of the main areas of kiwifruit production in the world, suggesting that it can be considered as a pandemic disease. Recent in-depth genetic studies performed on P. syringae pv. actinidiae strains have revealed that this pathovar is composed of four genetically different populations which, to different extents, can infect crops of the genus Actinidia worldwide. Genome comparisons of these strains have revealed that this pathovar can gain and lose the phaseolotoxin gene cluster, as well as mobile genetic elements, such as plasmids and putative prophages, and that it can modify the repertoire of the effector gene arrays. In addition, the strains currently causing worldwide severe economic losses display an extensive set of genes related to the ecological fitness of the bacterium in planta, such as copper and antibiotic resistance genes, multiple siderophore genes and genes involved in the degradation of lignin derivatives and other phenolics. This pathogen can therefore easily colonize hosts throughout the year. Bacteria; Proteobacteria, gamma subdivision; Order Pseudomonadales; Family Pseudomonadaceae; Genus Pseudomonas; Pseudomonas syringae species complex, genomospecies 8; Pathovar actinidiae. Gram-negative, aerobic, motile, rod-shaped, polar flagella, oxidase-negative, arginine dihydrolase-negative, DNA 58.5-58.8 mol.% GC, elicits the hypersensitive response on tobacco leaves. Primarily studied as the causal agent of bacterial canker of green-fleshed kiwifruit (Actinidia deliciosa), it has also been isolated from yellow-fleshed kiwifruit (A. chinensis). In both species, it causes severe economic losses worldwide. It has also been isolated from wild A. arguta and A. kolomikta. In green-fleshed and

Virulence of the Phytopathogen Pseudomonas syringae pv. Maculicola Is rpoN Dependent

Science.gov (United States)

Hendrickson, Erik L.; Guevera, Pablo; Peñaloza-Vàzquez, Alejandro; Shao, Jing; Bender, Carol; Ausubel, Frederick M.

2000-01-01

We cloned the rpoN (ntrA and glnF) gene encoding ς54 from the phytopathogen Pseudomonas syringae pv. maculicola strain ES4326. The P. syringae ES4326 rpoN gene complemented Pseudomonas aeruginosa, Escherichia coli, and Klebsiella aerogenes rpoN mutants for a variety of rpoN mutant phenotypes, including the inability to utilize nitrate as sole nitrogen source. DNA sequence analysis of the P. syringae ES4326 rpoN gene revealed that the deduced amino acid sequence was most similar (86% identity; 95% similarity) to the ς54 protein encoded by the Pseudomonas putida rpoN gene. A marker exchange protocol was used to construct an ES4326 rpoN insertional mutation, rpoN::Kmr. In contrast to wild-type ES4326, ES4326 rpoN::Kmr was nonmotile and could not utilize nitrate, urea, C4-dicarboxylic acids, several amino acids, or concentrations of ammonia below 2 mM as nitrogen sources. rpoN was essential for production of the phytotoxin coronatine and for expression of the structural genes encoding coronamic acid. In addition, ES4326 rpoN::Kmr did not multiply or elicit disease symptoms when infiltrated into Arabidopsis thaliana leaves, did not elicit the accumulation of several Arabidopsis defense-related mRNAs, and did not elicit a hypersensitive response (HR) when infiltrated into tobacco (Nicotiana tabacum) leaves. Furthermore, whereas P. syringae ES4326 carrying the avirulence gene avrRpt2 elicited an HR when infiltrated into Arabidopsis ecotype Columbia leaves, ES4326 rpoN::Kmr carrying avrRpt2 elicited no response. Constitutive expression of ES4326 hrpL in ES4326 rpoN::Kmr partially restored defense-related mRNA accumulation, showing a direct role for the hrp cluster in host defense gene induction in a compatible host-pathogen interaction. However, constitutive expression of hrpL in ES4326 rpoN::Kmr did not restore coronatine production, showing that coronatine biosynthesis requires factors other than hrpL. PMID:10852883

Potencialidade de um actinomiceto de rizosfera de tomateiro como agente de biocontrole de doenças Potenciality of an actinomycete from tomato rhizosphere as a biocontrol agent for tomato diseases

Directory of Open Access Journals (Sweden)

Renato Carrer Filho

2009-09-01

Full Text Available Um actinomiceto (Streptomyces setonii, isolado 'UFV-RD1', obtido de rizosfera de planta sadia de tomateiro, foi selecionado dentre outros 117, como promissor agente de biocontrole de enfermidades da cultura. Em testes de antagonismo in vitro contra patógenos do tomateiro, o isolado 'UFV-RD1' foi incapaz de inibir o crescimento de bactérias (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria mas inibiu a germinação de conídios de alguns fungos (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Em ensaios de biocontrole experimental in vivo, em casa de vegetação, o actinomiceto foi efetivo em reduzir a severidade de sintomas no caso de patógenos fúngicos e bacterianos testados como desafiantes. A campo, quando A. solani e P. infestans ocorreram naturalmente, as plantas originárias de sementes microbiolizadas com propágulos da estirpe 'UFV-RD1' exibiram sintomas menos severos que as plantas controle para o caso da pinta preta. O agente de biocontrole é promissor para futuros protocolos de manejo integrado, como forma de reduzir a quantidade de defensivos utilizados.An actinomycete (Streptomyces setonii, isolate 'UFV-RD1', isolated from the rhizosphere of a healthy tomato plant was selected out of 117 as a promising biocontrol agent for tomato diseases. In in vitro antagonism tests against tomato pathogens, the isolate 'UFV-RD1' was unable to inhibit growth of bacterial pathogens (Pseudomonas syringae pv. tomato, Ralstonia solanacearum, Pectobacterium carotovorum subsp. carotovorum, Xanthomonas campestris pv. vesicatoria but inhibited conidium germination of fungi (Alternaria solani, Phytophthora infestans, Corynespora cassiicola, Stemphylium solani. Experimental biocontrol assays in a greenhouse indicated that the actinomycete was effective for reducing symptom severity in the case of bacteria and fungi tested

Identification of a Candidate Gene in Solanum habrochaites for Resistance to a Race 1 Strain of Pseudomonas syringae pv. tomato

Directory of Open Access Journals (Sweden)

Zhilong Bao

2015-11-01

Full Text Available Bacterial speck disease caused by pv. ( is a persistent problem on tomato ( L.. Resistance against race 0 strains is conferred by the Pto protein, which recognizes either of two pathogen effectors: AvrPto or AvrPtoB. However, current tomato varieties do not have resistance to the increasingly common race 1 strains, which lack these effectors. We identified accessions of S. Knapp & D. M. Spooner that are resistant to the race 1 strain T1. Genome sequence comparisons of T1 and two strains that are virulent on these accessions suggested that known microbe-associated molecular patterns (MAMPs or effectors are not involved in the resistance. We developed an F population from a cross between one T1-resistant accession, LA2109, and a susceptible tomato cultivar to investigate the genetic basis of this resistance. Linkage analysis using whole-genome sequence of 58 F plants identified quantitative trait loci (QTL, , in a 5.8-Mb region on chromosome 2, and , in a 52.4-Mb region on chromosome 8, which account for 24 and 26% of the phenotypic variability, respectively. High-resolution mapping of confirmed it contributed to T1 resistance and delimited it to a 1060-kb region containing 139 genes, including three encoding receptor-like proteins (RLPs and 17 encoding receptor-like protein kinases (RLKs. One RLK gene, Solyc02g072470, is a promising candidate for , as it is highly expressed in LA2109 and induced on treatment with MAMPs. might be useful for enhancing resistance to race 1 strains and its future characterization could provide insights into the plant immune system.

Virulence of Pseudomonas syringae pv. tomato DC3000 is modulated through the Catabolite Repression Control protein Crc

Science.gov (United States)

Pseudomonas syringae (P.s.) infects diverse plant species and several P.s. pathovars have been used in the study of molecular events that occur during plant-microbe interactions. Although the relationship between bacterial metabolism, nutrient acquisition and virulence has attracted increasing atten...

Resistant and susceptible responses in alfalfa (Medicago sativa to bacterial stem blight caused by Pseudomonas syringae pv. syringae.

Directory of Open Access Journals (Sweden)

Lev G Nemchinov

Full Text Available Bacterial stem blight caused by Pseudomonas syringae pv. syringae is a common disease of alfalfa (Medicago sativa L. Little is known about host-pathogen interactions and host defense mechanisms. Here, individual resistant and susceptible plants were selected from cultivars Maverick and ZG9830 and used for transcript profiling at 24 and 72 hours after inoculation (hai with the isolate PssALF3. Bioinformatic analysis revealed a number of differentially expressed genes (DEGs in resistant and susceptible genotypes. Although resistant plants from each cultivar produced a hypersensitive response, transcriptome analyses indicated that they respond differently at the molecular level. The number of DEGs was higher in resistant plants of ZG9830 at 24 hai than in Maverick, suggesting that ZG9830 plants had a more rapid effector triggered immune response. Unique up-regulated genes in resistant ZG9830 plants included genes encoding putative nematode resistance HSPRO2-like proteins, orthologs for the rice Xa21 and soybean Rpg1-b resistance genes, and TIR-containing R genes lacking both NBS and LRR domains. The suite of R genes up-regulated in resistant Maverick plants had an over-representation of R genes in the CC-NBS-LRR family including two genes for atypical CCR domains and a putative ortholog of the Arabidopsis RPM1 gene. Resistance in both cultivars appears to be mediated primarily by WRKY family transcription factors and expression of genes involved in protein phosphorylation, regulation of transcription, defense response including synthesis of isoflavonoids, and oxidation-reduction processes. These results will further the identification of mechanisms involved in resistance to facilitate selection of parent populations and development of commercial varieties.

Fungicidal activities and mechanisms of action of Pseudomonas syringae pv. syringae lipodepsipeptide syringopeptins 22A and 25A

Directory of Open Access Journals (Sweden)

Mekki F. Bensaci

2011-10-01

Full Text Available The plant-associated bacterium Pseudomonas syringae pv. syringae simultaneously produces two classes of metabolites: the small cyclic lipodepsinonapeptides such as the syringomycins and the larger cyclic lipodepsipeptide syringopeptins SP22 or SP25. The syringomycins inhibit a broad spectrum of fungi (but particularly yeasts by lipid-dependent membrane interaction. The syringopeptins are phytotoxic and inhibitory to Gram positive bacteria. In this study, the fungicidal activities of two major syringopeptins, SP22A and SP25A, and their mechanisms of action were investigated and compared to those of syringomycin E. SP22A and SP25A were observed to inhibit the fungal yeasts Saccharomyces cerevisiae and Candida albicans although less effectively than syringomycin E. S. cerevisiae mutants defective in ergosterol and sphingolipid biosyntheses were less susceptible to SP22A and SP25A but the relative inhibitory capabilities of SRE vs. SP22A and SP25A were maintained. Similar differences were observed for capabilities to cause cellular K+ and Ca2+ fluxes in S. cerevisiae. Interestingly, in phospholipid bilayers the syringopeptins are found to induce larger macroscopic ionic conductances than syringomycin E but form single channels with similar properties. These findings suggest that the syringopeptins target the yeast plasma membrane, and, like syringomycin E, employ a lipid-dependent channel forming mechanism of action. The differing degrees of growth inhibition by these lipodepsipeptides may be explained by differences in their hydrophobicity. The more hydrophobic SP22A and SP25A might interact more strongly with the yeast cell wall that would create a selective barrier for their incorporation into the plasma membrane.

Coexistence between neighbours

DEFF Research Database (Denmark)

Shenge, K.C.; Mabagala, R.B.; Mortensen, C A Nieves Paulino

2008-01-01

Experiments were conducted under laboratory and screenhouse conditions to study the coexistence between Pseudomonas syringae pv. tomato and Xanthomonas campestris pv. vesicatoria, incitants of bacterial speck and bacterial spot diseases of tomato. Results of in vitro studies showed that when mixe...

Characterization of Pseudomonas syringae pv. syringae, Causal Agent of Citrus Blast of Mandarin in Montenegro

OpenAIRE

Ivanovi?, ?arko; Perovi?, Tatjana; Popovi?, Tatjana; Blagojevi?, Jovana; Trkulja, Nenad; Hrn?i?, Snje?ana

2017-01-01

Citrus blast caused by bacterium Pseudomonas syringae is a very important disease of citrus occuring in many areas of the world, but with few data about genetic structure of the pathogen involved. Considering the above fact, this study reports genetic characterization of 43 P. syringae isolates obtained from plant tissue displaying citrus blast symptoms on mandarin (Citrus reticulata) in Montenegro, using multilocus sequence analysis of gyrB, rpoD, and gap1 gene sequences. Gene sequences from...

Jasmonate ZIM-domain (JAZ protein regulates host and nonhost pathogen-induced cell death in tomato and Nicotiana benthamiana.

Directory of Open Access Journals (Sweden)

Yasuhiro Ishiga

Full Text Available The nonhost-specific phytotoxin coronatine (COR produced by several pathovars of Pseudomonas syringae functions as a jasmonic acid-isoleucine (JA-Ile mimic and contributes to disease development by suppressing plant defense responses and inducing reactive oxygen species in chloroplast. It has been shown that the F-box protein CORONATINE INSENSITIVE 1 (COI1 is the receptor for COR and JA-Ile. JASMONATE ZIM DOMAIN (JAZ proteins act as negative regulators for JA signaling in Arabidopsis. However, the physiological significance of JAZ proteins in P. syringae disease development and nonhost pathogen-induced hypersensitive response (HR cell death is not completely understood. In this study, we identified JAZ genes from tomato, a host plant for P. syringae pv. tomato DC3000 (Pst DC3000, and examined their expression profiles in response to COR and pathogens. Most JAZ genes were induced by COR treatment or inoculation with COR-producing Pst DC3000, but not by the COR-defective mutant DB29. Tomato SlJAZ2, SlJAZ6 and SlJAZ7 interacted with SlCOI1 in a COR-dependent manner. Using virus-induced gene silencing (VIGS, we demonstrated that SlJAZ2, SlJAZ6 and SlJAZ7 have no effect on COR-induced chlorosis in tomato and Nicotiana benthamiana. However, SlJAZ2-, SlJAZ6- and SlJAZ7-silenced tomato plants showed enhanced disease-associated cell death to Pst DC3000. Furthermore, we found delayed HR cell death in response to the nonhost pathogen Pst T1 or a pathogen-associated molecular pattern (PAMP, INF1, in SlJAZ2- and SlJAZ6-silenced N. benthamiana. These results suggest that tomato JAZ proteins regulate the progression of cell death during host and nonhost interactions.

Integration Host Factor (IHF binds to the promoter region of the phtD operon involved in phaseolotoxin synthesis in P. syringae pv. phaseolicola NPS3121

Directory of Open Access Journals (Sweden)

Álvarez-Morales Ariel

2011-05-01

Full Text Available Abstract Background Pseudomonas syringae pv. phaseolicola, the causal agent of halo blight disease in beans, produces a toxin known as phaseolotoxin, in whose synthesis participate a group of genes organized within the genome in a region known as the "Pht cluster". This region, which is thought to have been acquired by horizontal gene transfer, includes 5 transcriptional units, two monocistronic (argK, phtL and three polycistronic (phtA, phtD, phtM, whose expression is temperature dependent. So far, the regulatory mechanisms involved in phaseolotoxin synthesis have not been elucidated and the only well-established fact is the requirement of low temperatures for its synthesis. In this work, we searched for regulatory proteins that could be involved in phaseolotoxin synthesis, focusing on the regulation of the phtD operon. Results In this study we identified the global regulator IHF (Integration Host Factor, which binds to the promoter region of the phtD operon, exerting a negative effect on the expression of this operon. This is the first regulatory protein identified as part of the phaseolotoxin synthesis system. Our findings suggest that the Pht cluster was similarly regulated in the ancestral cluster by IHF or similar protein, and integrated into the global regulatory mechanism of P. syringae pv. phaseolicola, after the horizontal gene transfer event by using the host IHF protein. Conclusion This study identifies the IHF protein as one element involved in the regulation of phaseolotoxin synthesis in P. syringae pv. phaseolicola NPS3121 and provides new insights into the regulatory mechanisms involved in phaseolotoxin production.

A genetic screen reveals Arabidopsis stomatal and/or apoplastic defenses against Pseudomonas syringae pv. tomato DC3000.

Directory of Open Access Journals (Sweden)

Weiqing Zeng

2011-10-01

Full Text Available Bacterial infection of plants often begins with colonization of the plant surface, followed by entry into the plant through wounds and natural openings (such as stomata, multiplication in the intercellular space (apoplast of the infected tissues, and dissemination of bacteria to other plants. Historically, most studies assess bacterial infection based on final outcomes of disease and/or pathogen growth using whole infected tissues; few studies have genetically distinguished the contribution of different host cell types in response to an infection. The phytotoxin coronatine (COR is produced by several pathovars of Pseudomonas syringae. COR-deficient mutants of P. s. tomato (Pst DC3000 are severely compromised in virulence, especially when inoculated onto the plant surface. We report here a genetic screen to identify Arabidopsis mutants that could rescue the virulence of COR-deficient mutant bacteria. Among the susceptible to coronatine-deficient Pst DC3000 (scord mutants were two that were defective in stomatal closure response, two that were defective in apoplast defense, and four that were defective in both stomatal and apoplast defense. Isolation of these three classes of mutants suggests that stomatal and apoplastic defenses are integrated in plants, but are genetically separable, and that COR is important for Pst DC3000 to overcome both stomatal guard cell- and apoplastic mesophyll cell-based defenses. Of the six mutants defective in bacterium-triggered stomatal closure, three are defective in salicylic acid (SA-induced stomatal closure, but exhibit normal stomatal closure in response to abscisic acid (ABA, and scord7 is compromised in both SA- and ABA-induced stomatal closure. We have cloned SCORD3, which is required for salicylic acid (SA biosynthesis, and SCORD5, which encodes an ATP-binding cassette (ABC protein, AtGCN20/AtABCF3, predicted to be involved in stress-associated protein translation control. Identification of SCORD5 begins to

The Pseudomonas syringae type III effector HopG1 targets mitochondria, alters plant development, and suppresses plant innate immunity

Science.gov (United States)

Block, Anna; Guo, Ming; Li, Guangyong; Elowsky, Christian; Clemente, Thomas E.; Alfano, James R.

2009-01-01

Summary The bacterial plant pathogen Pseudomonas syringae uses a type III protein secretion system to inject type III effectors into plant cells. Primary targets of these effectors appear to be effector-triggered immunity (ETI) and pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI). The type III effector HopG1 is a suppressor of ETI that is broadly conserved in bacterial plant pathogens. Here we show that HopG1 from P. syringae pv. tomato DC3000 also suppresses PTI. Interestingly, HopG1 localizes to plant mitochondria, suggesting that its suppression of innate immunity may be linked to a perturbation of mitochondrial function. While HopG1 possesses no obvious mitochondrial signal peptide, its N-terminal two-thirds was sufficient for mitochondrial localization. A HopG1-GFP fusion lacking HopG1’s N-terminal 13 amino acids was not localized to the mitochondria reflecting the importance of the N-terminus for targeting. Constitutive expression of HopG1 in Arabidopsis thaliana, Nicotiana tabacum (tobacco) and Lycopersicon esculentum (tomato) dramatically alters plant development resulting in dwarfism, increased branching and infertility. Constitutive expression of HopG1 in planta leads to reduced respiration rates and an increased basal level of reactive oxygen species. These findings suggest that HopG1’s target is mitochondrial and that effector/target interaction promotes disease by disrupting mitochondrial functions. PMID:19863557

Miniature transposable sequences are frequently mobilized in the bacterial plant pathogen Pseudomonas syringae pv. phaseolicola.

Directory of Open Access Journals (Sweden)

Leire Bardaji

Full Text Available Mobile genetic elements are widespread in Pseudomonas syringae, and often associate with virulence genes. Genome reannotation of the model bean pathogen P. syringae pv. phaseolicola 1448A identified seventeen types of insertion sequences and two miniature inverted-repeat transposable elements (MITEs with a biased distribution, representing 2.8% of the chromosome, 25.8% of the 132-kb virulence plasmid and 2.7% of the 52-kb plasmid. Employing an entrapment vector containing sacB, we estimated that transposition frequency oscillated between 2.6×10(-5 and 1.1×10(-6, depending on the clone, although it was stable for each clone after consecutive transfers in culture media. Transposition frequency was similar for bacteria grown in rich or minimal media, and from cells recovered from compatible and incompatible plant hosts, indicating that growth conditions do not influence transposition in strain 1448A. Most of the entrapped insertions contained a full-length IS801 element, with the remaining insertions corresponding to sequences smaller than any transposable element identified in strain 1448A, and collectively identified as miniature sequences. From these, fragments of 229, 360 and 679-nt of the right end of IS801 ended in a consensus tetranucleotide and likely resulted from one-ended transposition of IS801. An average 0.7% of the insertions analyzed consisted of IS801 carrying a fragment of variable size from gene PSPPH_0008/PSPPH_0017, showing that IS801 can mobilize DNA in vivo. Retrospective analysis of complete plasmids and genomes of P. syringae suggests, however, that most fragments of IS801 are likely the result of reorganizations rather than one-ended transpositions, and that this element might preferentially contribute to genome flexibility by generating homologous regions of recombination. A further miniature sequence previously found to affect host range specificity and virulence, designated MITEPsy1 (100-nt, represented an average 2

Miniature transposable sequences are frequently mobilized in the bacterial plant pathogen Pseudomonas syringae pv. phaseolicola.

Science.gov (United States)

Bardaji, Leire; Añorga, Maite; Jackson, Robert W; Martínez-Bilbao, Alejandro; Yanguas-Casás, Natalia; Murillo, Jesús

2011-01-01

Mobile genetic elements are widespread in Pseudomonas syringae, and often associate with virulence genes. Genome reannotation of the model bean pathogen P. syringae pv. phaseolicola 1448A identified seventeen types of insertion sequences and two miniature inverted-repeat transposable elements (MITEs) with a biased distribution, representing 2.8% of the chromosome, 25.8% of the 132-kb virulence plasmid and 2.7% of the 52-kb plasmid. Employing an entrapment vector containing sacB, we estimated that transposition frequency oscillated between 2.6×10(-5) and 1.1×10(-6), depending on the clone, although it was stable for each clone after consecutive transfers in culture media. Transposition frequency was similar for bacteria grown in rich or minimal media, and from cells recovered from compatible and incompatible plant hosts, indicating that growth conditions do not influence transposition in strain 1448A. Most of the entrapped insertions contained a full-length IS801 element, with the remaining insertions corresponding to sequences smaller than any transposable element identified in strain 1448A, and collectively identified as miniature sequences. From these, fragments of 229, 360 and 679-nt of the right end of IS801 ended in a consensus tetranucleotide and likely resulted from one-ended transposition of IS801. An average 0.7% of the insertions analyzed consisted of IS801 carrying a fragment of variable size from gene PSPPH_0008/PSPPH_0017, showing that IS801 can mobilize DNA in vivo. Retrospective analysis of complete plasmids and genomes of P. syringae suggests, however, that most fragments of IS801 are likely the result of reorganizations rather than one-ended transpositions, and that this element might preferentially contribute to genome flexibility by generating homologous regions of recombination. A further miniature sequence previously found to affect host range specificity and virulence, designated MITEPsy1 (100-nt), represented an average 2.4% of the total

Anatomical changes on coffee leaves infected by Pseudomonas syringae pv. garcae

Directory of Open Access Journals (Sweden)

Lucas Mateus Rivero Rodrigues

2015-12-01

Full Text Available ABSTRACTAlthough poorly studied, the bacterial halo blight is an important disease in the major coffee-producing states of Brazil. External damage and anatomical changes on leaves were measured in seedlings of Coffea arabica cv. Mundo Novo, susceptible to Pseudomonas syringae pv. garcae, by using histological sections obtained at 10 and 20 days after inoculation (DAI. The changes on the epidermis were smaller than the lesions measured in the mesophyll, irrespective of the evaluated colonization period, showing that the internal damage caused by the bacterium represent twice the damage observed externally. From the inoculation site, lysis occurred on the epidermal cells and on the palisade and spongy parenchyma cells, with strong staining of their cellular contents, as well as abnormal intercellular spaces in the palisade parenchyma, hypertrophy and hyperplasia of mesophyll cells and partial destruction of chloroplasts. Additionally, this study revealed the presence of inclusion bodies in epidermal and mesophyll cells. Bacterial masses were found in the apoplast between and within mesophyll cells. Bacteria were also observed in the bundle sheath and vascular bundles and were more pronounced at 20 DAI, not only near the inoculation site but also in distant areas, suggesting displacement through the vascular system. These results can be useful to understand this plant-pathogen interaction.

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Pseudomonas syringae pv. tomato str. DC3000] ... Length = 157 ... Query: 238 GHGIPLSIHDAHGLDKTLEHVVSEIQRVHPSRLIRSN...IGALELIRCDHERIAQLLSNLVS 297 ... GHGIPLSIHDAHGLDKTLEHVVSEIQRVHPSRLIRSN...IGALELIRCDHERIAQLLSNLVS Sbjct: 1 ... GHGIPLSIHDAHGLDKTLEHVVSEIQRVHPSRLIRSNIGALELIRCDHERIAQLLSNLV

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s syringae ... pv. tomato str. DC3000] ... Length = 151 ... Query: 151 ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEI...TASDFASDCCFGVTSVRGTKVPA 210 ... ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEI...TASDFASDCCFGVTSVRGTKVPA Sbjct: 1 ... ALAAKNRLLHYLVFECDGRNFCIDASVVTELVDGPEITASDFASDCCFGVTSVRGTKVPA 60 ... Qu

The mbo operon is specific and essential for biosynthesis of mangotoxin in Pseudomonas syringae.

Science.gov (United States)

Carrión, Víctor J; Arrebola, Eva; Cazorla, Francisco M; Murillo, Jesús; de Vicente, Antonio

2012-01-01

Mangotoxin is an antimetabolite toxin produced by certain Pseudomonas syringae pv. syringae strains. This toxin is an oligopeptide that inhibits ornithine N-acetyl transferase, a key enzyme in the biosynthesis of ornithine and arginine. Previous studies have reported the involvement of the putative nonribosomal peptide synthetase MgoA in virulence and mangotoxin production. In this study, we analyse a new chromosomal region of P. syringae pv. syringae UMAF0158, which contains six coding sequences arranged as an operon (mbo operon). The mbo operon was detected in only mangotoxin-producing strains, and it was shown to be essential for the biosynthesis of this toxin. Mutants in each of the six ORFs of the mbo operon were partially or completely impaired in the production of the toxin. In addition, Pseudomonas spp. mangotoxin non-producer strains transformed with the mbo operon gained the ability to produce mangotoxin, indicating that this operon contains all the genetic information necessary for mangotoxin biosynthesis. The generation of a single transcript for the mbo operon was confirmed and supported by the allocation of a unique promoter and Rho-independent terminator. The phylogenetic analysis of the P. syringae strains harbouring the mbo operon revealed that these strains clustered together.

Pathovars of Pseudomonas syringae Causing Bacterial Brown Spot and Halo Blight in Phaseolus vulgaris L. Are Distinguishable by Ribotyping

Science.gov (United States)

González, Ana J.; Landeras, Elena; Mendoza, M. Carmen

2000-01-01

Ribotyping was evaluated as a method to differentiate between Pseudomonas syringae pv. phaseolicola and pv. syringae strains causing bacterial brown spot and halo blight diseases in Phaseolus vulgaris L. Ribotyping, with restriction enzymes BglI and SalI and using the Escherichia coli rrnB operon as the probe, differentiated 11 and 14 ribotypes, respectively, and a combination of data from both procedures yielded 19 combined ribotypes. Cluster analysis of the combined ribotypes differentiated the pathovars phaseolicola and syringae, as well as different clonal lineages within these pathovars. The potential of ribotyping to screen for correlations between lineages and factors such as geographical region and/or bean varieties is also reported. PMID:10653764

Inducible Expression of the De-Novo Designed Antimicrobial Peptide SP1-1 in Tomato Confers Resistance to Xanthomonas campestris pv. vesicatoria.

Directory of Open Access Journals (Sweden)

Areli Herrera Diaz

Full Text Available Antimicrobial peptides (AMPs are small peptides with less than 50 amino acids and are part of the innate immune response in almost all organisms, including bacteria, vertebrates, invertebrates and plants. AMPs are active against a broad-spectrum of pathogens. The inducible expression of AMPs in plants is a promising approach to combat plant pathogens with minimal negative side effects, such as phytotoxicity or infertility. In this study, inducible expression of the de-novo designed AMP SP1-1 in Micro Tom tomato protected tomato fruits against bacterial spot disease caused by Xanthomonas campestris pv. vesicatoria. The peptide SP1-1 was targeted to the apoplast which is the primary infection site for plant pathogens, by fusing SP1-1 peptide to the signal peptide RsAFP1 of radish (Raphanus sativus. The pathogen inducibility of the expression was enabled by using an optimized inducible 4XW2/4XS promoter. As a result, the tomato fruits of independently generated SP1-1 transgenic lines were significantly more resistant to X. campestris pv. vesicatoria than WT tomato fruits. In transgenic lines, bacterial infection was reduced up to 65% in comparison to the infection of WT plants. Our study demonstrates that the combination of the 4XW2/4XS cis-element from parsley with the synthetic antimicrobial peptide SP1-1 is a good alternative to protect tomato fruits against infections with X. campestris pv. vesicatoria.

Seleção de bactérias endofíticas de tomateiro como potenciais agentes de biocontrole e de promoção de crescimento Screening of endophytic bacteria isolated from tomato plants as potencial biocontrol agents and growth promotion

Directory of Open Access Journals (Sweden)

Patrícia Baston Barretti

2009-01-01

Full Text Available Quarenta isolados bacterianos endofíticos de plantas sadias de tomateiro foram avaliados quanto à sua potencialidade como agentes de biocontrole de doenças do tomateiro. Foi realizada, em casa de vegetação, uma seleção massal utilizando-se Pseudomonas syringae pv. tomato e Alternaria solani, como patógenos desafiantes. Com base na média do número de lesões por planta, quatro isolados foram selecionados como potenciais agentes de biocontrole dessas enfermidades fúngica e bacteriana do tomateiro. Esses isolados foram identificados, por meio do sequenciamento do gene 16S do DNA ribossômico, como Acinetobacter johnsonii (UFV-E05, Serratia marcescens (UFV-E13, Sinorhizobium sp. (UFV-E25 e Bacillus megaterium (UFV-E26. Os mesmos isolados selecionados para o biocontrole também foram avaliados quanto à sua capacidade de promover o crescimento em plantas e somente S. marcescens (UFV-E13 proporcionou aumento na altura das plantas.Forty isolates of endophytic bacteria obtained from healthy tomato plants were tested for their potential as biocontrol agents of tomato diseases. A massal screening was performed at greenhouse using Pseudomonas syringae pv. tomato and Alternaria solani as challenging pathogens. Based on the average number of lesions per plant, four isolates were selected as potential agents of biocontrol of these tomato diseases caused by fungi and bacteria. These isolates were identified by 16S ribosomal DNA sequence analysis as Acinetobacter johnsonii (UFV-E05, Serratia marcescens (UFV-E13, Sinorhizobium sp. (UFV-E25 and Bacillus megaterium (UFV-E26. The four endophytes selected for biocontrol were also evaluated for their ability of promoting plant growth and only S. marcescens (UFV-E13 presented increase in the height of the plants.

Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

Directory of Open Access Journals (Sweden)

María Pilar Castañeda-Ojeda

2017-05-01

Full Text Available The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts.

Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

Science.gov (United States)

Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

2017-01-01

The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

Priming by Rhizobacterium Protects Tomato Plants from Biotrophic and Necrotrophic Pathogen Infections through Multiple Defense Mechanisms

Science.gov (United States)

Ahn, Il-Pyung; Lee, Sang-Woo; Kim, Min Gab; Park, Sang-Ryeol; Hwang, Duk-Ju; Bae, Shin-Chul

2011-01-01

A selected strain of rhizobacterium, Pseudomonas putida strain LSW17S (LSW17S), protects tomato plants (Lycopersicon esculentum L. cv. Seokwang) from bacterial speck by biotrophic Pseudomonas syringae pv. tomato strain DC3000 (DC3000) and bacterial wilt by necrotrophic Ralstonia solanacearum KACC 10703 (Rs10703). To investigate defense mechanisms induced by LSW17S in tomato plants, transcription patterns of pathogenesis-related (PR) genes and H2O2 production were analyzed in plants treated with LSW17S and subsequent pathogen inoculation. LSW17S alone did not induce transcriptions of employed PR genes in leaves and roots. DC3000 challenge following LSW17S triggered rapid transcriptions of PR genes and H2O2 production in leaves and roots. Catalase infiltration with DC3000 attenuated defense-related responses and resistance against DC3000 infection. Despite depriving H2O2 production and PR1b transcription by the same treatment, resistance against Rs10703 infection was not deterred significantly. H2O2 is indispensable for defense signaling and/or mechanisms primed by LSW17S and inhibition of bacterial speck, however, it is not involved in resistance against bacterial wilt. PMID:21710203

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

Coronatine Facilitates Pseudomonas syringae Infection of Arabidopsis Leaves at Night

Science.gov (United States)

Panchal, Shweta; Roy, Debanjana; Chitrakar, Reejana; Price, Lenore; Breitbach, Zachary S.; Armstrong, Daniel W.; Melotto, Maeli

2016-01-01

In many land plants, the stomatal pore opens during the day and closes during the night. Thus, periods of darkness could be effective in decreasing pathogen penetration into leaves through stomata, the primary sites for infection by many pathogens. Pseudomonas syringae pv. tomato (Pst) DC3000 produces coronatine (COR) and opens stomata, raising an intriguing question as to whether this is a virulence strategy to facilitate bacterial infection at night. In fact, we found that (a) biological concentration of COR is effective in opening dark-closed stomata of Arabidopsis thaliana leaves, (b) the COR defective mutant Pst DC3118 is less effective in infecting Arabidopsis in the dark than under light and this difference in infection is reduced with the wild type bacterium Pst DC3000, and (c) cma, a COR biosynthesis gene, is induced only when the bacterium is in contact with the leaf surface independent of the light conditions. These findings suggest that Pst DC3000 activates virulence factors at the pre-invasive phase of its life cycle to infect plants even when environmental conditions (such as darkness) favor stomatal immunity. This functional attribute of COR may provide epidemiological advantages for COR-producing bacteria on the leaf surface. PMID:27446113

Coronatine Facilitates Pseudomonas syringae Infection of Arabidopsis Leaves at Night.

Science.gov (United States)

Panchal, Shweta; Roy, Debanjana; Chitrakar, Reejana; Price, Lenore; Breitbach, Zachary S; Armstrong, Daniel W; Melotto, Maeli

2016-01-01

In many land plants, the stomatal pore opens during the day and closes during the night. Thus, periods of darkness could be effective in decreasing pathogen penetration into leaves through stomata, the primary sites for infection by many pathogens. Pseudomonas syringae pv. tomato (Pst) DC3000 produces coronatine (COR) and opens stomata, raising an intriguing question as to whether this is a virulence strategy to facilitate bacterial infection at night. In fact, we found that (a) biological concentration of COR is effective in opening dark-closed stomata of Arabidopsis thaliana leaves, (b) the COR defective mutant Pst DC3118 is less effective in infecting Arabidopsis in the dark than under light and this difference in infection is reduced with the wild type bacterium Pst DC3000, and (c) cma, a COR biosynthesis gene, is induced only when the bacterium is in contact with the leaf surface independent of the light conditions. These findings suggest that Pst DC3000 activates virulence factors at the pre-invasive phase of its life cycle to infect plants even when environmental conditions (such as darkness) favor stomatal immunity. This functional attribute of COR may provide epidemiological advantages for COR-producing bacteria on the leaf surface.

Differential modulation of plant immune responses by diverse members of the Pseudomonas savastanoi pv. savastanoi HopAF type III effector family.

Science.gov (United States)

Castañeda-Ojeda, M Pilar; López-Solanilla, Emilia; Ramos, Cayo

2017-06-01

The Pseudomonas savastanoi pv. savastanoi NCPPB 3335 type III secretion system (T3SS) effector repertoire includes 33 candidates, seven of which translocate into host cells and interfere with plant defences. The present study was performed to investigate the co-existence of both plasmid- and chromosomal-encoded members of the HopAF effector family, HopAF1-1 and HopAF1-2, respectively, in the genome of NCPPB 3335. Here, we show that the HopAF1 paralogues are widely distributed in the Pseudomonas syringae complex, where HopAF1-1 is most similar to the homologues encoded by other P. syringae pathovars infecting woody hosts that belong to phylogroups 1 and 3. We show that the expression of both HopAF1-1 and HopAF-2 is transcriptionally dependent on HrpL and demonstrate their delivery into Nicotiana tabacum leaves. Although the heterologous delivery of either HopAF1-1 or HopAF1-2 significantly suppressed the production of defence-associated reactive oxygen species levels, only HopAF1-2 reduced the levels of callose deposition. Moreover, the expression of HopAF1-2 by functionally effectorless P. syringae pv. tomato DC3000D28E completely inhibited the hypersensitive response in tobacco and significantly increased the competitiveness of the strain in Nicotiana benthamiana. Despite their functional differences, subcellular localization studies reveal that green fluorescent protein (GFP) fusions to either HopAF1-1 or HopAF1-2 are targeted to the plasma membrane when they are expressed in plant cells, a process that is completely dependent on the integrity of their N-myristoylation motif. Our results further support the notion that highly similar T3SS effectors might differentially interact with diverse plant targets, even when they co-localize in the same cell compartment. © 2016 BSPP AND JOHN WILEY & SONS LTD.

E-2-hexenal promotes susceptibility to Pseudomonas syringae by activating jasmonic acid pathways in Arabidopsis

Directory of Open Access Journals (Sweden)

Alessandra eScala

2013-04-01

Full Text Available Green Leaf Volatiles (GLVs are C6-molecules - alcohols, aldehydes and esters - produced by plants upon herbivory or during pathogen infection. Exposure to this blend of volatiles induces defence-related responses in neighboring undamaged plants, thus assigning a role to GLVs in regulating plant defences. Here we compared Arabidopsis thaliana ecotype Ler with a hydroperoxide lyase line, hpl1, unable to synthesize GLVs, for susceptibility to Pseudomonas syringae pv. tomato (DC3000. We found that the growth of DC3000 was significantly reduced in the hpl1 mutant. This phenomenon correlated with lower jasmonic acid (JA levels and higher salicylic acid (SA levels in the hpl1 mutant. Furthermore, upon infection, the JA-responsive genes VSP2 and LEC were only slightly or not induced, respectively, in hpl1. This suggests that the reduced growth of DC3000 in hpl1 plants is due to the constraint of JA-dependent responses. Treatment of hpl1 plants with E-2-hexenal, one of the more reactive GLVs, prior to infection with DC3000, resulted in increased growth of DC3000 in hpl1, thus complementing this mutant. Interestingly, the growth of DC3000 also increased in Ler plants treated with E-2-hexenal. This stronger growth was not dependent on the JA-signaling component MYC2, but on ORA59, an integrator of JA and ethylene signaling pathways, and on the production of coronatine by DC3000. GLVs may have multiple effects on plant-pathogen interactions, in this case reducing resistance to P. syringae via JA and ORA59.

Arabidopsis seedling flood-inoculation technique: a rapid and reliable assay for studying plant-bacterial interactions

Directory of Open Access Journals (Sweden)

Uppalapati Srinivasa R

2011-10-01

Full Text Available Abstract Background The Arabidopsis thaliana-Pseudomonas syringae model pathosystem is one of the most widely used systems to understand the mechanisms of microbial pathogenesis and plant innate immunity. Several inoculation methods have been used to study plant-pathogen interactions in this model system. However, none of the methods reported to date are similar to those occurring in nature and amicable to large-scale mutant screens. Results In this study, we developed a rapid and reliable seedling flood-inoculation method based on young Arabidopsis seedlings grown on MS medium. This method has several advantages over conventional soil-grown plant inoculation assays, including a shorter growth and incubation period, ease of inoculation and handling, uniform infection and disease development, requires less growth chamber space and is suitable for high-throughput screens. In this study we demonstrated the efficacy of the Arabidopsis seedling assay to study 1 the virulence factors of P. syringae pv. tomato DC3000, including type III protein secretion system (TTSS and phytotoxin coronatine (COR; 2 the effector-triggered immunity; and 3 Arabidopsis mutants affected in salicylic acid (SA- and pathogen-associated molecular pattern (PAMPs-mediated pathways. Furthermore, we applied this technique to study nonhost resistance (NHR responses in Arabidopsis using nonhost pathogens, such as P. syringae pv. tabaci, pv. glycinea and pv. tomato T1, and confirmed the functional role of FLAGELLIN-SENSING 2 (FLS2 in NHR. Conclusions The Arabidopsis seedling flood-inoculation assay provides a rapid, efficient and economical method for studying Arabidopsis-Pseudomonas interactions with minimal growth chamber space and time. This assay could also provide an excellent system for investigating the virulence mechanisms of P. syringae. Using this method, we demonstrated that FLS2 plays a critical role in conferring NHR against nonhost pathovars of P. syringae, but not to

Expression of the Grape VaSTS19 Gene in Arabidopsis Improves Resistance to Powdery Mildew and Botrytis cinerea but Increases Susceptibility to Pseudomonas syringe pv Tomato DC3000.

Science.gov (United States)

Wang, Yaqiong; Wang, Dejun; Wang, Fan; Huang, Li; Tian, Xiaomin; van Nocker, Steve; Gao, Hua; Wang, Xiping

2017-09-17

Stilbene synthase (STS) is a key enzyme that catalyzes the biosynthesis of resveratrol compounds and plays an important role in disease resistance. The molecular pathways linking STS with pathogen responses and their regulation are not known. We isolated an STS gene, VaSTS19 , from a Chinese wild grape, Vitis amurensis Rupr. cv. "Tonghua-3", and transferred this gene to Arabidopsis . We then generated VaSTS19 -expressing Arabidopsis lines and evaluated the functions of VaSTS19 in various pathogen stresses, including powdery mildew, B. cinerea and Pseudomonas syringae pv. tomato DC3000 ( Pst DC3000). VaSTS19 enhanced resistance to powdery mildew and B. cinerea , but increased susceptibility to Pst DC3000. Aniline blue staining revealed that VaSTS19 transgenic lines accumulated more callose compared to nontransgenic control plants, and showed smaller stomatal apertures when exposed to pathogen-associated molecular patterns (flagellin fragment (flg22) or lipopolysaccharides (LPS)). Analysis of the expression of several disease-related genes suggested that VaSTS19 expression enhanced defense responses though salicylic acid (SA) and/or jasmonic acid (JA) signaling pathways. These findings provide a deeper insight into the function of STS genes in defense against pathogens, and a better understanding of the regulatory cross talk between SA and JA pathways.

Rhamnolipids elicit defense responses and induce disease resistance against biotrophic, hemibiotrophic, and necrotrophic pathogens that require different signaling pathways in Arabidopsis and highlight a central role for salicylic acid.

Science.gov (United States)

Sanchez, Lisa; Courteaux, Barbara; Hubert, Jane; Kauffmann, Serge; Renault, Jean-Hugues; Clément, Christophe; Baillieul, Fabienne; Dorey, Stéphan

2012-11-01

Plant resistance to phytopathogenic microorganisms mainly relies on the activation of an innate immune response usually launched after recognition by the plant cells of microbe-associated molecular patterns. The plant hormones, salicylic acid (SA), jasmonic acid, and ethylene have emerged as key players in the signaling networks involved in plant immunity. Rhamnolipids (RLs) are glycolipids produced by bacteria and are involved in surface motility and biofilm development. Here we report that RLs trigger an immune response in Arabidopsis (Arabidopsis thaliana) characterized by signaling molecules accumulation and defense gene activation. This immune response participates to resistance against the hemibiotrophic bacterium Pseudomonas syringae pv tomato, the biotrophic oomycete Hyaloperonospora arabidopsidis, and the necrotrophic fungus Botrytis cinerea. We show that RL-mediated resistance involves different signaling pathways that depend on the type of pathogen. Ethylene is involved in RL-induced resistance to H. arabidopsidis and to P. syringae pv tomato whereas jasmonic acid is essential for the resistance to B. cinerea. SA participates to the restriction of all pathogens. We also show evidence that SA-dependent plant defenses are potentiated by RLs following challenge by B. cinerea or P. syringae pv tomato. These results highlight a central role for SA in RL-mediated resistance. In addition to the activation of plant defense responses, antimicrobial properties of RLs are thought to participate in the protection against the fungus and the oomycete. Our data highlight the intricate mechanisms involved in plant protection triggered by a new type of molecule that can be perceived by plant cells and that can also act directly onto pathogens.

BOX-PCR-based identification of bacterial species belonging to Pseudomonas syringae: P. viridiflava group

Directory of Open Access Journals (Sweden)

Abi S.A. Marques

2008-01-01

Full Text Available The phenotypic characteristics and genetic fingerprints of a collection of 120 bacterial strains, belonging to Pseudomonas syringae sensu lato group, P. viridiflava and reference bacteria were evaluated, with the aim of species identification. The numerical analysis of 119 nutritional characteristics did not show patterns that would help with identification. Regarding the genetic fingerprinting, the results of the present study supported the observation that BOX-PCR seems to be able to identify bacterial strains at species level. After numerical analyses of the bar-codes, all pathovars belonging to each one of the nine described genomospecies were clustered together at a distance of 0.72, and could be separated at genomic species level. Two P. syringae strains of unknown pathovars (CFBP 3650 and CFBP 3662 and the three P. syringae pv. actinidiae strains were grouped in two extra clusters and might eventually constitute two new species. This genomic species clustering was particularly evident for genomospecies 4, which gathered P. syringae pvs. atropurpurea, coronafaciens, garçae, oryzae, porri, striafaciens, and zizaniae at a noticeably low distance.

Dicty_cDB: Contig-U06475-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available hensi glutathione S-... 33 4.0 AY754335_1( AY754335 |pid:none) Anopheles stephensi ..... 33 4.0 AE016853_1995( AE016853 |pid:none) Pseudomonas syringae pv. tomato... 33 4.0 AY573189_1( AY573189 |pid:none) Anopheles step

Induced resistance in tomato by SAR activators during predisposing salinity stress

Directory of Open Access Journals (Sweden)

Matthew Francis Pye

2013-05-01

Full Text Available Plant activators are chemicals that induce disease resistance. The phytohormone salicylic acid (SA is a crucial signal for systemic acquired resistance (SAR, and SA-mediated resistance is a target of several commercial plant activators, including Actigard (1,2,3-benzothiadiazole-7-thiocarboxylic acid-s-methyl-ester, BTH and Tiadinil (N-(3-chloro-4-methylphenyl-4-methyl-1,2,3-thiadiazole-5-carboxamide, TDL. BTH and TDL were examined for their impact on abscisic acid (ABA-mediated, salt-induced disease predisposition in tomato seedlings. A brief episode of salt stress to roots significantly increased the severity of disease caused by Pseudomonas syringae pv. tomato (Pst and Phytophthora capsici relative to non-stressed plants. Root treatment with TDL induced resistance to Pst in leaves and provided protection in both non-stressed and salt-stressed seedlings in WT and highly susceptible NahG plants. Non-stressed and salt-stressed ABA-deficient sitiens mutants were highly resistant to Pst. Neither TDL nor BTH induced resistance to root infection by P. capsici, nor did they moderate the salt-induced increment in disease severity. Root treatment with these plant activators increased the levels of ABA in roots and shoots similar to levels observed in salt-stressed plants. The results indicate that SAR activators can protect tomato plants from bacterial speck disease under predisposing salt stress, and suggest that some SA-mediated defense responses function sufficiently in plants with elevated levels of ABA.

Conductimetric detection of Pseudomonas syringae pathover pisi in pea seeds and soft rot Erwinia spp. on potato tubers

NARCIS (Netherlands)

Fraaije, B.

1996-01-01

Pea bacterial blight and potato blackleg are diseases caused by Pseudomonas syringae pv. pisi ( Psp ) and soft rot Erwinia spp., respectively. The primary source of inoculum for these bacteria is

Pseudomonas syringae Catalases Are Collectively Required for Plant Pathogenesis

Science.gov (United States)

Guo, Ming; Block, Anna; Bryan, Crystal D.; Becker, Donald F.

2012-01-01

The bacterial pathogen Pseudomonas syringae pv. tomato DC3000 must detoxify plant-produced hydrogen peroxide (H2O2) in order to survive in its host plant. Candidate enzymes for this detoxification include the monofunctional catalases KatB and KatE and the bifunctional catalase-peroxidase KatG of DC3000. This study shows that KatG is the major housekeeping catalase of DC3000 and provides protection against menadione-generated endogenous H2O2. In contrast, KatB rapidly and substantially accumulates in response to exogenous H2O2. Furthermore, KatB and KatG have nonredundant roles in detoxifying exogenous H2O2 and are required for full virulence of DC3000 in Arabidopsis thaliana. Therefore, the nonredundant ability of KatB and KatG to detoxify plant-produced H2O2 is essential for the bacteria to survive in plants. Indeed, a DC3000 catalase triple mutant is severely compromised in its ability to grow in planta, and its growth can be partially rescued by the expression of katB, katE, or katG. Interestingly, our data demonstrate that although KatB and KatG are the major catalases involved in the virulence of DC3000, KatE can also provide some protection in planta. Thus, our results indicate that these catalases are virulence factors for DC3000 and are collectively required for pathogenesis. PMID:22797762

Early Arabidopsis root hair growth stimulation by pathogenic strains of Pseudomonas syringae.

Science.gov (United States)

Pecenková, Tamara; Janda, Martin; Ortmannová, Jitka; Hajná, Vladimíra; Stehlíková, Zuzana; Žárský, Viktor

2017-09-01

Selected beneficial Pseudomonas spp. strains have the ability to influence root architecture in Arabidopsis thaliana by inhibiting primary root elongation and promoting lateral root and root hair formation. A crucial role for auxin in this long-term (1week), long-distance plant-microbe interaction has been demonstrated. Arabidopsis seedlings were cultivated in vitro on vertical plates and inoculated with pathogenic strains Pseudomonas syringae pv. maculicola (Psm) and P. syringae pv. tomato DC3000 (Pst), as well as Agrobacterium tumefaciens (Atu) and Escherichia coli (Eco). Root hair lengths were measured after 24 and 48h of direct exposure to each bacterial strain. Several Arabidopsis mutants with impaired responses to pathogens, impaired ethylene perception and defects in the exocyst vesicle tethering complex that is involved in secretion were also analysed. Arabidopsis seedling roots infected with Psm or Pst responded similarly to when infected with plant growth-promoting rhizobacteria; root hair growth was stimulated and primary root growth was inhibited. Other plant- and soil-adapted bacteria induced similar root hair responses. The most compromised root hair growth stimulation response was found for the knockout mutants exo70A1 and ein2. The single immune pathways dependent on salicylic acid, jasmonic acid and PAD4 are not directly involved in root hair growth stimulation; however, in the mutual cross-talk with ethylene, they indirectly modify the extent of the stimulation of root hair growth. The Flg22 peptide does not initiate root hair stimulation as intact bacteria do, but pretreatment with Flg22 prior to Psm inoculation abolished root hair growth stimulation in an FLS2 receptor kinase-dependent manner. These early response phenomena are not associated with changes in auxin levels, as monitored with the pDR5::GUS auxin reporter. Early stimulation of root hair growth is an effect of an unidentified component of living plant pathogenic bacteria. The root

Expression of the Grape VaSTS19 Gene in Arabidopsis Improves Resistance to Powdery Mildew and Botrytis cinerea but Increases Susceptibility to Pseudomonas syringe pv Tomato DC3000

Directory of Open Access Journals (Sweden)

Yaqiong Wang

2017-09-01

Full Text Available Stilbene synthase (STS is a key enzyme that catalyzes the biosynthesis of resveratrol compounds and plays an important role in disease resistance. The molecular pathways linking STS with pathogen responses and their regulation are not known. We isolated an STS gene, VaSTS19, from a Chinese wild grape, Vitis amurensis Rupr. cv. “Tonghua-3”, and transferred this gene to Arabidopsis. We then generated VaSTS19-expressing Arabidopsis lines and evaluated the functions of VaSTS19 in various pathogen stresses, including powdery mildew, B. cinerea and Pseudomonas syringae pv. tomato DC3000 (PstDC3000. VaSTS19 enhanced resistance to powdery mildew and B. cinerea, but increased susceptibility to PstDC3000. Aniline blue staining revealed that VaSTS19 transgenic lines accumulated more callose compared to nontransgenic control plants, and showed smaller stomatal apertures when exposed to pathogen-associated molecular patterns (flagellin fragment (flg22 or lipopolysaccharides (LPS. Analysis of the expression of several disease-related genes suggested that VaSTS19 expression enhanced defense responses though salicylic acid (SA and/or jasmonic acid (JA signaling pathways. These findings provide a deeper insight into the function of STS genes in defense against pathogens, and a better understanding of the regulatory cross talk between SA and JA pathways.

Association and Expression of Virulence from Plasmids of the Group B Strain in Pseudomonas syringae pv. eriobotryae

Directory of Open Access Journals (Sweden)

Tran Dang Khanh

2018-04-01

Full Text Available Pseudomonas syringae pv. eriobotryae causes serious stem canker in loquat (Eriobotrya japonica trees. This study was conducted to determine whether plasmids are involved with its virulence. The strain NAE89, which belonged to the B group, harbored two plasmids at approximately 6.2 and 50 Mdal that caused stem canker and halo leaf spots on loquat plants. Following digestion with BamHI and ligation into the BamHI cloning site of the broad range host cosmid pLAFR3, four DNA fragments at 3.8, 6.6, 12.3, and 22.8 kb were generated. Although the plasmid-encoded virulence gene psvA was undigested with the BamHI, the halo leaf spot gene may be adjacent to the psvA gene was digested. A pLAFR3 cosmid clone was introduced into the non-pathogenic PE0 and NAE89-1 strains by triparental matings and the pathogenicity was recovered. As a result, the pLAFR3 cosmid clone was introduced into the largest size DNA fragment of 22.8 kb and determined to be the causal agent of canker on the stem of the loquat. This study revealed that the psvA gene, previously found in the 50 Mdal plasmid, was also observed in the 22.8 kb DNA fragment.

