WorldWideScience

Sample records for sylvilagus floridanus leporidae

  1. REFERENCE AND BASELINE HEMATOCRIT MEASURES FOR THE THREATENED NEW ENGLAND COTTONTAIL (SYLVILAGUS TRANSITIONALIS) AND COMPARISON WITH SYMPATRIC EASTERN COTTONTAIL (SYLVILAGUS FLORIDANUS) RABBITS.

    Science.gov (United States)

    Ryan, S J; Gavard, E J; Cheeseman, A E; Cohen, J B; Whipps, C M

    2016-06-01

    From June 2014 to June 2015, capillary tube collections of blood were obtained concurrently with ear clips of trapped free-ranging, globally vulnerable New England cottontails (NEC; Sylvilagus transitionalis) and eastern cottontail rabbits (EC; Sylvilagus floridanus) in the Hudson Valley region of New York, United States. Species identification (NEC, EC) and sex (NEC) were determined genetically using a mitochondrial DNA assay and Y chromosome marker, respectively. Hematocrit values were obtained using a microhematocrit centrifuge. We provide the reference values 35.15-49.55 (2.5 and 97.5 percentiles) and 90% confidence intervals (CI) [lower: 33.00, 36.08; upper: 46.95, 51.00], for hematocrit of NEC. The mean hematocrit for NEC was 42.35% (SE = 0.58, n = 47) and a comparative contemporaneous mean in the same area for EC [39.96 (SE = 0.81, n = 26)], which was significantly different from NEC (P = 0.02). There was a significant sex difference for NEC [male: 43.99 (SE = 1.02, n = 28); female: 39.92 (SE = 0.78, n = 19), P < 0.0001], though not for EC.

  2. Local feeding specialization of the red fox (Vulpes vulpes in response to eastern cottontail (Sylvilagus floridanus introduction (NW Italy

    Directory of Open Access Journals (Sweden)

    Alessandro Balestrieri

    2006-03-01

    Full Text Available Abstract To appreciate the influence of the introduction of the Eastern cottontail (Sylvilagus floridanus on the food habits of the red fox (Vulpes vulpes, between June 1998 and February 2000 fox diet was investigated by means of scat analysis (N=115 in a 250 ha wide Natural Reserve of NW Italy, and compared with data collected in the same area prior to cottontail colonization (1988-1989. Comparison included also the diet of badgers (Meles meles, considered as potential competitors for food resources. Alien lagomorphs (mean percent volume, Vm% = 68% represented by far the most exploited resource, only three other food items reaching values of mean percent volume barely higher than 5%. Cottontails frequency of occurrence did not vary according either to season or to their reproductive cycle (II-IX vs. X-I, whilst diet niche breadth varied inversely proportional to the use of this key-resource. Overall fox trophic niche breadth varied from 0.64 in 1988-89 to 0.31 in 1998-00 (B, Levin’s index. These findings led us to consider the feeding habits of the fox in the study area as a result of local specialization of a typical generalist carnivore, according to the predictions of optimal foraging theory. No variation occurred in the badger niche breadth since cottontail introduction, whilst niche overlap between foxes and badgers decreased from 0.59 to 0.13 (O, Pianka’s index, possibly reducing competition for food in summer. Riassunto Specializzazione alimentare a livello locale della Volpe Vulpes vulpes in risposta all’introduzione del Silvilago Sylvilagus floridanus (Italia nord occidentale. Per valutare gli effetti dell’introduzione del Silvilago (Sylvilagus floridanus sul comportamento alimentare della volpe (Vulpes vulpes, nel periodo giugno 1998-febbraio 2000, la dieta del carnivoro è stata definita tramite l’analisi di 115

  3. In vitro host erythrocyte specificity and differential morphology of Babesia divergens and a zoonotic Babesia sp. from eastern cottontail rabbits (Sylvilagus floridanus).

    Science.gov (United States)

    Spencer, Angela M; Goethert, Heidi K; Telford, Samuel R; Holman, Patricia J

    2006-04-01

    A Babesia sp. isolated from eastern cottontail rabbits (Sylvilagus floridanus) is morphologically similar and genetically identical, based on SSU rRNA gene comparisons, to 2 agents responsible for human babesiosis in the United States. This zoonotic agent is closely related to the European parasite, Babesia divergens. The 2 organisms were characterized by in vitro comparisons. In vitro growth of the rabbit Babesia sp. was supported in human and cottontail rabbit erythrocytes, but not in bovine cells. Babesia divergens was supported in vitro in bovine and human erythrocytes, but not in cottontail rabbit cells. Morphometric analysis classifies B. divergens as a small babesia in bovine erythrocytes, but the parasite exceeds this size in human erythrocytes. The rabbit Babesia sp. is large, the same size in both human or rabbit erythrocytes, and is significantly larger than B. divergens. Eight or more rabbit Babesia sp. parasites may occur within a single erythrocyte, sometimes in a floret array, unlike B. divergens. The erythrocyte specificity and morphological differences reported in this study agree with previous in vivo results and validate the use of in vitro methods for characterization of Babesia species.

  4. Mammals of the Genera Odocoileus and Sylvilagus

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1940-01-01

    Whilst visiting the Leeward Group, little time could be spared to the collecting of mammals; from Odocoileus and Sylvilagus however, a rather representative series could be obtained. Regarding this, I must offer my grateful thanks and appreciation to the people who so ably and kindly assisted in

  5. Distribution of the Eastern cottontail Sylvilagus floridanus in the province of Alessandria

    Directory of Open Access Journals (Sweden)

    Fabrizio Silvano

    2000-09-01

    Full Text Available Abstract The Eastern cottontail, a lagomorph native to the American continent, was introduced to N-Italy in the mid-1960s. In subsequent years a rapid territorial expansion and a remarkable demographic increase has been observed in many areas. In the province of Alessandria, NW Italy, we used night-time censuses with spotlights and road mortality assessment to evaluate the diffusion of the species and its trend. Night-time censuses were performed each year in spring and in autumn along 51 transects which were 10 km long on average. Road deaths were extracted from our 6715 records regarding 85 species of mammals, birds and reptiles found dead along the roads. The distribution area expanded markedly from the 1980s, and the expansion persisted between 1996 and 1997, while in 1998 the area failed to increase further, settling at around 620-660 km². The species is not present, at the moment, in the entire Apennine sector nor in the eastern and southern plains. The densities reach maximum values of 2.5-2.75 individuals/10 ha. From the road-death data we found a progressive increase of the Eastern cottontail, its proportion of the total mammals rising from 2.2% in 1995 to 3.7% in 1996 and 6.0% in 1997.

  6. Distribution of the Eastern cottontail Sylvilagus floridanus in the province of Alessandria

    OpenAIRE

    Silvano, Fabrizio; Acquarone, Camilla; Cucco, Marco

    2000-01-01

    Abstract The Eastern cottontail, a lagomorph native to the American continent, was introduced to N-Italy in the mid-1960s. In subsequent years a rapid territorial expansion and a remarkable demographic increase has been observed in many areas. In the province of Alessandria, NW Italy, we used night-time censuses with spotlights and road mortality assessment to evaluate the diffusion of the species and its trend. Night-time censuses were performed each year in spr...

  7. Pseudogenization of the MCP-2/CCL8 chemokine gene in European rabbit (genus Oryctolagus, but not in species of Cottontail rabbit (Sylvilagus and Hare (Lepus

    Directory of Open Access Journals (Sweden)

    van der Loo Wessel

    2012-08-01

    Full Text Available Abstract Background Recent studies in human have highlighted the importance of the monocyte chemotactic proteins (MCP in leukocyte trafficking and their effects in inflammatory processes, tumor progression, and HIV-1 infection. In European rabbit (Oryctolagus cuniculus one of the prime MCP targets, the chemokine receptor CCR5 underwent a unique structural alteration. Until now, no homologue of MCP-2/CCL8a, MCP-3/CCL7 or MCP-4/CCL13 genes have been reported for this species. This is interesting, because at least the first two genes are expressed in most, if not all, mammals studied, and appear to be implicated in a variety of important chemokine ligand-receptor interactions. By assessing the Rabbit Whole Genome Sequence (WGS data we have searched for orthologs of the mammalian genes of the MCP-Eotaxin cluster. Results We have localized the orthologs of these chemokine genes in the genome of European rabbit and compared them to those of leporid genera which do (i.e. Oryctolagus and Bunolagus or do not share the CCR5 alteration with European rabbit (i.e. Lepus and Sylvilagus. Of the Rabbit orthologs of the CCL8, CCL7, and CCL13 genes only the last two were potentially functional, although showing some structural anomalies at the protein level. The ortholog of MCP-2/CCL8 appeared to be pseudogenized by deleterious nucleotide substitutions affecting exon1 and exon2. By analyzing both genomic and cDNA products, these studies were extended to wild specimens of four genera of the Leporidae family: Oryctolagus, Bunolagus, Lepus, and Sylvilagus. It appeared that the anomalies of the MCP-3/CCL7 and MCP-4/CCL13 proteins are shared among the different species of leporids. In contrast, whereas MCP-2/CCL8 was pseudogenized in every studied specimen of the Oryctolagus - Bunolagus lineage, this gene was intact in species of the Lepus - Sylvilagus lineage, and was, at least in Lepus, correctly transcribed. Conclusion The biological function of a gene was often

  8. Invasion status of Florida bass Micropterus floridanus (Lesueur ...

    African Journals Online (AJOL)

    Individuals with mitochondrial DNA matching M. salmoides were recovered from 16 localities, whereas M. floridanus mitochondrial DNA was recovered from 13 localities. At nine localities (45%), the mitochondrial DNA of both species was detected. These results demonstrate M. floridanus dispersal to multiple sites across ...

  9. Biologia de Agistemus floridanus Gonzalez (Acari, Stigmaeidae Biology of Agistemus floridanus Gonzalez (Acari, Stigmaeidae

    Directory of Open Access Journals (Sweden)

    Noeli Juarez Ferla

    2003-06-01

    Full Text Available The rubber tree (Hevea brasiliensis Muell. Arg. (Euphorbiaceae is attacked by various species of phytophagous mites in Brazil. Studies conducted in the State of Mato Grosso showed the presence of Agistemus floridanus Gonzalez, 1965 (Stigmaeidae on rubber trees, associated with the mite Tenuipalpus heveae Baker, 1945. The aim of this work was to study the biology of that predator in the laboratory, when fed with T. heveae as prey. The study was started with 22 eggs, which resulted in 15 females reaching adult hood. To determine the effect of mating on oviposition, 30 females were used; half of those were maintained isolated and the remaining were maintained then with males during the whole adult stage. The stage of egg was the longest, with a duration of more than 4.0 days. The total duration of the immature phase was 10.2 days. Each female oviposited an average of 38.4 eggs, with a daily oviposition rate of 2.3 eggs per female. The duration of each adult phase, the daily oviposition rate and the longevity were different between the mated females and non-mated females. All eggs produced by non-mated originated males, characterizing, in this way, the development through arrhenothokous parthenogenesis. The results showed that A. floridanus has an innate increase capacity of 13.2 times in each generation, that the average duration of one generation is 19.2 days, that the intrinsic rate of increase (rm is about 0.16 female per female per day and that the number of females added daily to the population is 1.1.

  10. Social isolation and brain development in the ant Camponotus floridanus

    Science.gov (United States)

    Seid, Marc A.; Junge, Erich

    2016-06-01

    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  11. Molecular phylogenetics of American snapping shrimps allied to Alpheus floridanus Kingsley, 1878 (Crustacea: Decapoda: Alpheidae).