Pseudomonas savastanoi pv. savastanoi: some like it knot.

Science.gov (United States)

Ramos, Cayo; Matas, Isabel M; Bardaji, Leire; Aragón, Isabel M; Murillo, Jesús

2012-12-01

Pseudomonas savastanoi pv. savastanoi is the causal agent of olive (Olea europaea) knot disease and an unorthodox member of the P. syringae complex, causing aerial tumours instead of the foliar necroses and cankers characteristic of most members of this complex. Olive knot is present wherever olive is grown; although losses are difficult to assess, it is assumed that olive knot is one of the most important diseases of the olive crop. The last century witnessed a large number of scientific articles describing the biology, epidemiology and control of this pathogen. However, most P. savastanoi pv. savastanoi strains are highly recalcitrant to genetic manipulation, which has effectively prevented the pathogen from benefitting from the scientific progress in molecular biology that has elevated the foliar pathogens of the P. syringae complex to supermodels. A number of studies in recent years have made significant advances in the biology, ecology and genetics of P. savastanoi pv. savastanoi, paving the way for the molecular dissection of its interaction with other nonpathogenic bacteria and their woody hosts. The selection of a genetically pliable model strain was soon followed by the development of rapid methods for virulence assessment with micropropagated olive plants and the analysis of cellular interactions with the plant host. The generation of a draft genome of strain NCPPB 3335 and the closed sequence of its three native plasmids has allowed for functional and comparative genomic analyses for the identification of its pathogenicity gene complement. This includes 34 putative type III effector genes and genomic regions, shared with other pathogens of woody hosts, which encode metabolic pathways associated with the degradation of lignin-derived compounds. Now, the time is right to explore the molecular basis of the P. savastanoi pv. savastanoi-olive interaction and to obtain insights into why some pathovars like it necrotic and why some like it knot

Dissection of Resistance Genes to Pseudomonas syringae pv. phaseolicola in UI3 Common Bean Cultivar.

Science.gov (United States)

González, Ana M; Godoy, Luís; Santalla, Marta

2017-11-23

Few quantitative trait loci have been mapped for resistance to Pseudomonas syringae pv. phaseolicola in common bean. Two F₂ populations were developed from the host differential UI3 cultivar. The objective of this study was to further characterize the resistance to races 1, 5, 7 and 9 of Psp included in UI3. Using a QTL mapping approach, 16 and 11 main-effect QTLs for pod and primary leaf resistance were located on LG10, explaining up to 90% and 26% of the phenotypic variation, respectively. The homologous genomic region corresponding to primary leaf resistance QTLs detected tested positive for the presence of resistance-associated gene cluster encoding nucleotide-binding and leucine-rich repeat (NL), Natural Resistance Associated Macrophage (NRAMP) and Pentatricopeptide Repeat family (PPR) proteins. It is worth noting that the main effect QTLs for resistance in pod were located inside a 3.5 Mb genomic region that included the Phvul.010G021200 gene, which encodes a protein that has the highest sequence similarity to the RIN4 gene of Arabidopsis, and can be considered an important candidate gene for the organ-specific QTLs identified here. These results support that resistance to Psp from UI3 might result from the immune response activated by combinations of R proteins, and suggest the guard model as an important mechanism in pod resistance to halo blight. The candidate genes identified here warrant functional studies that will help in characterizing the actual defense gene(s) in UI3 genotype.

The role of crop waste and soil in Pseudomonas syringae pathovar porri infection of leek (Allium porrum)

NARCIS (Netherlands)

Overbeek, van L.S.; Nijhuis, E.H.; Koenraadt, H.; Visser, J.H.M.

2010-01-01

Pseudomonas syringae pv. porri, the causal agent of bacterial blight of leek, is a current threat for leek (Allium porrum) production in the Netherlands. The roles of post-harvest crop waste and plant invasion from soil in leek plant infection was investigated with the purpose to gain better

Association mapping of main tomato fruit sugars and organic acids

Directory of Open Access Journals (Sweden)

Jiantao Zhao

2016-08-01

Full Text Available Association mapping has been widely used to map the significant associated loci responsible for natural variation in complex traits and are valuable for crop improvement. Sugars and organic acids are the most important metabolites in tomato fruits. We used a collection of 174 tomato accessions composed of S. lycopersicum (123 accessions and S. lycopersicum var cerasiforme (51 accessions to detect significantly associated loci controlling the variation of main sugars and organic acids. The accessions were genotyped with 182 SSRs spreading over the tomato genome. Association mapping was conducted on the main sugars and organic acids detected by gas chromatography-mass spectrometer (GC-MS over two years using the mixed linear model (MLM. We detected a total of 58 significantly associated loci (P<0.001 for the 17 sugars and organic acids, including fructose, glucose, sucrose, citric acid, malic acid. These results not only co-localized with several reported QTLs, including fru9.1/PV, suc9.1/PV, ca2.1/HS, ca3.1/PV, ca4.1/PV and ca8.1/PV, but also provided a list of candidate significantly associated loci to be functionally validated. These significantly associated loci could be used for deciphering the genetic architecture of tomato fruit sugars and organic acids and for tomato quality breeding.

Dissection of Resistance Genes to Pseudomonas syringae pv. phaseolicola in UI3 Common Bean Cultivar

Directory of Open Access Journals (Sweden)

Ana M. González

2017-11-01

Full Text Available Few quantitative trait loci have been mapped for resistance to Pseudomonas syringae pv. phaseolicola in common bean. Two F2 populations were developed from the host differential UI3 cultivar. The objective of this study was to further characterize the resistance to races 1, 5, 7 and 9 of Psp included in UI3. Using a QTL mapping approach, 16 and 11 main-effect QTLs for pod and primary leaf resistance were located on LG10, explaining up to 90% and 26% of the phenotypic variation, respectively. The homologous genomic region corresponding to primary leaf resistance QTLs detected tested positive for the presence of resistance-associated gene cluster encoding nucleotide-binding and leucine-rich repeat (NL, Natural Resistance Associated Macrophage (NRAMP and Pentatricopeptide Repeat family (PPR proteins. It is worth noting that the main effect QTLs for resistance in pod were located inside a 3.5 Mb genomic region that included the Phvul.010G021200 gene, which encodes a protein that has the highest sequence similarity to the RIN4 gene of Arabidopsis, and can be considered an important candidate gene for the organ-specific QTLs identified here. These results support that resistance to Psp from UI3 might result from the immune response activated by combinations of R proteins, and suggest the guard model as an important mechanism in pod resistance to halo blight. The candidate genes identified here warrant functional studies that will help in characterizing the actual defense gene(s in UI3 genotype.

Genome-wide DNA binding pattern of two-component system response regulator RhpR in Pseudomonas syringae

Directory of Open Access Journals (Sweden)

Tianhong Zhou

2015-06-01

Full Text Available Although Pseudomonas syringae uses the two-component system RhpRS to modulate the expression of type III secretion system (T3SS genes and pathogenicity, the molecular mechanisms and the regulon of RhpRS have yet to be fully demonstrated. We have performed a genome-wide analysis of RhpR binding to DNA prepared from P. syringae pv. phaseolicola in order to identify candidate direct targets of RhpR-mediated transcriptional regulation, as described in our recent article [1]. The data are available from NCBI Gene Expression Omnibus (GEO with the accession number GSE58533. Here we describe the detailed methods and data analyses of our RhpR ChIP-seq dataset.

Pseudomonas syringae evades host immunity by degrading flagellin monomers with alkaline protease AprA.

Science.gov (United States)

Pel, Michiel J C; van Dijken, Anja J H; Bardoel, Bart W; Seidl, Michael F; van der Ent, Sjoerd; van Strijp, Jos A G; Pieterse, Corné M J

2014-07-01

Bacterial flagellin molecules are strong inducers of innate immune responses in both mammals and plants. The opportunistic pathogen Pseudomonas aeruginosa secretes an alkaline protease called AprA that degrades flagellin monomers. Here, we show that AprA is widespread among a wide variety of bacterial species. In addition, we investigated the role of AprA in virulence of the bacterial plant pathogen P. syringae pv. tomato DC3000. The AprA-deficient DC3000 ΔaprA knockout mutant was significantly less virulent on both tomato and Arabidopsis thaliana. Moreover, infiltration of A. thaliana Col-0 leaves with DC3000 ΔaprA evoked a significantly higher level of expression of the defense-related genes FRK1 and PR-1 than did wild-type DC3000. In the flagellin receptor mutant fls2, pathogen virulence and defense-related gene activation did not differ between DC3000 and DC3000 ΔaprA. Together, these results suggest that AprA of DC3000 is important for evasion of recognition by the FLS2 receptor, allowing wild-type DC3000 to be more virulent on its host plant than AprA-deficient DC3000 ΔaprA. To provide further evidence for the role of DC3000 AprA in host immune evasion, we overexpressed the AprA inhibitory peptide AprI of DC3000 in A. thaliana to counteract the immune evasive capacity of DC3000 AprA. Ectopic expression of aprI in A. thaliana resulted in an enhanced level of resistance against wild-type DC3000, while the already elevated level of resistance against DC3000 ΔaprA remained unchanged. Together, these results indicate that evasion of host immunity by the alkaline protease AprA is important for full virulence of strain DC3000 and likely acts by preventing flagellin monomers from being recognized by its cognate immune receptor.

Plant innate immunity induced by flagellin suppresses the hypersensitive response in non-host plants elicited by Pseudomonas syringae pv. averrhoi.

Directory of Open Access Journals (Sweden)

Chia-Fong Wei

Full Text Available A new pathogen, Pseudomonas syringae pv. averrhoi (Pav, which causes bacterial spot disease on carambola was identified in Taiwan in 1997. Many strains of this pathovar have been isolated from different locations and several varieties of hosts. Some of these strains, such as HL1, are nonmotile and elicit a strong hypersensitive response (HR in nonhost tobacco leaves, while other strains, such as PA5, are motile and elicit a weak HR. Based on the image from a transmission electron microscope, the results showed that HL1 is flagellum-deficient and PA5 has normal flagella. Here we cloned and analyzed the fliC gene and glycosylation island from Pav HL1 and PA5. The amino acid sequences of FliC from HL1 and PA5 are identical to P. s. pvs. tabaci (Pta, glycinea and phaseolicola and share very high similarity with other pathovars of P. syringae. In contrast to the flagellin mutant PtaΔfliC, PA5ΔfliC grows as well as wild type in the host plant, but it elicits stronger HR than wild type does in non-host plants. Furthermore, the purified Pav flagellin, but not the divergent flagellin from Agrobacterium tumefaciens, is able to impair the HR induced by PA5ΔfliC. PA5Δfgt1 possessing nonglycosylated flagella behaved as its wild type in both bacterial growth in host and HR elicitation. Flagellin was infiltrated into tobacco leaves either simultaneously with flagellum-deficient HL1 or prior to the inoculation of wild type HL1, and both treatments impaired the HR induced by HL1. Moreover, the HR elicited by PA5 and PA5ΔfliC was enhanced by the addition of cycloheximide, suggesting that the flagellin is one of the PAMPs (pathogen-associated molecular patterns contributed to induce the PAMP-triggered immunity (PTI. Taken together, the results shown in this study reveal that flagellin in Pav is capable of suppressing HR via PTI induction during an incompatible interaction.

Plant Innate Immunity Induced by Flagellin Suppresses the Hypersensitive Response in Non-Host Plants Elicited by Pseudomonas syringae pv. averrhoi

Science.gov (United States)

Wei, Chia-Fong; Hsu, Shih-Tien; Deng, Wen-Ling; Wen, Yu-Der; Huang, Hsiou-Chen

2012-01-01

A new pathogen, Pseudomonas syringae pv. averrhoi (Pav), which causes bacterial spot disease on carambola was identified in Taiwan in 1997. Many strains of this pathovar have been isolated from different locations and several varieties of hosts. Some of these strains, such as HL1, are nonmotile and elicit a strong hypersensitive response (HR) in nonhost tobacco leaves, while other strains, such as PA5, are motile and elicit a weak HR. Based on the image from a transmission electron microscope, the results showed that HL1 is flagellum-deficient and PA5 has normal flagella. Here we cloned and analyzed the fliC gene and glycosylation island from Pav HL1 and PA5. The amino acid sequences of FliC from HL1 and PA5 are identical to P. s. pvs. tabaci (Pta), glycinea and phaseolicola and share very high similarity with other pathovars of P. syringae. In contrast to the flagellin mutant PtaΔfliC, PA5ΔfliC grows as well as wild type in the host plant, but it elicits stronger HR than wild type does in non-host plants. Furthermore, the purified Pav flagellin, but not the divergent flagellin from Agrobacterium tumefaciens, is able to impair the HR induced by PA5ΔfliC. PA5Δfgt1 possessing nonglycosylated flagella behaved as its wild type in both bacterial growth in host and HR elicitation. Flagellin was infiltrated into tobacco leaves either simultaneously with flagellum-deficient HL1 or prior to the inoculation of wild type HL1, and both treatments impaired the HR induced by HL1. Moreover, the HR elicited by PA5 and PA5ΔfliC was enhanced by the addition of cycloheximide, suggesting that the flagellin is one of the PAMPs (pathogen-associated molecular patterns) contributed to induce the PAMP-triggered immunity (PTI). Taken together, the results shown in this study reveal that flagellin in Pav is capable of suppressing HR via PTI induction during an incompatible interaction. PMID:22911741

The mangotoxin biosynthetic operon (mbo) is specifically distributed within Pseudomonas syringae genomospecies 1 and was acquired only once during evolution.

Science.gov (United States)

Carrión, Víctor J; Gutiérrez-Barranquero, José A; Arrebola, Eva; Bardaji, Leire; Codina, Juan C; de Vicente, Antonio; Cazorla, Francisco M; Murillo, Jesús

2013-02-01

Mangotoxin production was first described in Pseudomonas syringae pv. syringae strains. A phenotypic characterization of 94 P. syringae strains was carried out to determine the genetic evolution of the mangotoxin biosynthetic operon (mbo). We designed a PCR primer pair specific for the mbo operon to examine its distribution within the P. syringae complex. These primers amplified a 692-bp DNA fragment from 52 mangotoxin-producing strains and from 7 non-mangotoxin-producing strains that harbor the mbo operon, whereas 35 non-mangotoxin-producing strains did not yield any amplification. This, together with the analysis of draft genomes, allowed the identification of the mbo operon in five pathovars (pathovars aptata, avellanae, japonica, pisi, and syringae), all of which belong to genomospecies 1, suggesting a limited distribution of the mbo genes in the P. syringae complex. Phylogenetic analyses using partial sequences from housekeeping genes differentiated three groups within genomospecies 1. All of the strains containing the mbo operon clustered in groups I and II, whereas those lacking the operon clustered in group III; however, the relative branching order of these three groups is dependent on the genes used to construct the phylogeny. The mbo operon maintains synteny and is inserted in the same genomic location, with high sequence conservation around the insertion point, for all the strains in groups I and II. These data support the idea that the mbo operon was acquired horizontally and only once by the ancestor of groups I and II from genomospecies 1 within the P. syringae complex.

A role in immunity for Arabidopsis cysteine protease RD21, the ortholog of the tomato immune protease C14.

Directory of Open Access Journals (Sweden)

Takayuki Shindo

Full Text Available Secreted papain-like Cys proteases are important players in plant immunity. We previously reported that the C14 protease of tomato is targeted by cystatin-like EPIC proteins that are secreted by the oomycete pathogen Phytophthora infestans (Pinf during infection. C14 has been under diversifying selection in wild potato species coevolving with Pinf and reduced C14 levels result in enhanced susceptibility for Pinf. Here, we investigated the role C14-EPIC-like interactions in the natural pathosystem of Arabidopsis with the oomycete pathogen Hyaloperonospora arabidopsidis (Hpa. In contrast to the Pinf-solanaceae pathosystem, the C14 orthologous protease of Arabidopsis, RD21, does not evolve under diversifying selection in Arabidopsis, and rd21 null mutants do not show phenotypes upon compatible and incompatible Hpa interactions, despite the evident lack of a major leaf protease. Hpa isolates express highly conserved EPIC-like proteins during infections, but it is unknown if these HpaEPICs can inhibit RD21 and one of these HpaEPICs even lacks the canonical cystatin motifs. The rd21 mutants are unaffected in compatible and incompatible interactions with Pseudomonas syringae pv. tomato, but are significantly more susceptible for the necrotrophic fungal pathogen Botrytis cinerea, demonstrating that RD21 provides immunity to a necrotrophic pathogen.

Tomato SlRbohB, a member of the NADPH oxidase family, is required for disease resistance against Botrytis cinerea and tolerance to drought stress

Directory of Open Access Journals (Sweden)

Xiaohui eLi

2015-06-01

Full Text Available NADPH oxidases (also known as respiratory burst oxidase homologues, Rbohs are the enzymes that catalyze the generation of reactive oxygen species (ROS in plants. In the present study, eight SlRboh genes were identified in tomato and their possible involvement in resistance to Botrytis cinerea and drought tolerance was examined. Expression of SlRbohs was induced by B. cinerea and Pseudomonas syringae pv. tomato but displayed distinct patterns. Virus-induced gene silencing (VIGS-based silencing of SlRbohB resulted in reduced resistance to B. cinerea but silencing of each of other SlRbohs did not affect the resistance. The SlRbohB-silenced plants accumulated more ROS and attenuated expression of defense genes after infection of B. cinerea than the nonsilenced plants. Silencing of SlRbohB also suppressed flg22-induced ROS burst and the expression of SlLrr22, a marker gene related to PAMP-triggered immunity (PTI. Transient expression of SlRbohB in Nicotiana benthamiana led to enhanced resistance to B. cinerea. Furthermore, silencing of SlRbohB resulted in decreased drought tolerance, accelerated water loss in leaves and altered expression of drought-responsive genes. Our data demonstrate that SlRbohB positively regulates the resistance to B. cinerea, flg22-induced PTI and drought tolerance in tomato.

Tomato NAC transcription factor SlSRN1 positively regulates defense response against biotic stress but negatively regulates abiotic stress response.

Directory of Open Access Journals (Sweden)

Bo Liu

Full Text Available Biotic and abiotic stresses are major unfavorable factors that affect crop productivity worldwide. NAC proteins comprise a large family of transcription factors that play important roles in plant growth and development as well as in responses to biotic and abiotic stresses. In a virus-induced gene silencing-based screening to identify genes that are involved in defense response against Botrytis cinerea, we identified a tomato NAC gene SlSRN1 (Solanum lycopersicum Stress-related NAC1. SlSRN1 is a plasma membrane-localized protein with transactivation activity in yeast. Expression of SlSRN1 was significantly induced by infection with B. cinerea or Pseudomonas syringae pv. tomato (Pst DC3000, leading to 6-8 folds higher than that in the mock-inoculated plants. Expression of SlSRN1 was also induced by salicylic acid, jasmonic acid and 1-amino cyclopropane-1-carboxylic acid and by drought stress. Silencing of SlSRN1 resulted in increased severity of diseases caused by B. cinerea and Pst DC3000. However, silencing of SlSRN1 resulted in increased tolerance against oxidative and drought stresses. Furthermore, silencing of SlSRN1 accelerated accumulation of reactive oxygen species but attenuated expression of defense genes after infection by B. cinerea. Our results demonstrate that SlSRN1 is a positive regulator of defense response against B. cinerea and Pst DC3000 but is a negative regulator for oxidative and drought stress response in tomato.

Genomic Structural Variations Affecting Virulence During Clonal Expansion of Pseudomonas syringae pv. actinidiae Biovar 3 in Europe.

Science.gov (United States)

Firrao, Giuseppe; Torelli, Emanuela; Polano, Cesare; Ferrante, Patrizia; Ferrini, Francesca; Martini, Marta; Marcelletti, Simone; Scortichini, Marco; Ermacora, Paolo

2018-01-01

Pseudomonas syringae pv. actinidiae (Psa) biovar 3 caused pandemic bacterial canker of Actinidia chinensis and Actinidia deliciosa since 2008. In Europe, the disease spread rapidly in the kiwifruit cultivation areas from a single introduction. In this study, we investigated the genomic diversity of Psa biovar 3 strains during the primary clonal expansion in Europe using single molecule real-time (SMRT), Illumina and Sanger sequencing technologies. We recorded evidences of frequent mobilization and loss of transposon Tn6212, large chromosome inversions, and ectopic integration of IS sequences (remarkably ISPsy31, ISPsy36, and ISPsy37). While no phenotype change associated with Tn6212 mobilization could be detected, strains CRAFRU 12.29 and CRAFRU 12.50 did not elicit the hypersensitivity response (HR) on tobacco and eggplant leaves and were limited in their growth in kiwifruit leaves due to insertion of ISPsy31 and ISPsy36 in the hrpS and hrpR genes, respectively, interrupting the hrp cluster. Both strains had been isolated from symptomatic plants, suggesting coexistence of variant strains with reduced virulence together with virulent strains in mixed populations. The structural differences caused by rearrangements of self-genetic elements within European and New Zealand strains were comparable in number and type to those occurring among the European strains, in contrast with the significant difference in terms of nucleotide polymorphisms. We hypothesize a relaxation, during clonal expansion, of the selection limiting the accumulation of deleterious mutations associated with genome structural variation due to transposition of mobile elements. This consideration may be relevant when evaluating strategies to be adopted for epidemics management.

Water Extract from Spent Mushroom Substrate of Hericium erinaceus Suppresses Bacterial Wilt Disease of Tomato

Science.gov (United States)

Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop

2015-01-01

Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048

Defence responses of arabidopsis thaliana to infection by pseudomonas syringae are regulated by the circadian clock

KAUST Repository

Bhardwaj, Vaibhav

2011-10-31

The circadian clock allows plants to anticipate predictable daily changes in abiotic stimuli, such as light; however, whether the clock similarly allows plants to anticipate interactions with other organisms is unknown. Here we show that Arabidopsis thaliana (Arabidopsis) has circadian clock-mediated variation in resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), with plants being least susceptible to infection in the subjective morning. We suggest that the increased resistance to Pst DC3000 observed in the morning in Col-0 plants results from clock-mediated modulation of pathogen associated molecular pattern (PAMP)-triggered immunity. Analysis of publicly available microarray data revealed that a large number of Arabidopsis defence-related genes showed both diurnal- and circadian-regulation, including genes involved in the perception of the PAMP flagellin which exhibit a peak in expression in the morning. Accordingly, we observed that PAMP-triggered callose deposition was significantly higher in wild-type plants inoculated with Pst DC3000 hrpA in the subjective morning than in the evening, while no such temporal difference was evident in arrhythmic plants. Our results suggest that PAMP-triggered immune responses are modulated by the circadian clock and that temporal regulation allows plants to anticipate and respond more effectively to pathogen challenges in the daytime. © 2011 Bhardwaj et al.

Isolation and characterisation of EfeM, a periplasmic component of the putative EfeUOBM iron transporter of Pseudomonas syringae pv. syringae

Energy Technology Data Exchange (ETDEWEB)

Rajasekaran, Mohan B [School of Biological Sciences Harborne Building, Whiteknights Campus, Reading, RG6 6AS (United Kingdom); Structural Biology Unit at The BioCentre, University of Reading, Harborne Building, Whiteknights Campus, Reading, RG6 6AS (United Kingdom); Mitchell, Sue A; Gibson, Trevor M [Structural Biology Unit at The BioCentre, University of Reading, Harborne Building, Whiteknights Campus, Reading, RG6 6AS (United Kingdom); Hussain, Rohanah; Siligardi, Giuliano [Circular Dichroism Group, Diamond Light Source, Chiltern, Oxfordshire,OX11 0DE (United Kingdom); Andrews, Simon C [School of Biological Sciences Harborne Building, Whiteknights Campus, Reading, RG6 6AS (United Kingdom); Watson, Kimberly A, E-mail: k.a.watson@reading.ac.uk [School of Biological Sciences Harborne Building, Whiteknights Campus, Reading, RG6 6AS (United Kingdom); Structural Biology Unit at The BioCentre, University of Reading, Harborne Building, Whiteknights Campus, Reading, RG6 6AS (United Kingdom)

2010-07-30

Research highlights: {yields} Bioinformatic analysis reveals EfeM is a metallopeptidase with conserved HXXE motif. {yields} Mass spectrometry confirms EfeM consists of 251 residues, molecular weight 27,772Da. {yields} SRCD spectroscopy shows an {alpha}-helical secondary structure. {yields} Single crystals of EfeM are orthorhombic and diffract to 1.6A resolution. {yields} Space group is P22{sub 1}2{sub 1} with cell dimensions a = 46.74, b = 95.17 and c = 152.61 A. -- Abstract: The EfeM protein is a component of the putative EfeUOBM iron-transporter of Pseudomonas syringae pathovar syringae and is thought to act as a periplasmic, ferrous-iron binding protein. It contains a signal peptide of 34 amino acid residues and a C-terminal 'Peptidase{sub M}75' domain of 251 residues. The C-terminal domain contains a highly conserved 'HXXE' motif thought to act as part of a divalent cation-binding site. In this work, the gene (efeM or 'Psyr{sub 3}370') encoding EfeM was cloned and over-expressed in Escherichia coli, and the mature protein was purified from the periplasm. Mass spectrometry confirmed the identity of the protein (M{sub W} 27,772 Da). Circular dichroism spectroscopy of EfeM indicated a mainly {alpha}-helical structure, consistent with bioinformatic predictions. Purified EfeM was crystallised by hanging-drop vapor diffusion to give needle-shaped crystals that diffracted to a resolution of 1.6 A. This is the first molecular study of a peptidase M75 domain with a presumed iron transport role.

Elicitation of Induced Resistance against Pectobacterium carotovorum and Pseudomonas syringae by Specific Individual Compounds Derived from Native Korean Plant Species

Directory of Open Access Journals (Sweden)

Choong-Min Ryu

2013-10-01

Full Text Available Plants have developed general and specific defense mechanisms for protection against various enemies. Among the general defenses, induced resistance has distinct characteristics, such as broad-spectrum resistance and long-lasting effectiveness. This study evaluated over 500 specific chemical compounds derived from native Korean plant species to determine whether they triggered induced resistance against Pectobacterium carotovorum supsp. carotovorum (Pcc in tobacco (Nicotiana tabacum and Pseudomonas syringae pv. tomato (Pst in Arabidopsis thaliana. To select target compound(s with direct and indirect (volatile effects, a new Petri-dish-based in vitro disease assay system with four compartments was developed. The screening assay showed that capsaicin, fisetin hydrate, jaceosidin, and farnesiferol A reduced the disease severity significantly in tobacco. Of these four compounds, capsaicin and jaceosidin induced resistance against Pcc and Pst, which depended on both salicylic acid (SA and jasmonic acid (JA signaling, using Arabidopsis transgenic and mutant lines, including npr1 and NahG for SA signaling and jar1 for JA signaling. The upregulation of the PR2 and PDF1.2 genes after Pst challenge with capsaicin pre-treatment indicated that SA and JA signaling were primed. These results demonstrate that capsaicin and jaceosidin can be effective triggers of strong induced resistance against both necrotrophic and biotrophic plant pathogens.

The Identification of Genes Important in Pseudomonas syringae pv. phaseolicola Plant Colonisation Using In Vitro Screening of Transposon Libraries.

Directory of Open Access Journals (Sweden)

Bharani Manoharan

Full Text Available The bacterial plant pathogen Pseudomonas syringae pv. phaseolicola (Pph colonises the surface of common bean plants before moving into the interior of plant tissue, via wounds and stomata. In the intercellular spaces the pathogen proliferates in the apoplastic fluid and forms microcolonies (biofilms around plant cells. If the pathogen can suppress the plant's natural resistance response, it will cause halo blight disease. The process of resistance suppression is fairly well understood, but the mechanisms used by the pathogen in colonisation are less clear. We hypothesised that we could apply in vitro genetic screens to look for changes in motility, colony formation, and adhesion, which are proxies for infection, microcolony formation and cell adhesion. We made transposon (Tn mutant libraries of Pph strains 1448A and 1302A and found 106/1920 mutants exhibited alterations in colony morphology, motility and biofilm formation. Identification of the insertion point of the Tn identified within the genome highlighted, as expected, a number of altered motility mutants bearing mutations in genes encoding various parts of the flagellum. Genes involved in nutrient biosynthesis, membrane associated proteins, and a number of conserved hypothetical protein (CHP genes were also identified. A mutation of one CHP gene caused a positive increase in in planta bacterial growth. This rapid and inexpensive screening method allows the discovery of genes important for in vitro traits that can be correlated to roles in the plant interaction.

Pollen as a possible pathway for the dissemination of Pseudomonas syringae pv. actinide and bacterial canker of kiwifruit

Directory of Open Access Journals (Sweden)

Rodanthi TONTOU

2014-09-01

Full Text Available Pollen collected in a kiwifruit orchard with symptoms of bacterial canker and naturally contaminated by Pseudomonas syringae pv. actinidiae (Psa, was used to pollinate an experimental orchard, in order to confirm its role, under commercial orchard conditions, in disseminating the pathogen and, possibly, contributing to disease spread. A pollen lot, certified free from Psa, was used with the same methods as a control. Two pollination techniques were used: dusting (dry pollen and spraying (pollen suspension in water. The orchard was monitored during 2 years from experimental pollination, with regular sampling of flowers, fruits, leaves, and vines, to check for Psa as an epiphyte or endophyte, and for bacterial canker symptoms. Psa was recovered from flowers, fruitlets and leaves during the first season, mainly in plots where contaminated pollen had been sprayed in water suspension. From early August until harvesting time (mid-October, Psa detection was possible only on leaves. No symptoms developed during the first season after pollination. No endophytic Psa was detected in pruned vines in the following winter. During the second season, detection and isolation of Psa was erratic, but direct isolation was achieved from four plots. During the second season after pollination, typical leaf symptoms were observed on a few vines, and Psa was isolated and identified. Our results suggest that Psa could be disseminated via contaminated kiwifruit pollen as a pathway for spread of bacterial canker. However, further pollination experiments are needed to establish, beyond any doubt, whether contaminated pollen may contribute to possible disease outbreaks.

Real time expression of ACC oxidase and PR-protein genes mediated by Methylobacterium spp. in tomato plants challenged with Xanthomonas campestris pv. vesicatoria.

Science.gov (United States)

Yim, W J; Kim, K Y; Lee, Y W; Sundaram, S P; Lee, Y; Sa, T M

2014-07-15

Biotic stress like pathogenic infection increases ethylene biosynthesis in plants and ethylene inhibitors are known to alleviate the severity of plant disease incidence. This study aimed to reduce the bacterial spot disease incidence in tomato plants caused by Xanthomonas campestris pv. vesicatoria (XCV) by modulating stress ethylene with 1-aminocyclopropane-1-carboxylate (ACC) deaminase activity of Methylobacterium strains. Under greenhouse condition, Methylobacterium strains inoculated and pathogen challenged tomato plants had low ethylene emission compared to pathogen infected ones. ACC accumulation and ACC oxidase (ACO) activity with ACO related gene expression increased in XCV infected tomato plants over Methylobacterium strains inoculated plants. Among the Methylobacterium spp., CBMB12 resulted lowest ACO related gene expression (1.46 Normalized Fold Expression), whereas CBMB20 had high gene expression (3.42 Normalized Fold Expression) in pathogen challenged tomato. But a significant increase in ACO gene expression (7.09 Normalized Fold Expression) was observed in the bacterial pathogen infected plants. In contrast, Methylobacterium strains enhanced β-1,3-glucanase and phenylalanine ammonia-lyase (PAL) enzyme activities in pathogen challenged tomato plants. The respective increase in β-1,3-glucanase related gene expressions due to CBMB12, CBMB15, and CBMB20 strains were 66.3, 25.5 and 10.4% higher over pathogen infected plants. Similarly, PAL gene expression was high with 0.67 and 0.30 Normalized Fold Expression, in pathogen challenged tomato plants inoculated with CBMB12 and CBMB15 strains. The results suggest that ethylene is a crucial factor in bacterial spot disease incidence and that methylobacteria with ACC deaminase activity can reduce the disease severity with ultimate pathogenesis-related protein increase in tomato. Copyright © 2014 Elsevier GmbH. All rights reserved.

A possible role for acetylated intermediates in diaminopimelate and tabtoxinine-beta-lactam biosynthesis in Pseudomonas syringae pv. tabaci BR2.024.

Science.gov (United States)

Liu, L; Shaw, P D

1997-01-01

The deduced product of an open reading frame (ORF3) located in the tabtoxinine-beta-lactam (T beta L) biosynthetic region of Pseudomonas syringae pv. tabaci BR2.024 (BR2.024) has significant sequence homology to the dapD products of other bacteria. dapD encodes L-2,3,4,5-tetrahydrodipicolinate succinyl coenzyme A succinyltransferase (THDPA-ST), an enzyme in the diaminopimelate (DAP) and lysine biosynthetic pathway. Complementation studies, in vitro transcription-translation experiments, and enzymatic assays indicated that ORF3 encodes a product with THDPA-ST activity in Escherichia coli dapD mutant beta 274. However, a BR2.024 mutant with an insert in ORF3 was prototrophic, and only basal THDPA-ST activity was detected in extracts of both parent and mutant. This finding suggested that ORF3 was not required for DAP biosynthesis and that it did not encode a product with THDPA-ST activity. The results of enzymatic studies, indicating that BR2.024 uses acetylated intermediates for DAP biosynthesis, are consistent with the hypothesis that BR2.024 does not need THDPA-ST for DAP biosynthesis. The ORF3 mutant produced reduced levels of tabtoxin, indicating that ORF3 may have a role in T beta L biosynthesis. We have named the gene tabB and have proposed a possible function for the gene product. PMID:9294453

A Novel Protein Elicitor BAR11 From Saccharothrix yanglingensis Hhs.015 Improves Plant Resistance to Pathogens and Interacts With Catalases as Targets

OpenAIRE

Yanan Zhang; Yanan Zhang; Xia Yan; Xia Yan; Hongmei Guo; Hongmei Guo; Feiyang Zhao; Feiyang Zhao; Lili Huang; Lili Huang

2018-01-01

Previously, we reported the biocontrol effects of Saccharothrix yanglingensis strain Hhs.015 on Valsa mali. Here, we report a novel protein elicitor BAR11 from the biocontrol strain Hhs.015 and its functions in plant defense responses. Functional analysis showed that the elicitor BAR11 significantly stimulated plant systemic resistance in Arabidopsis thaliana to Pseudomonas syringae pv. tomato DC3000. In addition, systemic tissues accumulated reactive oxygen species and deposited callose in a...

Multilayered Regulation of Ethylene Induction Plays a Positive Role in Arabidopsis Resistance against Pseudomonas syringae1[OPEN

Science.gov (United States)

Guan, Rongxia; Su, Jianbin; Meng, Xiangzong; Li, Sen; Liu, Yidong; Xu, Juan; Zhang, Shuqun

2015-01-01

Ethylene, a key phytohormone involved in plant-pathogen interaction, plays a positive role in plant resistance against fungal pathogens. However, its function in plant bacterial resistance remains unclear. Here, we report a detailed analysis of ethylene induction in Arabidopsis (Arabidopsis thaliana) in response to Pseudomonas syringae pv tomato DC3000 (Pst). Ethylene biosynthesis is highly induced in both pathogen/microbe-associated molecular pattern (PAMP)-triggered immunity and effector-triggered immunity (ETI), and the induction is potentiated by salicylic acid (SA) pretreatment. In addition, Pst actively suppresses PAMP-triggered ethylene induction in a type III secretion system-dependent manner. SA potentiation of ethylene induction is dependent mostly on MITOGEN-ACTIVATED PROTEIN KINASE6 (MPK6) and MPK3 and their downstream ACS2 and ACS6, two type I isoforms of 1-aminocyclopropane-1-carboxylic acid synthases (ACSs). ACS7, a type III ACS whose expression is enhanced by SA pretreatment, is also involved. Pst expressing the avrRpt2 effector gene (Pst-avrRpt2), which is capable of triggering ETI, induces a higher level of ethylene production, and the elevated portion is dependent on SALICYLIC ACID INDUCTION DEFICIENT2 and NONEXPRESSER OF PATHOGENESIS-RELATED GENE1, two key players in SA biosynthesis and signaling. High-order ACS mutants with reduced ethylene induction are more susceptible to both Pst and Pst-avrRpt2, demonstrating a positive role of ethylene in plant bacterial resistance mediated by both PAMP-triggered immunity and ETI. PMID:26265775

Comparative genome analysis provides insights into the evolution and adaptation of Pseudomonas syringae pv. aesculi on Aesculus hippocastanum.

Directory of Open Access Journals (Sweden)

Sarah Green

Full Text Available A recently emerging bleeding canker disease, caused by Pseudomonas syringae pathovar aesculi (Pae, is threatening European horse chestnut in northwest Europe. Very little is known about the origin and biology of this new disease. We used the nucleotide sequences of seven commonly used marker genes to investigate the phylogeny of three strains isolated recently from bleeding stem cankers on European horse chestnut in Britain (E-Pae. On the basis of these sequences alone, the E-Pae strains were identical to the Pae type-strain (I-Pae, isolated from leaf spots on Indian horse chestnut in India in 1969. The phylogenetic analyses also showed that Pae belongs to a distinct clade of P. syringae pathovars adapted to woody hosts. We generated genome-wide Illumina sequence data from the three E-Pae strains and one strain of I-Pae. Comparative genomic analyses revealed pathovar-specific genomic regions in Pae potentially implicated in virulence on a tree host, including genes for the catabolism of plant-derived aromatic compounds and enterobactin synthesis. Several gene clusters displayed intra-pathovar variation, including those encoding type IV secretion, a novel fatty acid biosynthesis pathway and a sucrose uptake pathway. Rates of single nucleotide polymorphisms in the four Pae genomes indicate that the three E-Pae strains diverged from each other much more recently than they diverged from I-Pae. The very low genetic diversity among the three geographically distinct E-Pae strains suggests that they originate from a single, recent introduction into Britain, thus highlighting the serious environmental risks posed by the spread of an exotic plant pathogenic bacterium to a new geographic location. The genomic regions in Pae that are absent from other P. syringae pathovars that infect herbaceous hosts may represent candidate genetic adaptations to infection of the woody parts of the tree.

Multilayered Regulation of Ethylene Induction Plays a Positive Role in Arabidopsis Resistance against Pseudomonas syringae.

Science.gov (United States)

Guan, Rongxia; Su, Jianbin; Meng, Xiangzong; Li, Sen; Liu, Yidong; Xu, Juan; Zhang, Shuqun

2015-09-01

Ethylene, a key phytohormone involved in plant-pathogen interaction, plays a positive role in plant resistance against fungal pathogens. However, its function in plant bacterial resistance remains unclear. Here, we report a detailed analysis of ethylene induction in Arabidopsis (Arabidopsis thaliana) in response to Pseudomonas syringae pv tomato DC3000 (Pst). Ethylene biosynthesis is highly induced in both pathogen/microbe-associated molecular pattern (PAMP)-triggered immunity and effector-triggered immunity (ETI), and the induction is potentiated by salicylic acid (SA) pretreatment. In addition, Pst actively suppresses PAMP-triggered ethylene induction in a type III secretion system-dependent manner. SA potentiation of ethylene induction is dependent mostly on MITOGEN-ACTIVATED PROTEIN KINASE6 (MPK6) and MPK3 and their downstream ACS2 and ACS6, two type I isoforms of 1-aminocyclopropane-1-carboxylic acid synthases (ACSs). ACS7, a type III ACS whose expression is enhanced by SA pretreatment, is also involved. Pst expressing the avrRpt2 effector gene (Pst-avrRpt2), which is capable of triggering ETI, induces a higher level of ethylene production, and the elevated portion is dependent on SALICYLIC ACID INDUCTION DEFICIENT2 and NONEXPRESSER OF PATHOGENESIS-RELATED GENE1, two key players in SA biosynthesis and signaling. High-order ACS mutants with reduced ethylene induction are more susceptible to both Pst and Pst-avrRpt2, demonstrating a positive role of ethylene in plant bacterial resistance mediated by both PAMP-triggered immunity and ETI. © 2015 American Society of Plant Biologists. All Rights Reserved.

Characterization of dapB, a gene required by Pseudomonas syringae pv. tabaci BR2.024 for lysine and tabtoxinine-beta-lactam biosynthesis.

Science.gov (United States)

Liu, L; Shaw, P D

1997-01-01

The dapB gene, which encodes L-2,3-dihydrodipicolinate reductase, the second enzyme of the lysine branch of the aspartic amino acid family, was cloned and sequenced from a tabtoxin-producing bacterium, Pseudomonas syringae pv. tabaci BR2.024. The deduced amino acid sequence shared 60 to 90% identity to known dapB gene products from gram-negative bacteria and 19 to 21% identity to the dapB products from gram-positive bacteria. The consensus sequence for the NAD(P)H binding site [(V/I)(A/G)(V/I)XGXXGXXG)] and the proposed substrate binding site (HHRHK) were conserved in the polypeptide. A BR2.024 dapB mutant is a diaminopimelate auxotroph and tabtoxin negative. The addition of a mixture of L-,L-, D,D-, and meso-diaminopimelate to defined media restored growth but not tabtoxin production. Cloned DNA fragments containing the parental dapB gene restored the ability to grow in defined media and tabtoxin production to the dapB mutant. These results indicate that the dapB gene is required for both lysine and tabtoxin biosynthesis, thus providing the first genetic evidence that the biosynthesis of tabtoxin proceeds in part along the lysine biosynthetic pathway. These data also suggest that L-2,3,4,5-tetrahydrodipicolinate is a common intermediate for both lysine and tabtoxin biosynthesis. PMID:8990304

Constitutive activation of jasmonate signaling in an Arabidopsis mutant correlates with enhanced resistance to Erysiphe cichoracearum, Pseudomonas syringae, and Myzus persicae.

Science.gov (United States)

Ellis, Christine; Karafyllidis, Ioannis; Turner, John G

2002-10-01

In Arabidopsis spp., the jasmonate (JA) response pathway generally is required for defenses against necrotrophic pathogens and chewing insects, while the salicylic acid (SA) response pathway is generally required for specific, resistance (R) gene-mediated defenses against both biotrophic and necrotrophic pathogens. For example, SA-dependent defenses are required for resistance to the biotrophic fungal pathogen Erysiphe cichoracearum UCSC1 and the bacterial pathogen Pseudomonas syringae pv. maculicola, and also are expressed during response to the green peach aphid Myzus persicae. However, recent evidence indicates that the expression of JA-dependent defenses also may confer resistance to E. cichoracearum. To confirm and to extend this observation, we have compared the disease and pest resistance of wild-type Arabidopsis plants with that of the mutants coil, which is insensitive to JA, and cev1, which has constitutive JA signaling. Measurements of the colonization of these plants by E. cichoracearum, P. syringae pv. maculicola, and M. persicae indicated that activation of the JA signal pathway enhanced resistance, and was associated with the activation of JA-dependent defense genes and the suppression of SA-dependent defense genes. We conclude that JA and SA induce alternative defense pathways that can confer resistance to the same pathogens and pests.

Role of soil, crop debris, and a plant pathogen in Salmonella enterica contamination of tomato plants.

Directory of Open Access Journals (Sweden)

Jeri D Barak

Full Text Available BACKGROUND: In the U.S., tomatoes have become the most implicated vehicle for produce-associated Salmonellosis with 12 outbreaks since 1998. Although unconfirmed, trace backs suggest pre-harvest contamination with Salmonella enterica. Routes of tomato crop contamination by S. enterica in the absence of direct artificial inoculation have not been investigated. METHODOLOGY/PRINCIPAL FINDINGS: This work examined the role of contaminated soil, the potential for crop debris to act as inoculum from one crop to the next, and any interaction between the seedbourne plant pathogen Xanthomonas campestris pv. vesicatoria and S. enterica on tomato plants. Our results show S. enterica can survive for up to six weeks in fallow soil with the ability to contaminate tomato plants. We found S. enterica can contaminate a subsequent crop via crop debris; however a fallow period between crop incorporation and subsequent seeding can affect contamination patterns. Throughout these studies, populations of S. enterica declined over time and there was no bacterial growth in either the phyllosphere or rhizoplane. The presence of X. campestris pv. vesicatoria on co-colonized tomato plants had no effect on the incidence of S. enterica tomato phyllosphere contamination. However, growth of S. enterica in the tomato phyllosphere occurred on co-colonized plants in the absence of plant disease. CONCLUSIONS/SIGNIFICANCE: S. enterica contaminated soil can lead to contamination of the tomato phyllosphere. A six week lag period between soil contamination and tomato seeding did not deter subsequent crop contamination. In the absence of plant disease, presence of the bacterial plant pathogen, X. campestris pv. vesicatoria was beneficial to S. enterica allowing multiplication of the human pathogen population. Any event leading to soil contamination with S. enterica could pose a public health risk with subsequent tomato production, especially in areas prone to bacterial spot disease.

Modeling and mapping the current and future distribution of Pseudomonas syringae pv. actinidiae under climate change in China.

Directory of Open Access Journals (Sweden)

Rulin Wang

Full Text Available Bacterial canker of kiwifruit caused by Pseudomonas syringae pv. actinidiae (Psa is a major threat to the kiwifruit industry throughout the world and accounts for substantial economic losses in China. The aim of the present study was to test and explore the possibility of using MaxEnt (maximum entropy models to predict and analyze the future large-scale distribution of Psa in China.Based on the current environmental factors, three future climate scenarios, which were suggested by the fifth IPCC report, and the current distribution sites of Psa, MaxEnt combined with ArcGIS was applied to predict the potential suitable areas and the changing trend of Psa in China. The jackknife test and correlation analysis were used to choose dominant climatic factors. The receiver operating characteristic curve (ROC drawn by MaxEnt was used to evaluate the accuracy of the simulation.The results showed that under current climatic conditions, the area from latitude 25° to 36°N and from longitude 101° to 122°E is the primary potential suitable area of Psa in China. The highly suitable area (with suitability between 66 and 100 was mainly concentrated in Northeast Sichuan, South Shaanxi, most of Chongqing, West Hubei and Southwest Gansu and occupied 4.94% of land in China. Under different future emission scenarios, both the areas and the centers of the suitable areas all showed differences compared with the current situation. Four climatic variables, i.e., maximum April temperature (19%, mean temperature of the coldest quarter (14%, precipitation in May (11.5% and minimum temperature in October (10.8%, had the largest impact on the distribution of Psa.The MaxEnt model is potentially useful for forecasting the future adaptive distribution of Psa under climate change, and it provides important guidance for comprehensive management.

Modeling and mapping the current and future distribution of Pseudomonas syringae pv. actinidiae under climate change in China.

Science.gov (United States)

Wang, Rulin; Li, Qing; He, Shisong; Liu, Yuan; Wang, Mingtian; Jiang, Gan

2018-01-01

Bacterial canker of kiwifruit caused by Pseudomonas syringae pv. actinidiae (Psa) is a major threat to the kiwifruit industry throughout the world and accounts for substantial economic losses in China. The aim of the present study was to test and explore the possibility of using MaxEnt (maximum entropy models) to predict and analyze the future large-scale distribution of Psa in China. Based on the current environmental factors, three future climate scenarios, which were suggested by the fifth IPCC report, and the current distribution sites of Psa, MaxEnt combined with ArcGIS was applied to predict the potential suitable areas and the changing trend of Psa in China. The jackknife test and correlation analysis were used to choose dominant climatic factors. The receiver operating characteristic curve (ROC) drawn by MaxEnt was used to evaluate the accuracy of the simulation. The results showed that under current climatic conditions, the area from latitude 25° to 36°N and from longitude 101° to 122°E is the primary potential suitable area of Psa in China. The highly suitable area (with suitability between 66 and 100) was mainly concentrated in Northeast Sichuan, South Shaanxi, most of Chongqing, West Hubei and Southwest Gansu and occupied 4.94% of land in China. Under different future emission scenarios, both the areas and the centers of the suitable areas all showed differences compared with the current situation. Four climatic variables, i.e., maximum April temperature (19%), mean temperature of the coldest quarter (14%), precipitation in May (11.5%) and minimum temperature in October (10.8%), had the largest impact on the distribution of Psa. The MaxEnt model is potentially useful for forecasting the future adaptive distribution of Psa under climate change, and it provides important guidance for comprehensive management.

Bacterial canker on kiwifruit in Italy: Anatomical changes in the wood and in the primary infection sites

NARCIS (Netherlands)

Renzi, M.; Copini, P.; Taddei, A.R.; Rossetti, A.; Gallipoli, L.; Mazzaglia, A.; Balestra, G.M.

2012-01-01

The bacterial canker of kiwifruit caused by Pseudomonas syringae pv. actinidiae is a severe threat to kiwifruit production worldwide. Many aspects of P. syringae pv. actinidiae biology and epidemiology still require in-depth investigation. The infection by and spread of P. syringae pv. actinidiae in

A bacterial cysteine protease effector protein interferes with photosynthesis to suppress plant innate immune responses.

Science.gov (United States)

Rodríguez-Herva, José J; González-Melendi, Pablo; Cuartas-Lanza, Raquel; Antúnez-Lamas, María; Río-Alvarez, Isabel; Li, Ziduo; López-Torrejón, Gema; Díaz, Isabel; Del Pozo, Juan C; Chakravarthy, Suma; Collmer, Alan; Rodríguez-Palenzuela, Pablo; López-Solanilla, Emilia

2012-05-01

The bacterial pathogen Pseudomonas syringae pv tomato DC3000 suppresses plant innate immunity with effector proteins injected by a type III secretion system (T3SS). The cysteine protease effector HopN1, which reduces the ability of DC3000 to elicit programmed cell death in non-host tobacco, was found to also suppress the production of defence-associated reactive oxygen species (ROS) and callose when delivered by Pseudomonas fluorescens heterologously expressing a P. syringae T3SS. Purified His(6) -tagged HopN1 was used to identify tomato PsbQ, a member of the oxygen evolving complex of photosystem II (PSII), as an interacting protein. HopN1 localized to chloroplasts and both degraded PsbQ and inhibited PSII activity in chloroplast preparations, whereas a HopN1(D299A) non-catalytic mutant lost these abilities. Gene silencing of NtPsbQ in tobacco compromised ROS production and programmed cell death by DC3000. Our data reveal PsbQ as a contributor to plant immunity responses and a target for pathogen suppression. © 2012 Blackwell Publishing Ltd.

Investigation of intercellular salicylic acid accumulation during compatible and incompatible Arabidopsis-pseudomonas syringae interactions using a fast neutron-generated mutant allele of EDS5 identified by genetic mapping and whole-genome sequencing.

Directory of Open Access Journals (Sweden)

Jessie L Carviel

Full Text Available A whole-genome sequencing technique developed to identify fast neutron-induced deletion mutations revealed that iap1-1 is a new allele of EDS5 (eds5-5. RPS2-AvrRpt2-initiated effector-triggered immunity (ETI was compromised in iap1-1/eds5-5 with respect to in planta bacterial levels and the hypersensitive response, while intra- and intercellular free salicylic acid (SA accumulation was greatly reduced, suggesting that SA contributes as both an intracellular signaling molecule and an antimicrobial agent in the intercellular space during ETI. During the compatible interaction between wild-type Col-0 and virulent Pseudomonas syringae pv. tomato (Pst, little intercellular free SA accumulated, which led to the hypothesis that Pst suppresses intercellular SA accumulation. When Col-0 was inoculated with a coronatine-deficient strain of Pst, high levels of intercellular SA accumulation were observed, suggesting that Pst suppresses intercellular SA accumulation using its phytotoxin coronatine. This work suggests that accumulation of SA in the intercellular space is an important component of basal/PAMP-triggered immunity as well as ETI to pathogens that colonize the intercellular space.

Pseudomonas syringae pv. actinidiae (PSA) Isolates from Recent Bacterial Canker of Kiwifruit Outbreaks Belong to the Same Genetic Lineage

Science.gov (United States)

Taratufolo, Maria C.; Cai, Rongman; Almeida, Nalvo F.; Goodman, Tokia; Guttman, David S.; Vinatzer, Boris A.; Balestra, Giorgio M.

2012-01-01

Intercontinental spread of emerging plant diseases is one of the most serious threats to world agriculture. One emerging disease is bacterial canker of kiwi fruit (Actinidia deliciosa and A. chinensis) caused by Pseudomonas syringae pv. actinidiae (PSA). The disease first occurred in China and Japan in the 1980s and in Korea and Italy in the 1990s. A more severe form of the disease broke out in Italy in 2008 and in additional countries in 2010 and 2011 threatening the viability of the global kiwi fruit industry. To start investigating the source and routes of international transmission of PSA, genomes of strains from China (the country of origin of the genus Actinidia), Japan, Korea, Italy and Portugal have been sequenced. Strains from China, Italy, and Portugal have been found to belong to the same clonal lineage with only 6 single nucleotide polymorphisms (SNPs) in 3,453,192 bp and one genomic island distinguishing the Chinese strains from the European strains. Not more than two SNPs distinguish each of the Italian and Portuguese strains from each other. The Japanese and Korean strains belong to a separate genetic lineage as previously reported. Analysis of additional European isolates and of New Zealand isolates exploiting genome-derived markers showed that these strains belong to the same lineage as the Italian and Chinese strains. Interestingly, the analyzed New Zealand strains are identical to European strains at the tested SNP loci but test positive for the genomic island present in the sequenced Chinese strains and negative for the genomic island present in the European strains. Results are interpreted in regard to the possible direction of movement of the pathogen between countries and suggest a possible Chinese origin of the European and New Zealand outbreaks. PMID:22590555

Natural variation in partial resistance to Pseudomonas syringae is controlled by two major QTLs in Arabidopsis thaliana.