    Science.gov (United States)

    Bracken-Grissom, Heather D; Robles, Rafael; Felder, Darryl L

    2014-12-17

    Widely distributed populations of the snapping shrimp, Alpheus floridanus Kinglsey, 1878, from the eastern Pacific and western and eastern Atlantic Ocean have long been suspected to represent different species due to extreme morphological variation among conspecifics. A companion study (Bracken-Grissom & Felder 2014) contains redescriptions of two western Atlantic species (A. floridanus Kingsley 1878 sensu stricto and A. platycheirus Boone, 1927), assignments of the original syntypes for A. floridanus, descriptions of three new species from the Atlantic and eastern Pacific (A. hephaestus Bracken-Grissom & Felder, 2014; A. roblesi Bracken-Grissom & Felder, 2014; A. ulalae Bracken-Grissom & Felder, 2014), and discussion of the relationship of the eastern Atlantic A. floridanus africanus Balss, 1916. The present study underpins all these findings by application of molecular phylogenetic techniques. Analysis of partial sequences of the 16S, 12S, and COI mitochondrial genes separate species throughout the eastern Pacific and the eastern and western Atlantic. Morphological comparisons suggested that the two syntypes of A. floridanus belong to different species, and molecular results in this study confirm this separation. Genetic data suggest a strong affinity between the western Atlantic A. platycheirus and the eastern Pacific A. hephaestus. Close relationships are evident between trans-Atlantic species, A. floridanus africanus and A. floridanus, a pattern also seen for other cryptic and pseudocryptic species of Alpheus. Alpheus roblesi and A. ulalae represent early-branching lineages within the complex. In some cases, molecular phylogenetic relationships between members of the A. floridanus complex can be reconciled with postulated biogeographic history.

  12. Helminths of rabbits (Lagomorpha, Leporidae deposited in the Helminthological Collection of the Oswaldo Cruz Institute

    Directory of Open Access Journals (Sweden)

    Roberto Magalhães Pinto

    2004-09-01

    Full Text Available Helminth samples (n = 35 recovered from Oryctolagus cuniculus (Linnaeus, 1758 Lilljeborg, 1873 (3 and from another rabbit species, Sylvilagus brasiliensis (Linnaeus, 1758 Thomas, 1901 (32, from August 1909 to February 1948 and that are deposited in the Helminthological Collection of the Oswaldo Cruz Institute were analyzed. The studied samples were represented by the cysticercus of the cestode Taenia pisiformis (Bloch, 1780 and by the nematodes Passalurus ambiguus (Rudolphi, 1819, Vianella fariasi (Travassos, 1915, Longistriata perfida Travassos, 1943, Trichostrongylus retortaeformis (Zeder, 1800. The scope of the present investigation is to survey the parasites infecting these hosts, commonly used as laboratory animal models in scientific research and supply figurative data on the helminths in order to provide their easy identification, since the presence of autochthonous parasite burdens, if undetected or misinterpreted, can alter the final results of experimental assays, mainly those related to immunological approaches, when cross-reactions can occur.Trinta e cinco amostras de helmintos coletadas de Oryctolagus cuniculus (Linnaeus, 1758 Lilljeborg, 1873 (3 e de uma outra espécie de coelho, Sylvilagus brasiliensis (Linnaeus, 1758 Thomas, 1901 (32, de agosto de 1909 a fevereiro de 1948 e que estão depositadas na Coleção Helmintológica do Instituto Oswaldo Cruz, foram analisadas. As amostras estudadas estão representadas pelo cisticerco do cestóide Taenia pisiformis (Bloch, 1780 e pelos nematóides Passalurus ambiguus (Rudolphi, 1819, Vianella fariasi (Travassos, 1915, Longistriata perfida Travassos, 1943, Trichostrongylus retortaeformis (Zeder, 1800. O objetivo da presente investigação é o de inventariar os parasitos que infectam estes hospedeiros, comumente utilizados como modelos de animais de laboratório na pesquisa científica e fornecer dados figurativos sobre os helmintos a fim de facilitar sua identificação, uma vez que

  13. The Plio-Pleistocene record of Hypolagus (Lagomorpha, Leporidae) from the Czech and Slovak Republics with comments on systematics and classification of the genus

    Czech Academy of Sciences Publication Activity Database

    Čermák, Stanislav

    2009-01-01

    Roč. 84, č. 3 (2009), s. 497-524 ISSN 1214-1119 R&D Projects: GA AV ČR IAA300130701 Institutional research plan: CEZ:AV0Z30130516 Keywords : Leporidae * Hypolagus * nomenclature * taxonomy Subject RIV: EG - Zoology Impact factor: 0.983, year: 2009

  14. The genome sequence of Blochmannia floridanus: Comparative analysis of reduced genomes

    Science.gov (United States)

    Gil, Rosario; Silva, Francisco J.; Zientz, Evelyn; Delmotte, François; González-Candelas, Fernando; Latorre, Amparo; Rausell, Carolina; Kamerbeek, Judith; Gadau, Jürgen; Hölldobler, Bert; van Ham, Roeland C. H. J.; Gross, Roy; Moya, Andrés

    2003-01-01

    Bacterial symbioses are widespread among insects, probably being one of the key factors of their evolutionary success. We present the complete genome sequence of Blochmannia floridanus, the primary endosymbiont of carpenter ants. Although these ants feed on a complex diet, this symbiosis very likely has a nutritional basis: Blochmannia is able to supply nitrogen and sulfur compounds to the host while it takes advantage of the host metabolic machinery. Remarkably, these bacteria lack all known genes involved in replication initiation (dnaA, priA, and recA). The phylogenetic analysis of a set of conserved protein-coding genes shows that Bl. floridanus is phylogenetically related to Buchnera aphidicola and Wigglesworthia glossinidia, the other endosymbiotic bacteria whose complete genomes have been sequenced so far. Comparative analysis of the five known genomes from insect endosymbiotic bacteria reveals they share only 313 genes, a number that may be close to the minimum gene set necessary to sustain endosymbiotic life. PMID:12886019

  15. Reproductive biology and adaptability of the invasive alien freshwater Amphipod Crangonyx floridanus (Crustacea: Amphipoda, Crangonyctidae).