Directory of Open Access Journals (Sweden)

Laure Perchepied

Full Text Available BACKGROUND: Low-level, partial resistance is pre-eminent in natural populations, however, the mechanisms underlying this form of resistance are still poorly understood. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we used the model pathosystem Pseudomonas syringae pv. tomato DC3000 (Pst - Arabidopsis thaliana to study the genetic basis of this form of resistance. Phenotypic analysis of a set of Arabidopsis accessions, based on evaluation of in planta pathogen growth revealed extensive quantitative variation for partial resistance to Pst. It allowed choosing a recombinant inbred line (RIL population derived from a cross between the accessions Bayreuth and Shahdara for quantitative genetic analysis. Experiments performed under two different environmental conditions led to the detection of two major and two minor quantitative trait loci (QTLs governing partial resistance to Pst and called PRP-Ps1 to PRP-Ps4. The two major QTLs, PRP-Ps1 and PRP-Ps2, were confirmed in near isogenic lines (NILs, following the heterogeneous inbred families (HIFs strategy. Analysis of marker gene expression using these HIFs indicated a negative correlation between the induced amount of transcripts of SA-dependent genes PR1, ICS and PR5, and the in planta bacterial growth in the HIF segregating at PRP-Ps2 locus, suggesting an implication of PRP-Ps2 in the activation of SA dependent responses. CONCLUSIONS/SIGNIFICANCE: These results show that variation in partial resistance to Pst in Arabidopsis is governed by relatively few loci, and the validation of two major loci opens the way for their fine mapping and their cloning, which will improve our understanding of the molecular mechanisms underlying partial resistance.

Global transcriptional responses of Pseudomonas syringae DC3000 to changes in iron bioavailability in vitro

Directory of Open Access Journals (Sweden)

Rutzke Michael

2008-12-01

Full Text Available Abstract Background Pseudomonas syringae pv tomato DC3000 (DC3000 is a Gram-negative model plant pathogen that is found in a wide variety of environments. To survive in these diverse conditions it must sense and respond to various environmental cues. One micronutrient required for most forms of life is iron. Bioavailable iron has been shown to be an important global regulator for many bacteria where it not only regulates a wide variety of genes involved in general cell physiology but also virulence determinants. In this study we used microarrays to study differential gene regulation in DC3000 in response to changes in levels of cell-associated iron. Results DC3000 cultures were grown under highly controlled conditions and analyzed after the addition of iron citrate or sodium citrate to the media. In the cultures supplemented with iron, we found that cell-associated iron increased rapidly while culture densities were not significantly different over 4 hours when compared to cultures with sodium citrate added. Microarray analysis of samples taken from before and after the addition of either sodium citrate or iron citrate identified 386 differentially regulated genes with high statistical confidence. Differentially regulated genes were clustered based on expression patterns observed between comparison of samples taken at different time points and with different supplements. This analysis grouped genes associated with the same regulatory motifs and/or had similar putative or known function. Conclusion This study shows iron is rapidly taken up from the medium by iron-depleted DC3000 cultures and that bioavailable iron is a global cue for the expression of iron transport, storage, and known virulence factors in DC3000. Furthermore approximately 34% of the differentially regulated genes are associated with one of four regulatory motifs for Fur, PvdS, HrpL, or RpoD.

Xanthomonads and other yellow-pigmented, Xanthomonas-like bacteria associated with tomato seeds in Tanzania

DEFF Research Database (Denmark)

Mbega, Ernest Rashid; Wulff, Ednar Gadelha; Mabagala, R.B.

2012-01-01

of Xanthomonas campestris pv. malvacearum, were pathogenic on tomato and pepper plants. Strains identified by Biolog as Sphingomonas sanguinis and Sphingomonas terrae also incited black rot symptoms on pepper leaves. However, bacterial strains belonging to the genus Stenotrophomonas, Chryseobacterium, Pantoea...... and Flavobacterium were not pathogenic on tomato and pepper. Phylogenetic analysis showed that strains of the genus Xanthomonas are more closely related to Stenotrophomonas and Pantoea compared to the other bacterial genera found in tomato seeds....

Soil mixture composition alters Arabidopsis susceptibility to Pseudomonas syringae infection

Science.gov (United States)

Pseudomonas syringae is a Gram-negative bacterial pathogen that causes disease on more than 100 different plant species, including the model plant Arabidopsis thaliana. Dissection of the Arabidopsis thaliana-Pseudomonas syringae pathosystem has identified many factors that contribute to successful ...

Cell wall-bound invertase limits sucrose export and is involved in symptom development and inhibition of photosynthesis during compatible interaction between tomato and Xanthomonas campestris pv vesicatoria.

Science.gov (United States)

Kocal, Nurcan; Sonnewald, Uwe; Sonnewald, Sophia

2008-11-01

Cell wall-bound invertase (cw-Inv) plays an important role in carbohydrate partitioning and regulation of sink-source interaction. There is increasing evidence that pathogens interfere with sink-source interaction, and induction of cw-Inv activity has frequently been shown in response to pathogen infection. To investigate the role of cw-Inv, transgenic tomato (Solanum lycopersicum) plants silenced for the major leaf cw-Inv isoforms were generated and analyzed during normal growth and during the compatible interaction with Xanthomonas campestris pv vesicatoria. Under normal growth conditions, activities of sucrolytic enzymes as well as photosynthesis and respiration were unaltered in the transgenic plants compared with wild-type plants. However, starch levels of source leaves were strongly reduced, which was most likely caused by an enhanced sucrose exudation rate. Following X. campestris pv vesicatoria infection, cw-Inv-silenced plants showed an increased sucrose to hexose ratio in the apoplast of leaves. Symptom development, inhibition of photosynthesis, and expression of photosynthetic genes were clearly delayed in transgenic plants compared with wild-type plants. In addition, induction of senescence-associated and pathogenesis-related genes observed in infected wild-type plants was abolished in cw-Inv-silenced tomato lines. These changes were not associated with decreased bacterial growth. In conclusion, cw-Inv restricts carbon export from source leaves and regulates the sucrose to hexose ratio in the apoplast. Furthermore, an increased apoplastic hexose to sucrose ratio can be linked to inhibition of photosynthesis and induction of pathogenesis-related gene expression but does not significantly influence bacterial growth. Indirectly, bacteria may benefit from low invertase activity, since the longevity of host cells is raised and basal defense might be dampened.

40 CFR 180.1145 - Pseudomonas syringae; exemption from the requirement of a tolerance.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pseudomonas syringae; exemption from... FOOD Exemptions From Tolerances § 180.1145 Pseudomonas syringae; exemption from the requirement of a tolerance. Pseudomonas syringae is exempted from the requirement of a tolerance on all raw agricultural...

Genomic analysis of the Kiwifruit pathogen Pseudomonas syringae pv. actinidiae provides insight into the origins of an emergent plant disease.

Directory of Open Access Journals (Sweden)

Honour C McCann

Full Text Available The origins of crop diseases are linked to domestication of plants. Most crops were domesticated centuries--even millennia--ago, thus limiting opportunity to understand the concomitant emergence of disease. Kiwifruit (Actinidia spp. is an exception: domestication began in the 1930s with outbreaks of canker disease caused by P. syringae pv. actinidiae (Psa first recorded in the 1980s. Based on SNP analyses of two circularized and 34 draft genomes, we show that Psa is comprised of distinct clades exhibiting negligible within-clade diversity, consistent with disease arising by independent samplings from a source population. Three clades correspond to their geographical source of isolation; a fourth, encompassing the Psa-V lineage responsible for the 2008 outbreak, is now globally distributed. Psa has an overall clonal population structure, however, genomes carry a marked signature of within-pathovar recombination. SNP analysis of Psa-V reveals hundreds of polymorphisms; however, most reside within PPHGI-1-like conjugative elements whose evolution is unlinked to the core genome. Removal of SNPs due to recombination yields an uninformative (star-like phylogeny consistent with diversification of Psa-V from a single clone within the last ten years. Growth assays provide evidence of cultivar specificity, with rapid systemic movement of Psa-V in Actinidia chinensis. Genomic comparisons show a dynamic genome with evidence of positive selection on type III effectors and other candidate virulence genes. Each clade has highly varied complements of accessory genes encoding effectors and toxins with evidence of gain and loss via multiple genetic routes. Genes with orthologs in vascular pathogens were found exclusively within Psa-V. Our analyses capture a pathogen in the early stages of emergence from a predicted source population associated with wild Actinidia species. In addition to candidate genes as targets for resistance breeding programs, our findings

Pseudomnas syringae – a Pathogen of Fruit Trees in Serbia

Directory of Open Access Journals (Sweden)

Veljko Gavrilović

2009-01-01

Full Text Available Data about symptomatology, pathogenicity and bacteriological characteristics of Pseudomonas syringae, and PCR methods for fast and reliable detection of the pathogen are given in this paper. P. syringae has been experimentaly proved as a pathogen of pear, apple, apricot, plum cherry, and raspberry, and pathogen strains have also been isolated from necrotic peach buds. Two pathogen varieties, syringae and morsprunorum, were found in our research in Serbia, the former being dominant on fruit trees.The most reliable method for detection of this bacteria is PCR, using BOX and REP primers. This method has also revealed significant differences among the strains originating from fruit trees in Serbia. Thus, it was proved that the population of P. syringae in Serbia is heterogeneous, which is very important for future epidemiologocal studies. Control of this pathogen includes mechanical, cultural and chemical measures, but integrated approach is very important for sustainable control.

Bacterial canker on kiwifruit in Italy: anatomical changes in the wood and in the primary infection sites.

Science.gov (United States)

Renzi, Marsilio; Copini, Paul; Taddei, Anna R; Rossetti, Antonio; Gallipoli, Lorenzo; Mazzaglia, Angelo; Balestra, Giorgio M

2012-09-01

The bacterial canker of kiwifruit caused by Pseudomonas syringae pv. actinidiae is a severe threat to kiwifruit production worldwide. Many aspects of P. syringae pv. actinidiae biology and epidemiology still require in-depth investigation. The infection by and spread of P. syringae pv. actinidiae in xylem and phloem was investigated by carrying out artificial inoculation experiments with histological and dendrochronological analyses of naturally diseased plants in Italy. We found that the bacterium can infect host plants by entering natural openings and lesions. In naturally infected kiwifruit plants, P. syringae pv. actinidiae is present in the lenticels as well as in the dead phloem tissue beneath the lenticels, surrounded by a lesion in the periderm which appears to indicate the importance of lenticels to kiwifruit infection. Biofilm formation was observed outside and inside plants. In cases of advanced stages of P. syringae pv. actinidiae infection, neuroses of the phloem occur, which are followed by cambial dieback and most likely by infection of the xylem. Anatomical changes in wood such as reduced ring width, a drastic reduction in vessel size, and the presence of tyloses were observed within several infected sites. In the field, these changes occur only a year after the first leaf symptoms are observed suggesting a significant time lapse between primary and secondary symptoms. It was possible to study the temporal development of P. syringae pv. actinidiae-induced cambial dieback by applying dendrochronology methods which revealed that cambial dieback occurs only during the growing season.

Pseudomonas syringae enhances herbivory by suppressing the reactive oxygen burst in Arabidopsis.

Science.gov (United States)

Groen, Simon C; Humphrey, Parris T; Chevasco, Daniela; Ausubel, Frederick M; Pierce, Naomi E; Whiteman, Noah K

2016-01-01

Plant-herbivore interactions have evolved in the presence of plant-colonizing microbes. These microbes can have important third-party effects on herbivore ecology, as exemplified by drosophilid flies that evolved from ancestors feeding on plant-associated microbes. Leaf-mining flies in the genus Scaptomyza, which is nested within the paraphyletic genus Drosophila, show strong associations with bacteria in the genus Pseudomonas, including Pseudomonas syringae. Adult females are capable of vectoring these bacteria between plants and larvae show a preference for feeding on P. syringae-infected leaves. Here we show that Scaptomyza flava larvae can also vector P. syringae to and from feeding sites, and that they not only feed more, but also develop faster on plants previously infected with P. syringae. Our genetic and physiological data show that P. syringae enhances S. flava feeding on infected plants at least in part by suppressing anti-herbivore defenses mediated by reactive oxygen species. Copyright © 2015 Elsevier Ltd. All rights reserved.

Bacterial Leaf Spot of Parsley: Characterization of a New Disease

Science.gov (United States)

Since 2002, a severe leaf spot disease on parsley has occurred throughout central coastal California and particularly in Monterey County. Two different bacterial pathogens (Pseudomonas syringae pv. apii, and P. syringae pv. coriandricola) have been associated these outbreaks on parsley. Our research...

Show us your spots! Researchers need samples of bacterial leaf spots on celery, cilantro, parsley, and other crops.

Science.gov (United States)

Since 2002, a severe leaf spot disease on parsley has occurred throughout central coastal California and particularly in Monterey County. Three different bacterial pathogens (Pseudomonas syringae pv. apii, P. syringae pv. coriandricola and an organism very closely related to P. viridiflava) have bee...

Estudio de la respuesta de pseudomonas syringae pv. tomato DC3000 a flavonoides

OpenAIRE

Vargas Gallego, Paola Andrea

2013-01-01

Esta tesis doctoral ha sido realizada en el Grupo Interacciones Planta-Bacteria perteneciente al Departamento de Microbiología del Suelo y Sistemas Simbióticos de la Estación Experimental del Zaidín, gracias a una beca del Programa "Junta para la Ampliación de Estudios" JAE Predoc del Consejo Superior de Investigaciones Científicas (CSIC) cofinanciada por FEDER y a una beca Marie Curie Training Site for Marine Microbiology (MARMIC EST), financiada por la Comunidad Europea. La investigación ha...

Diversity and Abundance of Ice Nucleating Strains of Pseudomonas syringae in a Freshwater Lake in Virginia, USA.

Science.gov (United States)

Pietsch, Renée B; Vinatzer, Boris A; Schmale, David G

2017-01-01

The bacterium Pseudomonas syringae is found in a variety of terrestrial and aquatic environments. Some strains of P. syringae express an ice nucleation protein (hereafter referred to as Ice+) allowing them to catalyze the heterogeneous freezing of water. Though P. syringae has been sampled intensively from freshwater sources in France, little is known about the genetic diversity of P. syringae in natural aquatic habitats in North America. We collected samples of freshwater from three different depths in Claytor Lake, Virginia, USA between November 2015 and June 2016. Samples were plated on non-selective medium (TSA) and on medium selective for Pseudomonas (KBC) and closely related species to estimate the total number of culturable bacteria and of Pseudomonas , respectively. A droplet freezing assay was used to screen colonies for the Ice+ phenotype. Ice+ colonies were then molecularly identified based on the cts (citrate synthase) gene and the 16S rDNA gene. Phylogenetic analysis of cts sequences showed a surprising diversity of phylogenetic subgroups of P. syringae . Frequencies of Ice+ isolates on P. syringae selective medium ranged from 0 to 15% per sample with the highest frequency being found in spring. Our work shows that freshwater lakes can be a significant reservoir of Ice+ P. syringae . Future work is needed to determine the contribution of P. syringae from freshwater lakes to the P. syringae populations present in the atmosphere and on plants and, in particular, if freshwater lakes could be an inoculum source of P. syringae -caused plant disease outbreaks.

Antagonistic activity of Bacillus subtilis SB1 and its biocontrol effect on tomato bacterial wilt

Science.gov (United States)

A potential biocontrol agent of bacterial wilt, Bacillus subtilis SB1, isolated from tomato roots, showed a broad-spectrum of antimicrobial activity in in vitro experiments. It inhibited the growth of many plant pathogens, including Ralstonia solanacearum, Xanthomonas oryzae pv. oryzae, Fusarium ox...

Development of a Multiple Loci Variable Number of Tandem Repeats Analysis (MLVA) to Unravel the Intra-Pathovar Structure of Pseudomonas syringae pv. actinidiae Populations Worldwide

Science.gov (United States)

Ciarroni, Serena; Gallipoli, Lorenzo; Taratufolo, Maria C.; Butler, Margi I.; Poulter, Russell T. M.; Pourcel, Christine; Vergnaud, Gilles; Balestra, Giorgio M.; Mazzaglia, Angelo

2015-01-01

The bacterial canker of kiwifruit by Pseudomonas syringae pv. actinidiae is an emblematic example of a catastrophic disease of fruit crops. In 2008 a new, extremely virulent form of the pathogen emerged and rapidly devastated many Actinidia spp. orchards all over the world. In order to understand differences in populations within this pathovar and to elucidate their diffusion and movements on world scale, it is necessary to be able to quickly and on a routine basis compare new isolates with previous records. In this report a worldwide collection of 142 strains was analyzed by MLVA, chosen as investigative technique for its efficacy, reproducibility, simplicity and low cost. A panel of 13 Variable Number of Tandem Repeats (VNTR) loci was identified and used to describe the pathogen population. The MLVA clustering is highly congruent with the population structure as previously established by other molecular approaches including whole genome sequencing and correlates with geographic origin, time of isolation and virulence. For convenience, we divided the VNTR loci in two panels. Panel 1 assay, using six loci, recognizes 23 different haplotypes, clustered into ten complexes with highest congruence with previous classifications. Panel 2, with seven VNTR loci, provides discriminatory power. Using the total set of 13 VNTR loci, 58 haplotypes can be distinguished. The recent hypervirulent type shows very limited diversity and includes, beside the strains from Europe, New Zealand and Chile, a few strains from Shaanxi, China. A broad genetic variability is observed in China, but different types are also retrievable in Japan and Korea. The low virulent strains cluster together and are very different from the other MLVA genotypes. Data were used to generate a public database in MLVAbank. MLVA represents a very promising first-line assay for large-scale routine genotyping, prior to whole genome sequencing of only the most relevant samples. PMID:26262683

The Arabidopsis thaliana lectin receptor kinase LecRK-I.9 is required for full resistance to Pseudomonas syringae and affects jasmonate signalling.

Science.gov (United States)

Balagué, Claudine; Gouget, Anne; Bouchez, Olivier; Souriac, Camille; Haget, Nathalie; Boutet-Mercey, Stéphanie; Govers, Francine; Roby, Dominique; Canut, Hervé

2017-09-01

On microbial attack, plants can detect invaders and activate plant innate immunity. For the detection of pathogen molecules or cell wall damage, plants employ receptors that trigger the activation of defence responses. Cell surface proteins that belong to large families of lectin receptor kinases are candidates to function as immune receptors. Here, the function of LecRK-I.9 (At5g60300), a legume-type lectin receptor kinase involved in cell wall-plasma membrane contacts and in extracellular ATP (eATP) perception, was studied through biochemical, gene expression and reverse genetics approaches. In Arabidopsis thaliana, LecRK-I.9 expression is rapidly, highly and locally induced on inoculation with avirulent strains of Pseudomonas syringae pv. tomato (Pst). Two allelic lecrk-I.9 knock-out mutants showed decreased resistance to Pst. Conversely, over-expression of LecRK-I.9 led to increased resistance to Pst. The analysis of defence gene expression suggests an alteration of both the salicylic acid (SA) and jasmonic acid (JA) signalling pathways. In particular, LecRK-I.9 expression during plant-pathogen interaction was dependent on COI1 (CORONATINE INSENSITIVE 1) and JAR1 (JASMONATE RESISTANT 1) components, and JA-responsive transcription factors (TFs) showed altered levels of expression in plants over-expressing LecRK-I.9. A similar misregulation of these TFs was obtained by JA treatment. This study identified LecRK-I.9 as necessary for full resistance to Pst and demonstrated its involvement in the control of defence against pathogens through a regulation of JA signalling components. The role of LecRK-I.9 is discussed with regard to the potential molecular mechanisms linking JA signalling to cell wall damage and/or eATP perception. © 2016 BSPP AND JOHN WILEY & SONS LTD.

The Facultative Symbiont Rickettsia Protects an Invasive Whitefly against Entomopathogenic Pseudomonas syringae Strains.

Science.gov (United States)

Hendry, Tory A; Hunter, Martha S; Baltrus, David A

2014-12-01

Facultative endosymbionts can benefit insect hosts in a variety of ways, including context-dependent roles, such as providing defense against pathogens. The role of some symbionts in defense may be overlooked, however, when pathogen infection is transient, sporadic, or asymptomatic. The facultative endosymbiont Rickettsia increases the fitness of the sweet potato whitefly (Bemisia tabaci) in some populations through mechanisms that are not yet understood. In this study, we investigated the role of Rickettsia in mediating the interaction between the sweet potato whitefly and Pseudomonas syringae, a common environmental bacterium, some strains of which are pathogenic to aphids. Our results show that P. syringae multiplies within whiteflies, leading to host death, and that whiteflies infected with Rickettsia show a decreased rate of death due to P. syringae. Experiments using plants coated with P. syringae confirmed that whiteflies can acquire the bacteria at a low rate while feeding, leading to increased mortality, particularly when the whiteflies are not infected with Rickettsia. These results suggest that P. syringae may affect whitefly populations in nature and that Rickettsia can ameliorate this effect. This study highlights the possible importance of interactions among opportunistic environmental pathogens and endosymbionts of insects. Copyright © 2014, American Society for Microbiology. All Rights Reserved.

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available nas syringae ... pv. syringae B728a] ... Length = 133 ... Query: 313 ETCSLFFVEAIHAAEERVWITSPYFIPD...EAVSAALTLAVLRGVDVRLLLPSRPDHYVVYA 372 ... ETCSLFFVEAIHAAEERVWITSPYFIPDEAV+A...ALTLAVLRGVDVRLLLPSRPDHYVVYA Sbjct: 1 ... ETCSLFFVEAIHAAEERVWITSPYFIPDEAVTAALTLAVLRGVDVRLLLPSRPDHYVVYA 60 ... Quer

Flagellar motility confers epiphytic fitness advantages upon Pseudomonas syringae

International Nuclear Information System (INIS)

Haefele, D.M.; Lindow, S.E.

1987-01-01

The role of flagellar motility in determining the epiphytic fitness of an ice-nucleation-active strain of Pseudomonas syringae was examined. The loss of flagellar motility reduced the epiphytic fitness of a normally motile P. syringae strain as measured by its growth, survival, and competitive ability on bean leaf surfaces. Equal population sizes of motile parental or nonmotile mutant P. syringae strains were maintained on bean plants for at least 5 days following the inoculation of fully expanded primary leaves. However, when bean seedlings were inoculated before the primary leaves had expanded and bacterial populations on these leaves were quantified at full expansion, the population size of the nonmotile derivative strain reached only 0.9% that of either the motile parental or revertant strain. When fully expanded bean primary leaves were coinoculated with equal numbers of motile and nonmotile cells, the population size of a nonmotile derivative strain was one-third of that of the motile parental or revertant strain after 8 days. Motile and nonmotile cells were exposed in vitro and on plants to UV radiation and desiccating conditions. The motile and nonmotile strains exhibited equal resistance to both stresses in vitro. However, the population size of a nonmotile strain on leaves was less than 20% that of a motile revertant strain when sampled immediately after UV irradiation. Epiphytic populations of both motile and nonmotile P. syringae declined under desiccating conditions on plants, and after 8 days, the population size of a nonmotile strain was less than one-third that of the motile parental or revertant strain

An insight into the photodynamic approach versus copper formulations in the control of Pseudomonas syringae pv. actinidiae in kiwi plants.

Science.gov (United States)

Jesus, Vânia; Martins, Diana; Branco, Tatiana; Valério, Nádia; Neves, Maria G P M S; Faustino, Maria A F; Reis, Luís; Barreal, Esther; Gallego, Pedro P; Almeida, Adelaide

2018-02-14

In the last decade, the worldwide production of kiwi fruit has been highly affected by Pseudomonas syringae pv. actinidiae (Psa), a phytopathogenic bacterium; this has led to severe economic losses that are seriously affecting the kiwi fruit trade. The available treatments for this disease are still scarce, with the most common involving frequently spraying the orchards with copper derivatives, in particular cuprous oxide (Cu 2 O). However, these copper formulations should be avoided due to their high toxicity; therefore, it is essential to search for new approaches for controlling Psa. Antimicrobial photodynamic therapy (aPDT) may be an alternative approach to inactivate Psa. aPDT consists in the use of a photosensitizer molecule (PS) that absorbs light and by transference of the excess of energy or electrons to molecular oxygen forms highly reactive oxygen species (ROS) that can affect different molecular targets, thus being very unlikely to lead to the development of microbe resistance. The aim of the present study was to evaluate the effectiveness of aPDT to photoinactivate Psa, using the porphyrin Tetra-Py + -Me and different light intensities. The degree of inactivation of Psa was assessed using the PS at 5.0 μM under low irradiance (4.0 mW cm -2 ). Afterward, ex vivo experiments, using artificially contaminated kiwi leaves, were conducted with a PS at 50 μM under 150 mW cm -2 and sunlight irradiation. A reduction of 6 log in the in vitro assays after 90 min of irradiation was observed. In the ex vivo tests, the decrease was lower, approximately 1.8 log reduction at an irradiance of 150 mW cm -2 , 1.2 log at 4.0 mW cm -2 , and 1.5 log under solar radiation. However, after three successive cycles of treatment under 150 mW cm -2 , a 4 log inactivation was achieved. No negative effects were observed on leaves after treatment. Assays using Cu 2 O were also performed at the recommended concentration by law (50 g h L -1 ) and at concentrations 10 times

A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity.

Science.gov (United States)

Rosebrock, Tracy R; Zeng, Lirong; Brady, Jennifer J; Abramovitch, Robert B; Xiao, Fangming; Martin, Gregory B

2007-07-19

Many bacterial pathogens of plants and animals use a type III secretion system to deliver diverse virulence-associated 'effector' proteins into the host cell. The mechanisms by which these effectors act are mostly unknown; however, they often promote disease by suppressing host immunity. One type III effector, AvrPtoB, expressed by the plant pathogen Pseudomonas syringae pv. tomato, has a carboxy-terminal domain that is an E3 ubiquitin ligase. Deletion of this domain allows an amino-terminal region of AvrPtoB (AvrPtoB(1-387)) to be detected by certain tomato varieties leading to immunity-associated programmed cell death. Here we show that a host kinase, Fen, physically interacts with AvrPtoB(1-387 )and is responsible for activating the plant immune response. The AvrPtoB E3 ligase specifically ubiquitinates Fen and promotes its degradation in a proteasome-dependent manner. This degradation leads to disease susceptibility in Fen-expressing tomato lines. Various wild species of tomato were found to exhibit immunity in response to AvrPtoB(1-387 )and not to full-length AvrPtoB. Thus, by acquiring an E3 ligase domain, AvrPtoB has thwarted a highly conserved host resistance mechanism.

SlBIR3 Negatively Regulates PAMP Responses and Cell Death in Tomato

Directory of Open Access Journals (Sweden)

Shuhua Huang

2017-09-01

Full Text Available Bri1-associated kinase 1 (BAK1-interacting receptor-like kinase (BIR proteins have been shown to play important roles in regulating growth and development, pathogen associated molecular pattern (PAMP-triggered immunity (PTI responses, and cell death in the model plant, Arabidopsis thaliana. We identified four BIR family members in tomato (Solanum lycopersicum, including SlBIR3, an ortholog of AtBIR3 from A. thaliana. SlBIR3 is predicted to encode a membrane localized non-arginine-aspartate (non-RD kinase that, based on protein sequence, does not have autophosphorylation activity but that can be phosphorylated in vivo. We established that SlBIR3 interacts with SlBAK1 and AtBAK1 using yeast two-hybrid assays and co-immunoprecipitation and maltose-binding protein pull down assays. We observed that SlBIR3 overexpression in tomato (cv. micro-tom and A. thaliana has weak effect on growth and development through brassinosteroid (BR signaling. SlBIR3 overexpression in A. thaliana suppressed flg22-induced defense responses, but did not affect infection with the bacterial pathogen Pseudomonas syringae (PstDC3000. This result was confirmed using virus-induced gene silencing (VIGS in tomato in conjunction with PstDC3000 infection. Overexpression of SlBIR3 in tomato (cv. micro-tom and A. thaliana resulted in enhanced susceptibility to the necrotrophic fungus Botrytis cinerea. In addition, co-silencing SlBIR3 with SlSERK3A or SlSERK3B using VIGS and the tobacco rattle virus (TRV-RNA2 vector containing fragments of both the SlSERK3 and SlBIR3 genes induced spontaneous cell death, indicating a cooperation between the two proteins in this process. In conclusion, our study revealed that SlBIR3 is the ortholog of AtBIR3 and that it participates in BR, PTI, and cell death signaling pathways.

The Bacterial Effector HopX1 Targets JAZ Transcriptional Repressors to Activate Jasmonate Signaling and Promote Infection in Arabidopsis

Science.gov (United States)

Gimenez-Ibanez, Selena; Boter, Marta; Fernández-Barbero, Gemma; Chini, Andrea; Rathjen, John P.; Solano, Roberto

2014-01-01

Pathogenicity of Pseudomonas syringae is dependent on a type III secretion system, which secretes a suite of virulence effector proteins into the host cytoplasm, and the production of a number of toxins such as coronatine (COR), which is a mimic of the plant hormone jasmonate-isoleuce (JA-Ile). Inside the plant cell, effectors target host molecules to subvert the host cell physiology and disrupt defenses. However, despite the fact that elucidating effector action is essential to understanding bacterial pathogenesis, the molecular function and host targets of the vast majority of effectors remain largely unknown. Here, we found that effector HopX1 from Pseudomonas syringae pv. tabaci (Pta) 11528, a strain that does not produce COR, interacts with and promotes the degradation of JAZ proteins, a key family of JA-repressors. We show that hopX1 encodes a cysteine protease, activity that is required for degradation of JAZs by HopX1. HopX1 associates with JAZ proteins through its central ZIM domain and degradation occurs in a COI1-independent manner. Moreover, ectopic expression of HopX1 in Arabidopsis induces the expression of JA-dependent genes, represses salicylic acid (SA)-induced markers, and complements the growth of a COR-deficient P. syringae pv. tomato (Pto) DC3000 strain during natural bacterial infections. Furthermore, HopX1 promoted susceptibility when delivered by the natural type III secretion system, to a similar extent as the addition of COR, and this effect was dependent on its catalytic activity. Altogether, our results indicate that JAZ proteins are direct targets of bacterial effectors to promote activation of JA-induced defenses and susceptibility in Arabidopsis. HopX1 illustrates a paradigm of an alternative evolutionary solution to COR with similar physiological outcome. PMID:24558350

Building Integrated PV and PV/Hybrid Products - The PV:BONUS Experience: Preprint

Energy Technology Data Exchange (ETDEWEB)

Thomas, H.; Pierce, L. K.

2001-10-01

Presented at the 2001 NCPV Program Review Meeting: Successes and lessons learned from PV:BONUS (Building Opportunities in the United States in PV). This program has funded the development of PV or PV/hybrid products for building applications.

Identification of Isolates that Cause a Leaf Spot Disease of Brassicas as Xanthomonas campestris pv. raphani and Pathogenic and Genetic Comparison with Related Pathovars.

Science.gov (United States)

Vicente, J G; Everett, B; Roberts, S J

2006-07-01

ABSTRACT Twenty-five Xanthomonas isolates, including some isolates received as either X. campestris pv. armoraciae or pv. raphani, caused discrete leaf spot symptoms when spray-inoculated onto at least one Brassica oleracea cultivar. Twelve of these isolates and four other Xanthomonas isolates were spray- and pin-inoculated onto 21 different plant species/cultivars including horseradish (Armoracia rusticana), radish (Raphanus sativus), and tomato (Lycopersicon esculentum). The remaining 13 leaf spot isolates were spray-inoculated onto a subset of 10 plant species/cultivars. The leaf spot isolates were very aggressive on several Brassica spp., radish, and tomato causing leaf spots and dark sunken lesions on the middle vein, petiole, and stem. Based on the differential reactions of several Brassica spp. and radish cultivars, the leaf spot isolates were divided into three races, with races 1 and 3 predominating. A differential series was established to determine the race-type of isolates and a gene-for-gene model based on the interaction of two avirulence genes in the pathogen races and two matching resistance genes in the differential hosts is proposed. Repetitive-DNA polymerase chain reaction-based fingerprinting was used to assess the genetic diversity of the leaf spot isolates and isolates of closely related Xanthomonas pathovars. Although there was variability within each race, the leaf spot isolates were clustered separately from the X. campestris pv. campestris isolates. We propose that X. campestris isolates that cause a nonvascular leaf spot disease on Brassica spp. should be identified as pv. raphani and not pv. armoraciae. Race-type strains and a neopathotype strain for X. campestris pv. raphani are proposed.

Dual Effect of the Cubic Ag₃PO₄ Crystal on Pseudomonas syringae Growth and Plant Immunity

Directory of Open Access Journals (Sweden)

Mi Kyung Kim

2016-04-01

Full Text Available We previously found that the antibacterial activity of silver phosphate crystals on Escherichia coli depends on their structure. We here show that the cubic form of silver phosphate crystal (SPC can also be applied to inhibit the growth of a plant-pathogenic Pseudomonas syringae bacterium. SPC pretreatment resulted in reduced in planta multiplication of P. syringae. Induced expression of a plant defense marker gene PR1 by SPC alone is suggestive of its additional plant immunity-stimulating activity. Since SPC can simultaneously inhibit P. syringae growth and induce plant defense responses, it might be used as a more effective plant disease-controlling agent.

PV-CAD: an integrated tool for designing PV facades; PV-CAD - Ein integriertes Werkzeug zur Auslegung von PV-Fassaden

Energy Technology Data Exchange (ETDEWEB)

Giese, H.; Viotto, M. [Inst. fuer Solare Energieversorgungstechnik (ISET) e.V., Kassel (Germany); Esser, M.; Pukrop, D. [Univ. Oldenburg (Germany). Abt. Energie- und Halbleiterforschung; Stellbogen, D. [Zentrum fuer Sonnenergie- und Wasserstoff-Forschung, Stuttgart (Germany)

1997-12-31

PV-CAD provides PV system planners with a practice-oriented tool for an efficient design of PV facades. Being compatible with the standard programmes of the architects` and electrical engineering sectors it can be used on already existing systems and allows the user to draw on previously acquired knowedge. Its open interfaces permit the integration of further design tools. PV CAD works under Microsoft Windows for which it has the necessary graphic user interface. Its compliance to PC standards opens up a wide range of applications and permits its use also on inexpensive computers. Thanks to its promotion by the Federal Ministry for Education, Science, Research, and Technology under the research project ``Computer programmes for the design of photovoltaic facades`` PV-CAD is available at a moderate price. PV-CAD permits an efficient planning of solar facades and therefore has the potential to stimulate the use of PV on buildings. (orig.) [Deutsch] Mit PV-CAD steht dem Anlagenplaner ein anwendungsorientiertes Werkzeug zur Verfuegung, das eine rationelle Auslegung von PV-Fassaden ermoeglicht. Die Kompatibilitaet zu Standardprogrammen aus dem Architektur- und Elektrosektor erlaubt die Nutzung bereits vorhandener Systeme und damit erworbener Kenntnisse. Offene Schnittstellen gestatten die Einbindung weiterer Entwurfswerkzeuge. PV-CAD arbeitet unter Microsoft-Windows und verfuegt ueber die entsprechende grafische Benutzerschnittstelle. Die Kompatibilitaet zum PC-Standard eroeffnet eine sehr breite Anwenderbasis und ermoeglicht den Einsatz des Programms auch auf preiswerten Rechnern. Aufgrund der Foerderung durch das Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie im Rahmen des Forschungsprojekts `Rechnerprogramm zur Auslegung von Photovoltaik-Fassaden` steht PV-CAD preiswert zur Verfuegung. PV-CAD ermoeglicht eine effiziente Planung von Solarfassaden und kann daher dem PV-Einsatz in Gebaeuden weitere Impulse geben. (orig.)

PV-WEB: internet-based PV information tool

International Nuclear Information System (INIS)

Cowley, P.

2003-01-01

This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members

PV-WEB: internet-based PV information tool

Energy Technology Data Exchange (ETDEWEB)

Cowley, P

2003-07-01

This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members.

Thermo-Regulation of Genes Mediating Motility and Plant Interactions in Pseudomonas syringae

Science.gov (United States)

Hockett, Kevin L.; Burch, Adrien Y.; Lindow, Steven E.

2013-01-01

Pseudomonas syringae is an important phyllosphere colonist that utilizes flagellum-mediated motility both as a means to explore leaf surfaces, as well as to invade into leaf interiors, where it survives as a pathogen. We found that multiple forms of flagellum-mediated motility are thermo-suppressed, including swarming and swimming motility. Suppression of swarming motility occurs between 28° and 30°C, which coincides with the optimal growth temperature of P. syringae. Both fliC (encoding flagellin) and syfA (encoding a non-ribosomal peptide synthetase involved in syringafactin biosynthesis) were suppressed with increasing temperature. RNA-seq revealed 1440 genes of the P. syringae genome are temperature sensitive in expression. Genes involved in polysaccharide synthesis and regulation, phage and IS elements, type VI secretion, chemosensing and chemotaxis, translation, flagellar synthesis and motility, and phytotoxin synthesis and transport were generally repressed at 30°C, while genes involved in transcriptional regulation, quaternary ammonium compound metabolism and transport, chaperone/heat shock proteins, and hypothetical genes were generally induced at 30°C. Deletion of flgM, a key regulator in the transition from class III to class IV gene expression, led to elevated and constitutive expression of fliC regardless of temperature, but did not affect thermo-regulation of syfA. This work highlights the importance of temperature in the biology of P. syringae, as many genes encoding traits important for plant-microbe interactions were thermo-regulated. PMID:23527276

Type I J-domain NbMIP1 proteins are required for both Tobacco mosaic virus infection and plant innate immunity.

Directory of Open Access Journals (Sweden)

Yumei Du

Full Text Available Tm-2² is a coiled coil-nucleotide binding-leucine rich repeat resistance protein that confers durable extreme resistance against Tomato mosaic virus (ToMV and Tobacco mosaic virus (TMV by recognizing the viral movement protein (MP. Here we report that the Nicotiana benthamiana J-domain MIP1 proteins (NbMIP1s associate with tobamovirus MP, Tm-2² and SGT1. Silencing of NbMIP1s reduced TMV movement and compromised Tm-2²-mediated resistance against TMV and ToMV. Furthermore, silencing of NbMIP1s reduced the steady-state protein levels of ToMV MP and Tm-2². Moreover, NbMIP1s are required for plant resistance induced by other R genes and the nonhost pathogen Pseudomonas syringae pv. tomato (Pst DC3000. In addition, we found that SGT1 associates with Tm-2² and is required for Tm-2²-mediated resistance against TMV. These results suggest that NbMIP1s function as co-chaperones during virus infection and plant immunity.

Molecular signatures in Arabidopsis thaliana in response to insect attack and bacterial infection.

Science.gov (United States)

Barah, Pankaj; Winge, Per; Kusnierczyk, Anna; Tran, Diem Hong; Bones, Atle M

2013-01-01

Under the threat of global climatic change and food shortages, it is essential to take the initiative to obtain a comprehensive understanding of common and specific defence mechanisms existing in plant systems for protection against different types of biotic invaders. We have implemented an integrated approach to analyse the overall transcriptomic reprogramming and systems-level defence responses in the model plant species Arabidopsis thaliana (A. thaliana henceforth) during insect Brevicoryne brassicae (B. brassicae henceforth) and bacterial Pseudomonas syringae pv. tomato strain DC3000 (P. syringae henceforth) attacks. The main aim of this study was to identify the attacker-specific and general defence response signatures in A. thaliana when attacked by phloem-feeding aphids or pathogenic bacteria. The obtained annotated networks of differentially expressed transcripts indicated that members of transcription factor families, such as WRKY, MYB, ERF, BHLH and bZIP, could be crucial for stress-specific defence regulation in Arabidopsis during aphid and P. syringae attack. The defence response pathways, signalling pathways and metabolic processes associated with aphid attack and P. syringae infection partially overlapped. Components of several important biosynthesis and signalling pathways, such as salicylic acid (SA), jasmonic acid (JA), ethylene (ET) and glucosinolates, were differentially affected during the two the treatments. Several stress-regulated transcription factors were known to be associated with stress-inducible microRNAs. The differentially regulated gene sets included many signature transcription factors, and our co-expression analysis showed that they were also strongly co-expressed during 69 other biotic stress experiments. Defence responses and functional networks that were unique and specific to aphid or P. syringae stresses were identified. Furthermore, our analysis revealed a probable link between biotic stress and microRNAs in Arabidopsis and

Molecular signatures in Arabidopsis thaliana in response to insect attack and bacterial infection.

Directory of Open Access Journals (Sweden)

Pankaj Barah

Full Text Available BACKGROUND: Under the threat of global climatic change and food shortages, it is essential to take the initiative to obtain a comprehensive understanding of common and specific defence mechanisms existing in plant systems for protection against different types of biotic invaders. We have implemented an integrated approach to analyse the overall transcriptomic reprogramming and systems-level defence responses in the model plant species Arabidopsis thaliana (A. thaliana henceforth during insect Brevicoryne brassicae (B. brassicae henceforth and bacterial Pseudomonas syringae pv. tomato strain DC3000 (P. syringae henceforth attacks. The main aim of this study was to identify the attacker-specific and general defence response signatures in A. thaliana when attacked by phloem-feeding aphids or pathogenic bacteria. RESULTS: The obtained annotated networks of differentially expressed transcripts indicated that members of transcription factor families, such as WRKY, MYB, ERF, BHLH and bZIP, could be crucial for stress-specific defence regulation in Arabidopsis during aphid and P. syringae attack. The defence response pathways, signalling pathways and metabolic processes associated with aphid attack and P. syringae infection partially overlapped. Components of several important biosynthesis and signalling pathways, such as salicylic acid (SA, jasmonic acid (JA, ethylene (ET and glucosinolates, were differentially affected during the two the treatments. Several stress-regulated transcription factors were known to be associated with stress-inducible microRNAs. The differentially regulated gene sets included many signature transcription factors, and our co-expression analysis showed that they were also strongly co-expressed during 69 other biotic stress experiments. CONCLUSIONS: Defence responses and functional networks that were unique and specific to aphid or P. syringae stresses were identified. Furthermore, our analysis revealed a probable link between

Characterization of Pseudomonas pathovars isolated from rosaceous fruit trees in East Algeria.

Science.gov (United States)

Harzallah, D; Sadallah, S; Larous, L

2004-01-01

A survey of bacterial diseases due to Pseudomonas on rosaceous fruit trees was conducted. In forty two orchards located in the Constantine region ( East Algeria). Pseudomonas isolates were identified on the bases of their cultural and biochemical characteristics . A total of fifty nine phytopathogenic bacteria were isolated from diseased pome and stone fruit trees. Thirty one strains comparable to Pseudomonas syringae pv. syringae were isolated from cherry (Prunus avium L.), plum (P. domestica L.), apricot (P. armeniaca L.), almond (P. dulcis L.) and pear trees (Pirus communis L.); sixteen strains comparable to Pseudomonas syringae pv. morsprunorum were obtained from samples of cherry and plum. Twelve strains of Pseudomonas viridiflava were isolated from cherry, apricot and peach (Prunus persica L.).

Interactions of seedborne bacterial pathogens with host and non-host plants in relation to seed infestation and seedling transmission.

Science.gov (United States)

Dutta, Bhabesh; Gitaitis, Ronald; Smith, Samuel; Langston, David

2014-01-01

The ability of seed-borne bacterial pathogens (Acidovorax citrulli, Clavibacter michiganensis subsp. michiganensis, Pseudomonas syringae pv. tomato, Xanthomonas euvesicatoria, and Pseudomonas syringae pv. glycinea) to infest seeds of host and non-host plants (watermelon, tomato, pepper, and soybean) and subsequent pathogen transmission to seedlings was investigated. A non-pathogenic, pigmented strain of Serratia marcescens was also included to assess a null-interacting situation with the same plant species. Flowers of host and non-host plants were inoculated with 1 × 10(6) colony forming units (CFUs)/flower for each bacterial species and allowed to develop into fruits or umbels (in case of onion). Seeds harvested from each host/non-host bacterial species combination were assayed for respective bacteria by plating on semi-selective media. Additionally, seedlots for each host/non-host bacterial species combination were also assayed for pathogen transmission by seedling grow-out (SGO) assays under greenhouse conditions. The mean percentage of seedlots infested with compatible and incompatible pathogens was 31.7 and 30.9% (by plating), respectively and they were not significantly different (P = 0.67). The percentage of seedlots infested with null-interacting bacterial species was 16.8% (by plating) and it was significantly lower than the infested lots generated with compatible and incompatible bacterial pathogens (P = 0.03). None of the seedlots with incompatible/null-interacting bacteria developed symptoms on seedlings; however, when seedlings were assayed for epiphytic bacterial presence, 19.5 and 9.4% of the lots were positive, respectively. These results indicate that the seeds of non-host plants can become infested with incompatible and null-interacting bacterial species through flower colonization and they can be transmitted via epiphytic colonization of seedlings. In addition, it was also observed that flowers and seeds of non-host plants can be colonized by

Interactions of seedborne bacterial pathogens with host and non-host plants in relation to seed infestation and seedling transmission.

Directory of Open Access Journals (Sweden)

Bhabesh Dutta

Full Text Available The ability of seed-borne bacterial pathogens (Acidovorax citrulli, Clavibacter michiganensis subsp. michiganensis, Pseudomonas syringae pv. tomato, Xanthomonas euvesicatoria, and Pseudomonas syringae pv. glycinea to infest seeds of host and non-host plants (watermelon, tomato, pepper, and soybean and subsequent pathogen transmission to seedlings was investigated. A non-pathogenic, pigmented strain of Serratia marcescens was also included to assess a null-interacting situation with the same plant species. Flowers of host and non-host plants were inoculated with 1 × 10(6 colony forming units (CFUs/flower for each bacterial species and allowed to develop into fruits or umbels (in case of onion. Seeds harvested from each host/non-host bacterial species combination were assayed for respective bacteria by plating on semi-selective media. Additionally, seedlots for each host/non-host bacterial species combination were also assayed for pathogen transmission by seedling grow-out (SGO assays under greenhouse conditions. The mean percentage of seedlots infested with compatible and incompatible pathogens was 31.7 and 30.9% (by plating, respectively and they were not significantly different (P = 0.67. The percentage of seedlots infested with null-interacting bacterial species was 16.8% (by plating and it was significantly lower than the infested lots generated with compatible and incompatible bacterial pathogens (P = 0.03. None of the seedlots with incompatible/null-interacting bacteria developed symptoms on seedlings; however, when seedlings were assayed for epiphytic bacterial presence, 19.5 and 9.4% of the lots were positive, respectively. These results indicate that the seeds of non-host plants can become infested with incompatible and null-interacting bacterial species through flower colonization and they can be transmitted via epiphytic colonization of seedlings. In addition, it was also observed that flowers and seeds of non-host plants can be

New strategies for genetic engineering Pseudomonas syringae using recombination

Science.gov (United States)

Here we report that DNA oligonucleotides (oligos) introduced directly into bacteria by electroporation can recombine with the bacterial chromosome. This phenomenon was identified in Pseudomonas syringae and we subsequently found that Escherichia coli, Salmonella typhimurium and Shigella flexneri are...

PHYSICOCHEMICAL AND ANTIBACTERIAL PROPERTIES OF PLA-CHITOSAN BLENDS OBTAINED BY CASTING WITH POTENTIAL USE AS AGRICULTURAL MULCH FILMS

Directory of Open Access Journals (Sweden)

Danila Merino

2016-03-01

Full Text Available PLA-Chitosan films compatibilized with hexamethylenediisocyanate (HDI were obtained by casting and subsequent hot pressing. The films were prepared with different contents of chitosan (CS and then its physicochemical properties were studied by Fourier Transform infrared spectroscopy (FTIR, thermogravimetric analysis (TGA, differential scanning calorimetry (DSC, optical microscopy (OM and X-ray diffraction (XRD. It was found that the compatibilizing agent reacts completely and that chitosan affects the thermal properties of the films decreasing their decomposition temperatures, glass transition temperature (Tg and melting (Tm and increase its crystallinity. From the functional standpoint, antimicrobial properties of each blend were tested against Pseudomonas syringae pv tomato DC-3000. The increase in chitosan content was proportional to the antimicrobial effect allowing project its potential application in the agronomic field.

40 CFR 180.1114 - Pseudomonas fluorescens A506, Pseudomonas fluorescens 1629RS, and Pseudomonas syringae 742RS...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pseudomonas fluorescens A506, Pseudomonas fluorescens 1629RS, and Pseudomonas syringae 742RS; exemptions from the requirement of a tolerance... Tolerances § 180.1114 Pseudomonas fluorescens A506, Pseudomonas fluorescens 1629RS, and Pseudomonas syringae...

Entomopathogenicity to Two Hemipteran Insects Is Common but Variable across Epiphytic Pseudomonas syringae Strains.

Science.gov (United States)

Smee, Melanie R; Baltrus, David A; Hendry, Tory A

2017-01-01

Strains of the well-studied plant pathogen Pseudomonas syringae show large differences in their ability to colonize plants epiphytically and to inflict damage to hosts. Additionally, P. syringae can infect some sap-sucking insects and at least one P. syringae strain is highly virulent to insects, causing death to most individuals within as few as 4 days and growing to high population densities within insect hosts. The likelihood of agricultural pest insects coming into contact with transient populations of P. syringae while feeding on plants is high, yet the ecological implications of these interactions are currently not well understood as virulence has not been tested across a wide range of strains. To investigate virulence differences across strains we exposed the sweet potato whitefly, Bemisia tabaci , and the pea aphid, Acyrthosiphon pisum , both of which are cosmopolitan agricultural pests, to 12 P. syringae strains. We used oral inoculations with bacteria suspended in artificial diet in order to assay virulence while controlling for other variables such as differences in epiphytic growth ability. Generally, patterns of pathogenicity remain consistent across the two species of hemipteran insects, with bacterial strains from phylogroup II, or genomospecies 1, causing the highest rate of mortality with up to 86% of individuals dead after 72 h post infection. The rate of mortality is highly variable across strains, some significantly different from negative control treatments and others showing no discernable difference. Interestingly, one of the most pathogenic strains to both aphids and whiteflies (Cit7) is thought to be non-pathogenic on plants. We also found Cit7 to establish the highest epiphytic population after 48 h on fava beans. Between the nine P. syringae strains tested for epiphytic ability there is also much variation, but epiphytic ability was positively correlated with pathogenicity to insects, suggesting that the two traits may be linked and that

Entomopathogenicity to Two Hemipteran Insects Is Common but Variable across Epiphytic Pseudomonas syringae Strains

Directory of Open Access Journals (Sweden)

Melanie R. Smee

2017-12-01

Full Text Available Strains of the well-studied plant pathogen Pseudomonas syringae show large differences in their ability to colonize plants epiphytically and to inflict damage to hosts. Additionally, P. syringae can infect some sap-sucking insects and at least one P. syringae strain is highly virulent to insects, causing death to most individuals within as few as 4 days and growing to high population densities within insect hosts. The likelihood of agricultural pest insects coming into contact with transient populations of P. syringae while feeding on plants is high, yet the ecological implications of these interactions are currently not well understood as virulence has not been tested across a wide range of strains. To investigate virulence differences across strains we exposed the sweet potato whitefly, Bemisia tabaci, and the pea aphid, Acyrthosiphon pisum, both of which are cosmopolitan agricultural pests, to 12 P. syringae strains. We used oral inoculations with bacteria suspended in artificial diet in order to assay virulence while controlling for other variables such as differences in epiphytic growth ability. Generally, patterns of pathogenicity remain consistent across the two species of hemipteran insects, with bacterial strains from phylogroup II, or genomospecies 1, causing the highest rate of mortality with up to 86% of individuals dead after 72 h post infection. The rate of mortality is highly variable across strains, some significantly different from negative control treatments and others showing no discernable difference. Interestingly, one of the most pathogenic strains to both aphids and whiteflies (Cit7 is thought to be non-pathogenic on plants. We also found Cit7 to establish the highest epiphytic population after 48 h on fava beans. Between the nine P. syringae strains tested for epiphytic ability there is also much variation, but epiphytic ability was positively correlated with pathogenicity to insects, suggesting that the two traits may be

PV and PV/hybrid products for buildings

Energy Technology Data Exchange (ETDEWEB)

Thomas, H. P.; Hayter, S. J.; Martin, R. L., Pierce, L. K.

2000-05-15

Residential, commercial, and industrial buildings combined are the largest consumers of electricity in the United States and represent a significant opportunity for photovoltaic (PV) and PV/hybrid systems. The U.S. Department of Energy (DOE) is conducting a phased research and product development program, Building Opportunities in the United States for Photovoltaics (PV:BONUS), focused on this market sector. The purpose of the program is to develop technologies and foster business arrangements integrating cost-effective PV or hybrid products into buildings. The first phase was completed in 1996 and a second solicitation, PV:BONUS2, was initiated during 1997. These projects are resulting in a variety of building-integrated products. This paper summarizes the recent progress of the seven firms and collaborative teams currently participating in PV:BONUS2 and outlines planned work for the final phase of their work.