    Science.gov (United States)

    Tojo, Koji; Tanaka, Yoshiki; Kuranishi, Ryoichi B; Kanada, Shoji

    2010-06-01

    We studied the reproductive biology and adaptability of the alien freshwater crangonyctid amphipod Crangonyx floridanus, currently inhabiting a large portion of Japan, both in the field and under controlled laboratory conditions. In the Chikuma River population of this alien amphipod, egg-bearing individuals were found throughout the year. In terms of egg maturation cycle, egg development (during embryogenesis), and egg count per ovipositional cycle, these amphipods display a very efficient reproductive system. This study also established their adaptability to a wide range of water temperatures (primarily 4-20 degrees C, however in some cases, these individuals are able to survive at up to 30 degrees C). C. floridanus's strong capacity to adapt to broad and variable environmental conditions is certainly contributing to its high rate of population increase, and rapid dispersion throughout Japan.

  16. The endangered Florida pondweed (Potamogeton floridanus) is a hybrid: Why we need to understand biodiversity thoroughly.

    Science.gov (United States)

    Kaplan, Zdeněk; Fehrer, Judith; Bambasová, Veronika; Hellquist, C Barre

    2018-01-01

    Thorough understanding of biodiversity is a fundamental prerequisite for biological research. A lack of taxonomic knowledge and species misidentifications are particularly critical for conservation. Here we present an example of Potamogeton floridanus, the Florida Pondweed, an endangered taxon endemic to a small area in the Florida panhandle, whose taxonomic status remained controversial for more than a century, and all previous attempts to elucidate its identity have failed. We applied molecular approaches to tackle the origin of the mysterious taxon and supplemented them with morphological and anatomical investigations of both historical herbarium collections and plants recently collected in the type area for a comprehensive taxonomic reassessment. Sequencing of two nuclear ribosomal markers and one chloroplast non-coding spacer resulted in the surprising discovery that P. floridanus is a hybrid of P. pulcher and P. oakesianus, with the former being the maternal parent. The hybrid colony is currently geographically isolated from the distribution range of P. oakesianus. We show that previous molecular analyses have failed to reveal its hybrid identity due to inadequate nuclear DNA sequence editing. This is an example how the uncritical use of automized sequence reads can hamper molecular species identifications and also affect phylogenetic tree construction and interpretation. This unique hybrid taxon, P. ×floridanus, adds another case study to the debate on hybrid protection; consequences for its conservation are discussed.

  17. Environmental Assessment Building 5745, Historical Building Demolition, Barksdale Air Force Base, Louisiana

    Science.gov (United States)

    2012-12-01

    Thryothorus ludovicianus MAMMALS White-tailed Deer Odocoileus virginianus Gray Squirrel Sciurus carolinensis Fox Squirrel... Sciurus niger Cottontail Rabbit Sylvilagus floridanus Swamp Rabbit Sylvilagus aquaticus Beaver Castor canadensis Nutria

  18. O virus do mixoma no coelho do mato (Sylvilagus minenses, sua transmissão pelos Aedes scapularis e aegypti

    Directory of Open Access Journals (Sweden)

    Henrique Beaurepaire Aragão

    1943-01-01

    Full Text Available The brazilian wild rabbit (Sylvilagus minensis is sensible to the virus of the mixomatosis but the desease takes on it a mild character, lasts for long time and generally do not kill the animal. The tumors are generally smaller and less numerous than those of the domestic rabbit, but sometimes there were noted large and flat lesions (fig. 3. The natural infection of the wild rabbit may be quite common not only because many rabbits caught in the country were found to be immune as also because it was found among the animals caught in the country near Rio, one that was infected with mixomatosis. The experimental infection of the Sylvilagus may be easily obtained by cutan, subcutan or conjuntival way and also when a health wild rabbit is placed in the same cage with a sick domestic animal. It is also possible to obtain the infection of the wild and domestic rabbits by the bite of infected blood sucking insects as fleas and mosquitoes. The infected mosquito can transmit the disease 2 or 3 times til 17 days after an infective meal on a sick rabbit. The transmission is a mecanical one and only the proboscis of the insect contains the virus as it was shown by the inoculation of emulsions of the proboscis, thorax and abdomen of the mosquito. Though mecanical this kind of transmission acts as an important epidemiological mean of dissemination of the deseasse and splains the suddendly outbreaks of mixomatosis in rabbits breedings where no new rabbits were introduced since very long time. The transmition of mixomatosis by fleas (Slenopsylla was at first demonstrated by us, then S. Torres pointed out the capacity of Culex fatigans to transmit the desease and now we have proved that Aedes scapularis and Aedes aegypti were also able to transmit it (Foto 1 and 2. The virus of the mixomatosis (Chlamidozoon mixoma is seen on the smeavs of the tumors of the wild reabbit with the same morphology, as in the material of the domestic animal.

  19. Genome-wide and caste-specific DNA methylomes of the ants Camponotus floridanus and Harpegnathos saltator

    DEFF Research Database (Denmark)

    Bonasio, Roberto; Li, Qiye; Lian, Jinmin

    2012-01-01

    Ant societies comprise individuals belonging to different castes characterized by specialized morphologies and behaviors. Because ant embryos can follow different developmental trajectories, epigenetic mechanisms must play a role in caste determination. Ants have a full set of DNA...... methyltransferases and their genomes contain methylcytosine. To determine the relationship between DNA methylation and phenotypic plasticity in ants, we obtained and compared the genome-wide methylomes of different castes and developmental stages of Camponotus floridanus and Harpegnathos saltator....

  20. Cranial osteology of the pampathereHolmesina floridanus(Xenarthra: Cingulata; Blancan NALMA), including a description of an isolated petrosal bone.