DES-TOMATO: A Knowledge Exploration System Focused On Tomato Species

KAUST Repository

Salhi, Adil

2017-07-14

Tomato is the most economically important horticultural crop used as a model to study plant biology and particularly fruit development. Knowledge obtained from tomato research initiated improvements in tomato and, being transferrable to other such economically important crops, has led to a surge of tomato-related research and published literature. We developed DES-TOMATO knowledgebase (KB) for exploration of information related to tomato. Information exploration is enabled through terms from 26 dictionaries and combination of these terms. To illustrate the utility of DES-TOMATO, we provide several examples how one can efficiently use this KB to retrieve known or potentially novel information. DES-TOMATO is free for academic and nonprofit users and can be accessed at http://cbrc.kaust.edu.sa/des_tomato/, using any of the mainstream web browsers, including Firefox, Safari and Chrome.

DES-TOMATO: A Knowledge Exploration System Focused On Tomato Species

KAUST Repository

Salhi, Adil; Negrã o, Só nia; Essack, Magbubah; Morton, Mitchell J. L.; Bougouffa, Salim; Mohamad Razali, Rozaimi; Radovanovic, Aleksandar; Marchand, Benoit; Kulmanov, Maxat; Hoehndorf, Robert; Tester, Mark A.; Bajic, Vladimir B.

2017-01-01

Tomato is the most economically important horticultural crop used as a model to study plant biology and particularly fruit development. Knowledge obtained from tomato research initiated improvements in tomato and, being transferrable to other such economically important crops, has led to a surge of tomato-related research and published literature. We developed DES-TOMATO knowledgebase (KB) for exploration of information related to tomato. Information exploration is enabled through terms from 26 dictionaries and combination of these terms. To illustrate the utility of DES-TOMATO, we provide several examples how one can efficiently use this KB to retrieve known or potentially novel information. DES-TOMATO is free for academic and nonprofit users and can be accessed at http://cbrc.kaust.edu.sa/des_tomato/, using any of the mainstream web browsers, including Firefox, Safari and Chrome.

21 CFR 73.585 - Tomato lycopene extract; tomato lycopene concentrate.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Tomato lycopene extract; tomato lycopene... SERVICES GENERAL LISTING OF COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.585 Tomato lycopene extract; tomato lycopene concentrate. (a) Identity. (1) The color additive tomato lycopene extract is a...

Virulence determinants of Pseudomonas syringae strains isolated from grasses in the context of a small type III effector repertoire

DEFF Research Database (Denmark)

Dudnik, Alexey; Dudler, Robert

2014-01-01

derivative that inhibits the eukaryotic proteasome. In strains colonizing dicotyledonous plants, the compound was demonstrated to suppress the salicylic-acid-dependent defense pathway. Here, we analyze virulence factors of three strains colonizing wheat (Triticum aestivum): P. syringae pathovar syringae (Psy...

Tryptophan-Containing Cyclic Decapeptides with Activity against Plant Pathogenic Bacteria

Directory of Open Access Journals (Sweden)

Cristina Camó

2017-10-01

Full Text Available A library of 66 cyclic decapeptides incorporating a Trp residue was synthesized on solid phase and screened against the phytopathogenic bacteria Pseudomonas syringae pv. syringae, Xanthomonas axonopodis pv. vesicatoria, and Erwinia amylovora. The hemolytic activity of these peptides was also evaluated. The results obtained were compared with those of a collection of Phe analogues previously reported. The analysis of the data showed that the presence of the Trp improved the antibacterial activity against these three pathogens. In particular, 40 to 46 Trp analogues displayed lower minimum inhibitory concentration (MIC values than their corresponding Phe counterparts. Interestingly, 26 Trp-containing sequences exhibited MIC of 0.8 to 3.1 μM against X. axonopodis pv. vesicatoria, 21 peptides MIC of 1.6 to 6.2 μM against P. syringae pv. syringae and six peptides MIC of 6.2 to 12.5 μM against E. amylovora. Regarding the hemolysis, in general, Trp derivatives displayed a percentage of hemolysis comparable to that of their Phe analogues. Notably, 49 Trp-containing cyclic peptides showed a hemolysis ≤ 20% at 125 μM. The peptides with the best biological activity profile were c(LKKKLWKKLQ (BPC086W and c(LKKKKWLLKQ (BPC108W, which displayed MIC values ranging from 0.8 to 12.5 μM and a hemolysis ≤ 8% at 125 μM. Therefore, it is evident that these Trp sequences constitute promising candidates for the development of new agents for use in plant protection.

Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability

DEFF Research Database (Denmark)

Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

2017-01-01

. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact on the overall PV energy cost, due to the increased maintenance for the PV inverters. This paper...... evaluates the lifetime of PV inverters considering the PV array sizing and installation sites, e.g., Denmark and Arizona. The results reveal that the PV array sizing has a considerable impact on the PV inverter lifetime and reliability, especially in Denmark, where the average solar irradiance level...

Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability

OpenAIRE

Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso; Blaabjerg, Frede

2017-01-01

In order to enable a more wide-scale utilization of PV systems, the cost of PV energy has to be comparable with other energy sources. Oversizing the PV array is one common approach to reduce the cost of PV energy, since it increases the PV energy yield during low solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact...

Inhibitory effect of Thymus vulgaris and Origanum vulgare essential oils on virulence factors of phytopathogenic Pseudomonas syringae strains.

Science.gov (United States)

Carezzano, M E; Sotelo, J P; Primo, E; Reinoso, E B; Paletti Rovey, M F; Demo, M S; Giordano, W F; Oliva, M de Las M

2017-07-01

Pseudomonas syringae is a phytopathogenic bacterium that causes lesions in leaves during the colonisation process. The damage is associated with production of many virulence factors, such as biofilm and phytotoxins. The essential oils of Thymus vulgaris (thyme) and Origanum vulgare (oregano) have been demonstrated to inhibit P. syringae. The aim of this study was to investigate the effects of T. vulgaris and O. vulgare essential oils on production of virulence factors of phytopathogenic P. syringae strains, including anti-biofilm and anti-toxins activities. The broth microdilution method was used for determination of MIC and biofilm inhibition assays. Coronatine, syringomycin and tabtoxin were pheno- and genotypically evaluated. Both oils showed good inhibitory activity against P. syringae, with MIC values from 1.43 to 11.5 mg·ml -1 for thyme and 5.8 to 11.6 mg·ml -1 for oregano. Biofilm formation, production of coronatine, syringomycin and tabtoxin were inhibited by thyme and oregano essential oil in most strains. The results presented here are promising, demonstrating the bactericidal activity and reduction of virulence factor production after treatment with thyme and oregano oil, providing insight into how they exert their antibacterial activity. These natural products could be considered in the future for the control of diseases caused by P. syringae. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

The Epl1 and Sm1 proteins from Trichoderma atroviride and Trichoderma virens differentially modulate systemic disease resistance against different life style pathogens in Solanum lycopersicum

Directory of Open Access Journals (Sweden)

Miguel Angel eSalas-Marina

2015-02-01

Full Text Available Fungi belonging to the genus Trichoderma, commonly found in soil or colonizing plant roots, exert beneficial effects on plants, including the promotion of growth and the induction of resistance to disease. T. virens and T. atroviride secrete the proteins Sm1 and Epl1, respectively, which elicit local and systemic disease resistance in plants. In this work, we show that these fungi promote growth in tomato (Solanum lycopersicum plants. T. virens was more effective than T. atroviride in promoting biomass gain, and both fungi were capable of inducing systemic protection in tomato against Alternaria solani, Botrytis cinerea, and Pseudomonas syringae pv. tomato (Pst DC3000. Deletion (KO of epl1 in T. atroviride resulted in diminished systemic protection against A. solani and B. cinerea, whereas the T. virens sm1 KO strain was less effective in protecting tomato against Pst DC3000 and B. cinerea. Importantly, over-expression (OE of epl1 and sm1 led to an increase in disease resistance against all tested pathogens. Although the Trichoderma WT strains induced both systemic acquired resistance (SAR- and induced systemic resistance (ISR-related genes in tomato, inoculation of plants with OE and KO strains revealed that Epl1 and Sm1 play a minor role in the induction of these genes. However, we found that Epl1 and Sm1 induce the expression of a peroxidase and an α-dioxygenase encoding genes, respectively, which could be important for tomato protection by Trichoderma spp. Altogether, these observations indicate that colonization by beneficial and/or infection by pathogenic microorganisms dictates many of the outcomes in plants, which are more complex than previously thought.

PV potential and potential PV rent in European regions

DEFF Research Database (Denmark)

Hansen, Anders Chr.; Thorn, Paul

2013-01-01

The paper provides a GIS based model for assessing the potentials of photovoltaic electricity in Europe by NUTS 2 regions. The location specific energy potential per PV-­‐panel area is estimated based on observations of solar irradiation, conversion efficiency, levelised costs and the social value...... of PV-­‐electricity. Combined with the potential density of PV-­‐panel area based on land cover and environental restrictions, the PV energy potential and the potential PV ressource rent is calculated. These calculations enbable the model to estimate the regional patterns at NUTS 2 level...

One-step Multiplex RT-PCR Method for Simultaneous Detection of Seed Transmissible Bacteria and Viruses in Pepper and Tomato Seeds

Directory of Open Access Journals (Sweden)

Kyusik Jeong

2011-04-01

Full Text Available The aim of this study was to develop specific and sensitive PCR-based procedures for simultaneous detection of economically important plant seed infection pathogenic bacteria and virus, Xanthomonns campestris pv. vesicatoria (Xcv, Clavibacter michiganensis subsp. michiganensis (Cmm, Erwinia carotovora subsp. carotovora (Ecc, Pepper mild mottle virus (PMMoV and Tobacco mild green mosaic virus (TMGMV in pepper and tomato seeds. Most of pepper and tomato bacterial and virus diseases are responsible for germination and growth obstruction. PCR with arbitral primers: selection of specific primers, performance of PCR with specific primers and determination of the threshold level for pathogens detection. To detect simultaneously the Xcv, Cmm, Ecc, PMMoV and TMGMV in pepper and tomato seeds, five pairs (Cmm-F/R, Ecc-F/R, Xcv-F/R, PMMoV-F/R, TMGMV-F/R of specific primer were synthesized by primer-blast program. The multiplex PCR for the five pathogens in pepper and tomato seeds could detect specially without interference among primers and/or cDNA of plant seeds and other plant pathogens. The PCR result for pathogen detection using 20 commercial pepper and 10 tomato seed samples, Ecc was detected from 4 pepper and 2 tomato seed samples, PMMoV was detected from 1 pepper seed sample, and PMMoV and TMGMV were simultaneously detected from 1 pepper seed sample.

Characterisation of bacterial brown spot pathogen from dry bean ...

African Journals Online (AJOL)

Pseudomonas syringae pv. syringae (Pss) causes bacterial brown spot (BBS) of beans (Phaseolus vulgaris L.), with yield losses of up to 55% in South Africa. Pss has a wide host range and for many of these, the pathogen has been biochemically and genetically characterised. However, few studies have been conducted on ...

Tomato contact dermatitis

DEFF Research Database (Denmark)

Paulsen, Evy; Christensen, Lars P; Andersen, Klaus Ejner

2012-01-01

The tomato plant (Solanum lycopersicum) is an important crop worldwide. Whereas immediate-type reactions to tomato fruits are well known, contact dermatitis caused by tomatoes or tomato plants is rarely reported. The aims of this study were to present new data on contact sensitization to tomato...... plants and review the literature on contact dermatitis caused by both plants and fruits. An ether extract of tomato plants made as the original oleoresin plant extracts, was used in aimed patch testing, and between 2005 and 2011. 8 of 93 patients (9%) tested positive to the oleoresin extracts....... This prevalence is in accordance with the older literature that reports tomato plants as occasional sensitizers. The same applies to tomato fruits, which, in addition, may cause protein contact dermatitis. The allergens of the plant are unknown, but both heat-stable and heat-labile constituents seem...

Contribution of alginate and levan production to biofilm formation by Pseudomonas syringae

DEFF Research Database (Denmark)

Laue, H.; Schenk, A.; Li, H.

2006-01-01

formation, biofilms of Pseudomonas syringae strains with different EPS patterns were compared. The mucoid strain PG4180.muc, which produces levan and alginate, and its levan- and/or alginate-deficient derivatives all formed biofilms in the wells of microtitre plates and in flow chambers. Confocal laser...... by binding of the lectin from Naja mossambica to a fibrous structure in biofilms of all P. syringae derivatives. Production of the as yet uncharacterized additional EPS might be more important for biofilm formation than the syntheses of levan and alginate.......Exopolysaccharides (EPSs) play important roles in the attachment of bacterial cells to a surface and/or in building and maintaining the three-dimensional, complex structure of bacterial biofilms. To elucidate the spatial distribution and function of the EPSs levan and alginate during biofilm...

Interband cascade (IC) photovoltaic (PV) architecture for PV devices

Science.gov (United States)

Yang, Rui Q.; Tian, Zhaobing; Mishima, Tetsuya D.; Santos, Michael B.; Johnson, Matthew B.; Klem, John F.

2015-10-20

A photovoltaic (PV) device, comprising a PV interband cascade (IC) stage, wherein the IC PV stage comprises an absorption region with a band gap, the absorption region configured to absorb photons, an intraband transport region configured to act as a hole barrier, and an interband tunneling region configured to act as an electron barrier. An IC PV architecture for a photovoltaic device, the IC PV architecture comprising an absorption region, an intraband transport region coupled to the absorption region, and an interband tunneling region coupled to the intraband transport region and to the adjacent absorption region, wherein the absorption region, the intraband transport region, and the interband tunneling region are positioned such that electrons will flow from the absorption region to the intraband transport region to the interband tunneling region.

An Analysis of Open World PvP in LOTRO's PvMP as a Case Study for PvP Games

Directory of Open Access Journals (Sweden)

Toh Weimin

2014-11-01

Full Text Available This article focuses on the analysis of emergent gameplay, based on a case study of the author's subjective gameplay experience of Player versus Monster Player (PvMP in The Lord of the Rings Online (LOTRO. The argument presented here is that although there is a core system of Player versus Player (PvP which LOTRO shares with other online games, each type of online game has a specific kind of PvP system which attracts players to engage in the gameplay. For instance, the open world sandbox type of PvP attracts certain players to play in LOTRO's PvMP. One of the main aims of this study is thus to investigate some of the core systems of PvP gameplay in open world sandbox PvP. In this article, LOTRO is shown to offer unique opportunities for studying emergent gameplay in open world games, with particular relevance to PvP studies. Two of the core systems of PvP discussed include the design of the simple gameplay rules to support emergent gameplay, and the community's attitudes towards player's behaviours. The types of emergent gameplay discussed include free play versus negotiated fair play, the players' utilisation of strategies in open world PvP to support collaborative and competitive gameplay, and the changing dynamics of open ended gameplay. It is hoped that the analysis provided in this article would form the­ basis of future work on a more general framework for understanding PvP in other online games.

The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity

KAUST Repository

Abulfaraj, Aala A.; Mariappan, Kiruthiga; Bigeard, Jean; Manickam, Prabhu; Blilou, Ikram; Guo, Xiujie; Al-Babili, Salim; Pflieger, Delphine; Hirt, Heribert; Rayapuram, Naganand

2018-01-01

Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.

The Arabidopsis homolog of human G3BP1 is a key regulator of stomatal and apoplastic immunity

KAUST Repository

Abulfaraj, Aala Abdulaziz Hussien

2018-05-31

Mammalian Ras-GTPase–activating protein SH3-domain–binding proteins (G3BPs) are a highly conserved family of RNA-binding proteins that link kinase receptor-mediated signaling to RNA metabolism. Mammalian G3BP1 is a multifunctional protein that functions in viral immunity. Here, we show that the Arabidopsis thaliana homolog of human G3BP1 negatively regulates plant immunity. Arabidopsis g3bp1 mutants showed enhanced resistance to the virulent bacterial pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated in Atg3bp1 mutants by altered stomatal and apoplastic immunity. Atg3bp1 mutants restricted pathogen entry into stomates showing insensitivity to bacterial coronatine–mediated stomatal reopening. AtG3BP1 was identified as a negative regulator of defense responses, which correlated with moderate up-regulation of salicylic acid biosynthesis and signaling without growth penalty.

Fire resistant PV shingle assembly

Science.gov (United States)

Lenox, Carl J.

2012-10-02

A fire resistant PV shingle assembly includes a PV assembly, including PV body, a fire shield and a connection member connecting the fire shield below the PV body, and a support and inter-engagement assembly. The support and inter-engagement assembly is mounted to the PV assembly and comprises a vertical support element, supporting the PV assembly above a support surface, an upper interlock element, positioned towards the upper PV edge, and a lower interlock element, positioned towards the lower PV edge. The upper interlock element of one PV shingle assembly is inter-engageable with the lower interlock element of an adjacent PV shingle assembly. In some embodiments the PV shingle assembly may comprise a ventilation path below the PV body. The PV body may be slidably mounted to the connection member to facilitate removal of the PV body.

PV/T slates - Laboratory measurements; PV/T-Schiefer. Labormessungen

Energy Technology Data Exchange (ETDEWEB)

Kropf, S.

2003-07-01

This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with an experimental outdoor set-up and reviews in-situ measurements made on a prototype of a ventilated PV-tile system (PV/T-Slates). The report describes the configuration and construction of the experimental PV-tiled roof and the measurement system used to measure its electrical and thermal performance. The results of the measurements made are presented in detail in graphical form. The influence of various factors such as air-slit width and mounting angle are discussed.

Studies on the O-specific polysaccharide of the lipopolysaccharide from the Pseudomonas mediterranea strain C5P1rad1, a bacterium pathogenic of tomato and chrysanthemum.

Science.gov (United States)

Zdorovenko, Evelina L; Cimmino, Alessio; Marchi, Guido; Shashkov, Alexander S; Fiori, Mario; Knirel, Yuriy A; Evidente, Antonio

2017-08-07

An O-specific polysaccharide (OPS) was isolated from the lipopolysaccharide of Pseudomonas mediterranea strain C5P1rad1, the causal agents of tomato pith necrosis and Chrysanthemum stem rot, and studied by one- and two-dimensional 1 H and 13 C NMR spectroscopy. The following structure of the trisaccharide repeating unit of the OPS was established, which, to our knowledge, is unique among the known bacterial polysaccharide structures: →4)-β-d-ManpNAc3NAcA-(1 → 4)-β-d-ManpNAc3NAcA-(1 → 3)-α-d-QuipNAc4NAc-(1→ where QuiNAc4NAc and ManNAc3NAcA indicate 2,4-diacetamido-2,4,6-trideoxyglucose and 2,3-diacetamido-2,3-dideoxymannuronic acid, respectively. Pre-treatment of leaves with LPS or OPS preparations at 250 and 50 μg mL -1 did not inhibit development of a hypersensitivity reaction induced by P. mediterranea C5P1rad1 on tobacco, tomato and chrysanthemum plants. The same preparations at 250 μg mL -1 partially prevented elicitation of the hypersensitivity reaction by Pseudomonas syringae KVPT7RC on chrysanthemum but not tobacco and tomato. Copyright © 2017. Published by Elsevier Ltd.

Plasmodium vivax Tryptophan Rich Antigen PvTRAg36.6 Interacts with PvETRAMP and PvTRAg56.6 Interacts with PvMSP7 during Erythrocytic Stages of the Parasite.

Directory of Open Access Journals (Sweden)

Kriti Tyagi

Full Text Available Plasmodium vivax is most wide spread and a neglected malaria parasite. There is a lack of information on parasite biology of this species. Genome of this parasite encodes for the largest number of tryptophan-rich proteins belonging to 'Pv-fam-a' family and some of them are potential drug/vaccine targets but their functional role(s largely remains unexplored. Using bacterial and yeast two hybrid systems, we have identified the interacting partners for two of the P. vivax tryptophan-rich antigens called PvTRAg36.6 and PvTRAg56.2. The PvTRAg36.6 interacts with early transcribed membrane protein (ETRAMP of P.vivax. It is apically localized in merozoites but in early stages it is seen in parasite periphery suggesting its likely involvement in parasitophorous vacuole membrane (PVM development or maintenance. On the other hand, PvTRAg56.2 interacts with P.vivax merozoite surface protein7 (PvMSP7 and is localized on merozoite surface. Co-localization of PvTRAg56.2 with PvMSP1 and its molecular interaction with PvMSP7 probably suggest that, PvTRAg56.2 is part of MSP-complex, and might assist or stabilize the protein complex at the merozoite surface. In conclusion, the PvTRAg proteins have different sub cellular localizations and specific associated functions during intra-erythrocytic developmental cycle.

Plasmodium vivax Tryptophan Rich Antigen PvTRAg36.6 Interacts with PvETRAMP and PvTRAg56.6 Interacts with PvMSP7 during Erythrocytic Stages of the Parasite

Science.gov (United States)

Tyagi, Kriti; Hossain, Mohammad Enayet; Thakur, Vandana; Aggarwal, Praveen; Malhotra, Pawan; Mohmmed, Asif; Sharma, Yagya Dutta

2016-01-01

Plasmodium vivax is most wide spread and a neglected malaria parasite. There is a lack of information on parasite biology of this species. Genome of this parasite encodes for the largest number of tryptophan-rich proteins belonging to ‘Pv-fam-a’ family and some of them are potential drug/vaccine targets but their functional role(s) largely remains unexplored. Using bacterial and yeast two hybrid systems, we have identified the interacting partners for two of the P. vivax tryptophan-rich antigens called PvTRAg36.6 and PvTRAg56.2. The PvTRAg36.6 interacts with early transcribed membrane protein (ETRAMP) of P.vivax. It is apically localized in merozoites but in early stages it is seen in parasite periphery suggesting its likely involvement in parasitophorous vacuole membrane (PVM) development or maintenance. On the other hand, PvTRAg56.2 interacts with P.vivax merozoite surface protein7 (PvMSP7) and is localized on merozoite surface. Co-localization of PvTRAg56.2 with PvMSP1 and its molecular interaction with PvMSP7 probably suggest that, PvTRAg56.2 is part of MSP-complex, and might assist or stabilize the protein complex at the merozoite surface. In conclusion, the PvTRAg proteins have different sub cellular localizations and specific associated functions during intra-erythrocytic developmental cycle. PMID:26954579

The PV market

International Nuclear Information System (INIS)

Hammond, B.

1992-01-01

This paper forecasts the photovoltaic (PV) market growth for the 1990s. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market however is highly dependent on a number of market factors such as the cost of conventional energy the cost of PV systems utility acceptance of PV and regulatory controls. Government and institutional regulations, environmental issues, and OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer stand-alone and utility markets

Philadelphia and the Tomato.

Science.gov (United States)

Smith, Andrew F.; Kling, Tatiana

This booklet describes for elementary students the many contributions of people, traveling many places, over many years to bring the tomato to Philadelphia. The booklet includes the following: (1) "Introduction to the Tomato"; (2) "Where Does the Tomato Come From?"; (3) "The Spanish Tomato"; (4) "The Philadelphia…

Features of air masses associated with the deposition of Pseudomonas syringae and Botrytis cinerea by rain and snowfall.

Science.gov (United States)

Monteil, Caroline L; Bardin, Marc; Morris, Cindy E

2014-11-01

Clarifying the role of precipitation in microbial dissemination is essential for elucidating the processes involved in disease emergence and spread. The ecology of Pseudomonas syringae and its presence throughout the water cycle makes it an excellent model to address this issue. In this study, 90 samples of freshly fallen rain and snow collected from 2005-2011 in France were analyzed for microbiological composition. The conditions favorable for dissemination of P. syringae by this precipitation were investigated by (i) estimating the physical properties and backward trajectories of the air masses associated with each precipitation event and by (ii) characterizing precipitation chemistry, and genetic and phenotypic structures of populations. A parallel study with the fungus Botrytis cinerea was also performed for comparison. Results showed that (i) the relationship of P. syringae to precipitation as a dissemination vector is not the same for snowfall and rainfall, whereas it is the same for B. cinerea and (ii) the occurrence of P. syringae in precipitation can be linked to electrical conductivity and pH of water, the trajectory of the air mass associated with the precipitation and certain physical conditions of the air mass (i.e. temperature, solar radiation exposure, distance traveled), whereas these predictions are different for B. cinerea. These results are pertinent to understanding microbial survival, emission sources and atmospheric processes and how they influence microbial dissemination.

Kinome profiling of Arabidopsis using arrays of kinase consensus substrates

Directory of Open Access Journals (Sweden)

Pieterse Corné MJ

2007-02-01

Full Text Available Abstract Background Kinome profiling aims at the parallel analysis of kinase activities in a cell. Novel developed arrays containing consensus substrates for kinases are used to assess those kinase activities. The arrays described in this paper were already used to determine kinase activities in mammalian systems, but since substrates from many organisms are present we decided to test these arrays for the determination of kinase activities in the model plant species Arabidopsis thaliana. Results Kinome profiling using Arabidopsis cell extracts resulted in the labelling of many consensus peptides by kinases from the plant, indicating the usefulness of this kinome profiling tool for plants. Method development showed that fresh and frozen plant material could be used to make cell lysates containing active kinases. Dilution of the plant extract increased the signal to noise ratio and non-radioactive ATP enhances full development of spot intensities. Upon infection of Arabidopsis with an avirulent strain of the bacterial pathogen Pseudomonas syringae pv. tomato, we could detect differential kinase activities by measuring phosphorylation of consensus peptides. Conclusion We show that kinome profiling on arrays with consensus substrates can be used to monitor kinase activities in plants. In a case study we show that upon infection with avirulent P. syringae differential kinase activities can be found. The PepChip can for example be used to purify (unknown kinases that play a role in P. syringae infection. This paper shows that kinome profiling using arrays of consensus peptides is a valuable new tool to study signal-transduction in plants. It complements the available methods for genomics and proteomics research.

COMPARISON OF CAROTENOID CONTENT IN TOMATO, TOMATO PULP AND KETCHUP BY LIQUID CHROMATOGRAPHY

Directory of Open Access Journals (Sweden)

J. J. T. GAMA

2009-01-01

Full Text Available

Although tomatoes are commonly consumed fresh, over 80 % the consumption of tomatoes is in the form of processed products such as tomato pulp, ketchup, juice and sauce. Research has indicated the potential health benefits of a diet rich in tomatoes and tomato products. The present study was carried out to determine the carotenoid content of fresh tomato, tomato pulp and ketchup by high performance liquid chromatography. The major differences among these products were in the concentration of some of the pigments. Tomato had all-trans-lycopene (1046-1099 μg/g DW, cislycopene (125-132 μg/g DW and all-trans- -carotene (45-59 μg/g DW as principal carotenoids. Tomato pulp and ketchup had all-trans-lycopene (951-999 μg/g DW and 455-476 μg/g DW, all-trans- -carotene (76-88 DW μg/g and 20-27 DW μg/g and cis-lycopene (71-83 μg/g DW and 14-25 μg/g DW as the main pigments, respectively. They also contained other carotenoids in much smaller amounts (lycoxanthin, zeaxanthin, anteraxanthin, lutein, -carotene, -carotene and phytofluene.

Dynamic Evolution of Pathogenicity Revealed by Sequencing and Comparative Genomics of 19 Pseudomonas syringae Isolates

Science.gov (United States)

Romanchuk, Artur; Chang, Jeff H.; Mukhtar, M. Shahid; Cherkis, Karen; Roach, Jeff; Grant, Sarah R.; Jones, Corbin D.; Dangl, Jeffery L.

2011-01-01

Closely related pathogens may differ dramatically in host range, but the molecular, genetic, and evolutionary basis for these differences remains unclear. In many Gram- negative bacteria, including the phytopathogen Pseudomonas syringae, type III effectors (TTEs) are essential for pathogenicity, instrumental in structuring host range, and exhibit wide diversity between strains. To capture the dynamic nature of virulence gene repertoires across P. syringae, we screened 11 diverse strains for novel TTE families and coupled this nearly saturating screen with the sequencing and assembly of 14 phylogenetically diverse isolates from a broad collection of diseased host plants. TTE repertoires vary dramatically in size and content across all P. syringae clades; surprisingly few TTEs are conserved and present in all strains. Those that are likely provide basal requirements for pathogenicity. We demonstrate that functional divergence within one conserved locus, hopM1, leads to dramatic differences in pathogenicity, and we demonstrate that phylogenetics-informed mutagenesis can be used to identify functionally critical residues of TTEs. The dynamism of the TTE repertoire is mirrored by diversity in pathways affecting the synthesis of secreted phytotoxins, highlighting the likely role of both types of virulence factors in determination of host range. We used these 14 draft genome sequences, plus five additional genome sequences previously reported, to identify the core genome for P. syringae and we compared this core to that of two closely related non-pathogenic pseudomonad species. These data revealed the recent acquisition of a 1 Mb megaplasmid by a sub-clade of cucumber pathogens. This megaplasmid encodes a type IV secretion system and a diverse set of unknown proteins, which dramatically increases both the genomic content of these strains and the pan-genome of the species. PMID:21799664

Building brighter PV business

International Nuclear Information System (INIS)

Hacker, R.

2002-01-01

The current status and future prospects of the UK market for solar photovoltaic (PV) electricity are briefly discussed. Through the Department of Trade and Industry (DTI), the UK Government has supported research and development (R and D) into PV for a number of years. This programme has now been extended to demonstrating PV systems on houses. Phase 2 - the domestic field trial programme - aims to monitor the performance of individual systems and the impact on a cluster of systems on the electricity network. New funding had allowed a trebling of the size of this programme, which involves both private developers and housing associations. The DTI is also working to promote PV on commercial buildings, eg the installation of BP Solar PV systems at BP petrol stations. The PV industry in the UK is technically strong and is working to overcome the barriers in the UK to greater uptake of the technology (including cost, conservatism, legal requirements and metering practices). Improvements are expected in a number of recent initiatives in the electricity industry to boost PV use and the PV industry is lobbying for PV to be included in the Enhanced Capital Allowances (ECA) scheme

The life history of Pseudomonas syringae: linking agriculture to earth system processes.

Science.gov (United States)

Morris, Cindy E; Monteil, Caroline L; Berge, Odile

2013-01-01

The description of the ecology of Pseudomonas syringae is moving away from that of a ubiquitous epiphytic plant pathogen to one of a multifaceted bacterium sans frontières in fresh water and other ecosystems linked to the water cycle. Discovery of the aquatic facet of its ecology has led to a vision of its life history that integrates spatial and temporal scales spanning billions of years and traversing catchment basins, continents, and the planet and that confronts the implication of roles that are potentially conflicting for agriculture (as a plant pathogen and as an actor in processes leading to rain and snowfall). This new ecological perspective has also yielded insight into epidemiological phenomena linked to disease emergence. Overall, it sets the stage for the integration of more comprehensive contexts of ecology and evolutionary history into comparative genomic analyses to elucidate how P. syringae subverts the attack and defense responses of the cohabitants of the diverse environments it occupies.

CBL-interacting protein kinase 6 negatively regulates immune response to Pseudomonas syringae in Arabidopsis.

Science.gov (United States)

Sardar, Atish; Nandi, Ashis Kumar; Chattopadhyay, Debasis

2017-06-15

Cytosolic calcium ion (Ca2+) is an essential mediator of the plant innate immune response. Here, we report that a calcium-regulated protein kinase Calcineurin B-like protein (CBL)-interacting protein kinase 6 (CIPK6) functions as a negative regulator of immunity against the bacterial pathogen Pseudomonas syringae in Arabidopsis thaliana. Arabidopsis lines with compromised expression of CIPK6 exhibited enhanced disease resistance to the bacterial pathogen and to P. syringae harboring certain but not all avirulent effectors, while restoration of CIPK6 expression resulted in abolition of resistance. Plants overexpressing CIPK6 were more susceptible to P. syringae. Enhanced resistance in the absence of CIPK6 was accompanied by increased accumulation of salicylic acid and elevated expression of defense marker genes. Salicylic acid accumulation was essential for improved immunity in the absence of CIPK6. CIPK6 negatively regulated the oxidative burst associated with perception of pathogen-associated microbial patterns (PAMPs) and bacterial effectors. Accelerated and enhanced activation of the mitogen-activated protein kinase cascade in response to bacterial and fungal elicitors was observed in the absence of CIPK6. The results of this study suggested that CIPK6 negatively regulates effector-triggered and PAMP-triggered immunity in Arabidopsis. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Building opportunities in the U.S. for PV (PV:BONUS): A progress report

International Nuclear Information System (INIS)

Taylor, R.W.

1994-01-01

Five contract teams are developing photovoltaic (PV) products that will have a significant impact on building-integrated PV systems. The product lines that these teams are pursuing include roofing materials, building facade materials, PV integrated into modular homes, ac-PV modules, and utility-dispatchable PV systems. The objective of these efforts is to develop product and market opportunities that can provide for the introduction of PV into the buildings market sector at higher allowable installed systems costs than conventional ground- or roof-mounted systems. Each of the teams has a unique approach, and synergistic opportunities among teams are beginning to emerge. This paper reviews the product and market development efforts of these teams and describes the links between the product efforts and parallel analytical work to develop PV as a demand-side management option

Biosynthesis and regulation of coronatine, a non-host-specific phytotoxin produced by Pseudomonas syringae.

Science.gov (United States)

Bender, C L; Palmer, D A; Peñaloza-Vázquez, A; Rangaswamy, V; Ullrich, M

1998-01-01

Many P. syringae pathovars are known to produce low-molecular-weight, diffusible toxins in infected host plants. These phytotoxins reproduce some of the symptoms of the relevant bacterial disease and are effective at very low concentrations. Phytotoxins generally enhance the virulence of the P. syringae pathovar which produces them, but are not required for pathogenesis. Genes encoding phytotoxin production have been identified and cloned from several P. syringae pathovars. With the exception of coronatine, toxin biosynthetic gene clusters are generally chromosomally encoded. In several pathovars, the toxin biosynthetic gene cluster also contains a resistance gene which functions to protect the producing strain from the biocidal effects of the toxin. In the case of phaseolotoxin, a resistance gene (argK) has been utilized to engineer phaseolotoxin-resistant tobacco plants. Although P. syringae phytotoxins can induce very similar effects in plants (chlorosis and necrosis), their biosynthesis and mode of action can be quite different. Knowledge of the biosynthetic pathways to these toxins and the cloning of the structural genes for their biosynthesis has relevance to the development of new bioactive compounds with altered specificity. For example, polyketides constitute a huge family of structurally diverse natural products including antibiotics, chemotherapeutic compounds, and antiparasitics. Most of the research on polyketide synthesis in bacteria has focused on compounds synthesized by Streptomyces or other actinomycetes. It is also important to note that it is now possible to utilize a genetic rather than synthetic approach to biosynthesize novel polyketides with altered biological properties (Hutchinson and Fujii, 1995; Kao et al., 1994; Donadio et al., 1993; Katz and Donadio, 1993). Most of the reprogramming or engineering of novel polyketides has been done using actinomycete PKSs, but much of this technology could also be applied to polyketides synthesized by

Disruption of the ammonium transporter AMT1.1 alters basal defences generating resistance against Pseudomonas syringae and Plectosphaerella cucumerina

Directory of Open Access Journals (Sweden)

Victoria ePastor

2014-05-01

Full Text Available Disruption of the high-affinity nitrate transporter NRT2.1 activates the priming defence against Pseudomonas syringae, resulting in enhanced resistance. In this study, it is demonstrated that the high-affinity ammonium transporter AMT1.1 is a negative regulator of Arabidopsis defence responses. The T-DNA knockout mutant amt1.1 displays enhanced resistance against Plectosphaerella cucumerina and reduced susceptibility to P. syringae. The impairment of AMT1.1 induces significant metabolic changes in the absence of challenge, suggesting that amt1.1 retains constitutive defence responses. Interestingly, amt1.1 combats pathogens differently depending on the lifestyle of the pathogen. In addition, N starvation enhances the susceptibility of wild type plants and the mutant amt1.1 to P. syringae whereas it has no effect on P. cucumerina resistance. The metabolic changes of amt1.1 against P. syringae are subtler and are restricted to the phenylpropanoid pathway, which correlates with its reduced susceptibility. By contrast, the amt1.1 mutant responds by activating higher levels of camalexin and callose against P. cucumerina. In addition, amt1.1 shows altered levels of aliphatic and indolic glucosinolates and other Trp-related compounds following infection by the necrotroph. These observations indicate that AMT1.1 may play additional roles that affect N uptake and plant immune responses.

A highly active endo-levanase BT1760 of a dominant mammalian gut commensal Bacteroides thetaiotaomicron cleaves not only various bacterial levans, but also levan of timothy grass

DEFF Research Database (Denmark)

Mardo, Karin; Visnapuu, Triinu; Vija, Heiki

2017-01-01

of Pseudomonas syringae pv. tomato, its mutant Asp300Asn, levansucrases of Zymomonas mobilis, Erwinia herbicola, Halomonas smyrnensis as well as on levan isolated from timothy grass. For the first time a plant levan is shown as a perfect substrate for an endo-fructanase of a human gut bacterium. BT1760 degraded...... levans to FOS with degree of polymerization from 2 to 13. At optimal reaction conditions up to 1 g of FOS were produced per 1 mg of BT1760 protein. Low molecular weight (grass levan and levan synthesized from sucrose by the Lsc3Asp300Asn, were degraded most rapidly...... whilst levan produced by Lsc3 from raffinose least rapidly. BT1760 catalyzed finely at human body temperature (37°C) and in moderately acidic environment (pH 5-6) that is typical for the gut lumen. According to differential scanning fluorimetry, the Tm of the endo-levanase was 51.5°C. All tested levans...

Antagonism between phytohormone signalling underlies the variation in disease susceptibility of tomato plants under elevated CO2

Science.gov (United States)

Zhang, Shuai; Li, Xin; Sun, Zenghui; Shao, Shujun; Hu, Lingfei; Ye, Meng; Zhou, Yanhong; Xia, Xiaojian; Yu, Jingquan; Shi, Kai

2015-01-01

Increasing CO2 concentrations ([CO2]) have the potential to disrupt plant–pathogen interactions in natural and agricultural ecosystems, but the research in this area has often produced conflicting results. Variations in phytohormone salicylic acid (SA) and jasmonic acid (JA) signalling could be associated with variations in the responses of pathogens to plants grown under elevated [CO2]. In this study, interactions between tomato plants and three pathogens with different infection strategies were compared. Elevated [CO2] generally favoured SA biosynthesis and signalling but repressed the JA pathway. The exposure of plants to elevated [CO2] revealed a lower incidence and severity of disease caused by tobacco mosaic virus (TMV) and by Pseudomonas syringae, whereas plant susceptibility to necrotrophic Botrytis cinerea increased. The elevated [CO2]-induced and basal resistance to TMV and P. syringae were completely abolished in plants in which the SA signalling pathway nonexpressor of pathogenesis-related genes 1 (NPR1) had been silenced or in transgenic plants defective in SA biosynthesis. In contrast, under both ambient and elevated [CO2], the susceptibility to B. cinerea highly increased in plants in which the JA signalling pathway proteinase inhibitors (PI) gene had been silenced or in a mutant affected in JA biosynthesis. However, plants affected in SA signalling remained less susceptible to this disease. These findings highlight the modulated antagonistic relationship between SA and JA that contributes to the variation in disease susceptibility under elevated [CO2]. This information will be critical for investigating how elevated CO2 may affect plant defence and the dynamics between plants and pathogens in both agricultural and natural ecosystems. PMID:25657213

SH1 leaf rust and bacterial halo blight coffee resistances are genetically independent

Directory of Open Access Journals (Sweden)

Lucas Mateus Rivero Rodrigues

Full Text Available ABSTRACT Coffee resistance to Pseudomonas syringae pv. garcae has been associated to pleiotropic effect of SH1 allele, present in coffee plants resistant to certain races of Hemileia vastatrix, the causal agent of leaf rust, or genetic linkage between resistance alleles to both pathogens. To validate this hypothesis, 63 coffee plants in F2 generation were evaluated for resistance to 2 isolates of H. vastatrix carriers of alleles, respectively, v2, v5 (isolate I/2015 and v1; v2; v5 (isolate II/2015 with the objective to confirm presence of SH1 allele in resistant plants to isolate I/2015. The same coffee plants were evaluated for resistance to a mixture of P. syringae pv. garcae strains highly pathogenic to coffee. Results showed that, among F2 coffee allele SH1 carriers, resistant to isolate I/2015, resistant and susceptible plants to bacterial halo blight were found; the same segregation occurs between F2 homozygous for SH1 allele, susceptible to the same isolate (I/2015 of H. vastatrix. Results also indicate that there is no pleiotropic effect of gene or allele SH1 connection between genes conferring resistance to leaf rust caused by H. vastatrix and bacterial halo blight caused by P. syringae pv. garcae.

PV ready roofing systems

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

The integration of PV technology into roofs of houses has become very popular in the United States, Japan, Germany and The Netherlands. There could be a considerable market in the UK for these systems, given the large number of houses that are projected to be built in the next 10 years, and taking account of increased awareness of energy issues. A significant proportion of the market share of annual installed PV is for solar PV systems installed into homes (currently 15%), this is expected to rise to 23% (900MW) by 2010. The grid connected roof and building mounted facade systems represent the fastest growing market for PV systems in Europe. In conclusion, therefore, innovative approached for fixing PV technology onto roofs have been identified for both domestic roofs and for the commercial sector. With reference to production methodologies within the roofing industry, both approaches should be capable of being designed with PV-ready connections suitable for fixing PV modules at a later date. This will help overcome the key barriers of cost of installation, skills required and the lack of retrofit potential. Based on the results of this project, Sustainable Energy together with PV Systems are keen to take forward the full research and development of PV-ready systems for both the domestic and commercial sectors.

Sensorless PV Array Diagnostic Method for Residential PV Systems

DEFF Research Database (Denmark)

Sera, Dezso; Spataru, Sergiu; Mathe, Laszlo

2011-01-01

This work proposes a temperature and irradiance sensorless diagnostic method suitable for small residential PV installations, focusing on detection of partial shadows. The method works by detection of failures in crystalline silicone PV arrays by concomitant monitoring of some of their key...

City and County Solar PV Training Program, Module 2: Screening and Identifying PV Projects

Energy Technology Data Exchange (ETDEWEB)

Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2018-04-09

When screening and identifying PV projects, cities and counties should understand the different factors that impact the technical and economic potential of a PV project, the steps of the PV screening process, and how to use REopt Lite to screen a site for PV and storage project potential.

Gama de hospedeiros e reação de genótipos de tomateiro a Pseudomonas cichorii Host range and genotypes reaction to Pseudomonas cichorii

Directory of Open Access Journals (Sweden)

Tadeu Antônio Fernandes da Silva Júnior

2009-06-01

Full Text Available Em 2005, foi constatada em dois campos comerciais de tomate no Estado de São Paulo, a ocorrência da queima bacteriana, causada por Pseudomonas cichorii. Em vista disso, foram desenvolvidos estudos visando a determinação da gama de hospedeiros de isolados de Pseudomonas cichorii (IBSBF 2309 e IBSBF 2323, obtidos de tomateiro, provenientes de campos comerciais localizados nos municípios de Bragança Paulista e Mogi Guaçú, SP. Plantas de abobrinha, alface, beldroega, berinjela, beterraba, cenoura, couvebrócolo, datura, fumo, girassol, jiló, melão, pepino, petúnia, pimentão, rabanete, repolho, rúcula, salsa e tomateiro foram inoculadas por pulverização, separadamente, com os dois isolados de P. cichorii de tomateiro e um isolado de girassol (GIR-1. Os isolados IBSBF 2309 e IBSBF 2323 foram patogênicos à beldroega, datura, girassol, pimentão e tomate; GIR-1 foi patogênico apenas à beldroega, datura e girassol, não sendo patogênico ao pimentão e ao tomateiro. No Brasil não se conhecem fontes de resistência dentro do gênero Lycopersicon ou a reação de cultivares de tomateiros a esta bactéria. Vinte e oito genótipos de tomateiro provenientes do Banco de Germoplasma da empresa Sakata Seed Sudamerica Ltda., foram avaliados quanto a reação aos isolados IBSBF 2309 e IBSBF 2323 de P. cichorii, pelo método de inoculação nas folhas. Os maiores níveis de resistência foram observados em AF 11768, AF 2521, AF 11766, AF 11772, AF 229, AF 5719-1 e AF 8162. O genótipo AF 5719-1, que possui o gene Pto, que confere resistência a P. syringae pv. tomato, apresentou um bom nível de resistência a P. cichorii. A identificação de genótipos que apresentem bons níveis de resistência a este patógeno é importante para utilização em programas de melhoramento genético do tomateiro, visando a incorporação de genes de resistência a P. cichorii.The occurrence of the bacterial blight, caused by Pseudomonas cichorii, was observed

Syringa oblata Lindl var. alba as a source of oleuropein and related compounds

NARCIS (Netherlands)

Nenadis, N.; Vervoort, J.J.M.; Boeren, J.A.; Tsimidou, M.Z.

2007-01-01

The leaf methanol extract of Syringa oblata Lindl var. alba was investigated as a source of oleuropein and related compounds. The extract had a high total phenol content and a radical scavenging activity similar to that of the respective extract from Olea europaea leaves. HPLC-DAD characterisation

PV power plants

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-07-01

Within the international seminar of the Ostbayerisches Technologie-Transfer-Institut e.V. (OTTI) at 11th June, 2012 in Munich (Federal Republic of Germany), the following lectures were held: (1) Technical due diligence (Dietmar Obst); (2) Certification / rating system for large PV plants (Robert Pfatischer); (3) O and M requirements (Lars Rulf); (4) IR photography for large scale systems (Bernhard Weinreich); (5) New market models for PV systems - direct marketing and sales of PV electricity (Martin Schneider); (6) Needs and benefits for plant certification for grid connection and operation (Christoph Luetke-Lengerich); (7) Lare volume module testing / Screening in the field and workshop (Semir Merzoug); (8) Dismantling costs of large scale PV plants (Siegfried Schimpf).

Anti-atherosclerotic effects of tomatoes

Directory of Open Access Journals (Sweden)

Hidekatsu Yanai

2017-06-01

Full Text Available Tomatoes are rich in lycopene, which causes the red coloring of tomatoes. Several reports have suggested lycopene plays a role in the prevention of cardiovascular diseases. In this study, we systematically reviewed the interventional studies using tomatoes or tomato products to understandtheanti-atherosclerotic effects of the tomatoas a functional food. We found that a significantnumber of interventional studies reportedtheanti-atherosclerotic effects of tomatoes, includinganti-obesity effects, hypotensiveeffects, improvement of lipid/glucose metabolismand endothelial function, anti-oxidative and anti-inflammatory effect, and anti-platelet effect; however, the anti-platelet effect was disagreed uponby some studies. Furthermore, we discoveredcooking methods significantlyaffect anti-atherosclerotic effects of tomatoes.

Tomato Preserves.

Science.gov (United States)

Stevens, Wendy Tessman

1996-01-01

Describes a project in which students selected seeds from two heirloom varieties of tomatoes, sowed the seeds, harvested the tomatoes, and fermented the seeds. Details are provided for each step of the project and the school address is included so that other students can begin similar projects. (DDR)

Expression of the Bs2 pepper gene confers resistance to bacterial spot disease in tomato.

Science.gov (United States)

Tai, T H; Dahlbeck, D; Clark, E T; Gajiwala, P; Pasion, R; Whalen, M C; Stall, R E; Staskawicz, B J

1999-11-23

The Bs2 resistance gene of pepper specifically recognizes and confers resistance to strains of Xanthomonas campestris pv. vesicatoria that contain the corresponding bacterial avirulence gene, avrBs2. The involvement of avrBs2 in pathogen fitness and its prevalence in many X. campestris pathovars suggests that the Bs2 gene may be durable in the field and provide resistance when introduced into other plant species. Employing a positional cloning strategy, the Bs2 locus was isolated and the gene was identified by coexpression with avrBs2 in an Agrobacterium-mediated transient assay. A single candidate gene, predicted to encode motifs characteristic of the nucleotide binding site-leucine-rich repeat class of resistance genes, was identified. This gene specifically controlled the hypersensitive response when transiently expressed in susceptible pepper and tomato lines and in a nonhost species, Nicotiana benthamiana, and was designated as Bs2. Functional expression of Bs2 in stable transgenic tomatoes supports its use as a source of resistance in other Solanaceous plant species.

Physicochemical and microbiological evaluation of sun dried tomatoes in comparison with fresh tomatoes

International Nuclear Information System (INIS)

Sohail, M.

2011-01-01

The present study was conducted to evaluate the quality of sun dried tomatoes in comparison with fresh tomatoes. Fresh fully ripen tomatoes were washed and cut in thin slices with sterilized stainless steel knife and divided into two lots, one was taken as control and other was dipped in 3% potassium meta bisulfite solution for 5 minutes. The samples were spread over stainless steel trays covered with muslin cloth and kept in solar dehydrator for 5 days at 55 +- 2 deg. C. The physicochemical analyses were carried out in both dried and fresh (control) tomatoes. They were also analyzed microbiologically for bacterial and fugal count. Results showed that sun dried tomatoes are microbiologically safe. The values of moisture content and vitamin C of fresh and sun dried tomatoes statistically differ from each others at probability level of 5 %. The nutrient which is highly affected by sun drying is vitamin C. In fresh tomatoes it was 32.5 mg/100 g which is reduced to 24.6 mg/100 g after sun drying and further reduced to 15.86 mg/100 g during three months storage. The moisture content of the fresh tomatoes was 94.4% which decreased to 8.15% after drying, and then slowly increased to 9.95% in the three months storage. Statistically no major difference was found in the other nutrients during storage, which indicates that sun drying is nutritionally and microbiologically safe and can be used to preserve tomatoes and other fruits and vegetables for off season use. (author)

PV Obelisk - Information system with photovoltaics; PV-Obelisk Orientierungssystem mit Photovoltaik

Energy Technology Data Exchange (ETDEWEB)

Ruoss, D.; Rasmussen, J.

2004-07-01

This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed.

Cytogenetic and molecular studies on tomato chromosomes using diploid tomato and tomato monosomic additions in tetraploid potato

NARCIS (Netherlands)

Chang, S.B.

2004-01-01

Geneticists have studied the tomato, Lycopersicon esculentum, for several decades and now obtained a saturated linkage map on which numerous genes controlling morphological traits and disease resistances, and molecular markers have been positioned. They also investigated the chromosomes of tomato,

EFFECTIVE COMPLEX PROCESSING OF RAW TOMATOES

Directory of Open Access Journals (Sweden)

AIDA M. GADZHIEVA

2018-03-01

Full Text Available Tomatoes grown in the central and southern parts of the country, which contain 5 - 6 % of solids, including 0.13 % of pectin, 0.86 % of fat, 0.5 % of organic acids, 0.5 % minerals, etc. are used as research material. These tomatoes, grown in the mountains, on soils with high salinity, contain high amounts of valuable components and have long term preservation. For the extraction of valuable components from dried tomato pomace, the CO2 extraction method is applied. The technological and environmental feasibility of graded tomato drying in the atmosphere of an inert gas and in a solar drier is evaluated; the scheme of dried tomatoes production is improved; a system for tomato pomace drying is developed; a scheme of tomato powder production from pulp, skin and seeds is developed. The combined method of tomato pomace drying involves the simultaneous use of electromagnetic field of low and ultra-high frequency and blowing hot nitrogen on the product surface. Conducting the drying process in the atmosphere of nitrogen intensifies the process of removing moisture from tomatoes. The expediency of using tomato powder as an enriching additive is proved. Based on the study of the chemical composition of the tomato powder made from the Dagestan varieties, and on the organoleptic evaluation and physicochemical analysis of finished products, we prove the best degree of recoverability of tomato powder in the production of reconstituted juice and tomato beverages.

21 CFR 155.190 - Canned tomatoes.

Science.gov (United States)

2010-04-01

... tomatoes. (a) Identity—(1) Description. (i) Canned tomatoes is the food prepared from mature tomatoes...). Without shifting the tomatoes, so incline the sieve as to facilitate drainage of the liquid. Two minutes...

Novel Methods to Determine Feeder Locational PV Hosting Capacity and PV Impact Signatures

Energy Technology Data Exchange (ETDEWEB)

Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Coogan, Kyle [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2017-05-01

Often PV hosting capacity analysis is performed for a limited number of distribution feeders. For medium - voltage distribution feeders, previous results generally analyze less than 20 feeders, and then the results are extrapolated out to similar types of feeders. Previous hosting capacity research has often focused on determining a single value for the hosting capacity for the entire feeder, whereas this research expands previous hosting capacity work to investigate all the regions of the feeder that may allow many different hosting capacity values wit h an idea called locational hosting capacity (LHC)to determine the largest PV size that can be interconnected at different locations (buses) on the study feeders. This report discusses novel methods for analyzing PV interconnections with advanced simulati on methods. The focus is feeder and location - specific impacts of PV that determine the locational PV hosting capacity. Feeder PV impact signature are used to more precisely determine the local maximum hosting capacity of individual areas of the feeder. T he feeder signature provides improved interconnection screening with certain zones that show the risk of impact to the distribution feeder from PV interconnections.

The tomato sauce making process affects the bioaccessibility and bioavailability of tomato phenolics: a pharmacokinetic study.

Science.gov (United States)

Martínez-Huélamo, Miriam; Tulipani, Sara; Estruch, Ramón; Escribano, Elvira; Illán, Montserrat; Corella, Dolores; Lamuela-Raventós, Rosa M

2015-04-15

Tomato sauce is the most commonly consumed processed tomato product worldwide, but very little is known about how the manufacturing process may affect the phenolic composition and bioavailability after consumption. In a prospective randomised, cross-over intervention study, we analysed the plasma and urinary levels of tomato phenolic compounds and their metabolites after acute consumption of raw tomatoes and tomato sauce, enriched or not with refined olive oil during production. Respectively, eleven and four phenolic metabolites were found in urine and plasma samples. The plasma concentration and urinary excretion of naringenin glucuronide were both significantly higher after the consumption of tomato sauce than raw tomatoes. The results suggest that the mechanical and thermal treatments during tomato sauce manufacture may help to deliver these potentially bioactive phenolics from the food matrix more effectively than the addition of an oil component, thus increasing their bioavailability. Copyright © 2014 Elsevier Ltd. All rights reserved.