    Science.gov (United States)

    Gaudin, Timothy J; Lyon, Lauren M

    2017-01-01

    The present study entails descriptions of several well-preserved skulls from the pampathere species Holmesina floridanus , recovered from Pliocene localities in central Florida and housed in the collections of the Florida Museum of Natural History. Bone by bone descriptions have allowed detailed reconstructions of cranial morphology. Cranial foramina are described and illustrated in detail, and their contents inferred. The first ever description of an isolated pampathere petrosal is also included. Cranial osteology of Holmesina floridanus is compared to that of Pleistocene species of Holmesina from both North and South America ( Holmesina septentrionalis , Holmesina occidentalis ), as well as to the other well-known pampathere genera, to closely related taxa among glyptodonts ( Propalaehoplophorus ), and to extinct and extant armadillos ( Proeutatus, Euphractus ). This study identifies a suite of apomorphic cranial features that serve to diagnose a putative, progressive series of more inclusive monophyletic groups, including the species Holmesina floridanus , the genus Holmesina , pampatheres, pampatheres plus glyptodonts, and a clade formed by pampatheres, glyptodonts, and Proeutatus . The study highlights the need for further anatomical investigations of pampathere cranial anatomy, especially those using modern scanning technology, and for analyses of pampathere phylogenetic relationships.

  1. Ticks and tick-borne pathogens and putative symbionts of black bears (Ursus americanus floridanus) from Georgia and Florida.

    Science.gov (United States)

    Yabsley, Michael J; Nims, Todd N; Savage, Mason Y; Durden, Lance A

    2009-10-01

    Ticks were collected from 38 black bears (Ursus americanus floridanus) from northwestern Florida (n = 18) from 2003 to 2005 and southern Georgia (n = 20) in 2006. Five species (Amblyomma americanum, A. maculatum, Dermacentor variabilis, Ixodes scapularis, and I. affinis) were collected from Florida bears, and 4 species (A. americanum, A. maculatum, D. variabilis, I. scapularis) were collected from bears in Georgia. Ixodes scapularis was the most frequently collected tick, followed by D. variabilis, A. americanum, A. maculatum, and I. affinis. The collection of I. affinis from a Florida bear represents a new host record. A subset of ticks was screened for pathogens and putative symbionts by polymerase chain reaction (PCR). The zoonotic tick-borne pathogens Ehrlichia chaffeensis and Rickettsia parkeri were detected in 1 of 23 (4.3%) A. americanum and 1 of 12 (8.3%) A. maculatum, respectively. The putative zoonotic pathogen "Rickettsia amblyommii" was detected in 4 (17.4%) A. americanum and 1 (8.3%) A. maculatum. Other putative symbiotic rickettsiae detected included R. bellii and R. montanensis in D. variabilis, a Rickettsia cooleyi-like sp. and Rickettsia sp. Is-1 in I. scapularis, and Rickettsia TR39-like sp. in I. scapularis and A. americanum. All ticks were PCR-negative for Anaplasma phagocytophilum, Panola Mountain Ehrlichia sp., E. ewingii, Francisella tularensis, and Borrelia spp.

  2. Environmental Statement, Oswego Steam Station, Unit Six.

    Science.gov (United States)

    1973-03-29

    woodcock (Philohela minor , cottontail rabbits (Sylvilagus floridanus), ruffed grouse (Bonasa umbellus) and gray squirrel ( Sciurus carolinensis). There are a...herring gull (Laurus argentatus) crow (Corvus brachyrhynchos rock dove (Columbo livia) wood thrush (Hylacichia inustelina) starling (Sturnus vulgaris

  3. Environmental Assessment of the Construction of the Joint Use Small Arms Range for the 934th Airlift Wing at Minneapolis-St. paul International Airport Air Reserve Station, Minnesota

    Science.gov (United States)

    2006-10-01

    Sylvilagus floridanus), woodchuck (Marmota monax), Eastern gray squirrel ( Sciurus carolinensis), and raccoon (Procyon lotor). Avian species might...starling (Sturnus vulgaris ). Other species might include the common garter snake (Thamnophis sirtalis) and the American toad (Bufo americanus) (934 AW

  4. Analysis of the seasonal activity rate of sympatric carnivores and their prey in Saguaro National Park

    Science.gov (United States)

    Mary Beth Benton; Siria A. Cerda-Navarro; Katie R. Keck; Brittany N. McKnight

    2013-01-01

    We investigated the monthly activity rates of bobcats (Lynx rufus), gray foxes (Urocyon cinereoargenteus) and four of their potential prey species, antelope jackrabbits (Lepus alleni), black-tailed jackrabbits (Lepus californicus), desert cottontails (Sylvilagus audubonii) and eastern cottontails (Sylvilagus floridanus), in Saguaro National Park using remote camera...

  5. Phase 1 Cultural Resources Inventory of Public Access Lands in the Atchafalaya Basin, Vicinity of the Sherburne Wildlife Management Area, Pointe Coupee, St. Martin and Iberville Parishes, Louisiana

    Science.gov (United States)

    1994-03-16

    include poison- ivy (Rhus toxicodendron var. vulgaris ), Virginia creeper (Parthenocissus quinquefolia), supple-jack (Berchemia scandens), muscadine (Vitli...white tailed deer (Odocoileus virginianus), cotton tail rabbit (Sylvilagus floridanus), swamp rabbit (Sylvilagus aquaticus), gray squirrel ( Sciurus ...carolinensis), and fox squirrel ( Sciurus niger). The non-native nutria (Myocastor coypus) was not present during the prehistoric or early historic times

  6. Roadkills of vertebrates in Venezuela Vertebrados mortos em estradas na Venezuela

    Directory of Open Access Journals (Sweden)

    Jan Pinowski

    2005-03-01

    Full Text Available This paper presents an analysis of vertebrate roadkills in five different habitats of tropical South America. Observations of vertebrate roadkills were conducted in 1978, on a 572 km road between Caracas and Mantecal/Apure in Venezuela, during the rainy season (June-October. During five passages on this route, which includes five distinct habitats, 79 vertebrate carcasses - mammals and reptiles - were found. If we assume that the carcasses remain for two days on the road, vehicles can be expected to strike 350 spectacled caimans Caiman crocodilus Linnaeus, 1758 (Alligatoridae during the rainy season alone. Similar calculations for other species yield 313 snakes and lizards, 294 opossums Didelphis marsupialis Linnaeus, 1758 (Didelphidae, 220 crab-eating foxes Cerdocyon thous (Linnaeus, 1776 (Canidae, 129 tamanduas Tamandua tetradactyla (Linnaeus, 1758 (Myrmecophagidae, 55 capybaras Hydrochaerus hydrochaeris (Linnaeus, 1766 (Hydrochaeridae and 37 eastern cottontails Sylvilagus floridanus Allen, 1890 (Leporidae. Numerous papers have been published on vertebrates killed by vehicles on roads in Europe, North America, and Australia, and several papers are available regarding vertebrate roadkills in Africa and Asia. From South America there are several papers on vertebrates, birds, and mammals, whereas from Venezuela only one and it deals with iguanas (Iguana iguana Linnaeus, 1758, Iguanidae.Este trabalho apresenta uma análise de vertebrados mortos em estrada em cinco habitats tropicais diferentes na América do Sul. As observações dos vertebrados mortos em estrada foram feitas em 1978, a 572 km da rodovia entre Caracas e Mantecal/Apure na Venezuela, durante a estação das chuvas (junho-outubro. Durante cinco passagens nesta rota, a qual inclui cinco habitats diferentes, foram encontradas 79 carcaças de vertebrados - répteis e mamíferos. Assumindo que as carcaças permaneçam por dois dias na estrada, é esperado que veículos matem 350

  7. The Use Of Rectal Temperature Fluctuations In The Study Of ...

    African Journals Online (AJOL)

    Temperature fluctuations were studied in three different vertebrate species – Sylvilagus floridanus, Rattus norvegicus and Columba livia in relation to the rhythmicity of rectal temperature. Clinical digital thermometer was used to record the core temperatue by inserting it 2 – 3 cm deep from the anal sphincter before taking ...

  8. General Reevaluation and Environmental Impact Statement for Flood Control and Related Purposes, Sheyenne River, North Dakota. Volume 2. Technical Appendixes.

    Science.gov (United States)

    1984-01-01

    cottontail (Sylvilagus floridanus), squirrels ( Sciurus sp.), beaver (Castor canadensis), red fox (Vulpes vulpes), mink (Mustela vison), and white- tailed...Syringa vulgaris ). The fifth row would consist of tall trees including green ash (Fraxinus pennsylvanica), bur oak (Ouercus macrocarpa) or cottonwood

  9. Key to the South African Leporidae (Mammalia: Lagomorpha)

    African Journals Online (AJOL)

    Rhodesia, Salisbury. PETTER, F. 1972. Order Lagomorpha, Part 5. In: The mammals of. South Africa: an identification manual. Eds. Meester, J. &. Setzer, H. W. Smithsonian Inst. Press, Washington, D.C.. ROBERTS, A. 1951. The mammals of South Africa. Johannesburg: Trustees of 'The Mammals of South Africa' Book Fund ...

  10. Key to the South African Leporidae (Mammalia: Lagomorpha)

    African Journals Online (AJOL)

    trophoretic analyses of blood proteins and qualitative pelage characteristics is presented. The key provides for the ... Mammal Research Institute, University of Pretoria, Pretoria 0002, Republic of. South Africa. Received 1 April 1982; ... of the various species comprising each taxon. Pronolagus has been subjected to a wide ...

  11. Operation and Maintence, Vermilion Harbor, Erie County, Ohio.

    Science.gov (United States)

    1976-03-01

    Sylvilagus floridanus) and fox squirrel ( Sciurus niger) are found to a limited extent in the harbor area. It is possible that the endangered Indiana...explain the low number of species of birds which are residents in Vermilion Harbor. Such species as starling (Sturnus vulgaris ), house sparrow (Passer...ILeptodora kindtiil Rotifers Polyarthra vulgaris 108 Polyarthra euryptera 2 Trichocerca sp. 8 9 Keratella cochicaris 2 3 Kellicottia longispina 0.5 0.5

  12. European hare Lepus europaeus(Lagomorpha: Leporidae an invasive species in Peru

    Directory of Open Access Journals (Sweden)

    Horacio Zeballos

    2013-06-01

    Full Text Available We describe the current distribution of the European hare, Lepus europaeus, in Peru which currently covers the highlands, Andean valleys, surrounding areas of the Titicaca Lake and coastal irrigations; in Arequipa, Cusco, Moquegua, Puno and Tacna departments. Based on its current distribution we developed models of potential distribution of this species, which would forecast this species in northern Peru. We make recommendations on the main issues that should be studied in Peru, and the possible consequences of their invasive process of in Peru.

  13. Morphology of the lingual papillae of Oryctolagus cuniculus (Lagomorpha: Leporidae rabbits

    Directory of Open Access Journals (Sweden)

    André Luiz Quagliatto Santos

    2013-06-01

    Full Text Available The tongue represents the morphological diversification in mammals; their papillae have mechanical and gustatory functions in feeding. This study aimed to describe the macroscopic and microscopic morphology of the lingual papillae of rabbits of the Oryctolagus cuniculus species. One used 45 dissected tongues from adult rabbits belonging to the collection of the Laboratory for Education and Research on Wild Animals (LAPASof Universidade Federal de Uberlandia (UFU. For the microscopic identification of the tongue, the optical microscopy and the scanning electron microscopy (SEM techniques were used. The tongue has four papillae types: filiform, fungiform, vallate, and foliate. The filiform papillae have a mechanical function and they present three subtypes: type 1, with a conical shape, from the tongue’s body to the rostral edge of the lingual prominence; type 2, with a sharp shape, in the rostral area of the lingual prominence; and type 3, with a thick and sharp shape, in the caudal area of the lingual prominence. The fungiform papillae have a gustatory function and they’re in the tongue’s body. The foliate papillae are pairs, they have a gustatory function, in the lateral surfaces of the tongue’s body. The vallate papillae are pairs, they have a gustatory function, in the root. On the tongue, one observed a keratinized squamous stratified epithelium, lining the papillae and the regions between them.