Energy balance of the global photovoltaic (PV) industry--is the PV industry a net electricity producer?

Science.gov (United States)

Dale, Michael; Benson, Sally M

2013-04-02

A combination of declining costs and policy measures motivated by greenhouse gas (GHG) emissions reduction and energy security have driven rapid growth in the global installed capacity of solar photovoltaics (PV). This paper develops a number of unique data sets, namely the following: calculation of distribution of global capacity factor for PV deployment; meta-analysis of energy consumption in PV system manufacture and deployment; and documentation of reduction in energetic costs of PV system production. These data are used as input into a new net energy analysis of the global PV industry, as opposed to device level analysis. In addition, the paper introduces a new concept: a model tracking energetic costs of manufacturing and installing PV systems, including balance of system (BOS) components. The model is used to forecast electrical energy requirements to scale up the PV industry and determine the electricity balance of the global PV industry to 2020. Results suggest that the industry was a net consumer of electricity as recently as 2010. However, there is a >50% that in 2012 the PV industry is a net electricity provider and will "pay back" the electrical energy required for its early growth before 2020. Further reducing energetic costs of PV deployment will enable more rapid growth of the PV industry. There is also great potential to increase the capacity factor of PV deployment. These conclusions have a number of implications for R&D and deployment, including the following: monitoring of the energy embodied within PV systems; designing more efficient and durable systems; and deploying PV systems in locations that will achieve high capacity factors.

Zesty Tomato Soup

Science.gov (United States)

... https://medlineplus.gov/recipe/zestytomatosoup.html Zesty Tomato Soup To use the sharing features on this page, ... Number of Servings: 4 Not your traditional tomato soup, this quick-cooking dish can be a side ...

Transgenic tomato hybrids resistant to tomato spotted wilt virus infection.

NARCIS (Netherlands)

Haan, de P.; Ultzen, T.; Prins, M.; Gielen, J.; Goldbach, R.; Grinsven, van M.

1996-01-01

Tomato spotted wilt virus (TSWV) infections cause significant economic losses in the commercial culture of tomato (Lycopersicon esculentum). Culture practices have only been marginally effective in controlling TSWV. The ultimate way to minimize losses caused by TSWV is resistant varieties. These can

NpPDR1, a Pleiotropic Drug Resistance-Type ATP-Binding Cassette Transporter from Nicotiana plumbaginifolia, Plays a Major Role in Plant Pathogen Defense1

Science.gov (United States)

Stukkens, Yvan; Bultreys, Alain; Grec, Sébastien; Trombik, Tomasz; Vanham, Delphine; Boutry, Marc

2005-01-01

Nicotiana plumbaginifolia NpPDR1, a plasma membrane pleiotropic drug resistance-type ATP-binding cassette transporter formerly named NpABC1, has been suggested to transport the diterpene sclareol, an antifungal compound. However, direct evidence for a role of pleiotropic drug resistance transporters in the plant defense is still lacking. In situ immunolocalization and histochemical analysis using the gusA reporter gene showed that NpPDR1 was constitutively expressed in the whole root, in the leaf glandular trichomes, and in the flower petals. However, NpPDR1 expression was induced in the whole leaf following infection with the fungus Botrytis cinerea, and the bacteria Pseudomonas syringae pv tabaci, Pseudomonas fluorescens, and Pseudomonas marginalis pv marginalis, which do not induce a hypersensitive response in N. plumbaginifolia, whereas a weaker response was observed using P. syringae pv syringae, which does induce a hypersensitive response. Induced NpPDR1 expression was more associated with the jasmonic acid than the salicylic acid signaling pathway. These data suggest that NpPDR1 is involved in both constitutive and jasmonic acid-dependent induced defense. Transgenic plants in which NpPDR1 expression was prevented by RNA interference showed increased sensitivity to sclareol and reduced resistance to B. cinerea. These data show that NpPDR1 is involved in pathogen resistance and thus demonstrate a new role for the ATP-binding cassette transporter family. PMID:16126865

NpPDR1, a pleiotropic drug resistance-type ATP-binding cassette transporter from Nicotiana plumbaginifolia, plays a major role in plant pathogen defense.

Science.gov (United States)

Stukkens, Yvan; Bultreys, Alain; Grec, Sébastien; Trombik, Tomasz; Vanham, Delphine; Boutry, Marc

2005-09-01

Nicotiana plumbaginifolia NpPDR1, a plasma membrane pleiotropic drug resistance-type ATP-binding cassette transporter formerly named NpABC1, has been suggested to transport the diterpene sclareol, an antifungal compound. However, direct evidence for a role of pleiotropic drug resistance transporters in the plant defense is still lacking. In situ immunolocalization and histochemical analysis using the gusA reporter gene showed that NpPDR1 was constitutively expressed in the whole root, in the leaf glandular trichomes, and in the flower petals. However, NpPDR1 expression was induced in the whole leaf following infection with the fungus Botrytis cinerea, and the bacteria Pseudomonas syringae pv tabaci, Pseudomonas fluorescens, and Pseudomonas marginalis pv marginalis, which do not induce a hypersensitive response in N. plumbaginifolia, whereas a weaker response was observed using P. syringae pv syringae, which does induce a hypersensitive response. Induced NpPDR1 expression was more associated with the jasmonic acid than the salicylic acid signaling pathway. These data suggest that NpPDR1 is involved in both constitutive and jasmonic acid-dependent induced defense. Transgenic plants in which NpPDR1 expression was prevented by RNA interference showed increased sensitivity to sclareol and reduced resistance to B. cinerea. These data show that NpPDR1 is involved in pathogen resistance and thus demonstrate a new role for the ATP-binding cassette transporter family.

PV Thermal systems: PV panels supplying renewable electricity and heat

NARCIS (Netherlands)

Helden, van W.G.J.; Zolingen, van R.J.C.; Zondag, H.A.

2004-01-01

With PV Thermal panels sunlight is converted into electricity and heat simultaneously. Per unit area the total efficiency of a PVT panel is higher than the sum of the efficiencies of separate PV panels and solar thermal collectors. During the last 20 years research into PVT techniques and concepts

The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.

Science.gov (United States)

Mural, Ravi V; Liu, Yao; Rosebrock, Tracy R; Brady, Jennifer J; Hamera, Sadia; Connor, Richard A; Martin, Gregory B; Zeng, Lirong

2013-09-01

The activation of an immune response in tomato (Solanum lycopersicum) against Pseudomonas syringae relies on the recognition of E3 ligase-deficient forms of AvrPtoB by the host protein kinase, Fen. To investigate the mechanisms by which Fen-mediated immunity is regulated, we characterize in this study a Fen-interacting protein, Fni3, and its cofactor, S. lycoperiscum Uev (Suv). Fni3 encodes a homolog of the Ubc13-type ubiquitin-conjugating enzyme that catalyzes exclusively Lys-63-linked ubiquitination, whereas Suv is a ubiquitin-conjugating enzyme variant. The C-terminal region of Fen was necessary for interaction with Fni3, and this interaction was required for cell death triggered by overexpression of Fen in Nicotiana benthamiana leaves. Fni3 was shown to be an active E2 enzyme, but Suv displayed no ubiquitin-conjugating activity; Fni3 and Suv together directed Lys-63-linked ubiquitination. Decreased expression of Fni3, another tomato Ubc13 homolog, Sl-Ubc13-2, or Suv in N. benthamiana leaves diminished cell death associated with Fen-mediated immunity and cell death elicited by several other resistance (R) proteins and their cognate effectors. We also discovered that coexpression of Fen and other R proteins/effectors with a Fni3 mutant that is compromised for ubiquitin-conjugating activity diminished the cell death. These results suggest that Fni3/Sl-Ubc13-2 and Suv regulate the immune response mediated by Fen and other R proteins through Lys-63-linked ubiquitination.

Comparison of three different methods of perturbing the potential vorticity field in mesoscale forecasts of Mediterranean heavy precipitation events: PV-gradient, PV-adjoint and PV-satellite

Science.gov (United States)

Vich, M.; Romero, R.; Richard, E.; Arbogast, P.; Maynard, K.

2010-09-01

Heavy precipitation events occur regularly in the western Mediterranean region. These events often have a high impact on the society due to economic and personal losses. The improvement of the mesoscale numerical forecasts of these events can be used to prevent or minimize their impact on the society. In previous studies, two ensemble prediction systems (EPSs) based on perturbing the model initial and boundary conditions were developed and tested for a collection of high-impact MEDEX cyclonic episodes. These EPSs perturb the initial and boundary potential vorticity (PV) field through a PV inversion algorithm. This technique ensures modifications of all the meteorological fields without compromising the mass-wind balance. One EPS introduces the perturbations along the zones of the three-dimensional PV structure presenting the local most intense values and gradients of the field (a semi-objective choice, PV-gradient), while the other perturbs the PV field over the MM5 adjoint model calculated sensitivity zones (an objective method, PV-adjoint). The PV perturbations are set from a PV error climatology (PVEC) that characterizes typical PV errors in the ECMWF forecasts, both in intensity and displacement. This intensity and displacement perturbation of the PV field is chosen randomly, while its location is given by the perturbation zones defined in each ensemble generation method. Encouraged by the good results obtained by these two EPSs that perturb the PV field, a new approach based on a manual perturbation of the PV field has been tested and compared with the previous results. This technique uses the satellite water vapor (WV) observations to guide the correction of initial PV structures. The correction of the PV field intents to improve the match between the PV distribution and the WV image, taking advantage of the relation between dark and bright features of WV images and PV anomalies, under some assumptions. Afterwards, the PV inversion algorithm is applied to run

COMPLEX PROCESSING TECHNOLOGY OF TOMATO RAW MATERIALS

Directory of Open Access Journals (Sweden)

A. M. Gadzhieva

2015-01-01

Full Text Available Tomatoes grown in the central and southern parts of the country, which contain 5-6 % of solids, including 0.13 % of pectin, 0.86 % of fat, 0.5 % of organic acids; 0.5 % minerals, etc. were used as a subject of research. These tomatoes, grown in the mountains, on soils with high salinity, contain high amounts of valuable components and have a long-term preservation. For the extraction of valuable components from dried tomato pomace CO2 extraction method was applied. Technological and environmental feasibility of tomatoes stage drying in the atmosphere of inert gas in solar dry kiln were evaluated; production scheme of dried tomatoes is improved; a system for tomato pomace drying is developed; a production scheme of powders of pulp, skin and seeds of tomatoes is developed. Combined method of tomato pomace drying involves the simultaneous use of the electromagnetic field of low and ultra-high frequency and blowing product surface with hot nitrogen. Conducting the drying process in an inert gas atmosphere of nitrogen intensified the process of moisture removing from tomatoes. The expediency of using tomato powder as enriching additive was proved. Based on the study of the chemical composition of the tomato powder made from Dagestan varieties of tomatoes, and on the organoleptic evaluation and physico-chemical studies of finished products, we have proved the best degree of recoverability of tomato powder during the production of reconstituted juice and tomato beverages.

Photovoltaics for Buildings Cutting-Edge PV

International Nuclear Information System (INIS)

Hayter, S. J.; Martin, R. L.

1998-01-01

Photovoltaic (PV) technology development for building-integrated applications (commonly called PV for Buildings) is one of the fastest growing areas in the PV industry. Buildings represent a huge potential market for photovoltaics because they consume approximately two-thirds of the electricity consumed in the US. The PV and buildings industries are beginning to work together to address issues including building codes and standards, integration, after-market servicing, education, and building energy efficiency. One of the most notable programs to encourage development of new PV-for-buildings products is the PV:BONUS program, supported by the US Department of Energy. Demand for these products from building designers has escalated since the program was initiated in 1993. This paper presents a range of PV-for-buildings issues and products that are currently influencing today's PV and buildings markets

Global PV Market Development

International Nuclear Information System (INIS)

Schmidt, F.

2009-01-01

The dawn of 2009 saw several events which caused major turbulence in the global photovoltaic industry. In 2008 the Spanish PV market grew beyond all expectations and even outranked Germany as the world's number one market. However, the promotion scheme was modified and a market cap was introduced in 2009, cutting back the maximum capacity to be installed to about the level of 2007. In addition, the industry is facing an oversupply of PV modules and a harsh recession which is significantly affecting the traditionally strong PV markets. International photovoltaic companies are challenged by a changing market situation: all of a sudden, competition has increased significantly, pushing the customer to the fore. As a result, a consolidation process is expected within the PV industry worldwide. However, the story is not all negative. In the U.S., the election of Barack Obama may be seen as the starting signal for a massive expansion in PV, likely to bring the country to first place globally within the next five years. Furthermore, different markets and market segments are being opened up - especially in Europe - thanks to the gradual arrival of generation parity and new PV support mechanisms. EuPD Research has observed and studied international PV markets since its foundation. The information included in the presentation is based on a wide range of quantitative and qualitative studies that EuPD Research has conducted in the key markets since 2002. Florian Schmidt, EuPD Research's Head of Product Management, will give an overview of the global PV market and how it is developing in this crucial year 2009. Aspects such as technology development, production capacities and the demand side will be included, with a special emphasis on the European PV markets. So far Chinese PV companies have often benefited from the booming PV markets in Europe, above all Germany and Spain. Due to the lack of domestic market, the Chinese industry strongly depends on the export and is

Tomato Sauce Enriched with Olive Oil Exerts Greater Effects on Cardiovascular Disease Risk Factors than Raw Tomato and Tomato Sauce: A Randomized Trial

Directory of Open Access Journals (Sweden)

Palmira Valderas-Martinez

2016-03-01

Full Text Available Epidemiological studies have observed a negative association between tomato intake and the incidence of cardiovascular disease. As tomato sauces are usually cooked with the addition of oil, some studies have pointed out that both processes may increase the bioavailability of the bioactive compounds. However, the effect of consumption of raw tomatoes and tomato sauces on inflammation biomarkers and adhesion molecules related to atherosclerosis remains unknown. The aim of this study was to test the postprandial effects of a single dose of raw tomatoes (RT, tomato sauce (TS and tomato sauce with refined olive oil (TSOO on cardiovascular disease risk factors. We performed an open, prospective, randomized, cross-over, controlled feeding trial in 40 healthy subjects who randomly received: 7.0 g of RT/kg of body weight (BW, 3.5 g of TS/kg BW, 3.5 g of TSOO/Kg BW and 0.25 g of sugar solved in water/kg BW on a single occasion on four different days. Biochemical parameters and cellular and circulating inflammatory biomarkers were assessed at baseline and 6 h after each intervention. The results indicate that, compared to control intervention, a single tomato intake in any form decreased plasma total cholesterol, triglycerides and several cellular and plasma inflammatory biomarkers, and increased plasma high density lipoproteins (HDL cholesterol and interleukine (IL 10 concentrations. However, the changes of plasma IL-6 and vascular cell adhesion molecule-1 (VCAM-1, and lymphocyte function-associated antigen-1 (LFA-1 from T-lymphocytes and CD36 from monocytes were significantly greater after TSOO than after RT and TS interventions. We concluded that tomato intake has beneficial effects on cardiovascular risk factors, especially cooked and enriched with oil.

Apoplastic peroxidases are required for salicylic acid-mediated defense against Pseudomonas syringae.

Science.gov (United States)

Mammarella, Nicole D; Cheng, Zhenyu; Fu, Zheng Qing; Daudi, Arsalan; Bolwell, G Paul; Dong, Xinnian; Ausubel, Frederick M

2015-04-01

Reactive oxygen species (ROS) generated by NADPH oxidases or apoplastic peroxidases play an important role in the plant defense response. Diminished expression of at least two Arabidopsis thaliana peroxidase encoding genes, PRX33 (At3g49110) and PRX34 (At3g49120), as a consequence of anti-sense expression of a heterologous French bean peroxidase gene (asFBP1.1), were previously shown to result in reduced levels of ROS following pathogen attack, enhanced susceptibility to a variety of bacterial and fungal pathogens, and reduced levels of callose production and defense-related gene expression in response to the microbe associated molecular pattern (MAMP) molecules flg22 and elf26. These data demonstrated that the peroxidase-dependent oxidative burst plays an important role in the elicitation of pattern-triggered immunity (PTI). Further work reported in this paper, however, shows that asFBP1.1 antisense plants are not impaired in all PTI-associated responses. For example, some but not all flg22-elicited genes are induced to lower levels by flg22 in asFPB1.1, and callose deposition in asFPB1.1 is similar to wild-type following infiltration with a Pseudomonas syringae hrcC mutant or with non-host P. syringae pathovars. Moreover, asFPB1.1 plants did not exhibit any apparent defect in their ability to mount a hypersensitive response (HR). On the other hand, salicylic acid (SA)-mediated activation of PR1 was dramatically impaired in asFPB1.1 plants. In addition, P. syringae-elicited expression of many genes known to be SA-dependent was significantly reduced in asFBP1.1 plants. Consistent with this latter result, in asFBP1.1 plants the key regulator of SA-mediated responses, NPR1, showed both dramatically decreased total protein abundance and a failure to monomerize, which is required for its translocation into the nucleus. Copyright © 2014 Elsevier Ltd. All rights reserved.

PV-hybrid and mini-grid

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-07-01

Within the 5th European PV-hybrid and mini-grid conference 29th and 30th April, 2010 in Tarragona (Spain) the following lectures were held: (1) Overview of IEA PVPS Task 11 PV-hybrid systems within mini grids; (2) Photovoltaic revolution for deployment in developing countries; (3) Legal and financial conditions for the sustainable operation of mini-grids; (4) EU instruments to promote renewable energies in developing countries; (5) PV hybridization of diesel electricity generators: Conditions of profitability and examples in differential power and storage size ranges; (6) Education suit of designing PV hybrid systems; (7) Sustainable renewable energy projects for intelligent rural electrification in Laos, Cambodia and Vietnam; (8) Techno-economic feasibility of energy supply of remote villages in Palestine by PV systems, diesel generators and electric grid (Case studies: Emnazeil and Atouf villages); (9) Technical, economical and sustainability considerations of a solar PV mini grid as a tool for rural electrification in Uganda; (10) Can we rate inverters for rural electrification on the basis of energy efficiency?; (11) Test procedures for MPPT charge controllers characterization; (12) Energy storage for mini-grid stabilization; (13) Redox flow batteries - Already an alternative storage solution for hybrid PV mini-grids?; (14) Control methods for PV hybrid mini-grids; (15) Partial AC-coupling in mini-grids; (15) Normative issues of small wind turbines in PV hybrid systems; (16) Communication solutions for PV hybrid systems; (17) Towards flexible control and communication of mini-grids; (18) PV/methanol fuel cell hybrid system for powering a highway security variable message board; (19) Polygeneration smartgrids: A solution for the supply of electricity, potable water and hydrogen as fuel for transportation in remote Areas; (20) Implementation of the Bronsbergen micro grid using FACDS; (21) A revisited approach for the design of PV wind hybrid systems; (22

Bacillus spp. from rainforest soil promote plant growth under limited nitrogen conditions.

Science.gov (United States)

Huang, X-F; Zhou, D; Guo, J; Manter, D K; Reardon, K F; Vivanco, J M

2015-03-01

The aim of this study was to evaluate effects of PGPR (plant growth-promoting rhizobacteria) isolated from rainforest soil on different plants under limited nitrogen conditions. Bacterial isolates from a Peruvian rainforest soil were screened for plant growth-promoting effects on Arabidopsis (Col-0). Four selected isolates including one Bacillus subtilis, two B. atrophaeus and one B. pumilus significantly promoted growth of Zea mays L. and Solanum lycopersicum under greenhouse conditions. Moreover, the PGPRs significantly promoted growth of S. lycopersicum in both low and nitrogen-amended soil conditions. These PGPR strains were further studied to obtain insights into possible mechanisms of plant growth promotion. Volatile chemicals from those isolates promoted Arabidopsis growth, and the expression of genes related to IAA production was induced in the Arabidopsis plants treated with PGPRs. Further, selected PGPR strains triggered induced systemic resistance (ISR) against Pseudomonas syringae pv tomato DC3000 in Arabidopsis. PGPR strains isolated from the rainforest soil promoted the plant growth of Arabidopsis, corn and tomato. New PGPR that have wider adaptability to different crops, soils and environmental conditions are needed to decrease our reliance on agricultural amendments derived from fossil-based fuels. The PGPRs isolated from a nonagricultural site constitute new plant growth-promoting strains that could be developed for agricultural uses. © 2014 The Society for Applied Microbiology.

SunShot 2030 for Photovoltaics (PV): Envisioning a Low-Cost PV Future

Energy Technology Data Exchange (ETDEWEB)

Cole, Wesley J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zuboy, Jarrett; Woodhouse, Michael A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-10-01

This presentation summarizes the findings from the report 'SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future.' This presentation was given as a webinar on September 26, 2017.

Economic PV - a shift in thinking

International Nuclear Information System (INIS)

Maycock, P.

1999-01-01

This article argues that photovoltaic (PV) technology is already economically viable contrary to current opinion. A table of world PV module shipments for 1990 to 1998 by market sector is presented, and use of PV modules in consumer electronics such as calculators, battery trickle chargers, and garden lights; in communications and signals (eg. microwave repeaters, cellular communication); and in the residential sector in fluorescent lights, radios etc. are discussed. The early adopters of PV technology, and the value placed on PV devices by consumers are considered. Details of PV manufacturing costs for 1997, and forecasts for 2000 and 2010 are tabulated

Predicting the presence of whiteflies and tomato yellow leaf curl virus in Florida tomato fields

Science.gov (United States)

Florida is one of the leading states for production of fresh market tomatoes. Production is severely affected by Tomato yellow leaf curl virus (TYLCV). The objective of this study was to identify landscape and climatic factors that drive whitefly populations and TYLCV incidence in commercial tomato ...

Tomato juices and tomato juice concentrates : a study of factors contributing to their gross viscosity

NARCIS (Netherlands)

Heutink, R.

1986-01-01

The gross viscosity of tomato juice and tomato juice concentrates was found to be determined primarily by the water insoluble solids (WIS) content. The serum viscosity did not contribute to gross viscosity. The WIS consisted of whole tomato cells, vascular bundles and skin fragments. In general the

Effects of tomato variety, temperature differential and post-stem removal time on internalization of Salmonella Thompson into tomatoes

Science.gov (United States)

Tomatoes have been implicated in several Salmonellosis outbreaks due to possible contamination through bacterial infiltration into tomatoes during post-harvest handling. The aim of this study was to determine the effects of tomato variety, dump tank water to tomato pulp temperature differential, and...

PV module mounting method and mounting assembly

Science.gov (United States)

Lenox, Carl J.S.; Johnson, Kurt M.

2013-04-23

A method for mounting PV modules to a deck includes selecting PV module layout pattern so that adjacent PV module edges are spaced apart. PV mounting and support assemblies are secured to the deck according to the layout pattern using fasteners extending into the deck. The PV modules are placed on the PV mounting and support assemblies. Retaining elements are located over and secured against the upper peripheral edge surfaces of the PV modules so to secure them to the deck with the peripheral edges of the PV modules spaced apart from the deck. In some examples a PV module mounting assembly, for use on a shingled deck, comprises flashing, a base mountable on the flashing, a deck-penetrating fastener engageable with the base and securable to the deck so to secure the flashing and the base to the shingled deck, and PV module mounting hardware securable to the base.

Numerical study of PV/T-SAHP system

Institute of Scientific and Technical Information of China (English)

Gang PEI; Jie JI; Ke-liang LIU; Han-feng HE; Ai-guo JIANG

2008-01-01

In order to utilize solar energy effectively and to achieve a higher electrical efficiency by limiting the operating temperature of the photovoltaic (PV) panel, a novel photovoltaic/thermal solar-assisted heat pump (PV/T-SAHP) system was proposed and constructed. The hybrid solar system generates electricity and thermal energy simultaneously. A distributed parameters model of the PV/T-SAHP system was developed and applied to analyze the system dynamic performance in terms of PV action, photothermal action and Rankine cycle processes. The simulation results indicated that the coefficient of performance (COP) of the proposed PV/T-SAHP can be much better than that of the conventional heat pump. Both PV-efficiency and photothermic efficiency have been improved considerably. The results also showed that the performance of this PV/T-SAHP system was strongly influenced by the evaporator area, tube pitch and tilt angle of the PV/T evaporator, which are the key factors in PV/T-SAHP system optimization and PV/T evaporator design.

Design optimization of grid-connected PV inverters

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2011-01-01

The DC/AC inverters are the key elements in grid-connected PV energy production systems. In this paper, new design optimization techniques focused on transformerless (very high efficiency) PV inverters are proposed. They have been developed based on an analysis of the deficiencies of the current......, state-of-the-art PV inverters design technology, which limits the amount of PV energy supplied into the electric grid. The influences of the electric grid regulations and standards and the PV array operational characteristics on the design of grid-connected PV inverters have also been considered....... The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy injected into the electric grid by the optimized PV installation....

A case study of utility PV economics

International Nuclear Information System (INIS)

Wenger, H.; Hoff, T.; Osborn, D.E.

1997-01-01

This paper presents selected results from a detailed study of grid-connected photovoltaic (PV) applications within the service area of the Sacramento Municipal Utility District. The intent is to better understand the economics and markets for grid-connected PV systems in a utility setting. Research results include: Benefits calculations for utility-owned PV systems at transmission and distribution voltages; How the QuickScreen software package can help utilities investigate the viability of distributed PV; Energy production and capacity credit estimates for fixed and tracking PV systems; Economics and rate impacts of net metering residential PV systems; Market potential estimates for residential rooftop PV systems; and Viability and timing of grid-connected PV commercialization paths

Solar PV. Innovators talking; Zon PV. Innovators aan het woord

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-02-15

Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

Solar PV. Innovators talking; Zon PV. Innovators aan het woord

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-02-15

Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

Firefighter Safety for PV Systems

DEFF Research Database (Denmark)

Mathe, Laszlo; Sera, Dezso; Spataru, Sergiu

2015-01-01

An important and highly discussed safety issue for photovoltaic (PV) systems is that as long as the PV panels are illuminated, a high voltage is present at the PV string terminals and cables between the string and inverters that is independent of the state of the inverter's dc disconnection switch...

Dynamics of sugar content in vegetative organs of Syringa Genus representatives introduced into Steppe Zone

Directory of Open Access Journals (Sweden)

L. G. Dolgova

2005-12-01

Full Text Available Quantitative and qualitative contents of sugars in phases of growth and development in overground organs of species of Syringa L. genus were determined. It is shown a cryoprotective role of sugars in plants. Conclusions on resistance of plants under conditions of a steppe zone are made.

Grid integrated distributed PV (GridPV).

Energy Technology Data Exchange (ETDEWEB)

Reno, Matthew J.; Coogan, Kyle

2013-08-01

This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functions are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in the OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function in the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

PV/T slates - Pilot project in Steinhausen; PV/T-Schiefer. Pilotprojekt Steinhausen

Energy Technology Data Exchange (ETDEWEB)

Kropf, S.

2003-07-01

This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with a ventilated PV-tile system (PV/T-Slates) mounted on a garden shed in Steinhausen, Switzerland. The installation provides power and heat to the main house. The report describes the construction and operation of this pilot project and the results of measurements made on its electrical and thermal performance. The results of measurements made are presented in detail in graphical form and compared with the results of simulation. Suggestions are made for the optimisation of the system. Figures are presented on energy production and energy flows in graphical form.

Photovoltaics: PV takes off the UK

International Nuclear Information System (INIS)

Noble, Ray; Gregory, Jenny

2000-01-01

Despite historical ups and downs, there is still ambition to bring increasingly efficient photovoltaic (PV) systems to the market. PV for major remote telecommunications systems is now an established part of the market, many mobile phone systems are powered by PV and there is potential for increased use of home solar systems, especially in developing countries. Over the past few years, building-integrated PV (BIPV) has been on the increase. In 1999, global production from PV exceeded 200 MW and the UK installed capacity was greater than 1 MW. BIPV is a fast growing market and its characteristics and advantages are discussed. PV installations at Nottingham University, Greenwich Pavilion, BP Amoco Sunbury, Baglan Bay, BP filling stations, and Sainsbury's are described

INTEGRATED WEED MANAGEMENT ON THE PROCESSING TOMATO CROP AND TOMATO FOR CONSUMPTION IN NATURA

Directory of Open Access Journals (Sweden)

Y. O. Castro

2016-11-01

Full Text Available Weeds cause direct and indirect damage to processing tomato and tomato for consumption in natura. The coexistence period is decisive for the intensity of damage, although the economic cost is also considered for decision making when to control the weeds. There are similarities between processing tomato and tomato for consumption in natura cropping system and peculiarities. This causes the management has adopted its common applications and its variables within each system. As control alternative, the farmer has basically the preventive control, mechanical, cultural, biological and chemical. The application of a single method is not recommended. Ideally, the methods needs to be integrated in order to combat weeds, highly evolved populations and resistant to unfavorable conditions. Consider weed management taking only one control measure is to underestimate the evolutionary ability of such species. Therefore, it is necessary to integrate the various methods available to the weed interference not impede the tomato production.

Function of endoplasmic reticulum calcium ATPase in innate immunity-mediated programmed cell death

Science.gov (United States)

Zhu, Xiaohong; Caplan, Jeffrey; Mamillapalli, Padmavathi; Czymmek, Kirk; Dinesh-Kumar, Savithramma P

2010-01-01

Programmed cell death (PCD) initiated at the pathogen-infected sites during the plant innate immune response is thought to prevent the development of disease. Here, we describe the identification and characterization of an ER-localized type IIB Ca2+-ATPase (NbCA1) that function as a regulator of PCD. Silencing of NbCA1 accelerates viral immune receptor N- and fungal-immune receptor Cf9-mediated PCD, as well as non-host pathogen Pseudomonas syringae pv. tomato DC3000 and the general elicitor cryptogein-induced cell death. The accelerated PCD rescues loss-of-resistance phenotype of Rar1, HSP90-silenced plants, but not SGT1-silenced plants. Using a genetically encoded calcium sensor, we show that downregulation of NbCA1 results in the modulation of intracellular calcium signalling in response to cryptogein elicitor. We further show that NbCAM1 and NbrbohB function as downstream calcium decoders in N-immune receptor-mediated PCD. Our results indicate that ER-Ca2+-ATPase is a component of the calcium efflux pathway that controls PCD during an innate immune response. PMID:20075858

Competitiveness of tomato production in punjab, pakistan

International Nuclear Information System (INIS)

Akhtar, W.; Qureshi, A.H.; Khan, M.A.

2016-01-01

The study measures competitiveness at farm level and economic efficiency at country level of tomato production in relation to tomato trade by using Policy Analysis Matrix (PAM) framework in Punjab, Pakistan. The province was divided into two tomato production regions i.e., Central and Southern Punjab for analysis purpose under importable scenario by using import parity price. Results of PAM model revealed that tomato production in both regions of Punjab has competitiveness under prevailing market situation as indicated by positive private profitability and private cost ratio (PCR) which is less than 1. Competitiveness difference in two regions indicated that Central Punjab has more competitiveness at farm level in tomato production. Economic efficiency results i.e. Domestic Resource Cost (DRC) ratio remained 0.39 and 0.51 in Central and Southern Punjab, respectively with positive social profitability indicating strong comparative advantage under importable scenario. The above results implied that Central Punjab has greater economic efficiency than Southern Punjab in domestic resources use for production of tomato as import substitute commodity. Results of Nominal Protection Coefficient (NPC) and Effective Protection Coefficient (EPC) indicated that combine effects of policies on output and tradable input market did not pass any protection to tomato farmers in the study area. Net effect of policy or market failure is reducing the profitability of tomato producers at farm level which indicates lack of motivation from policies for farmers to expand tomato production as import substitute crop. Present study recommended competitiveness and economic efficiency analysis in other tomato producing regions of the country for year round tomato supply on the basis of resource efficiency and to curtail tomato imports to save the precious foreign exchange. To enhance the competitiveness there is need to increase farmer's incentives through increase of farm level price up to

PV-BUK: Operating and maintenance costs of photovoltaic installations; PV-BUK - Betriebs- und Unterhaltskosten von PV-Anlagen - Schlussbericht

Energy Technology Data Exchange (ETDEWEB)

Stettler, S.; Toggweiler, P. [Enecolo AG, Moenchaltorf (Switzerland); Ruoss, D.; Schudel, P. [Envision, Lucerne (Switzerland); Kottmann, A.; Steinle, F. [BE Netz AG, Lucerne (Switzerland)

2008-03-15

This final report elaborated for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a project carried out to determine the costs for facility management, to estimate future cost development and to propose activities for the further reduction of the operation and maintenance costs of photovoltaic systems. Information on the cost situation was collected by literature study, as well as in interviews and surveys with photovoltaic (PV) experts and the owners of PV installations. The discussion of the results at a workshop with about 20 Swiss PV experts is noted. The results are presented and discussed. These show that operating costs per kWh decrease with the size of the PV system. Figures are quoted. The major part of the costs are quoted as being those for spare parts, especially for the inverter. The authors are of the opinion that, in future, costs for facility management will further decrease, as they are partly linked to capital and insurance costs. Potential for optimisation is said to exist in several areas of facility management such as, for example, in system monitoring and fast reaction in the case of malfunctions.

Gamma-irradiation of tomatoes

International Nuclear Information System (INIS)

Tencheva, S.; Todorov, S.

1975-01-01

The influence of gamma-ray on tomatoes picked in a pink-red ripening stage, good for consumption, is studied. For that purpose tomatoes of ''Pioneer 2'' variety packed in perforated 500 g plastic bags were irradiated on a gamma device (Cobalt-60) at a dose power of 1900 rad/min with doses 200 or 300 krad. Samples were stored after irradiation at room temperature (20 - 22sup(o)C). Microbiological studies demonstrated that 44 resp. 99.96 per cent of the initial number of microorganisms was destroyed after irradiation with 200 resp. 300 krad. The time required for the number of microorganisms to be restored was accordingly increased. Irradiation delayed tomato ripening by 4 to 6 days, demonstrable by the reduced content of the basic staining substances - carotene and licopine. Immediately after irradiation the ascorbic acid content was reduced by an average of 13 per cent. After 18 days the amount of ascorbic acid in irradiated tomatoes was increased to a higher than the starting level, this is attributed to reductone formation during irradiation. The elevated total sugar content shown to be invert sugar was due to further tomato ripening. (Ch.K.)

Nutritional evaluation of dried tomato seeds.

Science.gov (United States)

Persia, M E; Parsons, C M; Schang, M; Azcona, J

2003-01-01

Two samples of tomato seeds, a by-product of the tomato canning industry were evaluated to determine proximate analysis, amino acid content, and digestibility, TMEn, and protein efficiency ratio. Tomato seeds were also used to replace corn and soybean meal (SBM) in a chick diet on an equal true amino acid digestibility and TMEn basis. Tomato seeds were found to contain 8.5% moisture, 25% CP, 20.0% fat, 3.1% ash, 35.1% total dietary fiber, 0.12% Ca, 0.58% P, and 3,204 kcal/kg of TMEn. The total amounts of methionine, cystine, and lysine in the tomato seeds were 0.39, 0.40, and 1.34%, respectively, and their true digestibility coefficients, determined in cecectomized roosters, were 75, 70, and 54%, respectively. The protein efficiency ratio (weight gain per unit of protein intake) value when fed to chicks at 9% CP was 2.5 compared to 3.6 for SBM (P seeds could replace corn and SBM without any adverse affects on chick weight gain, feed intake, or gain:feed ratio from 8 to 21 d posthatch. Tomato seeds at any level in the diet did not significantly affect skin pigmentation. Although the protein quality of tomato seeds may not be as high as SBM, tomato seeds do contain substantial amounts of digestible amino acids and TMEn. When formulating diets on a true digestible amino acid and TMEn basis, tomato seeds can be supplemented into chick rations at up to 15% without any adverse affects on growth performance.

Optimization of PV-based energy production by dynamic PV-panel/inverter configuration

DEFF Research Database (Denmark)

Paasch, Kasper; Nymand, Morten; Haase, Frerk

This paper investigates the possible increase in annual energy production of a PV system with more than one MPPT (maximum power point tracker) input channels under Nordic illumination conditions, in case a concept of dynamic switching of the PV panels is used at the inputs of the inverters....

PV integration into a CSP plant

Science.gov (United States)

Carvajal, Javier López; Barea, Jose M.; Barragan, Jose; Ortega, Carlos

2017-06-01

This paper describes a preliminary techno-economic analysis of the integration of a PV plant into an optimized Parabolic Trough Plant in order to reduce the online consumptions and thus, increase the net electricity injected into the grid. The idea is to assess the feasibility of such project and see what configuration would be the optimal. An extra effort has been made in terms of modelling as the analysis has to be done to the integrated CSP + PV plant instead of analyzing them independently. Two different technologies have been considered for the PV plant, fix and one-axis tracking. Additionally three different scenarios have been considered for the CSP plant auxiliary consumptions as they are essential for determining the optimal PV plant (the higher the auxiliary consumption the higher the optimal PV plant). As could be expected, the results for all cases with PV show an improvement in terms of electricity generation and also in terms of LCOE with respect to the CSP plant. Such improvement is slightly higher with tracking technology for this specific study. Although this exercise has been done to an already designed CSP plant (so only the PV plant had to be optimized), the methodology could be applied for the optimization of an integrated CSP + PV plant during the design phase.

Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance.

Science.gov (United States)

Ma, Hao; Song, Congfeng; Borth, Wayne; Sether, Diane; Melzer, Michael; Hu, John

2011-10-20

Tomato spotted wilt virus (TSWV) has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX) in tomato and petunia is related to TSWV resistance. The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petunia 'Sheer Madness' using Agrobacterium-mediated transformation. Highly expressed AOX transgenic tomato and petunia plants were selfed and transgenic R1 seedlings from 10 tomato lines and 12 petunia lines were used for bioassay. For each assayed line, 22 to 32 tomato R1 progeny in three replications and 39 to 128 petunia progeny in 13 replications were challenged with TSWV. Enzyme-Linked Immunosorbent Assays showed that the TSWV levels in transgenic tomato line FKT4-1 was significantly lower than that of wild-type controls after challenge with TSWV. In addition, transgenic petunia line FKP10 showed significantly less lesion number and smaller lesion size than non-transgenic controls after inoculation by TSWV. In all assayed transgenic tomato lines, a higher percentage of transgenic progeny had lower TSWV levels than non-transgenic plants after challenge with TSWV, and the significantly increased resistant levels of tomato and petunia lines identified in this study indicate that altered expression levels of AOX in tomato and petunia can affect the levels of TSWV resistance.

Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance

Directory of Open Access Journals (Sweden)

Ma Hao

2011-10-01

Full Text Available Abstract Background Tomato spotted wilt virus (TSWV has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX in tomato and petunia is related to TSWV resistance. Results The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petunia 'Sheer Madness' using Agrobacterium-mediated transformation. Highly expressed AOX transgenic tomato and petunia plants were selfed and transgenic R1 seedlings from 10 tomato lines and 12 petunia lines were used for bioassay. For each assayed line, 22 to 32 tomato R1 progeny in three replications and 39 to 128 petunia progeny in 13 replications were challenged with TSWV. Enzyme-Linked Immunosorbent Assays showed that the TSWV levels in transgenic tomato line FKT4-1 was significantly lower than that of wild-type controls after challenge with TSWV. In addition, transgenic petunia line FKP10 showed significantly less lesion number and smaller lesion size than non-transgenic controls after inoculation by TSWV. Conclusion In all assayed transgenic tomato lines, a higher percentage of transgenic progeny had lower TSWV levels than non-transgenic plants after challenge with TSWV, and the significantly increased resistant levels of tomato and petunia lines identified in this study indicate that altered expression levels of AOX in tomato and petunia can affect the levels of TSWV resistance.

Managing thrips and tospoviruses in tomato

Science.gov (United States)

Tomato spotted wilt virus and more recently emerged Tomato chlorotic spot virus and Groundnut ringspot virus are all transmitted by thrips, making managment complex. All three viruses and the thrips vector are major pests of tomato in Florida. Current management tools for these viruses and the th...

Projecting of PV facades in consideration of PV-specific operating conditions; Besonderheiten bei der Projektierung von Photovoltaik-Fassadenanlagen

Energy Technology Data Exchange (ETDEWEB)

Decker, B.; Grimmig, B.; Mencke, D. [Institut fuer Solarenergieforschung GmbH Hameln/Emmerthal (ISFH), Emmerthal (Germany). Gruppe Photovoltaik-Systeme; Stellbogen, D. [Zentrum fuer Sonnenenergie- und Wasserstoff-Forschung Baden-Wuerttemberg (ZSW), Stuttgart (Germany). Fachgebiet Photovoltaische Anlagentechnik

1998-02-01

PV facades can provide several additional functions such as weather protection, thermal insulation, daylighting or sun protection. On the other hand, specific operating conditions for PV facades must be taken into account when selecting components and designing the system. Depending on ventilation conditions, there is a large range of maximum module temperatures. South-oriented PV facades receive about 30% less yearly irradiation than an optimally inclined PV generator, hence reflection losses are approximately 4% higher. The maximum of yearly irradiation lies only in the 400-600 W/m{sup 2} range. Surrounding buildings and/or vegetation can impair performance of the PV-facades. For a south-oriented PV facade an annual yield in the range of 470-560 kwh/kW{sub p}.a has been prodicted which was verified by operating results of eight PV facades. (orig.) [Deutsch] Photovoltaik (PV) Fassaden ermoeglichen neben der Stromerzeugung zusaetzliche Funktionen wie Wetterschutz bzw. Waermedaemmung des Gebaeudes oder Tageslichtnutzung bzw. Sonnenschutz der Innenraeume. Allerdings muessen fassadenspezifische Betriebsbedingungen, bei der Komponentenauswahl und Systemauslegung beruecksichtigt werden. Unterschiedliche Hinterlueftungsbedingungen fuehren zu einer grossen Bandbreite der maximalen Modultemperatur. PV-Suedfassaden empfangen etwa 30% weniger Jahreseinstrahlung als ein optimal geneigter PV-Generator. Die Haelfte der jaehrlichen Einstrahlung trifft mit Einfallswinkeln groesser 50 auf die vertikal angeordneten Module wodurch die Reflexionsverluste um ca. 4% hoeher sind. Das Maximum der Jahreseinstrahlung liegt nur um 400-600 W/m{sup 2} und erreicht selten Werte ueber 800 W/m{sup 2}. Umliegende Gebaeude oder Vegetation koennen zu Teilabschattungen des Generators fuehren. Fuer eine vertikale PV-Suedfassade wird ein Jahresenergieertrag in Hoehe von 470-560 kWh/kW{sub p}.a prognostiziert, der anhand der Betriebsergebnisse von acht PV-Fassadenanlagen verifiziert werden konnte

A Mathematical model to investigate quorum sensing regulation and its heterogenecity in pseudomonas syringae on leaves

Science.gov (United States)

The bacterium Pseudomonas syringae is a plant-pathogen, which through quorum sensing (QS), controls virulence. In this paper, by means of mathematical modeling, we investigate QS of this bacterium when living on leaf surfaces. We extend an existing stochastic model for the formation of Pseudomonas s...

Rheological Behavior of Tomato Fiber Suspensions Produced by High Shear and High Pressure Homogenization and Their Application in Tomato Products

Science.gov (United States)

Sun, Ping; Adhikari, Benu P.; Li, Dong

2018-01-01

This study investigated the effects of high shear and high pressure homogenization on the rheological properties (steady shear viscosity, storage and loss modulus, and deformation) and homogeneity in tomato fiber suspensions. The tomato fiber suspensions at different concentrations (0.1%–1%, w/w) were subjected to high shear and high pressure homogenization and the morphology (distribution of fiber particles), rheological properties, and color parameters of the homogenized suspensions were measured. The homogenized suspensions were significantly more uniform compared to unhomogenized suspension. The homogenized suspensions were found to better resist the deformation caused by external stress (creep behavior). The apparent viscosity and storage and loss modulus of homogenized tomato fiber suspension are comparable with those of commercial tomato ketchup even at the fiber concentration as low as 0.5% (w/w), implying the possibility of using tomato fiber as thickener. The model tomato sauce produced using tomato fiber showed desirable consistency and color. These results indicate that the application of tomato fiber in tomato-based food products would be desirable and beneficial. PMID:29743890

Functional genomics of tomato

Indian Academy of Sciences (India)

2014-10-20

Oct 20, 2014 ... 1Repository of Tomato Genomics Resources, Department of Plant Sciences, School .... Due to its position at the crossroads of Sanger's sequencing .... replacement for the microarray-based expression profiling. .... during RNA fragmentation step prior to library construction, ...... tomato pollen as a test case.

The case for better PV forecasting

DEFF Research Database (Denmark)

Alet, Pierre-Jean; Efthymiou, Venizelos; Graditi, Giorgio

2016-01-01

Rising levels of PV penetration mean increasingly sophisticated forecasting technologies are needed to maintain grid stability and maximise the economic value of PV systems. The Grid Integration working group of the European Technology and Innovation Platform – Photovoltaics (ETIP PV) shares the ...

Development of a GIS Tool for High Precision PV Degradation Monitoring and Supervision: Feasibility Analysis in Large and Small PV Plants

Directory of Open Access Journals (Sweden)

Miguel de Simón-Martín

2017-06-01

Full Text Available It is well known that working photovoltaic (PV plants show several maintenance needs due to wiring and module degradation, mismatches, dust, and PV cell defects and faults. There are a wide range of theoretical studies as well as some laboratory tests that show how these circumstances may affect the PV production. Thus, it is mandatory to evaluate the whole PV plant performance and, then, its payback time, profitability, and environmental impact or carbon footprint. However, very few studies include a systematic procedure to quantify and supervise the real degradation effects and fault impacts on the field. In this paper, the authors first conducted a brief review of the most frequent PV faults and the degradation that can be found under real conditions of operation of PV plants. Then, they proposed and developed an innovative Geographic Information System (GIS application to locate and supervise them. The designed tool was applied to both a large PV plant of 108 kWp and a small PV plant of 9 kWp installed on a home rooftop. For the large PV plant, 24 strings of PV modules were modelized and introduced into the GIS application and every module in the power plant was studied including voltage, current, power, series and parallel resistances, fill factor, normalized PV curve to standard test conditions (STC, thermography and visual analysis. For the small PV installation three strings of PV panels were studied identically. It must be noted that PV modules in this case included power optimizers. The precision of the study enabled the researchers to locate and supervise up to a third part of every PV cell in the system, which can be adequately georeferenced. The developed tool allows both the researchers and the investors to increase control of the PV plant performance, to lead to better planning of maintenance actuations, and to evaluate several PV module replacement strategies in a preventive maintenance program. The PV faults found include hot

Adiabatic Rearrangement of Hollow PV Towers

Directory of Open Access Journals (Sweden)

Eric A Hendricks

2010-10-01

Full Text Available Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV. This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with significant vortex structural and intensity change. The three-dimensional adiabatic rearrangements of two prototypical hurricane-like hollow PV towers (one thick and one thin are examined in an idealized framework. For both hollow towers, dynamic instability causes air parcels with high PV to be mixed into the eye preferentially at lower levels, where unstable PV wave growth rates are the largest. Little or no mixing is found to occur at upper levels. The mixing at lower and middle levels is most rapid for the breakdown of the thin hollow tower, consistent with previous barotropic results. For both hollow towers, this advective rearrangement of PV affects the tropical cyclone structure and intensity in a number of ways. First, the minimum central pressure and maximum azimuthal mean velocity simultaneously decrease, consistent with previous barotropic results. Secondly, isosurfaces of absolute angular momentum preferentially shift inward at low levels, implying an adiabatic mechanism by which hurricane eyewall tilt can form. Thirdly, a PV bridge, similar to that previously found in full-physics hurricane simulations, develops as a result of mixing at the isentropic levels where unstable PV waves grow most rapidly. Finally, the balanced mass field resulting from the PV rearrangement is warmer in the eye between 900 and 700 hPa. The location of this warming is consistent with observed warm anomalies in the eye, indicating that in certain instances the hurricane

Parallel experimental study of a novel super-thin thermal absorber based photovoltaic/thermal (PV/T system against conventional photovoltaic (PV system

Directory of Open Access Journals (Sweden)

Peng Xu

2015-11-01

Full Text Available Photovoltaic (PV semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the overall field system involved 15 stand-alone PV panels and 15 retrofitted PV/T panels. The laboratory testing results demonstrated the PV/T panel could achieve the electrical efficiency of about 16.8% (relatively 5% improvement comparing with the stand-alone PV panel, and yield an extra amount of heat with thermal efficiency of nearly 65%. The field testing results indicated that the hybrid PV/T panel could enhance the electrical return of PV panels by nearly 3.5%, and increase the overall energy output by nearly 324.3%. Further opportunities and challenges were then discussed from aspects of different PV/T stakeholders to accelerate the development. It is expected that such technology could become a significant solution to yield more electricity, offset heating load freely and reduce carbon footprint in contemporary energy environment.

Clarification of Taxonomic Status within the Pseudomonas syringae Species Group Based on a Phylogenomic Analysis

Directory of Open Access Journals (Sweden)

Margarita Gomila

2017-12-01

Full Text Available The Pseudomonas syringae phylogenetic group comprises 15 recognized bacterial species and more than 60 pathovars. The classification and identification of strains is relevant for practical reasons but also for understanding the epidemiology and ecology of this group of plant pathogenic bacteria. Genome-based taxonomic analyses have been introduced recently to clarify the taxonomy of the whole genus. A set of 139 draft and complete genome sequences of strains belonging to all species of the P. syringae group available in public databases were analyzed, together with the genomes of closely related species used as outgroups. Comparative genomics based on the genome sequences of the species type strains in the group allowed the delineation of phylogenomic species and demonstrated that a high proportion of strains included in the study are misclassified. Furthermore, representatives of at least 7 putative novel species were detected. It was also confirmed that P. ficuserectae, P. meliae, and P. savastanoi are later synonyms of P. amygdali and that “P. coronafaciens” should be revived as a nomenspecies.

Economic Sustainability of Italian Greenhouse Cherry Tomato

Directory of Open Access Journals (Sweden)

Riccardo Testa

2014-11-01

Full Text Available Greenhouse tomato cultivation plays an important role in Sicily, being the primary production area in Italy, due to its favorable pedo-climatic conditions that permit extra-seasonal productions. In Sicily, more than half of greenhouse tomato production is derived from the Province of Ragusa on the southeastern coast, where especially cherry tomato typologies are cultivated. Over the last decade, the Ragusa Province has registered a decrease both in terms of greenhouse tomato area and harvested production due to several structural problems that would require restructuring of the tomato supply chain. Thus, since recognition of real costs and profitability of tomato growing is a vital issue, both from the perspective of the farm, as well as from that of the entrepreneur, the aim of this paper was to analyze the economic sustainability of Sicilian greenhouse cherry tomato cultivated in the Ragusa Province. In particular, an economic analysis on 30 representative farms was conducted in order to estimate production costs and profits of greenhouse cherry tomato. According to our results, the lack of commercial organization, which characterizes the small farms we surveyed, determines low contractual power for farmers and, consequently, low profitability.

The market for photovoltaic (PV) technology

International Nuclear Information System (INIS)

Frantzis, L.; Vejtasa, K.M.

1993-01-01

This paper describes a study that was intended to provide the Electric Power Research Institute (EPRI) with a market analysis for photovoltaic (PV) technologies under development by EPRI and others. The analysis was to focus on markets and factors leading to significant incremental growth for PV demand, large enough to support more efficient scale PV manufacturing capacity. EPRI anticipates that PV ultimately could provide grid-connected power, however, the 1995--2010 market dynamics are uncertain. The specific objectives of this study, therefore, were to: determine what major future domestic US markets for PV technologies will emerge and provide enough volume to support significant improvements in manufacturing costs through manufacturing economies of scale; provide insight on what is needed to gain acceptance of PV technologies for electric power generation in those major markets; provide insight on when investments in demonstration and manufacturing facilities should be made and what is needed to be successful in each element of the business that these markets could support (e.g., technology development, manufacturing, sales, installation, and service); and provide key insights on the requirements for commercial success of PV in the utility sector

Mineral Content in Leaves of Tomato Plants Grafted on Solanum Rootstocks

OpenAIRE

松添, 直隆; 間, 浩美; 花田, 勝美; モハメド, アリ; 大久保, 敬; 藤枝, 國光

1995-01-01

Nutrient uptake of tomato plants cv. Momotaro grafted on Solanum sisymbriifoliulm, S. torvum and S. toxicarium which are resistant to soil-born disease were compared with tomato grafted on its own root, a tomato/tomato, scion/rootstock combination. Mineral content in leaves of tomato/S. sisymbriifoliulm was nearly equal to that of tomato/tomato. In leaves of tomato/S. torvum, nitrogen content was higher, and magnesium content was lower than those of tomato/tomato. Furthermore, phosphorus and ...

Plastid and Stromule Morphogenesis in Tomato

Science.gov (United States)

PYKE, KEVIN A.; HOWELLS, CAROLINE A.

2002-01-01

By using green fluorescent protein targeted to the plastid organelle in tomato (Lycopersicon esculentum Mill.), the morphology of plastids and their associated stromules in epidermal cells and trichomes from stems and petioles and in the chromoplasts of pericarp cells in the tomato fruit has been revealed. A novel characteristic of tomato stromules is the presence of extensive bead‐like structures along the stromules that are often observed as free vesicles, distinct from and apparently unconnected to the plastid body. Interconnections between the red pigmented chromoplast bodies are common in fruit pericarp cells suggesting that chromoplasts could form a complex network in this cell type. The potential implications for carotenoid biosynthesis in tomato fruit and for vesicles originating from beaded stromules as a secretory mechanism for plastids in glandular trichomes of tomato is discussed. PMID:12466096

Development of immunofluorescence colony staining (IFC) for detection of Xanthomonas campestris pv. vesicatoria and Clavibacter michiganensis subsp michiganensis in tomato seeds

NARCIS (Netherlands)

Nemeth, J.; Vuurde, van J.W.L.

2006-01-01

Immunofluorescence colony-staining (IFC) is based on sample pour plating in combination with immunofluorescence staining for recognition of the target colony. IFC was optimised for detecting Xanthomonas campestris pv. vesicatoria (Xcv) and Clavibacter michiganensis subsp. michiganensis (Cmm) in

AP2/ERF Transcription Factors Involved in Response to Tomato Yellow Leaf Curly Virus in Tomato

Directory of Open Access Journals (Sweden)

Ying Huang

2016-07-01

Full Text Available Tomato yellow leaf curly virus (TYLCV, transmitted by the whitefly (, causes leaf curling and yellowing, plant dwarfism, and growth inhibition in tomato ( L.. The APETALA2 (AP2 and ethylene response factor (ERF transcription factor (TF family, the largest plant-specific TF family, was identified to function in plant development and pathogen defense. Our study aimed to analyze the mechanism underlying the function of ERF (SlERF TFs in response to TYLCV infection and improve useful information to increase the resistance to TYLCV in tomato. A total of 22 tomato AP2/ERF TFs in response to TYLCV were identified according to transcriptome database. Five ERF-B3 TFs were identified in cultivars Hongbeibei (highly resistant, Zheza-301, Zhefen-702 (both resistant, Jinpeng-1, and Xianke-6 (both susceptible. Interaction network indicated that SlERF TFs could interact with mitogen-activated protein kinase (MAPK. Expression profiles of five ERF-B3 genes (, , , , and were detected by quantitative real-time–polymerase chain reaction (qRT-PCR after TYLCV infection in five tomato cultivars. expression was upregulated in five tomato cultivars. The expressions of three genes (, , and were upregulated in Zheza-301 and Zhefen-702. and expressions were downregulated in Hongbeibei and Xianke-6, respectively. Yeast one-hybrid showed that the GCC-box binding ability of ERF-B3 TFs differed in resistant and susceptible tomato cultivars. Expression profiles were related to the GCC-box binding ability of SlERF TFs in resistant and susceptible tomato cultivars. The defense mechanism underlying the tomato’s response to TYLCV involved a complicated network, which provided important information for us in breeding and genetic analysis.

Pepino mosaic virus and Tomato chlorosis virus causing mixed infection in protected tomato crops in Sicily

Directory of Open Access Journals (Sweden)

SALVATORE DAVINO

2008-07-01

Full Text Available An unusual virus-like yellow leaf disorder associated with fruit marbling was observed during the winter of 2005 in some greenhouse tomato crops in the province of Ragusa Sicily (Southern Italy. Leaf samples from 250 symptomatic tomato plants were serologically tested by DAS-ELISA technique for 5 viruses: Tomato spotted wilt virus (TSWV, Impatiens necrotic spot virus (INSV, Tobacco mosaic virus (TMV, Cucumber mosaic virus (CMV and Pepino mosaic virus (PepMV. PepMV was detected in 215 of the samples. The virus was mechanically transmitted to cucumber, wild metel, wild tobacco and ‘Rio Grande’ tomato. The experimental host range of PepMV-Ragusa differed from that of the PepMV found in Sardinia in 2001, which infected ‘Camone’ tomato. By applying RT-PCR to 25 PepMV-infected tomato plants, the expected 844 bp DNA fragment for PepMV and the expected 439 bp DNA fragment for Tomato chlororis virus (ToCV were obtained from all the samples tested. Sequences of the obtained amplicons were used to study the phylogenetic relationships of the viruses with isolates from other countries. Nucleotide sequence alignments showed that the sequence CP-PepMV-Ragusa (Genbank acc. No. DQ 517884 were 99% homologous with both US2 and Spain-Murcia isolates, while those of ToCV-Ragusa (Genbank acc. No. DQ517885 isolate HSP70, were 99% homologous with the Florida isolate, and 98% with the Lebanon isolate. The results proved that the unusual disorder found in greenhouse tomatoes in Sicily can be associated with infections by PepMV and ToCV, reported for the first time in a mixed infection.

Carotenoids and lycopene content in fresh and dried tomato fruits and tomato juice

Directory of Open Access Journals (Sweden)

Andrea Mendelová

2013-01-01

Full Text Available Important component of the tomato are carotenoid dyes, especially lycopene. The importance of lycopene in the diet of people in recent years has grown mainly for its pharmacological effects due to its ability to reduce the risk of carcinoma diseases and prevention of cardiovascular diseases. The aim of this work was to analyze the content of total carotenoids and lycopene in 8 varieties of tomato and to monitor dynamic changes after their different treatments (heating, drying. The experiment included following tomato varieties: Bambino F1, Darina F1, Diana F1, Denár, Milica F1, Orange F1, Paulína F1, Šejk F1.We found that processing of tomato fruits into juices and dried slices positively affected the presence of carotenoids and lycopene. Processing leads to an increase in the content of carotenoids that can be attributed to better availability of these components in the human body.

Design of Tomato Drying System by Utilizing Brine Geothermal

Science.gov (United States)

Afuar, W.; Sibarani, B.; Abdurrahman, G.; Hendrarsakti, J.

2016-09-01

Cultivation of tomato plants in Indonesia has been started since 1961.Tomatoes generally will rot in three days if left on storage. Moreover, low quality tomatoes have cheaper price. After harvested, tomatoes need to be treated by drying process so it can last longer. Energy for drying tomatoes can be obtained by utilizing heat from geothermal brine. Purpose of this research is to design a tomato drying system by extracting heat of geothermal brine from separator with certain flow rate to heat up water by using a heat exchanger. Furthermore, this water will be used to heat up the surrounding air which is circulated by blower system to heat up the tomatoes chamber. Tomatoes drying process needs temperature range of 50-70°C to evaporate water content from 95.7% to 26%. After that treatment, the tomatoes are expected to have better durability. The objective of this study is to determine the quantity of hot brine which is needed for drying tomatoes and to design a drying system so that tomatoes can last longer.

Accumulation of anthocyanins in tomato skin extends shelf life.

Science.gov (United States)

Bassolino, Laura; Zhang, Yang; Schoonbeek, Henk-Jan; Kiferle, Claudia; Perata, Pierdomenico; Martin, Cathie

2013-11-01

Shelf life is one of the most important traits for the tomato (Solanum lycopersicum) industry. Two key factors, post-harvest over-ripening and susceptibility to post-harvest pathogen infection, determine tomato shelf life. Anthocyanins accumulate in the skin of Aft/Aft atv/atv tomatoes, the result of introgressing alleles affecting anthocyanin biosynthesis in fruit from two wild relatives of tomato, which results in extended fruit shelf life. Compared with ordinary, anthocyanin-less tomatoes, the fruits of Aft/Aft atv/atv keep longer during storage and are less susceptible to Botrytis cinerea, a major tomato pathogen, post-harvest. Using genetically modified tomatoes over-producing anthocyanins, we confirmed that skin-specific accumulation of anthocyanins in tomato is sufficient to reduce the susceptibility of fruit to Botrytis cinerea. Our data indicate that accumulation of anthocyanins in tomato fruit, achieved either by traditional breeding or genetic engineering can be an effective way to extend tomato shelf life. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

ECONOMIC EFFICIENCY IN TOMATOES PRODUCTION IN GREENHOUSES

Directory of Open Access Journals (Sweden)

A POPESCU

2003-07-01

Full Text Available This study aimed to appreciate the evolution of economic efficiency in tomatoes production in greenhouses within a private firm situated next to the capital. The firm owns 4 ha greenhouses and the weight of tomatoes crop in the cultivated area is just 38.75 %. In fact, during the last three years, the tomatoes cultivated surface has been diminished in favour of flowers production which, like tomatoes production is an important income source for any producer. The reduction of the tomatoes cultivated area was compensated by the increase of intensification grade using new high performance hybrids and modern technologies. Thus, the scientific production management has been looking for maintaining the total production at the same level from a year to another by an increased average tomatoes yield by 53.33 % . The continuous increase of farm input price has doubled the cost per surface unit and increased the cost per tomatoes kilogram by 33 %. The increase of tomatoes demand and of market price by 31 % have had a positive influence on the farm incomes which has doubled during the last three years. In the year 2000, the company has obtained USD 41,818 income/ha of which subtracting the related production cost we can easily get USD 4,815 profit/ha. The average profit rate recorded by the firm is 13 % in the period 2000-2002, when the study was made. As a conclusion, tomatoes production in greenhouses is a good deal. To keep a high economic efficiency, under the diminishing of the cultivated area, the producers have to increase average tomatoes production by using high performance technology based on high economic value hybrids.

Isolation and composition of chromoplasts from tomatoes.

Science.gov (United States)

Hansen, Linn U; Chiu, Mei-Chen M

2005-08-24

The fruit of the tomato plant is composed of elongated tomato cells filled with organelles called chromoplasts (plastids). These plastids scattered throughout the cell are rich in nutrients, particularly protein (33%) and lipids (20%). They can be released from the cells by rupture of their cell membranes and then isolated. Plastids and their cell contents can be utilized by the food-processing industry for the preparation of special food products. This study was designed to examine the macronutrient content of isolated tomato plastids and, therefore, determine its potential nutritional value. Use of tomato plastids in pasta sauces and rice dishes, salsa, and extrusion products would increase the nutritional value of the product. Because glucose has been removed in the process of plastid isolation, tomato plastids are useful in the diets of diabetics and cardiovascular patients, as well as for patients in need of weight reduction. Composition comparison of tomato plastid is made with tomato paste, from which glucose has not been removed. Many people require low-sugar products for medical reasons (diabetics and those with cardiovascular disease) and others for weight loss. Therefore, tomato chromoplasts having high protein and lipid contents and low sugar content may be useful in meeting these particular human needs.

Experimental investigation of PV modules recycling; PV module recycle no jikkenteki kento

Energy Technology Data Exchange (ETDEWEB)

Unagida, H; Kurokawa, K [Tokyo University of Agriculture and Technology, Tokyo (Japan); Sakuta, K; Otani, K; Murata, K [Electrotechnical Laboratory, Tsukuba (Japan)

1997-11-25

Recycling, cost/energy analysis and recovery experiment were made on crystalline silicon PV modules with EVA(ethylene vinyl acetate)-laminated structure. The life of modules is dependent not on performance deterioration of PV cells themselves but on yellowing or poor transmittance of EVA caused by ultraviolet ray, and disconnection between cells by thermal stress. Recovery is carried out in 3 stages of cell, wafer and material. Recovery in the stages of cell and wafer results in considerable reduction of energy and cost. The recovery experiment was carried out using PV module samples prepared by cutting the modules into 25times15mm pieces after removing Al frames from the used modules, peeling back sheets and cutting off EVA. Since a nitric acid process at 70-80degC can dissolve EVA effectively, it is promising for reuse of surface glass and PV cells as they are. This process is also carried out under a condition around room temperature and pressure, contributing to cost reduction and energy saving for recycling. Generation of harmful NOx is only a problem to be solved. 2 refs., 6 figs., 1 tab.

A Practical Irradiance Model for Bifacial PV Modules

Energy Technology Data Exchange (ETDEWEB)

Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford

2017-06-21

A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using ray tracing software.

POSTHARVEST FUNGAL DETERIORATION OF TOMATO ...

African Journals Online (AJOL)

Dr A.B.Ahmed

commercial food vendors often intentionally use physically damaged tomatoes and ... The production of the bulk of the fresh tomato and. 'tatase' in Nigeria is in ...... mycotoxin contamination of food include but not limited to mycotoxicoses, liver ...

Adaptation of bacteriophages to new hosts through overcoming the interspecific barrier

Directory of Open Access Journals (Sweden)

Е. N. Andriychuk

2016-10-01

Full Text Available Four wild type phage isolates were tested on P. syringae isolated from potato tuber samples collected in the Kiev and Cherkasy regions of Ukraine. The isolated phages formed clear plaques and had a virion size of 2 to 12 nm. Electron microscopy showed that the phages were of similar size and structure and consisted of isometric particles with long tails characteristic of the Podoviridae family. The effectiveness of phage culturing on bacteria different from the original host was also studied on two phytopathogenic strains of Pseudomonas savastanoi pv. рhaseolicola 4013 and P. syringae pv. tabaci 223. However, no stable isolates could be extracted from P. savastanoi pv. phaseolicola as the plages became inactive after a few passages on the bacterial culture. In order to overcome this, the phages were first cultured on P. syringae pv. tabaci before being transferred to P. savastanoi pv. рhaseolicola. The titers obtained were compared with phage titers from the original host bacteria. Thus, it was determined that the changes occuring in phages after their transfer to the Pseudomonas strain 4013 were irreversible. The changes were evaluated by comparing the effectiveness of phage culturing after a cycle of passages on strains 4013 and 223 where the phages were adapted to strain 4013 after being cultured on strain 223. Additionally, the effectiveness of phage culturing on strain 223 was also determined. The change in the effectiveness of phage culturing for the entire phage range suggests the presence of a defensive system in bacteria when the phages were transferred from strain 223 to strain 4013. The irreversibility of the changes occuring in phages was also tested and it was determined that phages 223/4 and 7591/2 adapt to original hosts and swiftly restore their original titers. Phage 7591/1, however, showed titers that were lower than the ones obtained from the original host culture. The testing of the irreversibility of changes in phages

Analysis of Clonostachys rosea-induced resistance to tomato gray mold disease in tomato leaves.

Directory of Open Access Journals (Sweden)

Liana Dalcantara Ongouya Mouekouba

Full Text Available Tomato gray mold disease, caused by Botrytis cinerea, is a serious disease in tomato. Clonostachys rosea is an antagonistic microorganism to B. cinerea. To investigate the induced resistance mechanism of C. rosea, we examined the effects of these microorganisms on tomato leaves, along with changes in the activities of three defense enzymes (PAL, PPO, GST, second messengers (NO, H2O2, O2(- and phytohormones (IAA, ABA, GA3, ZT, MeJA, SA and C2H4. Compared to the control, all treatments induced higher levels of PAL, PPO and GST activity in tomato leaves and increased NO, SA and GA3 levels. The expression of WRKY and MAPK, two important transcription factors in plant disease resistance, was upregulated in C. rosea- and C. rosea plus B. cinerea-treated samples. Two-dimensional gel electrophoresis analysis showed that two abundant proteins were present in the C. rosea plus B. cinerea-treated samples but not in the other samples. These proteins were determined (by mass spectrum analysis to be LEXYL2 (β-xylosidase and ATP synthase CF1 alpha subunit. Therefore, C. rosea plus B. cinerea treatment induces gray mold resistance in tomato. This study provides a basis for elucidating the mechanism of C. rosea as a biocontrol agent.

Impact of high-intensity pulsed electric fields on carotenoids profile of tomato juice made of moderate-intensity pulsed electric field-treated tomatoes.

Science.gov (United States)

Vallverdú-Queralt, Anna; Odriozola-Serrano, Isabel; Oms-Oliu, Gemma; Lamuela-Raventós, Rosa M; Elez-Martínez, Pedro; Martín-Belloso, Olga

2013-12-01

The effect of pulsed electric fields (PEF) on the carotenoid content of tomato juices was studied. First, moderate-intensity PEF (MIPEF) was applied to raw tomatoes. Afterwards, MIPEF-treated and untreated tomatoes were immediately refrigerated at 4 °C for 24 h and then, they were separately ground to produce tomato juices. Juices were treated by heat treatments or by high-intensity PEF (HIPEF) and stored under refrigeration for 56 days. MIPEF treatment of tomatoes increased the content of carotenoid compounds in tomato juices. An enhancement of 63-65% in 15-cis-lycopene was observed in juices prepared with MIPEF-treated tomatoes. A slight increase in cis-lycopene isomers was observed over time, whereas other carotenoids slightly decreased. However, HIPEF treated tomato juices maintained higher carotenoid content (10-20%) through the storage time than thermally and untreated juices. The combination of MIPEF and HIPEF treatments could be used not only to produce tomato juices with high carotenoid content but also, to maintain higher the carotenoid content during storage time. Copyright © 2013 Elsevier Ltd. All rights reserved.

Power of design - the future of building-integrated PV

International Nuclear Information System (INIS)

Abbate, Cinzia

2001-01-01

This paper discusses strategies to make building integrated photovoltaic (PV) systems more acceptable and to allow PV material to compete with conventional construction material. The history of developments in building integration and difficulties encountered by architects wishing to use PV products are explored, and the Dutch Amersfoot project in Utrecht involving a new suburb of 501 house covered with PV panels is described. Questions raised regarding architectural integration of PV systems, and PV systems and the construction market are discussed. The Italian PV programme, financial and political constraints, and the positioning of PV on existing structures are reported

Microbial contaminants of cultured Hibiscus cannabinus and Telfaria ...

African Journals Online (AJOL)

Nine microbial contaminants comprising of five bacteria and four fungi species were isolated from Hibiscus cannabinus and Telfaria occidentalis cultured tissues. The rate of occurrence of bacteria isolates was higher than that of fungi. The bacterial isolates includes Pseudomonas syringae pv phaseolicoli, Bacillus ...

PSCAD Modules Representing PV Generator

Energy Technology Data Exchange (ETDEWEB)

Muljadi, E.; Singh, M.; Gevorgian, V.

2013-08-01

Photovoltaic power plants (PVPs) have been growing in size, and the installation time is very short. With the cost of photovoltaic (PV) panels dropping in recent years, it can be predicted that in the next 10 years the contribution of PVPs to the total number of renewable energy power plants will grow significantly. In this project, the National Renewable Energy Laboratory (NREL) developed a dynamic modeling of the modules to be used as building blocks to develop simulation models of single PV arrays, expanded to include Maximum Power Point Tracker (MPPT), expanded to include PV inverter, or expanded to cover an entire PVP. The focus of the investigation and complexity of the simulation determines the components that must be included in the simulation. The development of the PV inverter was covered in detail, including the control diagrams. Both the current-regulated voltage source inverter and the current-regulated current source inverter were developed in PSCAD. Various operations of the PV inverters were simulated under normal and abnormal conditions. Symmetrical and unsymmetrical faults were simulated, presented, and discussed. Both the three-phase analysis and the symmetrical component analysis were included to clarify the understanding of unsymmetrical faults. The dynamic model validation was based on the testing data provided by SCE. Testing was conducted at SCE with the focus on the grid interface behavior of the PV inverter under different faults and disturbances. The dynamic model validation covers both the symmetrical and unsymmetrical faults.

OnToPV - a virtual guidance through the PV-plant ''Solardach New Munich Trade Fair''; OnToPV - eine virtuelle Fuehrung druch die PV-Anlage ''Solardach Neue Messe Muenchen''

Energy Technology Data Exchange (ETDEWEB)

Stich, C.; Becker, G.; Zehner, M. [Fachhochschule Muenchen (Germany). Fachbereich Elektrotechnik; Giesler, B. [Shell Solar GmbH, Muenchen (Germany); Weber, W.; Flade, F. [Solarenergiefoerderverein Bayern e.V., Muenchen (Germany)

2003-07-01

OnToPV is the project of an online tour guide through the PV-plant of the new Munich trade fair. The first focs was to provide an interactive circuit of a PV-plant. Within a virtual tour different areas of the plant should be made accessible over the internet. For this purpose a three-dimensional, multimedia guidance was developed for the PV-plant of the new Munich trade fair with informative diagrams, *.pdf-files and retrievable video-files. In such a way interested internet-users could experience with minimum system requirements, local- and time-independently the PV-plant in its structure and components and could receive different background informations in addition. From the view of the plant operators such an internet project serves on the one hand as an additional source of information where questions could be referred to and on the other hand as sort of advertisement for the technology and the PV-system. In addition the attractiveness of the internet appearance of the plant operator rises and the public awareness of such projects could increase. Seen from the user perspective - such an internet project gives private or business users the possibility to inform themselves interactively, purposefully and with the possibility to move through the plant on their own. Users could utilize the guidance through the plant without overcoming far geographical distances, saving time and money. Perhaps this source of information helps awaking a larger consciousness for renewable energies. The result OnToPV showed the various possibilities offered by projects of this kind in the internet. Ideas of possible extensions as for example the integration of current PV-plant operational data or of a virtual learning platform illustrate the perspectives of the project. Virtual guidance of this kind for various types of power plants are conceivable. (orig.)

Carotenes in processed tomato after thermal treatment

NARCIS (Netherlands)

Luterotti, S.; Bicanic, D.D.; Markovic, K.; Franko, M.

2015-01-01

This report adds to the ongoing vivid dispute on the fate of carotenes in tomato upon thermal processing. Although many papers dealing with changes in the raw tomatoes during industrial treatment have already appeared, data on the fate of finished, processed tomato products when they are

λ-Carrageenan Suppresses Tomato Chlorotic Dwarf Viroid (TCDVd Replication and Symptom Expression in Tomatoes

Directory of Open Access Journals (Sweden)

Jatinder S. Sangha

2015-05-01

Full Text Available The effect of carrageenans on tomato chlorotic dwarf viroid (TCDVd replication and symptom expression was studied. Three-week-old tomato plants were spray-treated with iota(ɩ-, lambda(λ-, and kappa(κ-carrageenan at 1 g·L−1 and inoculated with TCDVd after 48 h. The λ-carrageenan significantly suppressed viroid symptom expression after eight weeks of inoculation, only 28% plants showed distinctive bunchy-top symptoms as compared to the 82% in the control group. Viroid concentration was reduced in the infected shoot cuttings incubated in λ-carrageenan amended growth medium. Proteome analysis revealed that 16 tomato proteins were differentially expressed in the λ-carrageenan treated plants. Jasmonic acid related genes, allene oxide synthase (AOS and lipoxygenase (LOX, were up-regulated in λ-carrageenan treatment during viroid infection. Taken together, our results suggest that λ-carrageenan induced tomato defense against TCDVd, which was partly jasmonic acid (JA dependent, and that it could be explored in plant protection against viroid infection.

PV monitoring at Jubilee Campus - Nottingham University

Energy Technology Data Exchange (ETDEWEB)

Riffat, S.B.; Gan, G.

2002-07-01

This report summarises the results of a project monitoring the efficiency of photovoltaic (PV) modules integrated in the roofs of atria to meet the energy consumption needs of ventilation fans in the academic buildings at the Jubilee Campus of the University of Nottingham. Details are given of the instrumentation of one atrium to allow the monitoring the effectiveness of the ventilation in cooling the PV arrays integrated in the atrium roof, the economic analysis of the benefit of cooling the PV system, and the use of computational fluid dynamics (CFD) modelling to predict the performance of the atrium. The design of the PV system, the calculated system efficiency, the high cost of atrium integrated PV power supplies, the periodic failure of the inverters, and the overheating of the PV array and the atrium space in the summer are discussed.

Consumer attitudes and preferences for fresh market tomatoes.

Science.gov (United States)

Oltman, A E; Jervis, S M; Drake, M A

2014-10-01

This study established attractive attributes and consumer desires for fresh tomatoes. Three focus groups (n = 28 participants) were conducted to explore how consumers perceived tomatoes, including how they purchased and consumed them. Subsequently, an Adaptive Choice Based Conjoint (ACBC) survey was conducted to understand consumer preferences toward traditional tomatoes. The ACBC survey with Kano questions (n = 1037 consumers in Raleigh, NC) explored the importance of color, firmness, size, skin, texture, interior, seed presence, flavor, and health benefits. The most important tomato attribute was color, then juice when sliced, followed by size, followed by seed presence, which was at parity with firmness. An attractive tomato was red, firm, medium/small sized, crisp, meaty, juicy, flavorful, and with few seeds. Deviations from these features resulted in a tomato that was rejected by consumers. Segmentations of consumers were determined by patterns in utility scores. External attributes were the main drivers of tomato liking, but different groups of tomato consumers exist with distinct preferences for juiciness, firmness, flavor, and health benefits. Conjoint analysis is a research technique that collects a large amount of data from consumers in a format designed to be reflective of a real life market setting and can be combined with qualitative insight from focus groups to gain information on consumer consumption and purchase behaviors. This study established that the most important fresh tomato attributes were color, amount of juice when sliced, and size. Distinct consumer clusters were differentiated by preference for color/appearance, juiciness and firm texture. Tomato growers can utilize the results to target attributes that drive consumer choice for fresh tomatoes. © 2014 Institute of Food Technologists®

PV-DSM: Policy actions to speed commercialization

International Nuclear Information System (INIS)

Hoff, T.; Wenger, H.J.; Keane, D.M.

1993-01-01

Pacific Gas and Electric Company (PG ampersand E) recently applied Demand-Side Management (DSM) evaluation techniques to photovoltaic (PV) technology to develop the concept of photovoltaics as a Demand-Side Management option (PV-DSM). The analysis demonstrated that PV-DSM has the potential to be economically attractive. Two criticisms in response to that analysis are that the assumptions of 25 year financing and a 25 year evaluation period are unrealistic. This paper responds to those criticisms and documents the mathematical relationships to calculate the value of PV-DSM from a customer's perspective. It demonstrates how regulatory and government agencies could implement policies to resolve both issues and speed PV commercialization

The Tomato Fni3 Lysine-63–Specific Ubiquitin-Conjugating Enzyme and Suv Ubiquitin E2 Variant Positively Regulate Plant Immunity[C][W

Science.gov (United States)

Mural, Ravi V.; Liu, Yao; Rosebrock, Tracy R.; Brady, Jennifer J.; Hamera, Sadia; Connor, Richard A.; Martin, Gregory B.; Zeng, Lirong

2013-01-01

The activation of an immune response in tomato (Solanum lycopersicum) against Pseudomonas syringae relies on the recognition of E3 ligase–deficient forms of AvrPtoB by the host protein kinase, Fen. To investigate the mechanisms by which Fen-mediated immunity is regulated, we characterize in this study a Fen-interacting protein, Fni3, and its cofactor, S. lycoperiscum Uev (Suv). Fni3 encodes a homolog of the Ubc13-type ubiquitin-conjugating enzyme that catalyzes exclusively Lys-63–linked ubiquitination, whereas Suv is a ubiquitin-conjugating enzyme variant. The C-terminal region of Fen was necessary for interaction with Fni3, and this interaction was required for cell death triggered by overexpression of Fen in Nicotiana benthamiana leaves. Fni3 was shown to be an active E2 enzyme, but Suv displayed no ubiquitin-conjugating activity; Fni3 and Suv together directed Lys-63–linked ubiquitination. Decreased expression of Fni3, another tomato Ubc13 homolog, Sl-Ubc13-2, or Suv in N. benthamiana leaves diminished cell death associated with Fen-mediated immunity and cell death elicited by several other resistance (R) proteins and their cognate effectors. We also discovered that coexpression of Fen and other R proteins/effectors with a Fni3 mutant that is compromised for ubiquitin-conjugating activity diminished the cell death. These results suggest that Fni3/Sl-Ubc13-2 and Suv regulate the immune response mediated by Fen and other R proteins through Lys-63–linked ubiquitination. PMID:24076975

The possibility of developing hybrid PV/T solar system

Science.gov (United States)

Dobrnjac, M.; Zivkovic, P.; Babic, V.

2017-05-01

An alternative and cost-effective solution to developing integrated PV system is to use hybrid photovoltaic/thermal (PV/T) solar system. The temperature of PV modules increases due to the absorbed solar radiation that is not converted into electricity, causing a decrease in their efficiency. In hybrid PV/T solar systems the reduction of PV module temperature can be combined with a useful fluid heating. In this paper we present the possibility of developing a new hybrid PV/T solar system. Hybrid PV/T system can provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation. We developed PV/T prototype consisted of commercial PV module and thermal panel with our original solution of aluminium absorber with special geometric shapes. The main advantages of our combined PV/T system are: removing of heat from the PV panel; extending the lifetime of photovoltaic cells; excess of the removing heat from PV part is used to heat the fluid in the thermal part of the panel; the possibility of using on the roof and facade constructions because less weight.

Antioxidant Activity from Various Tomato Processing

Directory of Open Access Journals (Sweden)

Retno Sri Iswari

2016-04-01

Full Text Available Tomato is one of the high antioxidant potential vegetables. Nowadays, there are many techniques of tomato processings instead of fresh consumption, i.e. boiled, steamed, juiced and sauteed. Every treatment of cooking will influence the chemical compound inside the fruits and the body's nutrition intake. It is important to conduct the research on antioxidant compound especially lycopene, β-carotene, vitamin C, α-tocopherol, and its activity after processing. This research has been done using the experimental method. Tomatoes were cooked into six difference ways, and then it was extracted using the same procedure continued with antioxidant measurement. The research results showed that steaming had promoted the higher antioxidant numbers (lycopene. α-tocopherol, β-carotene and vitamin C and higher TCA and antioxidant activities in the tomatoes than other processings. It was indicated that steaming was the best way to enhance amount, capacity and activities of antioxidants of the tomatoes.

PV Obelisk - Information system with photovoltaics

International Nuclear Information System (INIS)

Ruoss, D.; Rasmussen, J.

2004-01-01

This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed

Flavor characteristics of the juices from fresh market tomatoes differentiated from those from processing tomatoes by combined analysis of volatile profiles with sensory evaluation.

Science.gov (United States)

Iijima, Yoko; Iwasaki, Yumi; Otagiri, Yuji; Tsugawa, Hiroshi; Sato, Tsuneo; Otomo, Hiroe; Sekine, Yukio; Obata, Akio

2016-12-01

Various commercial tomato juices with different flavors are available at markets worldwide. To clarify the marker compounds related to the flavor characteristics of tomato juice, we analyzed 15 pure commercial tomato juices by a combination of volatile profiling and sensory evaluation. The correlations among volatiles and the relationship between volatiles and sensory descriptors were elucidated by multivariate analyses. Consequently, the tomato juices made from fresh market tomatoes (including the popular Japanese tomato variety "Momotaro") were clearly separated from other juices made from processing tomatoes, by both the volatile composition and sensory profiles. cis-3-Hexenol, hexanal, and apocarotenoids negatively contributed to the juices from fresh market tomatoes, whereas Strecker aldehydes and furfural showed positive contributions to the juices. Accordingly, the sensory characteristics of juices from fresh market tomatoes were related to cooked and fruity flavors but not to green or fresh notes.

The new NOZ-PV: Market-oriented

International Nuclear Information System (INIS)

Ter Horst, E.

1995-01-01

In the proposal for the new National Research Program for Photovoltaics (NOZ-PV) 1995-1999 the focus is on four subjects: solar cell technology, the industrial support, the stimulation of autonomous, favorable applications and markets for PV, and the realization of a training program PV in the Built Areas. The program will be carried out as a market-oriented program. 1 tab., 2 figs

Annual technical report. PV domestic field trial

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

This report describes progress at the first five sites of the UK photovoltaic (PV) domestic field trial. All five sites are generating electricity, but one has not yet been commissioned and two sites are not yet monitoring performance. The BedZED development has roof-mounted PV modules and PV cells installed in sealed double-glazing. Solar slates/tiles have been installed at the Laing Homes development in Montagu Road, where the designer has sought to minimise the visual impact of the PV system on the roofs. At Hunters Moon, PV modules have been retrofitted and some unforeseen difficulties have arisen. PV is an integral part of the roof design at the state-of-the-art low energy development by Integer Houses at Greenfields. Corn Croft uses a British mounting system to facilitate integration of the modules flush with the roof. Installation issues and the progress of the trial are discussed.

Multicompartment analysis of the effects of fertilizing nitrogen form, quantity of potassium fertilizer and tomato variety upon tomato-fruit sugar metabolism

International Nuclear Information System (INIS)

Watanabe, Kazuhiko; Mori, Masato; Kubo, Yunosuke; Takeba, Tsuyoshi.

1977-01-01

Concerning ''streaky decay'' of tomato fruits, the sugar metabolism of tomato fruits has been studied by multicompartment analysis dividing the radioactivity into 14 C-glucose non-absorbing, ethanol soluble, carbonic acid gas and ethanol insoluble compartments. 14 C-glucose was introduced to pieces of tomato fruits about 60 days after fructification. Influence in the stage of 14 C-glucose entry into the tissue was recognized in a tomato variety affected by excess ammonia and a tomato variety affected by potassium shortage on the carbonic acid gas generation portion. The decrease of metabolism turnover from the ethanol soluble to the insoluble compartment was remarkable in the tomato variety so nutritionally treated as to be apt to cause streaky decay and the variety susceptible to it. (Mori, K.)

PV in a sports arena; PV im Hexenkessel

Energy Technology Data Exchange (ETDEWEB)

Hoeche, B.

2008-05-19

The German soccer club Werder Bremen is reconstructing its stadium. Apart from higher spectator comfort and a better atmosphere, there will also be PV systems on the roof and external walls of the arena. (orig.)

The PV market - Past, present, and future

International Nuclear Information System (INIS)

Hammond, B.

1992-01-01

This paper forecasts the photovoltaic (PV) market growth for the 1900's. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market, however, is highly dependent on a number of market factors such as the cost of conventional energy, the cost of PV systems, utility acceptance of PV, and regulatory controls. Government and institutional regulations, environmental issues, OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer, stand-alone, and utility markets. PV has unique attributes which make it a desirable source of energy in specific applications. It is a renewable source of energy, non-polluting, very reliable, predictable, low maintenance, modular, and has a very low operating cost. The energy source (sunlight) is distributed around the globe. Its limitations are high initial cost, no inherent energy storage, and low energy density

Optimal Design of Modern Transformerless PV Inverter Topologies

DEFF Research Database (Denmark)

Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede

2013-01-01

the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inverter design variables are derived for each PV inverter topology and installation site. The H5, H6, neutral point...... clamped, active-neutral point clamped and conergy-NPC PV inverters designed using the proposed optimization process feature lower levelized cost of generated electricity and lifetime cost, longer mean time between failures and inject more PV-generated energy into the electric grid than their nonoptimized......The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during...

PV-HYBRID and MINI-GRID. Proceedings

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

Within the 3rd European Conference at the Centre de Congres in Aix en Provence (France) between 11th and 12th May, 2006, the following lessons were held: (1) Small electric networks: European drivers and projects for the integration of RES and DG into the electricity grids of the future (Manuel Sanchez-Jimenez); (2) PV hybrid system within mini grids - IEA PVPS programme (Meuch Konraf); (3) Renewables for the developing world (Alvaro Ponce Plaza); (4) Rural electicity supply using photovoltaic / - Diesel hybrid systems: Attractive for investors in the renewable energy sector? (Andreas Hahn); (5) Economic analysis of stand-alone and grid-connected photovoltaic systems under current tariff structure of Taiwan (Yaw-Juen Wang); (6) Using wind-PV-diesel hybrid system for electrification of remote village in Western Libya (N.M. Kreama); (7) Venezuela's renewable energy program for small towns and rural areas ''Sembrando Luz'' (Jorge Torres); (8) AeroSmart5, the professional, sysem-compatible small-scale wind energy converter will be tested in field tests (Fabian Jochem); (9) Lifetime, test procedures and recommendations for optimal operating strategies for lead-acid-batteries in renewable energy systems - A survey on results from European projects from the 5th framework programme (Rudi Kaiser); (10) Prototype of a reversible fuel cell system for autonomous power supplies (Tom Smolinska); (11) Interconnection management in microgrids (Michel Vandenbergh); (12) Control strategy for a small-scale stand-alone power system based on renewable energy and hydrogen (Harald Miland); (13) Standard renewable electricity supply for people in rural areas - mini-grids in western provinces of China (Michael Wollny); (14) The Brava island a ''100% renewable energy'' project (Jean-Christian Marcel); (15) Breakthrough to a new era of PV-hybrid systems with the help of standardised components communication? (Michael Mueller); (16) Standardized

Environmental impact of PV cell waste scenario.

Science.gov (United States)

Bogacka, M; Pikoń, K; Landrat, M

2017-12-01

Rapid growth of the volume of waste from PV cells is expected in the following years. The problem of its utilization seems to be the most important issue for future waste management systems. The environmental impacts of the PV recycling scenario are presented in the manuscript. The analysis is based on the LCA approach and the average data available in specialized databases for silicon standard PV cell is used. The functional unit includes parameters like: efficiency, composition, surface area. The discussion on the environmental impact change due to the location of the PV production and waste processing plants is presented in the manuscript. Additionally, the discussion on the environmental effect of substituting different energy resources with PV cells is presented in the manuscript. The analysis of the PV cell life cycle scenario presented in the article was performed using the SIMA PRO software and data from Ecoinvent 3.0 database together with additional data obtained from other sources. Copyright © 2017 Elsevier Ltd. All rights reserved.

Novel laboratory mouse papillomavirus (MusPV) infection.

Science.gov (United States)

Ingle, A; Ghim, S; Joh, J; Chepkoech, I; Bennett Jenson, A; Sundberg, J P

2011-03-01

Most papillomaviruses (PVs) are oncogenic. There are at least 100 different human PVs and 65 nonhuman vertebrate hosts, including wild rodents, which have species-specific PV infections. Florid papillomatosis arose in a colony of NMRI-Foxn1(nu)/Foxn1(nu) (nude) mice at the Advanced Centre for Treatment Research and Education in Cancer in India. Lesions appeared at the mucocutaneous junctions of the nose and mouth. Histologically, lesions were classical papillomas with epidermal hyperplasia on thin fibrovascular stalks in a verrucous pattern. Koilocytotic cells were observed in the stratum granulosum of the papillomatous lesions. Immunohistochemically, these abnormal cells were positive for PV group-specific antigens. With transmission electron microscopy, virus particles were observed in crystalline intranuclear inclusions within keratinocytes. The presence of a mouse PV, designated MusPV, was confirmed by amplification of PV DNA with degenerative primers specific for PVs. This report is the first of a PV and its related disease in laboratory mice.

PV Working with Industry, 2nd Quarter, 2000

Energy Technology Data Exchange (ETDEWEB)

Poole, L.; Moon, S.

2000-06-29

NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The Second Quarter, 2000, issue is titled ``Our Shared PV Future''. It contains a review of several important PV-related meetings held in the prior three months: the NCPV Program Review, the 16 European PV Conference, and year-2000 Earth Day activities in Denver, CO. The editorialist is Paul Maycock, Publisher of PV News.

Screening of tomato genotypes for resistance to tomato fruit borer (helicoverpa armiger hubner) in Pakistan

International Nuclear Information System (INIS)

Sajjad, M.; Ashfaq, M.; Suhail, A.

2011-01-01

Tomato genotypes viz., Roma Local, Rio Grande, Tanja, Chico III, Long Tipped, Red-Top, FS-8001, FS-8002, Tropic, Pakit, Peelo, NARC-1, Roma VFN, Pant Bahr, Ebein, Nova Mech, Rockingham, Nagina, Shalkot-96, Pomodoro, Manik, Gressilesse, Nadir, Early Mech, Tommy, Pusha Rubi, Tropic boy, Big Long, Sahil, Sun 6002, Money-Maker and Royesta were evaluated to screen out the suitable resistant/susceptible genotypes against the fruit borer in Pakistan. The results imparted that the percentage of fruit infestation and larval population per plant on tested genotypes of tomato varied significantly. Roma VF, NARC-1 and FS-8002 were categorized as susceptible genotypes with fruit infestation (37.69%, 37.08% and 36.41%, respectively) and larval population per plant (1.02%, 1.02% and 0.84 %, respectively). Whereas, the genotypes Sahil, Pakit and Nova Mecb had fruit infestation (12.30%, 13.14% and 13.96%, respectively) and larval population per plant (0.42%, 0.42% and 0.43%, respectively) and declared as resistant genotypes to tomato fruit borer. Lower values of host plant susceptibility indices (HPSI) were recorded on resistant genotypes. Sahil, Pakit and Nova Mecb could be used as a source of resistance for developing tomato genotypes resistant to tomato fruit borer. (author)

Grid Integrated Distributed PV (GridPV) Version 2.

Energy Technology Data Exchange (ETDEWEB)

Reno, Matthew J.; Coogan, Kyle

2014-12-01

This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functio ns are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in th e OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function i n the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

Screening of tomato varieties for fruit tree based Agroforestry system

OpenAIRE

J. Hossain

2014-01-01

An experiment was conducted with four tomato varieties under a six year old orchard was accomplished at the Bangabandhu Sheikh Mujibur Rahman Agricultural University (BSMRAU) research farm during October 2011 to April 2012. The experiment was laid out in a Randomized Complete Block Design with three replications. Four tomato varieties (BARI Tomato 2, BARI Tomato 8, BARI Tomato 14 and BARI Tomato 15) were grown under guava, mango, olive and control. Results showed that light availability in co...

EFEITO ANTIBIÓTICO DO PRÓPOLIS SOBRE BACTÉRIAS FITOPATOGÊNICAS

OpenAIRE

BIANCHINI, L.; BEDENDO, I.P.

1998-01-01

O efeito antibiótico de extrato aquoso de própolis, em várias concentrações, foi avaliado para cinco espécies de bactérias fitopatogênicas. Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis e Xanthomonas axonopodis pv. phaseoli foram completamente inibidas em meio de cultura contendo 10% de extrato de própolis. Erwinia chrysanthemi foi parcialmente inibida, enquanto Pseudomonas syringae pv. tabaci se mostrou insensível ao extrato, desenvolvendo colônias idênticas àquel...

Flexible packaging for PV modules

Science.gov (United States)

Dhere, Neelkanth G.

2008-08-01

Economic, flexible packages that provide needed level of protection to organic and some other PV cells over >25-years have not yet been developed. However, flexible packaging is essential in niche large-scale applications. Typical configuration used in flexible photovoltaic (PV) module packaging is transparent frontsheet/encapsulant/PV cells/flexible substrate. Besides flexibility of various components, the solder bonds should also be flexible and resistant to fatigue due to cyclic loading. Flexible front sheets should provide optical transparency, mechanical protection, scratch resistance, dielectric isolation, water resistance, UV stability and adhesion to encapsulant. Examples are Tefzel, Tedlar and Silicone. Dirt can get embedded in soft layers such as silicone and obscure light. Water vapor transmittance rate (WVTR) of polymer films used in the food packaging industry as moisture barriers are ~0.05 g/(m2.day) under ambient conditions. In comparison, light emitting diodes employ packaging components that have WVTR of ~10-6 g/(m2.day). WVTR of polymer sheets can be improved by coating them with dense inorganic/organic multilayers. Ethylene vinyl acetate, an amorphous copolymer used predominantly by the PV industry has very high O2 and H2O diffusivity. Quaternary carbon chains (such as acetate) in a polymer lead to cleavage and loss of adhesional strength at relatively low exposures. Reactivity of PV module components increases in presence of O2 and H2O. Adhesional strength degrades due to the breakdown of structure of polymer by reactive, free radicals formed by high-energy radiation. Free radical formation in polymers is reduced when the aromatic rings are attached at regular intervals. This paper will review flexible packaging for PV modules.

Interharmonics from Grid-Connected PV Systems

DEFF Research Database (Denmark)

Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

2017-01-01

As the penetration level of grid-connected Photovoltaic (PV) systems increases, the power quality is one of the major concerns for system operators and the demands are becoming even stricter. The impact of interharmonics on the grid has been acknowledged in recent research when considering a large......-scale adoption of PV inverters. However, the origins of interharmonics remain unclear. Thus, this paper performs tests on a commercial PV inverter to explore interharmonic generation and more important investigates the mechanism of interharmonic emission. The investigation reveals that the perturbation...... of the solutions. Simulation results indicate that the constant-voltage MPPT method is the most suitable solution to the mitigation of interharmonics introduced by the MPPT operation, as it avoids the perturbation in the PV voltage during operation....

Optimal Solar PV Arrays Integration for Distributed Generation

Energy Technology Data Exchange (ETDEWEB)

Omitaomu, Olufemi A [ORNL; Li, Xueping [University of Tennessee, Knoxville (UTK)

2012-01-01

Solar photovoltaic (PV) systems hold great potential for distributed energy generation by installing PV panels on rooftops of residential and commercial buildings. Yet challenges arise along with the variability and non-dispatchability of the PV systems that affect the stability of the grid and the economics of the PV system. This paper investigates the integration of PV arrays for distributed generation applications by identifying a combination of buildings that will maximize solar energy output and minimize system variability. Particularly, we propose mean-variance optimization models to choose suitable rooftops for PV integration based on Markowitz mean-variance portfolio selection model. We further introduce quantity and cardinality constraints to result in a mixed integer quadratic programming problem. Case studies based on real data are presented. An efficient frontier is obtained for sample data that allows decision makers to choose a desired solar energy generation level with a comfortable variability tolerance level. Sensitivity analysis is conducted to show the tradeoffs between solar PV energy generation potential and variability.

Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.

Reaction of common bean lines to Xanthomonas axonopodis pv. phaseoli and Curtobacterium flaccumfaciens pv. flaccumfaciens

Directory of Open Access Journals (Sweden)

Tamires Ribeiro

2016-12-01

Full Text Available The aim of this study was to evaluate the resistance of 58 common bean lines against common bacterial blight (Xanthomonas axonopodis pv. phaseoli and bacterial wilt (Curtobacterium flaccumfaciens pv. flaccumfaciens. The experimental design consisted of completely randomized blocks, with four replications per pathogen. The results were subjected to variance analysis by the F test at 1% probability. Significant differences between the treatments indicated different resistance levels among the lines against both pathogens. According to the Scott-Knott test, six lines were resistant to Xanthomonas axonopodis pv. phaseoli, 14 moderately resistant, and 38 susceptible. To Curtobacterium flaccumfaciens pv. flaccumfaciens, 11 lines were resistant, 26 moderately resistant and 21 susceptible. Among these, the lines Pr10-3-4/1, Pr10-5-2/1 and Pr10-5- 2/2 of the black bean group and C10-2-4/2 of the Carioca group were resistant to both major bacterial diseases affecting common bean in Brazil.

Extensive Field Survey, Laboratory and Greenhouse Studies Reveal Complex Nature of Pseudomonas syringae-Associated Hazelnut Decline in Central Italy.

Science.gov (United States)

Lamichhane, Jay Ram; Bartoli, Claudia; Varvaro, Leonardo

2016-01-01

Pseudomonas avellanae (Pav) has been reported as the causal agent of bacterial decline and bacterial canker of hazelnut in Italy and Greece, respectively. Both hazelnut diseases were reported to be similar in terms of symptoms, severity and persistence. In this study, we found that both symptomatic and asymptomatic trees in the field were colonized by Pav. Multilocus Sequence Typing (MLST) analysis showed that Pav strains isolated during this study in Italy belong to the P. syringae phylogroup 1 and they are closely related to Pav strains previously isolated in Greece from hazelnut bacterial canker. On the other hand, strains isolated in earlier studies from hazelnut decline in Italy belong to both phylogroup 1 and 2 of P. syringae. Both phylogroup 1 strains of P. syringae from Greece and Italy are different than strains isolated in this study in terms of their capacity to excrete fluorescent pigments on different media. Despite the same plant genotype and cropping practices adopted, the incidence of hazelnut decline ranged from nearly 0 to 91% across our study sites. No disease developed on plants inoculated with Pav through wounding while leaf scar inoculations produced only mild disease symptoms. Based on our results and the previously reported correlation between pedo-climatic conditions and hazelnut decline, we conclude that hazelnut decline in central Italy could be incited by a combination of predisposing (adverse pedo-climatic conditions) and contributing factors (Pav). Because this is a true decline different from "bacterial canker" described in Greece, we refer to it as hazelnut decline (HD).

Extensive Field Survey, Laboratory and Greenhouse Studies Reveal Complex Nature of Pseudomonas syringae-Associated Hazelnut Decline in Central Italy.

Directory of Open Access Journals (Sweden)

Jay Ram Lamichhane

Full Text Available Pseudomonas avellanae (Pav has been reported as the causal agent of bacterial decline and bacterial canker of hazelnut in Italy and Greece, respectively. Both hazelnut diseases were reported to be similar in terms of symptoms, severity and persistence. In this study, we found that both symptomatic and asymptomatic trees in the field were colonized by Pav. Multilocus Sequence Typing (MLST analysis showed that Pav strains isolated during this study in Italy belong to the P. syringae phylogroup 1 and they are closely related to Pav strains previously isolated in Greece from hazelnut bacterial canker. On the other hand, strains isolated in earlier studies from hazelnut decline in Italy belong to both phylogroup 1 and 2 of P. syringae. Both phylogroup 1 strains of P. syringae from Greece and Italy are different than strains isolated in this study in terms of their capacity to excrete fluorescent pigments on different media. Despite the same plant genotype and cropping practices adopted, the incidence of hazelnut decline ranged from nearly 0 to 91% across our study sites. No disease developed on plants inoculated with Pav through wounding while leaf scar inoculations produced only mild disease symptoms. Based on our results and the previously reported correlation between pedo-climatic conditions and hazelnut decline, we conclude that hazelnut decline in central Italy could be incited by a combination of predisposing (adverse pedo-climatic conditions and contributing factors (Pav. Because this is a true decline different from "bacterial canker" described in Greece, we refer to it as hazelnut decline (HD.

A Practical Irradiance Model for Bifacial PV Modules: Preprint

Energy Technology Data Exchange (ETDEWEB)

Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford

2017-06-15

A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors (CFs) to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using the RADIANCE ray tracing program.

Multifunctional a-Si PV systems

Energy Technology Data Exchange (ETDEWEB)

Peippo, K; Lund, P; Vartiainen, E [Helsinki Univ. of Technology, Otaniemi (Finland). Advanced Energy Systems

1998-10-01

The optimal use of the various forms of solar energy (passive, active, daylighting, photovoltaics) in buildings calls for an optimal integration of the technologies. As energy conservation potential in space heating may soon be exhausted, electricity efficiency and on-site generation will play an increasing role in energy-conscious building design. There, dispersed PV systems integrated into buildings show a significant market potential, due to a number of benefits: no extra land area is required, PV-array may replace conventional cladding materials and become a building element. Moreover, the produced PV-electricity is more valuable for the building owner than for an electric utility

Industrial processing versus home processing of tomato sauce

NARCIS (Netherlands)

Tomas, Merve; Beekwilder, Jules; Hall, Robert D.; Sagdic, Osman; Boyacioglu, Dilek; Capanoglu, Esra

2017-01-01

The effect of industrial and home processing, in vitro gastrointestinal digestion, individual phenolic content, and antioxidant capacity of tomato into tomato sauce were investigated. Industrial processing of tomato fruit into sauce had an overall positive effect on the total antioxidant capacity

Preferential Promotion of Lycopersicon esculentum (Tomato) Growth by Plant Growth Promoting Bacteria Associated with Tomato.

Science.gov (United States)

Vaikuntapu, Papa Rao; Dutta, Swarnalee; Samudrala, Ram Babu; Rao, Vukanti R V N; Kalam, Sadaf; Podile, Appa Rao

2014-12-01

A total of 74 morphologically distinct bacterial colonies were selected during isolation of bacteria from different parts of tomato plant (rhizoplane, phylloplane and rhizosphere) as well as nearby bulk soil. The isolates were screened for plant growth promoting (PGP) traits such as production of indole acetic acid, siderophore, chitinase and hydrogen cyanide as well as phosphate solubilization. Seven isolates viz., NR4, NR6, RP3, PP1, RS4, RP6 and NR1 that exhibited multiple PGP traits were identified, based on morphological, biochemical and 16S rRNA gene sequence analysis, as species that belonged to four genera Aeromonas, Pseudomonas, Bacillus and Enterobacter. All the seven isolates were positive for 1-aminocyclopropane-1-carboxylate deaminase. Isolate NR6 was antagonistic to Fusarium solani and Fusarium moniliforme, and both PP1 and RP6 isolates were antagonistic to F. moniliforme. Except RP6, all isolates adhered significantly to glass surface suggestive of biofilm formation. Seed bacterization of tomato, groundnut, sorghum and chickpea with the seven bacterial isolates resulted in varied growth response in laboratory assay on half strength Murashige and Skoog medium. Most of the tomato isolates positively influenced tomato growth. The growth response was either neutral or negative with groundnut, sorghum and chickpea. Overall, the results suggested that bacteria with PGP traits do not positively influence the growth of all plants, and certain PGP bacteria may exhibit host-specificity. Among the isolates that positively influenced growth of tomato (NR1, RP3, PP1, RS4 and RP6) only RS4 was isolated from tomato rhizosphere. Therefore, the best PGP bacteria can also be isolated from zones other than rhizosphere or rhizoplane of a plant.

Induction of mutations in tomato variety Solar Set

International Nuclear Information System (INIS)

Peiris, R.

1995-01-01

The production of tomatoes in Sri Lanka is hampered by many problems. Tomato is an economic crop which is nutritious and has export potential. The major constraint for tomato production is Bacterial Wilt caused by Pseudomonas Solanacearum. A study was initiated with the obnjective of finding tomato genotype having resistance to bacterial wilt. The seeds of the varity, Solar Set which is highly susceptible to bacterial wilt was exposed to irradiation from Co 60 source after adjusting moisture content to 14%. The dosese given were 0, 25, 30, 35, 40, 45, 50 krad. The seeds were sown in plastic trays and germination count was taken after 3 days. The LD50 value for the induction of mutants in tomato variety Solar Set is observed to be 35.6 Kr and it is the best dose value for the induction of beneficial mutants in tomato variety, Solar Set by irradiation

Effect of gamma irradiation on fatty acids of tomato seed oil

International Nuclear Information System (INIS)

El-Sayed, S.A.; Raouf, M.S.; Morad, M.M.; Rady, A.H.