  14. A Century of Shope Papillomavirus in Museum Rabbit Specimens.

    Directory of Open Access Journals (Sweden)

    Clara Escudero Duch

    Full Text Available Sylvilagus floridanus Papillomavirus (SfPV causes growth of large horn-like tumors on rabbits. SfPV was described in cottontail rabbits (probably Sylvilagus floridanus from Kansas and Iowa by Richard Shope in 1933, and detected in S. audubonii in 2011. It is known almost exclusively from the US Midwest. We explored the University of Kansas Natural History Museum for historical museum specimens infected with SfPV, using molecular techniques, to assess if additional wild species host SfPV, and whether SfPV occurs throughout the host range, or just in the Midwest. Secondary aims were to detect distinct strains, and evidence for strain spatio-temporal specificity. We found 20 of 1395 rabbits in the KU collection SfPV symptomatic. Three of 17 lagomorph species (S. nuttallii, and the two known hosts were symptomatic, while Brachylagus, Lepus and eight additional Sylvilagus species were not. 13 symptomatic individuals were positive by molecular testing, including the first S. nuttallii detection. Prevalence of symptomatic individuals was significantly higher in Sylvilagus (1.8% than Lepus. Half of these specimens came from Kansas, though new molecular detections were obtained from Jalisco-Mexico's first-and Nebraska, Nevada, New Mexico, and Texas, USA. We document the oldest lab-confirmed case (Kansas, 1915, pre-dating Shope's first case. SfPV amplification was possible from 63.2% of symptomatic museum specimens. Using multiple methodologies, rolling circle amplification and, multiple isothermal displacement amplification in addition to PCR, greatly improved detection rates. Short sequences were obtained from six individuals for two genes. L1 gene sequences were identical to all previously detected sequences; E7 gene sequences, were more variable, yielding five distinct SfPV1 strains that differing by less than 2% from strains circulating in the Midwest and Mexico, between 1915 and 2005. Our results do not clarify whether strains are host species

  15. Colonization history of Mallorca Island by the European rabbit, Oryctolagus cuniculus, and the Iberian hare, Lepus granatensis (Lagomorpha: Leporidae)

    DEFF Research Database (Denmark)

    Seixas, Fernando A.; Juste, Javier; Campos, Paula

    2014-01-01

    reconstruction methods provides a complementary perspective for answering questions related to the history of insular species. In the present study, we infer the colonization history of Mallorca (Balearic Islands) by the European rabbit (Oryctolagus cuniculus) and the Iberian hare (Lepus granatensis) using...... been originated both from Iberian and French populations. The molecular estimates of the timing of the colonization events of the Mallorcan lagomorphs are consistent with human-mediated introductions by early settlers on the islands....

  16. Observações sobre a ocorrência de Pilumnus floridanus Stimpson (Decapoda, Brachyura, Pilumnidae na costa do Rio de Janeiro, Brasil Remarks about the Pilumnus floridanus Stimpson (Decapoda, Brachyura, Pilumnidae occurrence in Rio de Janeiro coast, Brazil

    Directory of Open Access Journals (Sweden)

    Lydia M. S. Oliveira

    2006-12-01

    Full Text Available Os espécimes foram coletados na Baía de Sepetiba, Rio de Janeiro no inverno. Sua distribuição era conhecida para Off Cape Lookout, Carolina do Norte até a Flórida, Golfo do México, Canal de Yucatan, Honduras, Antilhas, Venezuela e Brasil (Alagoas, Sergipe e Bahia.The specimens were collected in Sepetiba Bay during the winter. Their distribution was formerly known from Off Cape Lookout, North Carolina until Florida, Gulf of Mexico, Yucatan Channel, Honduras, Antilles, Venezuela and Brazil (Alagoas, Sergipe and Bahia.

  17. Fototrampeo de mamíferos en la Sierra Nanchititla, México: abundancia relativa y patrón de actividad

    Directory of Open Access Journals (Sweden)

    Octavio Monroy-Vilchis

    2011-03-01

    Full Text Available La conservación de las especies y su manejo adecuado dependen de la disponibilidad de información sobre sus poblaciones, por ello es importante estudiar aspectos como la abundancia y el patrón de actividad. En esta investigación se utilizaron trampas-cámara para obtener índices de abundancia relativa y establecer el patrón de actividad de los mamíferos medianos y grandes de la Sierra Nanchititla, México. El trabajo se llevó a cabo durante el periodo de diciembre de 2003 a mayo de 2006, con un esfuerzo total de 4 305 días-trampa. Se obtuvieron 897 fotografías de 19 especies, las más abundantes fueron: Nasua narica, Sylvilagus floridanus y Urocyon cinereoargenteus, de acuerdo con el índice de abundancia relativa (IAR, número de registros independientes/100 días trampa, coincidiendo con estudios basados en métodos indirectos. El patrón de actividad de las especies registradas mostraron que el 67% son de hábitos nocturnos. Algunas especies mostraron diferencias con los patrones mencionados por otros autores, las cuales se relacionan principalmente con la estacionalidad, la disponibilidad de recursos y el sexo de los individuosMammals’ camera-trapping in Sierra Nanchititla, Mexico: relative abundance and activity patterns. Species conservation and their management depend on the availability of their population behavior and changes in time. This way, population studies include aspects such as species abundance and activity pattern, among others, with the advantage that nowadays new technologies can be applied, in addition to common methods. In this study, we used camera-traps to obtain the index of relative abundance and to establish activity pattern of medium and large mammals in Sierra Nanchititla, Mexico. The study was conducted from December 2003 to May 2006, with a total sampling effort of 4 305 trap-days. We obtained 897 photographs of 19 different species. Nasua narica, Sylvilagus floridanus and Urocyon cinereoargenteus

  18. Density and habitat requirements of sympatric hares and cottontails in northern Italy

    Directory of Open Access Journals (Sweden)