1979-01-01

Since gamma irradiation of tomatoes is investigated as a tool for increasing tomato shelf-lefe, in this study the tomato seed oil produced from irradiated tomatoes was compared with that produced from industrial tomato seeds and with cotton seeds. Fatty acid contents of tomato seed oil, produced from industrial tomato seed waste and from tomato seeds (Variety Ace), were found nearly the same as in the edible cotton seed oil. Hence, both tomato seed oils may be considered as an additional source of essential fatty acids especially linoleic. Gamma irradiation doses ranged from 50-200 Krad had no significant effect on total saturated and total unsaturated fatty acids. 200 Krad led to significant increases in lenolic acid on the account of insignificant decrease in palmatic acid. Essentail and non essential amino acids of tomato seed meal seem to be equivalent to these of cotton seed meal. This suggests the possible use of tomato seed meal in animal feeding

PV installations, protection and the code

Energy Technology Data Exchange (ETDEWEB)

Silecky, L. [Mersen, Toronto, ON (Canada)

2010-12-15

This article discussed the need for improved standards in Ontario's solar industry to ensure safety for the systems and also safety for the workers. Photovoltaic cells used in solar arrays can now deliver between 50 vDC to 600 vDC. The workings of such a high voltage photocell must be understood in order to understand its protection needs. Since PVs are semiconductors and susceptible to damage from short circuits and overloads, a fast-acting overcurrent protective device (OCPD) should be used. Combiner boxes are also needed to provide a clean method of safely connecting all the wires that are needed in the system, including surge protection and a means of isolation between the PV array and the inverter. Section 50 of the Canadian Electrical Code outlines the requirements for solar PV systems, but it does not mention the protection of DC circuits, including DC fuse protectors which are manufactured to provide a high degree of protection for the PV array. As the photovoltaic (PV) market continues to grow in Ontario, the PV industry also has a responsibility to ensure it is in compliance with codes and standards related to photovoltaic systems. This author suggested that Article 690 of the National Electric Code (NEC) is a good document to use when determining the requirements for PV systems. 3 figs.

Comparative transcriptome profiling of a resistant vs. susceptible tomato (Solanum lycopersicum cultivar in response to infection by tomato yellow leaf curl virus.

Directory of Open Access Journals (Sweden)

Tianzi Chen

Full Text Available Tomato yellow leaf curl virus (TYLCV threatens tomato production worldwide by causing leaf yellowing, leaf curling, plant stunting and flower abscission. The current understanding of the host plant defense response to this virus is very limited. Using whole transcriptome sequencing, we analyzed the differential gene expression in response to TYLCV infection in the TYLCV-resistant tomato breeding line CLN2777A (R and TYLCV-susceptible tomato breeding line TMXA48-4-0 (S. The mixed inoculated samples from 3, 5 and 7 day post inoculation (dpi were compared to non-inoculated samples at 0 dpi. Of the total of 34831 mapped transcripts, 209 and 809 genes were differentially expressed in the R and S tomato line, respectively. The proportion of up-regulated differentially expressed genes (DEGs in the R tomato line (58.37% was higher than that in the S line (9.17%. Gene ontology (GO analyses revealed that similar GO terms existed in both DEGs of R and S lines; however, some sets of defense related genes and their expression levels were not similar between the two tomato lines. Genes encoding for WRKY transcriptional factors, R genes, protein kinases and receptor (-like kinases which were identified as down-regulated DEGs in the S line were up-regulated or not differentially expressed in the R line. The up-regulated DEGs in the R tomato line revealed the defense response of tomato to TYLCV infection was characterized by the induction and regulation of a series of genes involved in cell wall reorganization, transcriptional regulation, defense response, ubiquitination, metabolite synthesis and so on. The present study provides insights into various reactions underlining the successful establishment of resistance to TYLCV in the R tomato line, and helps in the identification of important defense-related genes in tomato for TYLCV disease management.

Comparative analysis of copper and zinc based agrichemical biocide products: materials characteristics, phytotoxicity and in vitro antimicrobial efficacy

Directory of Open Access Journals (Sweden)

Harikishan Kannan

2016-07-01

Full Text Available In the past few decades, copper based biocides have been extensively used in food crop protection including citrus, small fruits and in all garden vegetable production facilities. Continuous and rampant use of copper based biocides over decades has led to accumulation of this metal in the soil and the surrounding ecosystem. Toxic levels of copper and its derivatives in both the soil and in the run off pose serious environmental and public health concerns. Alternatives to copper are in great need for the agriculture industry to produce food crops with minimal environmental risks. A combination of copper and zinc metal containing biocide such as Nordox 30/30 or an improved version of zinc-only containing biocide would be a good alternative to copper-only products if the efficacy can be maintained. As of yet there is no published literature on the comparative study of the materials characteristics and phyto-compatibility properties of copper and zinc-based commercial products that would allow us to evaluate the advantages and disadvantages of both versions of pesticides. In this report, we compared copper hydroxide and zinc oxide based commercially available biocides along with suitable control materials to assess their efficacy as biocides. We present a detailed material characterization of the biocides including morphological studies involving electron microscopy, molecular structure studies involving X-ray diffraction, phytotoxicity studies in model plant (tomato and antimicrobial studies involving surrogate plant pathogens (Xanthomonas alfalfae subsp. citrumelonis, Pseudomonas syringae pv. syringae and Clavibacter michiganensis subsp. michiganensis. Zinc based compounds were found to possess comparable to superior antimicrobial properties while exhibiting significantly lower phytotoxicity when compared to copper based products thus suggesting their potential as an alternative.

Manipulation of MKS1 gene expression affects Kalanchoë blossfeldiana and Petunia hybrida phenotypes.

Science.gov (United States)

Gargul, Joanna Maria; Mibus, Heiko; Serek, Margrethe

2015-01-01

The establishment of alternative methods to chemical treatments for growth retardation and pathogen protection in ornamental plant production has become a major goal in recent breeding programmes. This study evaluates the effect of manipulating MAP kinase 4 nuclear substrate 1 (MKS1) expression in Kalanchoë blossfeldiana and Petunia hybrida. The Arabidopsis thaliana MKS1 gene was overexpressed in both species via Agrobacterium-mediated transformation, resulting in dwarfed phenotypes and delayed flowering in both species and increased tolerance to Pseudomonas syringae pv. tomato in transgenic Petunia plants. The lengths of the stems and internodes were decreased, while the number of nodes in the transgenic plants was similar to that of the control plants in both species. The transgenic Kalanchoë flowers had an increased anthocyanin concentration, and the length of the inflorescence stem was decreased. The morphology of transgenic Petunia flowers was not altered. The results of the Pseudomonas syringae tolerance test showed that Petunia plants with one copy of the transgene reacted similarly to the nontransgenic control plants; however, plants with four copies of the transgene exhibited considerably higher tolerance to bacterial attack. Transgene integration and expression was determined by Southern blot hybridization and RT-PCR analyses. MKS1 in wild-type Petunia plants was down-regulated through a virus-induced gene silencing (VIGS) method using tobacco rattle virus vectors. There were no significant phenotypic differences between the plants with silenced MKS1 genes and the controls. The relative concentration of the MKS1 transcript in VIGS-treated plants was estimated by quantitative RT-PCR. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Experimental grid connected PV system power analysis

Science.gov (United States)

Semaoui, Smail; Abdeladim, Kamel; Arab, Amar Hadj; Boulahchich, Saliha; Amrouche, Said Ould; Yassaa, Noureddine

2018-05-01

Almost 80 % of Algerian territory is appropriate for the exploitation of solar energy. The Algerian energetic strategy provides a substantial injection of PV electricity to the national grid. Currently, about 344 MWp of PV arrays which corresponds approximately to 2,34 km2 of module surfaces, are connected on electricity grid over the national territory. The Algerian Northern regions are characterized by strong pollution and high humidity. These phenomena affect the energetic productivity of PV generator. The objective of our study is to analyze experimental grid connected PV system power in coastal locations. Hence, experiments have been conducted on three identical PV systems to determine the electrical performances. Transformer-less inverters are the most attractive for the ground-based photovoltaic (PV) system due to their efficiencies, reduced cost and weight. Besides, the absence of the galvanic isolation generates problems of capacitive leakage current on the AC side and the degradation of the insulation resistance on the DC side of the inverter. In this work, experimental study of the behavior of single-phase inverters without transformers is presented. The main objective of this work is to study the degradation of the insulation resistance at the input of the inverter, and the capacitive leakage current at the output of the inverter. This study was achieved at the CDER on a rainy day of 15/03/2017, on the first PV plant connected to the low voltage network in Algeria. This investigation can help forecasting the PV array energetic production by taking into account natural conditions.

Effects of pre-sowing gamma irradiation of tomato seeds on production and yield of open field tomato crops

International Nuclear Information System (INIS)

Zhamyansurehn, D.; Voloozh, D.

1976-01-01

The following conclusions may be drawn from results obtained in experiments with pre-sowing irradiation of tomato seeds and its effect on tomato crops. The dose of 2500 R proved to be optimum for increase of tomato crops yield. The yield increase resulted from increase in average weight, quantity and the dry matter of the fruit. The irradiation did not significantly affect the concentration of sugar, phosphorus, nitrogen and ascorbic acid in the fruit. (author)

Effects of pre-sowing gamma irradiation of tomato seeds on production and yield of open field tomato crops

Energy Technology Data Exchange (ETDEWEB)

Zhamyansurehn, D [Institut Fiziki i Matematiki Akademii Nauk Mongol' skoj Narodnoj Respubliki, Ulan Bator; Voloozh, D

1976-01-01

The following conclusions may be drawn from results obtained in experiments with pre-sowing irradiation of tomato seeds and its effect on tomato crops. The dose of 2500 R proved to be optimum for increase of tomato crops yield. The yield increase resulted from increase in average weight, quantity and the dry matter of the fruit. The irradiation did not significantly affect the concentration of sugar, phosphorus, nitrogen and ascorbic acid in the fruit.

China PV Business and Applications Evaluation

Energy Technology Data Exchange (ETDEWEB)

Sherring, Chris (Sherring Energy Associates)

1999-08-30

This report provides an overview of photovoltaics (PV) business and applications in China. Although more than 70 million people in China are without access to grid electricity, many of the unelectrified regions benefit from considerable renewable resources, including good solar insolation. Current annual PV sales are still modest, however, and are estimated to be between 2.0 and 2.5 megawatts. This and other significant PV data, including information regarding the current status of key aspects of Chinese businesses, markets, and distribution channels, are included in the report. Detailed company profiles of Chinese business organizations and summaries of visits made to these companies (as well as to more remote sites in Inner Mongolia to examine PV usage by the end-use customer) in September-October 1998 are also presented.

Robust PV Degradation Methodology and Application

Energy Technology Data Exchange (ETDEWEB)

Jordan, Dirk [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Deline, Christopher A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kimball, Greg [SunPower; Anderson, Mike [SunPower

2017-11-15

The degradation rate plays an important role in predicting and assessing the long-term energy generation of PV systems. Many methods have been proposed for extracting the degradation rate from operational data of PV systems, but most of the published approaches are susceptible to bias due to inverter clipping, module soiling, temporary outages, seasonality, and sensor degradation. In this manuscript, we propose a methodology for determining PV degradation leveraging available modeled clear-sky irradiance data rather than site sensor data, and a robust year-over-year (YOY) rate calculation. We show the method to provide reliable degradation rate estimates even in the case of sensor drift, data shifts, and soiling. Compared with alternate methods, we demonstrate that the proposed method delivers the lowest uncertainty in degradation rate estimates for a fleet of 486 PV systems.

Respective contribution of CML8 and CML9, two arabidopsis calmodulin-like proteins, to plant stress responses.

Science.gov (United States)

Zhu, Xiaoyang; Perez, Manon; Aldon, Didier; Galaud, Jean-Philippe

2017-05-04

In their natural environment, plants have to continuously face constraints such as biotic and abiotic stresses. To achieve their life cycle, plants have to perceive and interpret the nature, but also the strength of environmental stimuli to activate appropriate physiological responses. Nowadays, it is well established that signaling pathways are crucial steps in the implementation of rapid and efficient plant responses such as genetic reprogramming. It is also reported that rapid raises in calcium (Ca 2+ ) levels within plant cells participate in these early signaling steps and are essential to coordinate adaptive responses. However, to be informative, calcium increases need to be decoded and relayed by calcium-binding proteins also referred as calcium sensors to carry-out the appropriate responses. In a recent study, we showed that CML8, an Arabidopsis calcium sensor belonging to the calmodulin-like (CML) protein family, promotes plant immunity against the phytopathogenic bacteria Pseudomonas syringae pv tomato (strain DC3000). Interestingly, other CML proteins such as CML9 were also reported to contribute to plant immunity using the same pathosystem. In this addendum, we propose to discuss about the specific contribution of these 2 CMLs in stress responses.

A nanosized Ag-silica hybrid complex prepared by γ-irradiation activates the defense response in Arabidopsis

Science.gov (United States)

Chu, Hyosub; Kim, Hwa-Jung; Su Kim, Joong; Kim, Min-Soo; Yoon, Byung-Dae; Park, Hae-Jun; Kim, Cha Young

2012-02-01

Silver nanoparticles have antimicrobial activity against many pathogenic microbes. Here, the preparation of a nanosized Ag-silica hybrid complex (NSS) prepared by γ-irradiation is described. The effects of both NSS and reduced Ag nanoparticles (Ag 0) on the growth of the model plant Arabidopsis thaliana were tested. The application of 1-10 ppm NSS complex improved Arabidopsis growth in soil, whereas 100 ppm NSS resulted in weakly curled leaves. In addition, supplementation of Murashige and Skoog (MS) growth medium with 1 ppm NSS promoted the root growth of Arabidopsis seedlings, but root growth was inhibited by supplementation with 10 ppm NSS. To investigate whether the NSS complex could induce plant defense responses, the expression of pathogenesis-related ( PR) genes that are implicated in systemic acquired resistance (SAR) in Arabidopsis plants was examined. PR1, PR2 and PR5 were significantly up-regulated by each application of 10 ppm NSS complex or Ag 0 to the rosette leaves. Furthermore, pretreatment with the NSS complex induced more pathogen resistance to the virulent pathogen Pseudomonas syringae pv. tomato DC3000 ( Pst) compared to water treatment in Arabidopsis plants.

Chitin nanofiber elucidates the elicitor activity of polymeric chitin in plants

Directory of Open Access Journals (Sweden)

Mayumi eEgusa

2015-12-01

Full Text Available Chitin, an N-acetyl-D-glucosamine polymer, is a component of fungal cell walls and a microbe/pathogen-associated molecular pattern that elicits plant defense responses. As polymeric chitin is difficult to handle due to its insolubility in water, many studies on chitin-induced immune responses have used water-soluble low-molecular weight chitin instead. Thus, it is unclear if polymeric chitin can induce resistance. Here, we examined the elicitor activity of chitin nanofiber (CNF of submicron thickness prepared from polymeric chitin. CNF showed a high dispersing ability in water and induced both reactive oxygen species (ROS production and chitin-induced defense-related gene expression in Arabidopsis thaliana seedlings. The Arabidopsis chitin elicitor receptor kinase 1 (Atcerk1 mutant, which is impaired in chitin perception, also failed to respond to CNF. CNF exposure triggered ROS generation in suspension-cultured cells from Oryza sativa. Furthermore, pre-treatment of Arabidopsis leaves with CNF effectively reduced pathogen infection by both the fungus Alternaria brassicicola and the bacterium Pseudomonas syringae pv. tomato DC3000. These results demonstrate that CNF has elicitor activity and will help define the role of polymeric chitin in plant immune responses.

Analysis of the grape (Vitis vinifera L.) thaumatin-like protein (TLP) gene family and demonstration that TLP29 contributes to disease resistance.

Science.gov (United States)

Yan, Xiaoxiao; Qiao, Hengbo; Zhang, Xiuming; Guo, Chunlei; Wang, Mengnan; Wang, Yuejin; Wang, Xiping

2017-06-27

Thaumatin-like protein (TLP) is present as a large family in plants, and individual members play different roles in various responses to biotic and abiotic stresses. Here we studied the role of 33 putative grape (Vitis vinifera L.) TLP genes (VvTLP) in grape disease resistance. Heat maps analysis compared the expression profiles of 33 genes in disease resistant and susceptible grape species infected with anthracnose (Elsinoe ampelina), powdery mildew (Erysiphe necator) or Botrytis cinerea. Among these 33 genes, the expression level of TLP29 increased following the three pathogens inoculations, and its homolog from the disease resistant Chinese wild grape V. quinquangularis cv. 'Shang-24', was focused for functional studies. Over-expression of TLP29 from grape 'Shang-24' (VqTLP29) in Arabidopsis thaliana enhanced its resistance to powdery mildew and the bacterium Pseudomonas syringae pv. tomato DC3000, but decreased resistance to B. cinerea. Moreover, the stomatal closure immunity response to pathogen associated molecular patterns was strengthened in the transgenic lines. A comparison of the expression profiles of various resistance-related genes after infection with different pathogens indicated that VqTLP29 may be involved in the salicylic acid and jasmonic acid/ethylene signaling pathways.

Diuretics Prime Plant Immunity in Arabidopsis thaliana

Science.gov (United States)

Noutoshi, Yoshiteru; Ikeda, Mika; Shirasu, Ken

2012-01-01

Plant activators are agrochemicals that activate the plant immune system, thereby enhancing disease resistance. Due to their prophylactic and durable effects on a wide spectrum of diseases, plant activators can provide synergistic crop protection when used in combination with traditional pest controls. Although plant activators have achieved great success in wet-rice farming practices in Asia, their use is still limited. To isolate novel plant activators applicable to other crops, we screened a chemical library using a method that can selectively identify immune-priming compounds. Here, we report the isolation and characterization of three diuretics, bumetanide, bendroflumethiazide and clopamide, as immune-priming compounds. These drugs upregulate the immunity-related cell death of Arabidopsis suspension-cultured cells induced with an avirulent strain of Pseudomonas syringae pv. tomato in a concentration-dependent manner. The application of these compounds to Arabidopsis plants confers disease resistance to not only the avirulent but also a virulent strain of the pathogen. Unlike salicylic acid, an endogenous phytohormone that governs disease resistance in response to biotrophic pathogens, the three diuretic compounds analyzed here do not induce PR1 or inhibit plant growth, showing potential as lead compounds in a practical application. PMID:23144763

PROPIEDADES FISICOQUIMICAS Y ANTIBACTERIALES DE MEZCLAS PLA-QUITOSANO OBTENIDAS POR CASTING CON POTENCIAL USO COMO ACOLCHADOS AGRÍCOLAS

Directory of Open Access Journals (Sweden)

Danila Merino

2016-01-01

Full Text Available Se obtuvieron films PLA - Quitosano compatibilizados con diisocianato de hexametileno (HDI por el método de casting y posterior prensado. Los films fueron preparados con diferentes contenidos de quitosano (CS y a continuación se estudiaron sus propiedades fisicoquímicas, mediante espectroscopia infrarroja de Transformada de Fourier (FTIR, análisis termogravimétrico (TGA, calorimetría diferencial de barrido (DSC, microscopia óptica (MO y difracción de rayos X (DRX. Se encontró que el agente compatibilizante reacciona completamente y que el quitosano afecta las propiedades térmicas de los films disminuyendo sus temperaturas de descomposición, transición vítrea (T g y de fusión (T f e incrementando su cristalinidad. Desde el punt o de vista funcional, se estudiaron las propiedades antimicrobianas de cada uno de los films frente a la bacteria patógena Pseudomonas syringae pv tomato DC - 3000. E l aumento en el contenido de quitosano fue proporcional al efecto antimicrobiano permitiendo proyectar su potencial de aplicación en el campo agronómico.

A single base pair in the right terminal domain of Tomato planta macho viroid is a virulence determinant factor on tomato

Science.gov (United States)

Tomato planta macho viroid (TPMVd), including isolates previously designated as Mexican papita viroid (MPVd), causes serious disease on tomatoes in North America. Two predominant variants, sharing 93.8% sequence identity, incited distinct severe (MPVd-S) or mild (MPVd-M) symptoms on tomato. To ide...

Effect of tomato post-harvest fungicide treatment and storage conditions on the quality of fruits, and biological value of tomato pulp and concentrated pulp

Directory of Open Access Journals (Sweden)

H. Parynow

2013-12-01

Full Text Available The influence of storage conditions on the quality of tomato fruits was tested. The rate of ripening was established in normal air, where tomatoes ripen quickly, under controlled atmosphere where they ripen more slowly and under low pressure, where they ripen slowest. The influence of post-harvest benomyl or methylthiophanate treatment on tomato rot, ripening, and biological value were examined. Post-harvest tomato treatment did not reduce fruit rot. The color of fruits and the processed products depended on the fungicide treatment. Concentrated tomato pulp made of fruits treated with methylthiophanate was redder than the others. The fungicide treatment increased or decreased the level of some chemical substances in the fruits in dependence on the applied fungicide, storage conditions and the length of storage, e.g. tomatoes treated with benomyl and stored for 14 days contained the highest level of vitamin C under 0% CO2:3%O2 and tomatoes treated with methylthiophanate contained the highest level of vitamin C under 38 mm Hg. Degradation of vitamin C in pulp was faster than in the concentrated pulp. Tomato pulp made of tomatoes treated with methylthiophanate contained the lowest level of vitamin C.

Optimal Design of Modern Transformerless PV Inverter Topologies

OpenAIRE

Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede

2013-01-01

The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inver...

Fungi of genus Alternaria occurring on tomato

Directory of Open Access Journals (Sweden)

Joanna Marcinkowska

2013-12-01

Full Text Available Tomato early blight in central Poland was caused by Alternaria solani (A. porri f. sp., solani and A. alernata (A. tenuis. A. alternata was isolated more often than A. solani. All isolates of A. solani in controlled conditions killed tomato seedlings, while pathogenic isolates of A. alternata caused only slight seedling blight. In greenhouse tests A. solani proved to be strongly pathogenic for leaves and stems of tomato but A. alternata was weakly pathogenic. The latter species attacked only injured fruits while, A. solanicould penetrate through undamaged peel of fruits. Both of these species caused the same type of symptoms; the differences consisted only in intensification of disease symptoms. During 1974 and 1975 field tomatoes were moderately attacked by early blight. Thebest development of this disease occurred by the turn of August and September. Determinate variety 'New Yorker' was distinguished by more severe infection of stem parts of tomato whereas the fruits of a stock variety 'Apollo' were more strongly attacked.

Solar cell junction temperature measurement of PV module

KAUST Repository

Huang, B.J.; Yang, P.E.; Lin, Y.P.; Lin, B.Y.; Chen, H.J.; Lai, R.C.; Cheng, J.S.

2011-01-01

The present study develops a simple non-destructive method to measure the solar cell junction temperature of PV module. The PV module was put in the environmental chamber with precise temperature control to keep the solar PV module as well

Photovoltaic (PV) Pricing Trends: Historical, Recent, and Near-Term Projections

Energy Technology Data Exchange (ETDEWEB)

Feldman, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Barbose, Galen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wiser, Ryan [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Darghouth, Naim [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Goodrich, Alan [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2012-11-30

The installed capacity of global and U.S. photovoltaic (PV) systems has soared in recent years, driven by declining PV prices and government incentives. The U.S. Department of Energy’s (DOE) SunShot Initiative aims to make PV cost competitive without incentives by reducing the cost of PV-generated electricity by about 75% between 2010 and 2020. This summary report—based on research at Lawrence Berkeley National Laboratory (LBNL) and the National Renewable Energy Laboratory (NREL)—examines progress in PV price reductions to help DOE and other PV stakeholders manage the transition to a market-driven PV industry, and to provide clarity surrounding the wide variety of potentially conflicting data available about PV system prices.

Tomato and tomato byproducts. Human health benefits of lycopene and its application to meat products: a review.

Science.gov (United States)

Viuda-Martos, M; Sanchez-Zapata, E; Sayas-Barberá, E; Sendra, E; Pérez-Álvarez, J A; Fernández-López, J

2014-01-01

During recent decades, the food industry, consumers, and regulatory authorities have developed a significant interest in functional foods because of their potential benefits for human health over and above their basic nutritional value. Tomato is the second most important vegetable crop in the world. The amount of the related wastes is estimated at up to 50,000 tons per year, representing a serious disposal problem with a consequent negative impact on the environment. Tomato byproducts contain a great variety of biologically active substances, principally lycopene, which have been demonstrated by in vitro and in vivo studies to possess antioxidant, hypolipidemic, and anticarcinogenic activities. The aim of this review is to present an overview of the functional and physiological properties of the principal bioactive compound present in tomato and tomato byproducts, lycopene, its addition to meat, and meat products.

The Value of Transparency in Distributed Solar PV Markets

Energy Technology Data Exchange (ETDEWEB)

OShaughnessy, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zamzam, Ahmed S [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-12-01

Market transparency refers to the degree of customer awareness of product options and fair market prices for a given good. In The Value of Transparency in Distributed Solar PV Markets, we use residential solar photovoltaic (PV) quote data to study the value of transparency in distributed solar PV markets. We find that improved market transparency results in lower installation offer prices. Further, the results of this study suggest that PV customers benefit from gaining access to more PV quotes.

Engineering resistance against Tomato yellow leaf curl virus via the CRISPR/Cas9 system in tomato

KAUST Repository

Mahfouz, Magdy M.

2017-12-22

CRISPR/Cas systems confer molecular immunity against phages and conjugative plasmids in prokaryotes. Recently, CRISPR/Cas9 systems have been used to confer interference against eukaryotic viruses. Here, we engineered Nicotiana benthamiana and tomato (Solanum lycopersicum) plants with the CRISPR/Cas9 system to confer immunity against the Tomato yellow leaf curl virus (TYLCV). Targeting the TYLCV genome with Cas9-single guide RNA at the sequences encoding the coat protein (CP) or replicase (Rep) resulted in efficient virus interference, as evidenced by low accumulation of the TYLCV DNA genome in the transgenic plants. The CRISPR/Cas9-based immunity remained active across multiple generations in the N. benthamiana and tomato plants. Together, our results confirmed the efficiency of the CRISPR/Cas9 system for stable engineering of TYLCV resistance in N. benthamiana and tomato, and opens the possibilities of engineering virus resistance against single and multiple infectious viruses in other crops.

Optimal design of PV and HP system

DEFF Research Database (Denmark)

Nepper-Rasmussen, Bjarke Christian; Rasmussen, Theis Bo

2015-01-01

Methods of utilizing residential produced photovoltaic (PV) power by converting to thermal energy through heat pumps (HP) are present in literature, where thermal energy is dispersed as either heat or hot water at the instant moment of PV production. In this paper an alternative solution is descr...... that the thermal storage with a BT is a better investment than a PV system without HP or no investment. Furthermore, it showed that the optimization model developed in this project is capable of finding the optimal combination of component sizes based on our data.......Methods of utilizing residential produced photovoltaic (PV) power by converting to thermal energy through heat pumps (HP) are present in literature, where thermal energy is dispersed as either heat or hot water at the instant moment of PV production. In this paper an alternative solution...... is described, where the thermal energy is stored in a buffer tank (BT) capable of dispersing heat to either the heating system of a house or a hot water tank, for later use. The thermal storage solution including a BT can increase the self-consumption of residentially produced PV power and thereby shift...

Learning in PV trends and future prospects

International Nuclear Information System (INIS)

Schaeffer, G.J.; De Moor, H.H.C.

2004-06-01

For large scale application of PV cost reduction is essential. It is shown in this study that the price evolution is on track and even accelerating the last 15 years. Using an experience curve approach a learning rate of little over 20% was found consistent with other studies. As data were collected for small rooftop grid connected systems, it could be shown that this learning rate is not only found for modules, but also for BOS (all costs apart from the modules) in Germany as well as in the Netherlands. Projections of the future price of PV systems show that a learning rate of at least 20% is needed to make introduction of PV affordable. It is very effective to invest in learning, thus increasing the learning rate, as well as developing market segments were the value of PV is higher, such as residential PV systems in southern Europe

PV solar system feasibility study

International Nuclear Information System (INIS)

Ashhab, Moh’d Sami S.; Kaylani, Hazem; Abdallah, Abdallah

2013-01-01

Highlights: ► This research studies the feasibility of PV solar systems. ► The aim is to develop the theory and application of a hybrid system. ► Relevant research topics are reviewed and some of them are discussed in details. ► A prototype of the PV solar system is designed and built. - Abstract: This research studies the feasibility of PV solar systems and aims at developing the theory and application of a hybrid system that utilizes PV solar system and another supporting source of energy to provide affordable heating and air conditioning. Relevant research topics are reviewed and some of them are discussed in details. Solar heating and air conditioning research and technology exist in many developed countries. To date, the used solar energy has been proved to be inefficient. Solar energy is an abundant source of energy in Jordan and the Middle East; with increasing prices of oil this source is becoming more attractive alternative. A good candidate for the other system is absorption. The overall system is designed such that it utilizes solar energy as a main source. When the solar energy becomes insufficient, electricity or diesel source kicks in. A prototype of the PV solar system that operates an air conditioning unit is built and proper measurements are collected through a data logging system. The measured data are plotted and discussed, and conclusions regarding the system performance are extracted.

Data monitoring system for PV solar generators

International Nuclear Information System (INIS)

Stoev, M.; Katerski, A.; Williams, A.

2000-01-01

The two 1.5 kWp photovoltaic (PV) solar generators are installed and the new PC data monitoring system is developed by applying EC standards for European Solar Test Installation (ESTI). The schematic system diagram of PV generator is presented. The recording parameters for analytical and global monitoring are discussed. The meteorological data from ESTI sensors, temperature sensor and electrical data from inverter and calibrated shunt are stored via analog digital converters (ADC) on a hard disk of data storage PC. Data Logger and Monitor software for automatic data acquisition, treatment and visual distance control of all output PV data from PV solar generator has been created

Salmonella transfer during pilot plant scale washing and roller conveying of tomatoes.

Science.gov (United States)

Wang, Haiqiang; Ryser, Elliot T

2014-03-01

Salmonella transfer during washing and roller conveying of inoculated tomatoes was quantified using a pilot scale tomato packing line equipped with plastic, foam, or brush rollers. Red round tomatoes (2.3 kg) were dip inoculated with Salmonella enterica serovar Typhimurium LT2 (avirulent) (4 log CFU/g), air dried for 2 h, and then washed in sanitizer-free water for 2 min. Inoculated tomatoes were then passed single file over a 1.5-m conveyor equipped with plastic, foam, or brush rollers followed by 25 previously washed uninoculated tomatoes. Tomato samples were collected after 2 min of both washing and roller conveying, with all 25 uninoculated tomatoes collected individually after conveying. Roller surface samples were collected before and after conveying the uninoculated tomatoes. Both tomato and surface samples were quantitatively examined for Salmonella by direct plating or membrane filtration using xylose lysine Tergitol 4 agar. Regardless of the roller type, Salmonella populations on inoculated tomatoes did not significantly (P conveyors. After conveying uninoculated tomatoes over contaminated foam rollers, 96% of the 25 tomatoes were cross-contaminated with Salmonella at >100 CFU per tomato. With plastic rollers, 24 and 76% of tomatoes were cross-contaminated with Salmonella at 10 to 100 and 1 to 10 CFU per tomato, respectively. In contrast, only 8% of 25 tomatoes were cross-contaminated with brush rollers with Salmonella populations of 1 to 10 CFU per tomato. Overall, cross-contamination was greatest with foam, followed by plastic and brush rollers (P < 0.05). Adding peroxyacetic acid or chlorine to the wash water significantly decreased cross-contamination during tomato conveying, with chlorine less effective in controlling Salmonella on foam compared with plastic and brush rollers.

Simulation of Distributed PV Power Output in Oahu Hawaii

Energy Technology Data Exchange (ETDEWEB)

Lave, Matthew Samuel [Sandia National Lab. (SNL-CA), Livermore, CA (United States)

2016-08-01

Distributed solar photovoltaic (PV) power generation in Oahu has grown rapidly since 2008. For applications such as determining the value of energy storage, it is important to have PV power output timeseries. Since these timeseries of not typically measured, here we produce simulated distributed PV power output for Oahu. Simulated power output is based on (a) satellite-derived solar irradiance, (b) PV permit data by neighborhood, and (c) population data by census block. Permit and population data was used to model locations of distributed PV, and irradiance data was then used to simulate power output. PV power output simulations are presented by sub-neighborhood polygons, neighborhoods, and for the whole island of Oahu. Summary plots of annual PV energy and a sample week timeseries of power output are shown, and a the files containing the entire timeseries are described.

Design optimization of transformerless grid-connected PV inverters including reliability

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2012-01-01

Of the Electricity (LCOE) generated during the PV system lifetime period is minimized. The LCOE is calculated also considering the failure rates of the components, which affect the reliability performance and lifetime maintenance cost of the PV inverter. A design example is presented, demonstrating that compared...... to the non-optimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE.......This paper presents a new methodology for optimal design of transformerless Photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal values and types of the PV inverter components are calculated such that the PV inverter Levelized Cost...

Design Optimization of Transformerless Grid-Connected PV Inverters Including Reliability

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2013-01-01

such that the PV inverter LCOE generated during the PV system lifetime period is minimized. The LCOE is also calculated considering the failure rates of the components, which affect the reliability performance and lifetime maintenance cost of the PV inverter. A design example is presented, demonstrating...... that compared to the nonoptimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE.......This paper presents a new methodology for optimal design of transformerless photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal switching frequency as well as the optimal values and types of the PV inverter components is calculated...

Impedance characterization of PV modules in outdoor conditions

DEFF Research Database (Denmark)

Oprea, Matei-lon; Thorsteinsson, Sune; Spataru, Sergiu

2016-01-01

Impedance spectroscopy (IS) has been used for laboratory characterizations of photovoltaic (PV) technologies under well controlled conditions. This work applies IS for outdoor characterization of PV panels, in order to observe the effect of irradiance (G) and temperature (T) on the PV module’s...

Performance of a 34 kWp grid-connected PV system in Indonesia - A comparison of tropical and European PV systems

NARCIS (Netherlands)

Veldhuis, A.J.; Reinders, Angelina H.M.E.

2014-01-01

We analysed a monitored grid-connected PV system of 34 kWp in Indonesia to investigate the performance of PV systems in tropical climates. The PV system has been installed in Jayapura, the capital of the Province of Papua, Indonesia, by the beginning of 2012. Due to the aged gensets and frequent

Influence of Heat Treatments on Carotenoid Content of Cherry Tomatoes

OpenAIRE

D'Evoli, Laura; Lombardi-Boccia, Ginevra; Lucarini, Massimo

2013-01-01

Tomatoes and tomato products are rich sources of carotenoids—principally lycopene, followed by β-carotene and lutein. The aim of this work was to study the effect of heat treatment on carotenoid content in cherry tomatoes. Raw and canned products were sampled and analysed; furthermore whole, skin and pulp fractions of cherry tomatoes were analysed when raw and home-processed, in order to better understand heat treatment effects. Lycopene content in canned tomatoes was two-fold higher than in ...

Antioxidant and Antiplatelet Activities in Extracts from Green and Fully Ripe Tomato Fruits (Solanum lycopersicum and Pomace from Industrial Tomato Processing

Directory of Open Access Journals (Sweden)

Eduardo Fuentes

2013-01-01

Full Text Available The consumption of fruits and vegetables is accepted to be one of the strategies to reduce risk factors for these diseases. The aim of this study was to examine potential relationships between the antioxidant and the antiplatelet activities in green mature and fully ripe (red tomatoes and of lycopene-rich byproducts of tomato paste processing such as pomace. The total phenol content of tomato components was the highest in peels, pulp, and in the mucilaginous myxotesta covering the tomato seeds with values 36.9±0.8, 33.3±00.5, and 17.6±0.9 mg GAE/100 g, respectively (P<0.05. Tomato peels had the highest antioxidant activity, both, as measured by the FRAP (46.9±0.9 μmol Fe+2/g, P<0.05 and the DPPH assays (97.4±0.2%, 1000 μg/mL, P<0.05. Pomace extracts showed the highest antiplatelet activity induced by ADP, collagen, TRAP-6, and arachidonic acid. While the maturation stage of the tomato fruit affected the antioxidant effect, antiplatelet activity was independent of fruit ripeness. Finally, based on the present results, tomato and its byproducts may be considered as a valuable source of antioxidant and antiplatelet activities.

Study of bypass diodes configuration on PV modules

Energy Technology Data Exchange (ETDEWEB)

Silvestre, S.; Boronat, A.; Chouder, A. [Electronics Engineering Department - UPC., C/Jordi Girona 1-3, Modul C4 Campus Nord UPC., 08034 Barcelona (Spain)

2009-09-15

A procedure of simulation and modelling solar cells and PV modules, working partially shadowed in Pspice environment, is presented. Simulation results have been contrasted with real measured data from a commercial PV module of 209 Wp from Siliken. Some cases of study are presented as application examples of this simulation methodology, showing its potential on the design of bypass diodes configuration to include in a PV module and also on the study of PV generators working in partial shading conditions. (author)

Is tomato a healthy and/or functional food?

Directory of Open Access Journals (Sweden)

Inmaculada Navarro-González

2016-12-01

Full Text Available This paper is a literature review about the presence of bioactive compounds in tomato and tomato based food, and these compounds function to promote health in the human organism. Several scientific studies show that tomato and tomato based products have several molecules, some of them with antioxidant activity, that protect lipids, lipoproteins, DNA, etc. against free radicals. This function could be one of the causes of the apparent link between consumption and protection of degenerative and chronic diseases such as cancer, cardiovascular disease, Parkinson’s disease, etc. More recent studies have proposed different biochemical mechanisms in which tomato components can exert this beneficial role on health. In addition, several studies seem to show that the greatest benefit of this food is due to the synergistic effect between all its compounds. Some epidemiological studies associate that regular intake has several beneficial effects on health. Due to the association between bioactive compounds, daily tomato consumption and its effect on human health, the aim of the current literature review is summarize the compounds in this food and its possible actions on health.

Using hyperspectral imaging technology to identify diseased tomato leaves

Science.gov (United States)

Li, Cuiling; Wang, Xiu; Zhao, Xueguan; Meng, Zhijun; Zou, Wei

2016-11-01

In the process of tomato plants growth, due to the effect of plants genetic factors, poor environment factors, or disoperation of parasites, there will generate a series of unusual symptoms on tomato plants from physiology, organization structure and external form, as a result, they cannot grow normally, and further to influence the tomato yield and economic benefits. Hyperspectral image usually has high spectral resolution, not only contains spectral information, but also contains the image information, so this study adopted hyperspectral imaging technology to identify diseased tomato leaves, and developed a simple hyperspectral imaging system, including a halogen lamp light source unit, a hyperspectral image acquisition unit and a data processing unit. Spectrometer detection wavelength ranged from 400nm to 1000nm. After hyperspectral images of tomato leaves being captured, it was needed to calibrate hyperspectral images. This research used spectrum angle matching method and spectral red edge parameters discriminant method respectively to identify diseased tomato leaves. Using spectral red edge parameters discriminant method produced higher recognition accuracy, the accuracy was higher than 90%. Research results have shown that using hyperspectral imaging technology to identify diseased tomato leaves is feasible, and provides the discriminant basis for subsequent disease control of tomato plants.

Latin America as new PV market opportunity

International Nuclear Information System (INIS)

Weiss, Ingrid

2015-01-01

It is important to recognize solar energy as an international and strategic opportunity for the European market to expand. The objective of this paper is to apply the methodology created during the PV Parity project for analyzing PV Competitiveness in the emerging residential PV market in Brazil, using information from the State of Rio de Janeiro. The dynamic competitiveness analysis was performed considering the price with and without taxes in order to assess the year when PV will reach grid parity in Rio de Janeiro and how the taxes impact on the results. Results are divided into 3 scenarios: Optimistic, Conservative, and Conservative Moderate. The LCOE of residential systems will likely become competitive with the residential electricity tariffs between 2020 and 2030, assuming the residential tariffs in Rio de Janeiro. This is an indicator that PV energy business opportunities are increasing in Brazil and, with the adequate policy support, its market competitiveness could be improved. We are also looking in other markets of Latin America. (full text)

Dissipation of heat from building integrated PV

Energy Technology Data Exchange (ETDEWEB)

Taylor, C.M.L.

2001-07-01

The objectives of the project were to investigate methods for improving heat transfer and the reflection of heat from PV modules in building integrated situations and to develop the design of a building integrated PV element with improved heat transfer characteristics, with the aim of reducing the operating temperature of the PV cells. The prototypes developed for improving heat transfer have only shown small reductions in the PV cell operating temperature and these results have not been fully quantified due to problems associated with experimental testing. The improvement in the overall electrical performance of PV modules operating at lower temperatures is consequently even smaller. As a result, none of the prototypes can be considered to be economically viable. Based upon the theoretical and experimental results of this work, it is the recommendation of this project that no further work be conducted in improving BIPV performance through improved heat transfer of BIPV. (Author)

The potential of solar PV in Ontario

International Nuclear Information System (INIS)

McMonagle, R.

2005-01-01

Canada has lagged behind other industrialized nations in the growth of solar energy markets. Currently, over 78 per cent of the global market for solar energy is for grid-connected applications where power is fed into the electrical distribution network. Less than 3.5 per cent of the Canadian solar market is grid-connected. This report investigated the potential size of the photovoltaic (PV) market in Ontario given adequate support from both governments and utilities. The forecast was based on sustainable growth levels that the solar industry as a whole might maintain over an extended period of time. It was suggested that it is technically feasible to install over 3000 MW of PV in single, detached homes in the province, which could generate over 3200 GWh each year. If the right policy conditions were put in place, the technical potential for PV on all buildings in Ontario is over 14,000 MW by 2025, which would generate over 13,000 GWh annually. Support mechanisms such as the Advanced Renewable Tariff (ART) or Standard Offer Contracts (SOC) will enable the PV industry to build capacity. Future markets for PV include new homes, commercial buildings and the existing housing stock. With a properly designed system, it is forecasted that the deployment of PV by 2025 could result in the involvement of 400,000 homes with over 1200 MW of installed capacity and over 290 MW installed annually by 2025. Recommendations to Ontario Power Authority's (OPA) report supply mix report focused on the use of SOCs as the appropriate support mechanism to start building solar capacity in Ontario, as projections using SOCs would see Ontario following the growth patterns of other nations. It was concluded that the OPA report does not acknowledge the current growth rates of PV globally, nor does it fully consider the potential of PV in Ontario. 9 refs., 8 figs

Influence of Heat Treatments on Carotenoid Content of Cherry Tomatoes

Directory of Open Access Journals (Sweden)

Laura D'Evoli

2013-07-01

Full Text Available Tomatoes and tomato products are rich sources of carotenoids—principally lycopene, followed by β-carotene and lutein. The aim of this work was to study the effect of heat treatment on carotenoid content in cherry tomatoes. Raw and canned products were sampled and analysed; furthermore whole, skin and pulp fractions of cherry tomatoes were analysed when raw and home-processed, in order to better understand heat treatment effects. Lycopene content in canned tomatoes was two-fold higher than in raw tomatoes (11.60 mg/100 g versus 5.12 mg/100 g. Lutein and β-carotene were respectively 0.15 mg/100 g and 0.75 mg/100 g in canned tomatoes versus 0.11 mg/100 g and 1.00 mg/100 g in raw tomatoes. For home-processed tomatoes, β-carotene and lutein showed a content decrease in all thermally treated products. This decrease was more evident for β-carotene in the skin fraction (−17%, while for lutein it was greater in the pulp fraction (−25%. Lycopene presented a different pattern: after heat treatment its concentration increased both in the whole and in pulp fractions, while in the skin fraction it decreased dramatically (−36%. The analysis of the isomers formed during the thermal treatment suggests that lycopene is rather stable inside the tomato matrix.

Influence of Heat Treatments on Carotenoid Content of Cherry Tomatoes.

Science.gov (United States)

D'Evoli, Laura; Lombardi-Boccia, Ginevra; Lucarini, Massimo

2013-07-31

Tomatoes and tomato products are rich sources of carotenoids-principally lycopene, followed by β-carotene and lutein. The aim of this work was to study the effect of heat treatment on carotenoid content in cherry tomatoes. Raw and canned products were sampled and analysed; furthermore whole, skin and pulp fractions of cherry tomatoes were analysed when raw and home-processed, in order to better understand heat treatment effects. Lycopene content in canned tomatoes was two-fold higher than in raw tomatoes (11.60 mg/100 g versus 5.12 mg/100 g). Lutein and β-carotene were respectively 0.15 mg/100 g and 0.75 mg/100 g in canned tomatoes versus 0.11 mg/100 g and 1.00 mg/100 g in raw tomatoes. For home-processed tomatoes, β-carotene and lutein showed a content decrease in all thermally treated products. This decrease was more evident for β-carotene in the skin fraction (-17%), while for lutein it was greater in the pulp fraction (-25%). Lycopene presented a different pattern: after heat treatment its concentration increased both in the whole and in pulp fractions, while in the skin fraction it decreased dramatically (-36%). The analysis of the isomers formed during the thermal treatment suggests that lycopene is rather stable inside the tomato matrix.

A detailed thermal-electrical model of three photovoltaic/thermal (PV/T) hybrid air collectors and photovoltaic (PV) module: Comparative study under Algiers climatic conditions

International Nuclear Information System (INIS)

Slimani, Mohamed El Amine; Amirat, Madjid; Kurucz, Ildikó; Bahria, Sofiane; Hamidat, Abderrahmane; Chaouch, Wafa Braham

2017-01-01

Highlights: • A detailed thermal and electrical model for PV and PV/T systems has been presented. • The developed numerical model was validated successfully with previously published experimental results. • A comparative study between four solar devices (PV and PV/T systems) was carried out. • The experimental weather conditions of Algiers site are used in the numerical model. • The glazed double-pass photovoltaic/thermal air collector shows the best overall energy efficiency. - Abstract: The thermal photovoltaic hybrid collector is a genuine cogeneration technology; it can produce electricity and heat simultaneously. In this paper, a comparative study is presented between four solar device configurations: photovoltaic module (PV-I), conventional hybrid solar air collector (PV/T-II), glazed hybrid solar air collector (PV/T-III) and glazed double-pass hybrid solar air collector (PV/T-IV). A numerical model is developed and validated through experimental results indicated in the previous literature. The numerical model takes the heat balance equations and different thermal and electrical parameters into account for each configuration included in this study, the energy performances are evaluated with a sample weather data of Algiers site. The numerical results show that the daily average of overall energy efficiency reaches: 29.63%, 51.02%, 69.47% and 74% for the first (PV-I), the second (PV/T-II), the third (PV/T-III) and the fourth (PV/T-IV) configurations respectively. These values are obtained with an air flow of 0.023 kg/s and introducing a sample of experimental weather data collected in Algiers site for a sunny day in summer.

Impact of residential PV adoption on Retail Electricity Rates

International Nuclear Information System (INIS)

Cai, Desmond W.H.; Adlakha, Sachin; Low, Steven H.; De Martini, Paul; Mani Chandy, K.

2013-01-01

The price of electricity supplied from home rooftop photo voltaic (PV) solar cells has fallen below the retail price of grid electricity in some areas. A number of residential households have an economic incentive to install rooftop PV systems and reduce their purchases of electricity from the grid. A significant portion of the costs incurred by utility companies are fixed costs which must be recovered even as consumption falls. Electricity rates must increase in order for utility companies to recover fixed costs from shrinking sales bases. Increasing rates will, in turn, result in even more economic incentives for customers to adopt rooftop PV. In this paper, we model this feedback between PV adoption and electricity rates and study its impact on future PV penetration and net-metering costs. We find that the most important parameter that determines whether this feedback has an effect is the fraction of customers who adopt PV in any year based solely on the money saved by doing so in that year, independent of the uncertainties of future years. These uncertainties include possible changes in rate structures such as the introduction of connection charges, the possibility of PV prices dropping significantly in the future, possible changes in tax incentives, and confidence in the reliability and maintainability of PV. -- Highlights: •Households who install PV reduce their electricity consumption from the grid. •Electricity rates must increase for utility companies to recover its fixed costs. •However, higher electricity rates give households more incentives to adopt PV. •We find that this feedback has significant impact on PV uptake only in later years. •Utility companies could lose a significant fraction of high consumption customers

Remote and Centralized Monitoring of PV Power Plants

DEFF Research Database (Denmark)

Kopacz, Csaba; Spataru, Sergiu; Sera, Dezso

2014-01-01

the inverters within each PV plant. The monitoring software stores the PV measurements in a data warehouse optimized for managing and data mining large amounts of data, from where it can be later visualized, analyzed and exported. By combining PV production measurements data with I-V curve measurements...

SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future

Energy Technology Data Exchange (ETDEWEB)

Cole, Wesley J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Woodhouse, Michael A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-09-12

In this report we summarize the implications, impacts, and deployment potential of reaching the SunShot 2030 targets for the electricity system in the contiguous United States. We model 25 scenarios of the U.S. power sector using the Regional Energy Deployment Systems (ReEDS) and Distributed Generation (dGen) capacity expansion models. The scenarios cover a wide range of sensitivities to capture future uncertainties relating to fuel prices, retirements, renewable energy capital costs, and load growth. We give special attention to the potential for storage costs to also rapidly decline due to its large synergies with low-cost solar. The ReEDS and dGen models project utility- and distributed-scale power sector evolution, respectively, for the United States. Both models have been designed with special emphasis on capturing the unique traits of renewable energy, including variability and grid integration requirements. Across the suite of scenarios modeled, we find that reaching the SunShot 2030 target has the potential to lead to significant capacity additions of PV in the United States. By 2050, PV penetration levels are projected to reach 28-46 percent of total generation. If storage also sees significant reductions in cost, then the 2050 solar penetration levels could reach 41-64 percent. PV deployment is projected to occur in all of the lower 48 states, though the specific deployment level is scenario dependent. The growth in PV is projected to be dominated by utility-scale systems, but the actual mix between utility and distributed systems could ultimately vary depending on how policies, system costs, and rate structures evolve.

Prediction of processing tomato peeling outcomes

Science.gov (United States)

Peeling outcomes of processing tomatoes were predicted using multivariate analysis of Magnetic Resonance (MR) images. Tomatoes were obtained from a whole-peel production line. Each fruit was imaged using a 7 Tesla MR system, and a multivariate data set was created from 28 different images. After ...

Screening of tomato varieties for fruit tree based Agroforestry system

Directory of Open Access Journals (Sweden)

J. Hossain

2014-12-01

Full Text Available An experiment was conducted with four tomato varieties under a six year old orchard was accomplished at the Bangabandhu Sheikh Mujibur Rahman Agricultural University (BSMRAU research farm during October 2011 to April 2012. The experiment was laid out in a Randomized Complete Block Design with three replications. Four tomato varieties (BARI Tomato 2, BARI Tomato 8, BARI Tomato 14 and BARI Tomato 15 were grown under guava, mango, olive and control. Results showed that light availability in control plot (999.75 μ mol m-2s-1 was remarkably higher over fruit tree based agroforestry systems and it was 58.8, 43.9 and 31.5% of the control for guava, mango and olive based systems, respectively. The shortest tomato plant was observed in olive based system (54.91 cm, while the tallest plant was observed in mango based system (60.09 cm. The highest SPAD value and number of primary branches per plant was recorded in control plot. Fruit length, fruit girth was found lowest in olive based system. The highest yield (34.06 t ha-1 was recorded in control plot while the lowest yield (10.26 t ha-1 was recorded in olive based system. The economic performance of fruit tree based tomato production system showed that both the net return and BCR of mango and guava based system was higher over control and olive based system. The contents of organic carbon, nitrogen, available phosphorus, potassium and sulfur of before experimentation soil were slightly higher in fruit tree based agroforestry systems than the control. After experimentation, nutrient elements in soil were found increased slightly than initial soils. Fruit tree based agroforestry systems could be ranked based on the economic performance as mango> guava> control> olive based system with BARI Tomato 15, BARI Tomato 2, BARI Tomato 14 and BARI Tomato 8, respectively.

The Value of Transparency in Distributed Solar PV Markets

Energy Technology Data Exchange (ETDEWEB)

OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-10-09

Distributed solar photovoltaic (PV) markets are relatively non-transparent: PV price and product information is not readily available, searching for this information is costly (in terms of time and effort), and customers are mostly unfamiliar with the new technology. Quote aggregation, where third-party companies collect PV quotes on behalf of customers, may be one way to increase PV market transparency. In this paper, quote aggregation data are analyzed to study the value of transparency for distributed solar PV markets. The results suggest that easier access to more quotes results in lower prices. We find that installers tend to offer lower prices in more competitive market environments. We supplement the empirical analysis with key findings from interviews of residential PV installers.

Low concentrator PV optics optimization

Science.gov (United States)

Sharp, Leonard; Chang, Ben

2008-08-01

Purpose: Cost reduction is a major focus of the solar industry. Thin film technologies and concentration systems are viable ways to reducing cost, with unique strengths and weakness for both. Most of the concentrating PV work focuses on high concentration systems for reducing energy cost. Meanwhile, many believe that low concentrators provide significant cost reduction potential while addressing the mainstream PV market with a product that acts as a flat panel replacement. This paper analyzes the relative benefit of asymmetric vs. symmetric optics for low-concentrators in light of specific PV applications. Approach: Symmetric and asymmetric concentrating PV module performance is evaluated using computer simulation to determine potential value across various geographic locations and applications. The selected optic design is modeled against standard cSi flat panels and thin film to determine application fit, system level energy density and economic value. Results: While symmetric designs may seem ideal, asymmetric designs have an advantage in energy density. Both designs are assessed for aperture, optimum concentration ratio, and ideal system array configuration. Analysis of performance across climate specific effects (diffuse, direct and circumsolar) and location specific effects (sunpath) are also presented. The energy density and energy production of low concentrators provide a compelling value proposition. More significantly, the choice of optics for a low concentrating design can affect real world performance. With the goal of maximizing energy density and return on investment, this paper presents the advantages of asymmetric optic concentration and illustrates the value of this design within specific PV applications.

Control of the Tomato Leafminer, Tuta absoluta (Lepidoptera: Gelechiidae), in Open-Field Tomatoes by Indigenous Natural Enemies Occurring in Israel.

Science.gov (United States)

Shaltiel-Harpaz, Liora; Gerling, Dan; Graph, Shaul; Kedoshim, Hendrika; Azolay, Lotem; Rozenberg, Tamir; Nachache, Yaakov; Steinberg, Shimon; Allouche, Arnon; Alon, Tamar

2016-02-01

The tomato leafminer, Tuta absoluta (Meyrick), had established in Israel by 2010, attacking both open-field tomatoes and greenhouse crops.We searched for its natural enemies in open-field tomatoes, and tried to determine their potential for controlling this pest. We surveyed the local natural enemies in open tomato fields and measured their impact on pest populations in an unsprayed field. We assessed the suppressive ability of the dominant hemipteran predator, Nesidiocoris tenuis Reuter, against T. absoluta under controlled laboratory conditions and evaluated the impact of its augmentation on T. absoluta control in open-field tomatoes. We found five natural enemy species:the predator, N. tenuis, two braconids, and two eulophids. Predation accounted for 64.5±9.2% (mean ± SE) of T. absoluta larval mortality, whereas parasitism accounted for 20.96±7.5%. Together, they eliminated the pest population at tomato harvest time. Under controlled conditions, predation by N. tenuis rose from 58 to 72% with increased density of T. absoluta, suggesting positive density dependence. The reduction of T. absoluta (83%) by N. tenuis was higher than that of Bemisia tabaci (32%), suggesting a preference of N. tenuis for T. absoluta. Augmentation of N.tenuis was as effective as conventional treatment insecticide treatment, and plant damage was low and did not seem to affect yield. Results indicate that reduced pesticide use enables indigenous natural enemies, particularly N.tenuis, to successfully control T. absoluta and prevent crop damage in open-field tomatoes.

Commercialization and business development of grid-connected PV at SMUD

International Nuclear Information System (INIS)

Osborn, D.E.

1998-01-01

SMUD has completed its first 5 year, 6 MW PV commercialization effort based on the sustained, orderly development of the utility PV market. SMUD has begun a 5 year, 10 MW program designed to complete a process that will result in PV being at a market competitive price by 2002 and as a sustainable business opportunity for SMUD. As part of this effort, by the end of 1997, SMUD had installed over 450 PV systems totaling 6 MW. These included over 420 residential rooftop systems as well as commercial buildings, parking lots and substation systems. Under its new Business Plan, SMUD has signed contracts for an additional 10 MW of PV systems for 1998 through 2002 with cost decreasing to less than $3/W. As part of its new competitive business strategy responding to changes the utility industry is undergoing, SMUD has incorporated PV as a key business opportunity. SMUD has established partnerships with its customers through the PV Pioneer green pricing program, with DOE and UPVG through TEAM-UP and Million Solar Roofs to advance PV commercialization and to develop rooftops as PV power plant sites and with other utilities through its PV Partnership program

Evaluation of some varieties and breeding lines of tomato (Lycopersison sp) against tomato yellow leaf curl disease in the Greater Accra Region (Ghana)

International Nuclear Information System (INIS)

Kusi-Adjei, R.

2011-01-01

A series of experiments were conducted to evaluate ten (10) tomato varieties and breeding lines against tomato yellow leaf curl virus disease in Ghana. The research was undertaken at the research farm of the Biotechnology and Nuclear Agriculture Research Institute of the Ghana Atomic Energy Commission. Ten tomato varieties and breeding lines were evaluated in the field under natural whitefly inoculation in insect-proof cages. The field trial was done in the dry season from October, 2010 to February, 2011 and wet season from March, 2011 to July, 2011. Plants in the fields and in the cage exhibited varied symptoms such as leaf curling, leaf yellowing and reduced leaf sizes. Assessment of disease incidence and symptom severity using a four point scale (0-4) showed that, in the field there was higher disease incidence in the dry season as compared to the wet season. This was attributed to the higher number of whiteflies in the dry season as demonstrated through a whitefly population survey conducted in the field. Differences among means for disease incidence and whitefly surveys on the ten tomato varieties and breeding lines were statistically significant (p≤ 0.05). Wild Tomato (Solanum pimpinellifollium) and two hybrids, Wosowoso x Wild Tomato and Cherry Red x Wild Tomato exhibited signs of resistance in the field and did not show any symptoms of TYLCV disease symptoms. All the commercial varieties were highly susceptible and showed severe symptoms. Evaluation of fruit yield in the field revealed that the commercial variety Tomato Advanta had the heaviest fruit weight (42 g/ fruit) whilst Wosowoso had the highest total fruit yield (5.74 t/ha) in the wet season. Wild Tomato and the hybrids produced higher number of fruits compared to the commercial varieties. There were highly significant differences in the means of number of fruits, fruit weight (g) and total fruit yield (t/ha) among the ten tomato varieties and breeding lines in both the wet and dry seasons

Tomato yellow leaf curl virus can be acquired and transmitted by Bemisia tabaci (Gennadius) from tomato fruits

NARCIS (Netherlands)

Delatte, H.; Dalmon, A.; Rist, D.; Soustrade, I.; Wuster, G.; Lett, J.M.; Goldbach, R.W.; Peterschmitt, M.; Reynaud, B.

2003-01-01

The whitefly Bemisia tabaci is an insect pest causing worldwide economic losses, especially as a vector of geminiviruses such as Tomato yellow leaf curl virus (TYLCV). Currently, imported and exported tomato fruit are not monitored for TYLCV infection because they are not considered to represent a

Effect of essential oil of Origanum rotundifolium on some plant pathogenic bacteria, seed germination and plant growth of tomato

Science.gov (United States)

Dadaşoǧlu, Fatih; Kotan, Recep; Karagöz, Kenan; Dikbaş, Neslihan; Ćakmakçi, Ramazan; Ćakir, Ahmet; Kordali, Şaban; Özer, Hakan

2016-04-01

The aim of this study is to determine effect of Origanum rotundifolium's essential oil on some plant pathogenic bacterias, seed germination and plant growth of tomato. Xanthomonas axanopodis pv. vesicatoria strain (Xcv-761) and Clavibacter michiganensis ssp. michiganensis strain (Cmm) inoculated to tomato seed. The seeds were tested for germination in vitro and disease severity and some plant growth parameters in vivo. In vitro assay, maximum seed germination was observed at 62,5 µl/ml essential oil treatment in seeds inoculated with Xcv-761 and at 62,5 µl/ml essential oil and streptomycin treatment in seeds inoculated with Cmm. The least infected cotiledon number was observed at 500 µg/ml streptomycin treatment in seeds inoculated with Cmm. In vivo assay, maximum seed germination was observed at 250 µl/ml essential oil teratment in tomato inoculated with Cmm. Lowest disease severity, is seen in the CMM infected seeds with 250 µl/ml essential oil application these results were statistically significant when compared with pathogen infected seeds. Similarly, in application conducted with XCV-761 infected seed, the lowest disease severity was observed for seeds as a result of 250 µl/ml essential oil application. Also according to the results obtained from essential oil application of CMM infected seeds conducted with 62,5 µl/ml dose; while disease severity was found statistically insignificant compared to 250 µl/ml to essential oil application, ıt was found statistically significant compared to pathogen infected seeds. The results showed that essential oil of O. rotundifolium has a potential for some suppressed plant disease when it is used in appropriate dose.

TRNSYS HYBRID wind diesel PV simulator

Energy Technology Data Exchange (ETDEWEB)

Quinlan, P.J.A.; Mitchell, J.W.; Klein, S.A.; Beckman, W.A.; Blair, N.J. [Univ. of Wisconsin, Madison, WI (United States)

1996-12-31

The Solar Energy Laboratory (SEL) has developed a wind diesel PV hybrid systems simulator, UW-HYBRID 1.0, an application of the TRNSYS 14.2 time-series simulation environment. An AC/DC bus links up to five diesels and wind turbine models, along with PV modules, a battery bank, and an AC/DC converter. Multiple units can be selected. PV system simulations include solar angle and peak power tracking options. Weather data are Typical Meteorological Year data, parametrically generated synthesized data, or external data files. PV performance simulations rely on long-standing SEL-developed algorithms. Loads data are read as scalable time series. Diesel simulations include estimated fuel-use and waste heat output, and are dispatched using a least-cost of fuel strategy. Wind system simulations include varying air density, wind shear and wake effects. Time step duration is user-selectable. UW-HYBRID 1.0 runs in Windows{reg_sign}, with TRNSED providing a customizable user interface. 12 refs., 6 figs.

Environmental and exergy benefit of nanofluid-based hybrid PV/T systems

International Nuclear Information System (INIS)

Hassani, Samir; Saidur, R.; Mekhilef, Saad; Taylor, Robert A.

2016-01-01

Highlights: • Environmental and ExPBT analysis of different PV/T configurations is presented. • The exergy payback time of nanofluid-based hybrid PV/T system is about 2 years. • Nanofluid-based hybrid PV/T system is a reliable solution for pollution prevention. • Nanofluid-based hybrid PV/T system is highly recommended at high solar concentration. - Abstract: Photovoltaic/thermal (PV/T) solar systems, which produce both electrical and thermal energy simultaneously, represent a method to achieve very high conversion rates of sunlight into useful energy. In recent years, nanofluids have been proposed as efficient coolants and optical filter for PV/T systems. Aim of this paper is to theoretically analyze the life cycle exergy of three different configurations of nanofluids-based PV/T hybrid systems, and compare their performance to a standard PV and PV/T system. Electrical and thermal performance of the analyzed solar collectors was investigated numerically. The life cycle exergy analysis revealed that the nanofluids-based PV/T system showed the best performance compared to a standard PV and PV/T systems. At the optimum value of solar concentration C, nanofluid-based PV/T configuration with optimized optical and thermal properties produces ∼1.3 MW h/m 2 of high-grade exergy annually with the lowest exergy payback time of 2 years, whereas these are ∼0.36, ∼0.79 MW h/m 2 and 3.48, 2.55 years for standard PV and PV/T systems, respectively. In addition, the nanofluids-based PV/T system can prevent the emissions of about 448 kg CO 2 eq m −2 yr −1 . Overall, it was found that the nanofluids-based PV/T with optimized optical and thermal properties has potential for further development in a high-concentration solar system.

Less CO2 by means of photovoltaic energy (PV)

International Nuclear Information System (INIS)

Alsema, E.A.; Van Brummelen, M.

1992-11-01

Regarding the title subject special attention is paid to the technical limitations of a fast introduction of the use of photovoltaic (PV) energy conversion. After a brief introduction on PV systems and the operation of a solar cell in chapter two, a state of the art is given of PV technology and possible price developments for PV modules and Balance-Of-System (BOS) components up to the year 2000 in chapters three and four. In chapter five the potential of installing grid-connected PV systems in the Netherlands is determined, taking into account the options of using existing buildings (PV systems on the roof), unexplored ground, in the verge of highways or railroads, industrial areas and airports. In chapter six non-economical bottlenecks for a large-scale introduction of grid-connected PV systems are discussed: the industrial production capacity for PV modules and other components, the fitting-in into the public electricity supply, and institutional aspects of installing PV systems on roofs. In chapter seven it is determined how much costs can be saved and CO 2 emission can be reduced when PV capacity is fitted-in into the Dutch electric power supply. The calculations are based on the Global Shift scenario. In chapter eight two scenarios (an optimistic scenario and a more realistic scenario) for the introduction of PV systems are outlined. For both scenarios the financial consequences and the contribution to the electric power supply are indicated. In chapter nine the net energy yield, being the result of the previously discussed introduction scenarios, is calculated, followed by a calculation of the avoided CO 2 emission, as well as the costs to avoid such emission. 25 figs., 15 tabs., 116 refs., 1 annex

Fertilizers applied to certified organic tomato culture

International Nuclear Information System (INIS)

Martins, T.C.G.; De Nadai Fernandes, E.A.; Ferrari, A.A.; Bacchi, M.A.; Tagliaferro, F.S.

2010-01-01

The tomato culture demands large quantities of mineral nutrients, which are supplied by synthetic fertilizers in the conventional cultivation system. In the organic cultivation system only alternative fertilizers are allowed by the certifiers and accepted as safe for humans and environment. The chemical composition of rice bran, oyster flour, cattle manure and ground charcoal, as well as soils and tomato fruits were evaluated by instrumental neutron activation analysis (INAA). The potential contribution of organic fertilizers to the enrichment of chemical elements in soil and their transfer to fruits was investigated using concentration ratios for fertilizer and soil samples, and also for soil and tomato. Results evidenced that these alternative fertilizers could be taken as important sources of Br, Ca, Ce, K, Na and Zn for the organic tomato culture. (author)

Accelerating residential PV expansion: supply analysis for competitive electricity markets

International Nuclear Information System (INIS)

Payne, Adam; Williams, Robert H.; Duke, Richard

2001-01-01

Photovoltaic (PV) technology is now sufficiently advanced that market support mechanisms such as net metering plus a renewable portfolio standard (RPS) could induce rapid PV market growth in grid-connected applications. With such support mechanisms, markets would be sufficiently large that manufacturers could profitably build and operate 100 MW p /yr PV module factories, and electricity costs for residential rooftop PV systems would compare favorably with residential electricity prices in certain areas (e.g., California and the greater New York region in the US). This prospect is illustrated by economic and market analyses for one promising technology (amorphous silicon thin-film PV) from the perspectives of both module manufacturers and buyers of new homes with rooftop PV systems. With public policies that reflect the distributed and environmental benefits offered by PV-and that can sustain domestic PV market demand growth at three times the historical growth rate for a period of the order of two decades - PV could provide 3% of total US electricity supply by 2025. (Author)

Changes in antioxidant and metabolite profiles during production of tomato paste

NARCIS (Netherlands)

Capanoglu, E.; Beekwilder, M.J.; Boyacioglu, D.; Hall, R.D.; Vos, de C.H.

2008-01-01

Tomato products and especially concentrated tomato paste are important sources of antioxidants in the Mediterranean diet. Tomato fruit contain well-known antioxidants such as vitamin C, carotenoids, flavonoids, and hydroxycinnamic acids. The industrial processing of this fruit into tomato paste

KINETICS OF COLOUR CHANGE OF TOMATOES DURING DRYING

Directory of Open Access Journals (Sweden)

A. Unadi

2016-10-01

Full Text Available Colour is one of the pharameters determining the quality of dried tomatoes. The changes in colour of the skin of tomatoes during drying in an experimental dryer at various temperatures were measured every two hours by using Minolta CR 200 colorimeter and the colours were represented in Hunter-Lab scale. The objective of this research was develop a model for predicting colour changes of tomatoes during drying. The decrease in darkness as represented by dL value varied from 10 to 16%, while decrease in chroma value (dL varied from 20 to 37% of initial values. An empirical logarithmic equation with six constants was derived to fit the data of chroma changes during drying at various temperature and times. The model of colour change of tomatoes can be used for determining the optimum drying temperature to produce acceptable colour of dried tomatoes at reasonable cost.

The Arabidopsis thaliana non-specific phospholipase C2 is involved in the response to Pseudomonas syringae attack

Czech Academy of Sciences Publication Activity Database

Krčková, Zuzana; Kocourková, Daniela; Daněk, Michal; Brouzdová, Jitka; Pejchar, Přemysl; Janda, Martin; Pokotylo, I.; Ott, P.G.; Valentová, O.; Martinec, Jan

2018-01-01

Roč. 121, č. 2 (2018), s. 297-310 ISSN 0305-7364 R&D Projects: GA ČR(CZ) GAP501/12/1942 Institutional support: RVO:61389030 Keywords : Arabidopsis thaliana * effector-triggered immunity * flagellin * MAMP-triggered immunity * non-specific phospholipase C * phosphatidylcholine-specific phospholipase C * Pseudomonas syringae * reactive oxygen species Subject RIV: ED - Physiology OBOR OECD: Plant sciences, botany Impact factor: 4.041, year: 2016

PV panel model based on datasheet values

DEFF Research Database (Denmark)

Sera, Dezso; Teodorescu, Remus; Rodriguez, Pedro

2007-01-01

This work presents the construction of a model for a PV panel using the single-diode five-parameters model, based exclusively on data-sheet parameters. The model takes into account the series and parallel (shunt) resistance of the panel. The equivalent circuit and the basic equations of the PV cell....... Based on these equations, a PV panel model, which is able to predict the panel behavior in different temperature and irradiance conditions, is built and tested....

Good and bad practices in pv plants

OpenAIRE

Martinez Moreno, Francisco; Helleputte, F.; Tyutyundzhiev, N.; Rabal Echeverria, Daniel; Conlon, Michael; Fartaria, Tomás; Oteiza, David

2013-01-01

The PVCROPS project (PhotoVolta ic Cost r€duction, Reliability, Operational performance, Prediction and Simulation), cofinanced by European Commission in the frame of Seventh Framework Programme, has compiled in the “Good and bad practices: Manual to improve the quality and reduce the cost of PV systems” a collection of good and bad practices in actual PV plants . All the situations it collects represent the state-of-the-art of existing PV installations all around Europe. They show how ...

Real Time Photovoltaic Array Simulator for Testing Grid-Connected PV Inverters

DEFF Research Database (Denmark)

Sera, Dezso; Valentini, Massimo; Raducu, Alin

2008-01-01

In this paper a real time flexible PV array simulator is presented. It is a system that can simulate different PV panel arrays in specific environmental conditions. To evaluate performance of the Maximum Power Point Tracking (MPPT) of grid-connected Photovoltaic (PV) inverters only measurements...... undertaken with an appropriate PV array simulator provide accurate and reproducible results. Thus the PV array simulator has been developed and implemented. MPPT efficiency tests on a commercial grid-connected PV inverter have been performed to validate the PV array simulator....

Energy metrics analysis of hybrid - photovoltaic (PV) modules

Energy Technology Data Exchange (ETDEWEB)

Tiwari, Arvind [Department of Electronics and Communication, Krishna Institute of Engineering and Technology, 13 k.m. stone, Ghaziabad - Meerut Road, Ghaziabad 201 206, UP (India); Barnwal, P.; Sandhu, G.S.; Sodha, M.S. [Centre for Energy Studies, Indian Institute of Technology Delhi, Hauz Khas, New Delhi 110 016 (India)

2009-12-15

In this paper, energy metrics (energy pay back time, electricity production factor and life cycle conversion efficiency) of hybrid photovoltaic (PV) modules have been analyzed and presented for the composite climate of New Delhi, India. For this purpose, it is necessary to calculate (1) the energy consumption in making different components of the PV modules and (2) the annual energy (electrical and thermal) available from the hybrid-PV modules. A set of mathematical relations have been reformulated for computation of the energy metrics. The manufacturing energy, material production energy, energy use and distribution energy of the system have been taken into account, to determine the embodied energy for the hybrid-PV modules. The embodied energy and annual energy outputs have been used for evaluation of the energy metrics. For hybrid PV module, it has been observed that the EPBT gets significantly reduced by taking into account the increase in annual energy availability of the thermal energy in addition to the electrical energy. The values of EPF and LCCE of hybrid PV module become higher as expected. (author)

Real time PV manufacturing diagnostic system

Energy Technology Data Exchange (ETDEWEB)

Kochergin, Vladimir [MicroXact Inc., Blacksburg, VA (United States); Crawford, Michael A. [MicroXact Inc., Blacksburg, VA (United States)

2015-09-01

The main obstacle Photovoltaic (PV) industry is facing at present is the higher cost of PV energy compared to that of fossil energy. While solar cell efficiencies continue to make incremental gains these improvements are so far insufficient to drive PV costs down to match that of fossil energy. Improved in-line diagnostics however, has the potential to significantly increase the productivity and reduce cost by improving the yield of the process. On this Phase I/Phase II SBIR project MicroXact developed and demonstrated at CIGS pilot manufacturing line a high-throughput in-line PV manufacturing diagnostic system, which was verified to provide fast and accurate data on the spatial uniformity of thickness, an composition of the thin films comprising the solar cell as the solar cell is processed reel-to-reel. In Phase II project MicroXact developed a stand-alone system prototype and demonstrated the following technical characteristics: 1) ability of real time defect/composition inconsistency detection over 60cm wide web at web speeds up to 3m/minute; 2) Better than 1mm spatial resolution on 60cm wide web; 3) an average better than 20nm spectral resolution resulting in more than sufficient sensitivity to composition imperfections (copper-rich and copper-poor regions were detected). The system was verified to be high vacuum compatible. Phase II results completely validated both technical and economic feasibility of the proposed concept. MicroXact’s solution is an enabling technique for in-line PV manufacturing diagnostics to increase the productivity of PV manufacturing lines and reduce the cost of solar energy, thus reducing the US dependency on foreign oil while simultaneously reducing emission of greenhouse gasses.

Methods for the Optimal Design of Grid-Connected PV Inverters

DEFF Research Database (Denmark)

Koutroulis, Eftichios; Blaabjerg, Frede

2011-01-01

and the efficient processing of this power by the DC/AC inverter. In this paper two new methods are presented for the optimal design of a PV inverter power section, output filter and MPPT control strategy. The influences of the electric grid regulations and standards as well as the PV array operational......The DC/AC inverters are used in grid-connected PV energy production systems as the power processing interface between the PV energy source and the electric grid. The energy injected into the electric grid by the PV installation depends on the amount of power extracted from the PV power source...

Abscisic acid-cytokinin antagonism modulates resistance against pseudomonas syringae in Tobacco

DEFF Research Database (Denmark)

Grosskinsky, Dominik Kilian; van der Graaff, Eric; Roitsch, Thomas Georg

2014-01-01

Phytohormones are known as essential regulators of plant defenses, with ethylene, jasmonic acid, and salicylic acid as the central immunity backbone, while other phytohormones have been demonstrated to interact with this. Only recently, a function of the classic phytohormone cytokinin in plant...... immunity has been described in Arabidopsis, rice, and tobacco. Although interactions of cytokinins with salicylic acid and auxin have been indicated, the complete network of cytokinin interactions with other immunity-relevant phytohormones is not yet understood. Therefore, we studied the interaction...... of kinetin and abscisic acid as a negative regulator of plant immunity to modulate resistance in tobacco against Pseudomonas syringae. By analyzing infection symptoms, pathogen proliferation, and accumulation of the phytoalexin scopoletin as a key mediator of kinetin-induced resistance in tobacco...

Design Optimization of Transformerless Grid-Connected PV Inverters Including Reliability

OpenAIRE

Koutroulis, Eftichios; Blaabjerg, Frede

2013-01-01

This paper presents a new methodology for optimal design of transformerless photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal switching frequency as well as the optimal values and types of the PV inverter components is calculated such that the PV inverter LCOE generated during the PV system lifetime period is minimized. The LCOE is also calculated considering the failure rates of the components, which affect the reliability performance...

Terawatt Challenge for Thin-Film PV

Energy Technology Data Exchange (ETDEWEB)

Zweibel, K.

2005-08-01

The evolution of PV into one of the world's largest industries is not going to happen without major unforeseen problems. However, this study attempts to address the obvious ones, so that we can put aside the mythology of PV (for example, that it is only ''boutique power'' or that one must pave the world with it to be useful) and get on with changing the world's energy infrastructure. With the years of rapid market growth now under way in PV, the author is sure this will not be the last effort to understand the real potential and pitfalls of meeting the Challenge.

Morphological and Molecular Identification of Colletotrichum acutatum from Tomato Fruit

Directory of Open Access Journals (Sweden)

Svetlana Živković

2010-01-01

Full Text Available Colletotrichum gloeosporioides, Colletotrichum acutatum, Colletotrichum coccodes, and Colletotrichum dematium are the four main species of Colletotrichum that cause tomato anthracnose. In Serbia, the occurrence of anthracnose on tomato fruit has been recorded during the last several years. Typical fruit symptoms include dark, sunken, and circular lesion with orange conidial masses. Pathogen isolates were obtained from a diseased tomato fruits, on PDA medium forming a white to gray colonies. The cultures developed black acervuli around the center of the colony. Conidia were hyaline, aseptate, and fusiform or rarely cylindrical. Appressoria were smooth, simple, clavate to ovate, and variedfrom light to dark brown. Pathogenicity tests with representative isolates were conducted on symptomless, detached tomato fruits. All tested isolates caused anthracnose lesions on tomato fruit after 7 days of incubation. Koch’s postulates were fulfilled by reisolationfrom inoculated tomato fruits. PCR analysis (using species-specific primer pair, CaInt2/ITS4 of genomic DNA from tomato isolates resulted in an amplification product of 490 bp, specific for C. acutatum, further confirming the identity of the pathogen. Based onmorphological and molecular characteristics, the isolates from tomato fruit were determined as C. acutatum.

The 7B-1 mutation in tomato (Solanum lycopersicum L.) confers a blue light-specific lower sensitivity to coronatine, a toxin produced by Pseudomonas syringae pv. tomato

Czech Academy of Sciences Publication Activity Database

Bergougnoux, V.; Hlaváčková, V.; Plotzová, R.; Novák, Ondřej; Fellner, Martin

2009-01-01

Roč. 60, č. 4 (2009), s. 1219-1230 ISSN 0022-0957 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blue light-specific response * COI1 * coronatine Subject RIV: EF - Botanics Impact factor: 4.271, year: 2009

National survey report on PV power applications in Switzerland 2006

International Nuclear Information System (INIS)

Huesser, P.; Hostettler, T.

2007-01-01

This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.

National survey report on PV power applications in Switzerland 2006

Energy Technology Data Exchange (ETDEWEB)

Huesser, P. [Nova Energie GmbH, Aarau (Switzerland); Hostettler, T. [Ingenieurbuero Hostettler, Berne (Switzerland)

2007-07-01

This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.

Economics Of Tomato Production In Yewa North Local Government ...

African Journals Online (AJOL)

Questions relating to the socio-economic characteristics of the tomato farmers, tomato outputs, output prices and cost of resources viz. labour, seed, fertilizer and land used in production, as well as constraints to tomato production were asked in the questionnaire. Production function analysis was used to show the ...

A Snapshot of the Emerging Tomato Genome Sequence

Directory of Open Access Journals (Sweden)

Lukas A. Mueller

2009-03-01

Full Text Available The genome of tomato ( L. is being sequenced by an international consortium of 10 countries (Korea, China, the United Kingdom, India, the Netherlands, France, Japan, Spain, Italy, and the United States as part of the larger “International Solanaceae Genome Project (SOL: Systems Approach to Diversity and Adaptation” initiative. The tomato genome sequencing project uses an ordered bacterial artificial chromosome (BAC approach to generate a high-quality tomato euchromatic genome sequence for use as a reference genome for the Solanaceae and euasterids. Sequence is deposited at GenBank and at the SOL Genomics Network (SGN. Currently, there are around 1000 BACs finished or in progress, representing more than a third of the projected euchromatic portion of the genome. An annotation effort is also underway by the International Tomato Annotation Group. The expected number of genes in the euchromatin is ∼40,000, based on an estimate from a preliminary annotation of 11% of finished sequence. Here, we present this first snapshot of the emerging tomato genome and its annotation, a short comparison with potato ( L. sequence data, and the tools available for the researchers to exploit this new resource are also presented. In the future, whole-genome shotgun techniques will be combined with the BAC-by-BAC approach to cover the entire tomato genome. The high-quality reference euchromatic tomato sequence is expected to be near completion by 2010.

Effect of Tomato Industrial Processing on Phenolic Profile and Antiplatelet Activity

Directory of Open Access Journals (Sweden)

Iván Palomo

2013-09-01

Full Text Available Background: Regular consumption of fruits and vegetables (e.g., tomatoes has been shown to be beneficial in terms of reducing the incidence of cardiovascular diseases. The industrial processing of tomatoes into tomato-based products includes several thermal treatments. Very little is known on the effect of tomato industrial processing on antiaggregatory activity and phenolic profile. Methods: It was assessed the effect of tomato and by-products extracts on platelet aggregation induced by ADP, collagen, TRAP-6 and arachidonic acid. These in vitro antithrombotic properties were further supported in an in vivo model of thrombosis. A set of antiplatelet compounds has been selected for HPLC analysis in the different extracts. Results: Some natural compounds such as chlorogenic, caffeic, ferulic and p-coumaric acids were identified by HPLC in tomatoes and its products may inhibit platelet activation. Red tomatoes, tomato products (sauce, ketchup and juice and by-products extracts inhibited platelet aggregation induced adenosine 5'-diphosphate, collagen, thrombin receptor activator peptide-6 and arachidonic acid, but to a different extent. Also, pomace extract presents antithrombotic activity. Conclusions: Processed tomatoes may have a higher content of health-benefiting compounds than fresh ones. Pomace even presents the best antiplatelet activity. Finally, tomato products may be used as a functional ingredient adding antiplatelet activities to processed foods.

Accelerating residential PV expansion: demand analysis for competitive electricity markets

International Nuclear Information System (INIS)

Duke, Richard; Williams, Robert; Payne, Adam

2005-01-01

This article quantifies the potential market for grid-connected, residential photovoltaic (PV) electricity integrated into new homes built in the US. It complements an earlier supply-side analysis by the authors that demonstrates the potential to reduce PV module prices below $1.5/W p by scaling up existing thin-film technology in 100 MW p /yr manufacturing facilities. The present article demonstrates that, at that price, PV modules may be cost effective in 125,000 new home installations per year (0.5 GW p /yr). While this market is large enough to support multiple scaled up thin-film PV factories, inefficient energy pricing and demand-side market failures will inhibit prospective PV consumers without strong public policy support. Net metering rules, already implemented in many states to encourage PV market launch, represent a crude but reasonable surrogate for efficient electricity pricing mechanisms that may ultimately emerge to internalize the externality benefits of PV. These public benefits include reduced air pollution damages (estimated costs of damage to human health from fossil fuel power plants are presented in Appendix A), deferral of transmission and distribution capital expenditures, reduced exposure to fossil fuel price risks, and increased electricity system reliability for end users. Thus, net metering for PV ought to be implemented as broadly as possible and sustained until efficient pricing is in place. Complementary PV 'buydowns' (e.g., a renewable portfolio standard with a specific PV requirement) are needed to jumpstart regional PV markets

Development of Aloe vera based edible coating for tomato

Science.gov (United States)

Athmaselvi, K. A.; Sumitha, P.; Revathy, B.

2013-12-01

The effect of formulated Aloe vera based edible coating on mass loss, colour, firmness, pH, acidity, total soluble solid, ascorbic acid and lycopene on the coated tomato was investigated. The tomato in control showed a rapid deterioration with an estimated shelf life period of 19 days, based on the mass loss, colour changes, accelerated softening and ripening. On the contrary, the coating on tomatoes delayed the ripening and extended the shelf life up to 39 days. The physiological loss in weight was 7.6 and 15.1%, firmness was 36 and 46.2 N on 20th day for control and coated tomatoes, respectively. From the results, it was concluded that the use of Aloe vera based edible coating leads to increased tomato shelf-life.

Do feed-in tariffs drive PV cost or viceversa?

International Nuclear Information System (INIS)

Antonelli, Marco; Desideri, Umberto

2014-01-01

Highlights: • The distribution of PV installations on the territory is not a function of the solar radiation. • Cost of PV plants were adapted to the FIT framework. • The FIT for PV in Italy was considered an incentive to financial investment. • The FIT for PV in Italy did not stimulate the development of national PV industry. - Abstract: A survey of the PV market in Italy was done studying a number of installations of different sizes whose economic data were known and assessed. The Italian market has experienced a boom in the PV market after the first mechanism of feed-in tariffs was promoted in 2005. The variations of the tariff structure in the following years have caused significant changes in the market structure in terms of average size and technical characteristics of installed plants. However, an Italian PV industry was not stimulated by the incentives and only companies involved in installation and maintenance were created. At the same time, the cost of the PV plants components, design and commissioning have followed quite a particular trend, which is more determined by the tariffs than by the market development and structure. It is quite clear that the costs of PV plants component are not driven by the amount of installations but by the tariffs, with a trend that follows the decreases in the incentives and not the global installed power. It is therefore very important to study the right tariff mechanisms and benefits to avoid financial disturbances on the market and to promote a real competitive market instead of a simple financial operation under a fake façade of green economy

Solar Energy: Incentives to Promote PV in EU27

Directory of Open Access Journals (Sweden)

María del P. Pablo-Romero

2013-11-01

Full Text Available The growth in the use of renewable energies in the EU has been remarkable. Among these energies is PV. The average annual growth rate for the EU-27 countries in installed PV capacity in the period 2005-2012 was 41.2%. While the installed capacity of PV has reached almost 82 % of National Renewable Energy Action Plan (NREAP targets for the EU-27 countries for 2020, it is still far from being used at its full potential. Over recent years, several measures have been adopted in the EU to enhance and promote PV. This paper undertakes a complete review of the state of PV power in Europe and the measures taken to date to promote it in EU-27. 25 countries have adopted measures to promote PV. The most widespread measure to promote PV use is Feed- in Tariffs. Tariffs are normally adjusted, in a decreasing manner, annually. Nevertheless, currently, seven countries have decided to accelerate this decrease rate in view of cost reduction of the installations and of higher efficiencies. The second instrument used to promote PV in the EU-27 countries is the concession of subsidies. Nevertheless, subsidies have the disadvantage of being closely linked to budgetary resources and therefore to budgetary constraints. In most EU countries, subsidies for renewable energy for PV are being lowered. Twelve EU-27 countries adopted tax measures. Low-interest loans and green certificate systems were only sparingly used.

Kauai Island Utility Co-op (KIUC) PV integration study.

Energy Technology Data Exchange (ETDEWEB)

Ellis, Abraham; Mousseau, Tom (Knoxville, TN)

2011-08-01

This report investigates the effects that increased distributed photovoltaic (PV) generation would have on the Kauai Island Utility Co-op (KIUC) system operating requirements. The study focused on determining reserve requirements needed to mitigate the impact of PV variability on system frequency, and the impact on operating costs. Scenarios of 5-MW, 10-MW, and 15-MW nameplate capacity of PV generation plants distributed across the Kauai Island were considered in this study. The analysis required synthesis of the PV solar resource data and modeling of the KIUC system inertia. Based on the results, some findings and conclusions could be drawn, including that the selection of units identified as marginal resources that are used for load following will change; PV penetration will displace energy generated by existing conventional units, thus reducing overall fuel consumption; PV penetration at any deployment level is not likely to reduce system peak load; and increasing PV penetration has little effect on load-following reserves. The study was performed by EnerNex under contract from Sandia National Laboratories with cooperation from KIUC.

A global strategy for the European PV industry

International Nuclear Information System (INIS)

Viaud, M.; Despotou, E.; Latour, M.; Hoffmann, W.; Macias, E.; Cameron, M.; Laborde, E.

2004-01-01

The objective was to develop a comprehensive strategy that answers to the need of today European PV industry. Namely: - Develop PV markets in Europe - Develop export markets. - Position the European PV industry within the European political environment and support the effort of national actors in their local objectives. This method lends itself to brainstorming to create actions and synergies, on order to achieve strategy objectives. The whole work is based on working groups clearly defined on the purpose, where all EPIA members are invited to participate. The overall first results are presented during the 19. EU PV Conference in Paris and EPIA will do recommendations on actions to be undertaken in the future. This strategy is co-financed by EPIA members and the 6. Framework Programme for research of the European Commission through the PV Catapult project. (authors)

A Practical Optimization Method for Designing Large PV Plants

DEFF Research Database (Denmark)

Kerekes, Tamas; Koutroulis, E.; Eyigun, S.

2011-01-01

Nowadays Photovoltaic (PV) plants have multi MW sizes, the biggest plants reaching tens of MW of capacity. Such large-scale PV plants are made up of several thousands of PV panels, each panel being in the range of 150-350W. This means that the design of a Large PV power plant is a big challenge...... and configuring such a plant should be implemented taking into consideration not only the cost of the installation, but also the Annual Energy Production, the Performance Ratio and the Levelized Cost Of Energy. In this paper, an algorithm is presented including the most important models of the PV system...

Dynamics of Membrane Potential Variation and Gene Expression Induced by Spodoptera littoralis, Myzus persicae, and Pseudomonas syringae in Arabidopsis

Science.gov (United States)

Bricchi, Irene; Bertea, Cinzia M.; Occhipinti, Andrea; Paponov, Ivan A.; Maffei, Massimo E.

2012-01-01

Background Biotic stress induced by various herbivores and pathogens invokes plant responses involving different defense mechanisms. However, we do not know whether different biotic stresses share a common response or which signaling pathways are involved in responses to different biotic stresses. We investigated the common and specific responses of Arabidopsis thaliana to three biotic stress agents: Spodoptera littoralis, Myzus persicae, and the pathogen Pseudomonas syringae. Methodology/Principal Findings We used electrophysiology to determine the plasma membrane potential (Vm) and we performed a gene microarray transcriptome analysis on Arabidopsis upon either herbivory or bacterial infection. Vm depolarization was induced by insect attack; however, the response was much more rapid to S. littoralis (30 min −2 h) than to M. persicae (4–6 h). M. persicae differentially regulated almost 10-fold more genes than by S. littoralis with an opposite regulation. M. persicae modulated genes involved in flavonoid, fatty acid, hormone, drug transport and chitin metabolism. S. littoralis regulated responses to heat, transcription and ion transport. The latest Vm depolarization (16 h) was found for P. syringae. The pathogen regulated responses to salicylate, jasmonate and to microorganisms. Despite this late response, the number of genes differentially regulated by P. syringae was closer to those regulated by S. littoralis than by M. persicae. Conclusions/Significance Arabidopsis plasma membranes respond with a Vm depolarization at times depending on the nature of biotic attack which allow setting a time point for comparative genome-wide analysis. A clear relationship between Vm depolarization and gene expression was found. At Vm depolarization timing, M. persicae regulates a wider array of Arabidopsis genes with a clear and distinct regulation than S. littoralis. An almost completely opposite regulation was observed between the aphid and the pathogen, with the former

PV investment in Europe

Energy Technology Data Exchange (ETDEWEB)

Hueser, Pius [Nova Energy GmbH, (Switzerland)

2007-06-15

This presentation is mainly about how the PV market in Europe has been growing, and which elements are going to determine if this market succeed or failed not only in Europe but also in the rest of the world. In the first part of this presentation, it is mentioned how in 2005 the development of some PV technologies triggered the PV market growth without any marketing control. Then, there are explained the aspects that changed such situation out of control, therefore, it emerged the beginning of the consolidation of this market. There are briefly explained those factors that are going to determine if this market succeed or failed in the future. Finally, there are given examples of some the PV investments. [Spanish] Esta presentacion habla principalmente de la manera en como ha crecido el Mercado de sistemas fotovoltaicos en Europa, asi tambien se mencionan los elementos fundamentales que determinaran el exito o fracaso de este mercado, no solamente en Europa sino tambien en el resto del mundo, en un futuro. En la primera parte de esta presentacion, se describe como en el 2005, debido al desarrollo de algunas tecnologias fotovoltaicas se desencadeno el crecimiento desenfrenado del mercado fotovoltaico. Despues, se explican los aspectos que hicieron que dicho crecimiento tomara su curso, teniendo como resultado el inicio de un mercado mas consolidado. Se explican brevemente los factores que determinaran si este mercado encuentra el exito o el fracaso en un futuro. Finalmente, se dan ejemplos de algunas adquisiciones fotovoltaicas.

China PV Business and Applications Evaluation; TOPICAL

International Nuclear Information System (INIS)

Sherring, Chris

1999-01-01

This report provides an overview of photovoltaics (PV) business and applications in China. Although more than 70 million people in China are without access to grid electricity, many of the unelectrified regions benefit from considerable renewable resources, including good solar insolation. Current annual PV sales are still modest, however, and are estimated to be between 2.0 and 2.5 megawatts. This and other significant PV data, including information regarding the current status of key aspects of Chinese businesses, markets, and distribution channels, are included in the report. Detailed company profiles of Chinese business organizations and summaries of visits made to these companies (as well as to more remote sites in Inner Mongolia to examine PV usage by the end-use customer) in September-October 1998 are also presented

The Arabidopsis thaliana cysteine-rich receptor-like kinase CRK20 modulates host responses to Pseudomonas syringae pv. tomato DC3000 infection

KAUST Repository

Ederli, Luisa; Madeo, Laura; Calderini, Ornella; Gehring, Christoph A; Moretti, Chiaraluce; Buonaurio, Roberto; Paolocci, Francesco; Pasqualini, Stefania

2011-01-01

by pathogens, salicylic acid and ozone (O3). However, its role in responses to biotic and abiotic stress remains to be elucidated. To determine the function of CRK20 in such responses, two CRK20 loss-of-function mutants, crk20-1 and crk20-2, were isolated from

21 CFR 155.191 - Tomato concentrates.

Science.gov (United States)

2010-04-01

... Tomato concentrates. (a) Identity—(1) Definition. Tomato concentrates are the class of foods each of... greater in length. (c) Blemishes, such as dark brown or black particles (specks)—not more than four exceed...; place a U.S. No. 12 screen (1.68 millimeters (0.066 inch) openings) over the sink drain; transfer the...

Rating PV Power and Energy: Cell, Module, and System Measurements

Energy Technology Data Exchange (ETDEWEB)

Emery, Keith

2016-06-02

A summary of key points related to research-level measurements of current vs. voltage measurement theory including basic PV operation, equivalent circuit, and concept of spectral error; PV power performance including PV irradiance sensors, simulators and commercial and generic I-V systems; PV measurement artifacts, intercomparisons, and alternative rating methods.

Production, Survival, and Evaluation of Solid-Substrate Inocula of Penicillium oxalicum, a Biocontrol Agent Against Fusarium Wilt of Tomato.

Science.gov (United States)

Larena, I; Melgarejo, P; De Cal, A

2002-08-01

ABSTRACT Production of conidia of Penicillium oxalicum (ATCC number pending), a biocontrol agent of Fusarium oxysporum f. sp. lycopersici, was tested in liquid and solid fermentation. P. oxalicum produced 250-fold more conidia in solid than in liquid fermentation at 30 days after inoculation of substrate. Solid fermentation was carried out in plastic bags (600 cm(3)) especially designed for solid fermentation (VALMIC) containing 50 g of peat/vermiculite (PV) (1:1, wt/wt) with 40% moisture, sealed, sterilized, and then inoculated with 1 ml of a conidial suspension of P. oxalicum (10(5) conidia g(-1) dry substrate), sealed again, and incubated in darkness at 20 to 25 degrees C for 30 days. Addition of amendments to PV in a proportion of 0.5 (wt/wt) significantly increased conidial production of P. oxalicum. The best production was obtained on PV plus meal of cereal grains (barley) or leguminous seeds (lentil) (100-fold higher). Conidial production obtained after 5 days of inoculation was similar to that obtained at 30 days. However, viability of conidia produced in PV plus lentil meal was 35% higher than that of conidia produced in PV plus barley meal. Changes in proportions (1:1:0.5, wt/wt/wt; 1:1:1, wt/wt/wt; 1:0.5:0.5, wt/wt/wt; 1:1:0.5, vol/vol/vol) of components of the substrate (peat/vermiculite/lentil meal) did not enhance production or viability of conidia. Optimal initial moisture in the substrate was 30 to 40%. At lower moistures, significant reductions of production of conidia were observed, particularly at 10%. There was a general decline in the number of conidia in bags with time of storage at -80, -20, 4, and 25 degrees C, or at room temperature (range from 30 to 15 degrees C), with the highest decline occurring from 60 to 180 days. Conidial viability also was reduced with time, except for conidia stored at -20 degrees C. Fresh conidia produced in solid fermentation system or those conidia stored at -20 degrees C for 180 days reduced Fusarium wilt of

Emergence of a resistance breaking TSWV strain in tomato in California

Science.gov (United States)

Tomato spotted wilt virus (TSWV) is a highly destructive pathogen of tomato in the central valley of California. During the 2016 tomato growing season, unusually early and severe symptoms of TSWV occurred in fields of TSWV-resistant fresh market tomato cultivars. Disease incidences of 50-80% were ob...

Effect of Dry Season Tomato Farming on Poverty Alleviation among ...

African Journals Online (AJOL)

Effect of Dry Season Tomato Farming on Poverty Alleviation among Women ... their major sources of resources for tomato farming, marketing and marketing ... and the effect of dry season tomato farming as strategy for poverty reduction; ...

EPR study on tomatoes before and after gamma-irradiation

International Nuclear Information System (INIS)

Aleksieva, K.; Georgieva, L.; Tzvetkova, E.; Yordanov, N.D.

2009-01-01

The results from the EPR studies on fresh, air-dried and lyophilized tomato samples before and after gamma-irradiation are reported. Before irradiation fresh and air-dried tomatoes exhibit one singlet EPR line characterized with common g-factor of 2.0048±0.0005, whereas freeze-dried tomato does not show any EPR spectrum. After irradiation, a typical 'cellulose-like' triplet EPR spectrum appears in all samples, attributed to cellulose free radicals, generated by gamma-irradiation. It consists of intense central line with g=2.0048±0.0005 and two weak satellite lines separated ca. 3 mT left and right of it. In air-dried and lyophilized tomatoes the 'cellulose-like' EPR spectrum is superimposed by an additional partly resolved carbohydrate spectrum. Fading measurements of the radiation-induced EPR signals indicate that the intensity of the EPR spectra of air-dried and freeze-dried tomato are reduced to about 50% after 50 days, whereas those of fresh irradiated tomatoes kept at 4 o C fade completely in 15 days. The reported results unambiguously show that the presence of two satellite lines in the EPR 'cellulose-like' spectra of tomato samples can be used for identification of radiation processing.

PV System Component Fault and Failure Compilation and Analysis.

Energy Technology Data Exchange (ETDEWEB)

Klise, Geoffrey Taylor; Lavrova, Olga; Gooding, Renee Lynne

2018-02-01

This report describes data collection and analysis of solar photovoltaic (PV) equipment events, which consist of faults and fa ilures that occur during the normal operation of a distributed PV system or PV power plant. We present summary statistics from locations w here maintenance data is being collected at various intervals, as well as reliability statistics gathered from that da ta, consisting of fault/failure distributions and repair distributions for a wide range of PV equipment types.

Examples of successful architectural integration of PV: Germany

International Nuclear Information System (INIS)

Hagemann, I.B.

2004-01-01

In Germany building-integrated photovoltaics (BIPV) are developing rapidly, and much progress has been achieved in the past five years. BIPV can be used today in different ways on both existing and new buildings. Architects and designers are discovering BIPV. With the help of custom-made products available on the German market they are beginning to explore the technical limits of an aesthetic and structural integration of PV in buildings. As a result some exciting high-profile building projects with PV have been built, for example, the small service pavilion Meereslauschen in Steinhude or the new headquarters building of the Wood Trade Association in Munich. These projects show that the use of PV is very varied and offers opportunities for creative architects. However non-technical problems still need to be solved to allow a meaningful and widespread application of PV in the built environment. To decrease costs it is essential to develop further standard BIPV components. The aim of such developments should be to replace standard PV modules by products in which PV and structural building elements are melded into one design and structural unit. (author)

PV experience curves for the Netherlands

International Nuclear Information System (INIS)

Gerwig, R.

2005-01-01

Experience curves are one of several tools used by policy makers to take a look at market development. Numerous curves have been constructed for PV but none specific to the Netherlands. The objective of this report is to take a look at the price development of grid-connected PV systems in the Netherlands using the experience curve theory. After a literature and internet search and attempts to acquire information from PV companies information on 51% of the totally installed capacity was found. Curves for the period 1991-2001 were constructed based on system price, BOS (balance-of-system) price and inverter price. The progress ratio of the locally learning BOS was similar to the globally learning module market. This indicates that the pace of development of the Dutch PV market is similar to the globally followed pace. Improvement of the detail of the data might help to get a better idea of which BOS components have declined most. The similar progress ratio also shows the importance of investing both in module and system research as is the case in the Netherlands

Optimal design of orientation of PV/T collector with reflectors

International Nuclear Information System (INIS)

Kostic, Lj.T.; Pavlovic, T.M.; Pavlovic, Z.T.

2010-01-01

Hybrid conversion of solar radiation implies simultaneous solar radiation conversion into thermal and electrical energy in the PV/Thermal collector. In order to get more thermal and electrical energy, flat solar radiation reflectors have been mounted on PV/T collector. To obtain higher solar radiation intensity on PV/T collector, position of reflectors has been changed and optimal position of reflectors has been determined by both experimental measurements and numerical calculation so as to obtain maximal concentration of solar radiation intensity. The calculated values have been found to be in good agreement with the measured ones, both yielding the optimal position of the flat reflector to be the lowest (5 o ) in December and the highest (38 o ) in June. In this paper, the thermal and electrical efficiency of PV/T collector without reflectors and with reflectors in optimal position have been calculated. Using these results, the total efficiency and energy-saving efficiency of PV/T collector have been determined. Energy-saving efficiency for PV/T collector without reflectors is 60.1%, which is above the conventional solar thermal collector, whereas the energy-saving efficiency for PV/T collector with reflectors in optimal position is 46.7%, which is almost equal to the values for conventional solar thermal collector. Though the energy-saving efficiency of PV/T collector decreases slightly with the solar radiation intensity concentration factor, i.e. the thermal and electrical efficiency of PV/T collector with reflectors are lower than those of PV/T collector without reflectors, the total thermal and electrical energy generated by PV/T collector with reflectors in optimal position are significantly higher than total thermal and electrical energy generated by PV/T collector without reflectors.

Battery storage for PV power systems: an overview

Energy Technology Data Exchange (ETDEWEB)

Chaurey, A; Deambi, S [Tata Energy Research Inst., New Delhi (India)

1992-06-01

Batteries used in photovoltaic applications are required to have particular properties in order to minimize the system cost, in addition to meeting stringent reliability requirements associated with PV system installations. The battery sizing, installations, operation and maintenance, thus, are fundamentally different from those used in several other energy storage applications. The current paper gives an overview of battery systems commonly used in PV installation, as well as several new options which are found suitable or have been modified suitably to meet PV energy storage requirements. The systems are discussed briefly with respect to their construction, performance characteristics and compatibility with PV systems. The battery sizing procedures are also reviewed. (Author).

Vision-based judgment of tomato maturity under growth conditions ...

African Journals Online (AJOL)

To determine the picking time of tomato and design the control strategy for the harvesting robot, the judgment of tomato maturity under natural conditions is ... Hue-mean and red-green color-difference image mean can be used as a criterion for the judgment of tomato maturity, and the tests indicated that the redgreen mean ...

Assessing the PV business opportunities in Greece

International Nuclear Information System (INIS)

Patlitzianas, Konstantinos D.; Skylogiannis, Georgios K.; Papastefanakis, Dimitrios

2013-01-01

Highlights: • An approach of qualitative judgments for the PV opportunities through the assessing of the licenses’ value in Greece. • It can be supplied in other countries by applying different weights to the criteria. • It can be used by everyone in order to find a suitable PV investment without the need of experts in the field. - Abstract: Greece, as a member of the European Union (EU), has undertaken the obligation to meet the expected goals for the penetration of Renewable Energy Sources (RES) in the national energy balance in compliance with “20–20–20” goals (20% of the Gross Energy Consumption and 40% of the Gross Electricity Consumption should be covered by RES). Although the development of RES, and particularly of Photovoltaic (PV), in Greece during the last years has presented a satisfactory growth, the country is still far away from the above goals. The main reason for this delay is that – except the financial crisis – many licenses are inactive and waiting funding in order to be utilized. Additionally, the latest law (L.4152/2013) has forbidden the interconnection of new PV power Plants to the grid until the end of 2013. The above fact determines the significance of the existing PV Licenses in achieving the national goals. The aim of this paper is to present an integrated approach of qualitative judgments for the PV business opportunities through the assessing of the licenses’ value in Greece. The approach, which is based on a Multi Criteria Decision Making (MCDM) theory of quantifying multiple qualitative judgments, takes into account the real factors which can affect the expected production and cost of the PV installation and therefore the RoI (Return of Investment)

Begomovirus diversity in tomato crops and weeds in Ecuador and the detection of a recombinant isolate of rhynchosia golden mosaic Yucatan virus infecting tomato.

Science.gov (United States)

Paz-Carrasco, Lenin C; Castillo-Urquiza, Gloria P; Lima, Alison T M; Xavier, Cesar A D; Vivas-Vivas, Leticia M; Mizubuti, Eduardo S G; Zerbini, F Murilo

2014-08-01

Viral diseases caused by begomoviruses are of economic importance due to their adverse effects on the production of tropical and subtropical crops. In Ecuador, despite reports of significant infestations of Bemisia tabaci in the late 1990s, only very recently has a begomovirus, tomato leaf deformation virus (ToLDeV, also present in Peru), been reported in tomato. ToLDeV is the first monopartite begomovirus discovered that originated in the Americas, and its presence in Ecuador highlights the need for a wider survey of tomato-infecting begomoviruses in this country. Tomato and weed samples were collected in 2010 and 2011 in six provinces of Ecuador, and begomovirus genomes were cloned and sequenced using a rolling-circle-amplification-based approach. Most tomato samples from the provinces of Guayas, Loja, Manabi and Santa Elena were infected with tomato leaf deformation virus (ToLDeV). One sample from Manabi had a triple infection with ToLDeV, rhynchosia golden mosaic Yucatan virus (RhGMYuV) and an isolate that was a recombinant between the two. A new begomovirus was detected in another tomato sample from Manabi. Samples of Rhynchosia sp. from the provinces of Guayas and Manabi were infected by RhGMYuV. These results indicate not only the prevalence of ToLDeV in tomato in Ecuador but also the presence of other viruses, albeit at a much lower frequency.

Addressing firefighter safety around solar PV systems

Energy Technology Data Exchange (ETDEWEB)

Harris, B. [Sustainable Energy Technologies, Calgary, AB (Canada)