    Anna Vidus Rosin

    2010-06-01

    Full Text Available Abstract From 2005 to 2009, densities and habitat selection by the European hare (Lepus europaeus and Eastern cottontail (Sylvilagus floridanus were assessed during feeding activity in an intensively cultivated area in northern Italy. Hare average density (74 ind./km2 was comparable to the highest values reported for European farming areas. Preand post-breeding density fluctuated widely across the study years, probably as a consequence of changes in the carrying capacity of the study area. Cottontail population size progressively increased, as expected for a recently introduced species supported by high reproductive performances. Hares used both crops and spontaneous vegetation during their feeding activity. Conversely, cottontails avoided winter cereals and preferred to feed on alfalfa. Our results suggest that simplified agro-ecosystems cannot maintain high density hare populations even at a short time scale. Landscape heterogeneity could enhance the chances of coexistence between the two lagomorphs.
    Riassunto Densità ed esigenze ecologiche della lepre e del silvilago in condizioni di simpatria in Italia settentrionale Tra il 2005 e il 2009, la densità e l’uso del habitat durante l’attività di alimentazione da parte della Lepre europea (Lepus europaeus e del Silvilago (Sylvilagus floridanus sono stati indagati in un’area intensamente coltivata nell’Italia settentrionale. La densità media della lepre nell’area di studio (74 ind./km2 corrisponde ai valori maggiori riportati per le aree agricole europee. Le densità pre- e post riproduttive della lepre hanno mostrato sensibili fluttuazioni durante il periodo di studio, probabilmente dovute ai cambiamenti stagionali della capacità portante dell’area di studio. L’abbondanza del silvilago è aumentata durante gli ultimi tre anni di studio, come prevedibile per una

  19. Fototrampeo de mamíferos en la Sierra Nanchititla, México: abundancia relativa y patrón de actividad

    Directory of Open Access Journals (Sweden)

    Octavio Monroy-Vilchis

    2011-03-01

    Full Text Available La conservación de las especies y su manejo adecuado dependen de la disponibilidad de información sobre sus poblaciones, por ello es importante estudiar aspectos como la abundancia y el patrón de actividad. En esta investigación se utilizaron trampas-cámara para obtener índices de abundancia relativa y establecer el patrón de actividad de los mamíferos medianos y grandes de la Sierra Nanchititla, México. El trabajo se llevó a cabo durante el periodo de diciembre de 2003 a mayo de 2006, con un esfuerzo total de 4 305 días-trampa. Se obtuvieron 897 fotografías de 19 especies, las más abundantes fueron: Nasua narica, Sylvilagus floridanus y Urocyon cinereoargenteus, de acuerdo con el índice de abundancia relativa (IAR, número de registros independientes/100 días trampa, coincidiendo con estudios basados en métodos indirectos. El patrón de actividad de las especies registradas mostraron que el 67% son de hábitos nocturnos. Algunas especies mostraron diferencias con los patrones mencionados por otros autores, las cuales se relacionan principalmente con la estacionalidad, la disponibilidad de recursos y el sexo de los individuos

  20. Do coyotesCanis latransinfluence occupancy of prey in suburban forest fragments?

    Science.gov (United States)

    Jones, Brandon M; Cove, Michael V; Lashley, Marcus A; Jackson, Victoria L

    2016-02-01

    With the extirpation of apex predators from many North American systems, coyotes Canis latrans have become the de facto top predator and are ubiquitous members of most ecosystems. Keystone predators aid in maintaining ecosystem function by regulating the mammal community through direct predation and instilling the landscape of fear, yet the value of coyotes regulating systems to this capacity is understudied and likely variable across environments. Since coyotes are common in the Midwestern United States, we utilized camera traps and occupancy analyses to assess their role in regulating the distribution of mammalian herbivores in a fragmented suburban ecosystem. Forest cover was a strong positive predictor of white-tailed deer Odocoileus virginianus detection, while coyote occurrence had a negative effect. Coyotes exerted a negative effect on squirrel ( Sciurus spp.) and eastern cottontail rabbit Sylvilagus floridanus occurrence, while urban cover was a positive predictor for the prey species' occurrence. These results suggest all 3 species behaviorally avoid coyotes whereby deer seek denser forest cover and squirrels and cottontails mitigate risk by increasing use of urban areas. Although previous studies reveal limited influence of coyote on the rest of the carnivore guild in suburban systems, we suggest coyotes play an important role in regulating the herbivorous mammals and hence may provide similar ecological benefits in urban/suburban forest fragments through trophic cascades. Furthermore, since hunting may not be allowed in urban and suburban habitats, coyotes might also serve as the primary regulator of nuisance species occurring at high abundance such as white-tailed deer and squirrels.

  1. [Mammals' camera-trapping in Sierra Nanchititla, Mexico: relative abundance and activity patterns].

    Science.gov (United States)

    Monroy-Vilchis, Octavio; Zarco-González, Martha M; Rodríguez-Soto, Clarita; Soria-Díaz, Leroy; Urios, Vicente

    2011-03-01

    Species conservation and their management depend on the availability of their population behavior and changes in time. This way, population studies include aspects such as species abundance and activity pattern, among others, with the advantage that nowadays new technologies can be applied, in addition to common methods. In this study, we used camera-traps to obtain the index of relative abundance and to establish activity pattern of medium and large mammals in Sierra Nanchititla, Mexico. The study was conducted from December 2003 to May 2006, with a total sampling effort of 4 305 trap-days. We obtained 897 photographs of 19 different species. Nasua narica, Sylvilagus floridanus and Urocyon cinereoargenteus were the most abundant, in agreement with the relative abundance index (RAI, number of independent records/100 trap-days), and according to previous studies with indirect methods in the area. The activity patterns of the species showed that 67% of them are nocturnal, except Odocoileus virginianus, Nasua narica and others. Some species showed differences with previously reported patterns, which are related with seasonality, resources availability, organism sex, principally. The applied method contributed with reliable data about relative abundance and activity patterns.

  2. Great horned owl (Bubo virginianus) dietary exposure to PCDD/DF in the Tittabawassee River floodplain in Midland, Michigan, USA.

    Science.gov (United States)

    Coefield, Sarah J; Zwiernik, Matthew J; Fredricks, Timothy B; Seston, Rita M; Nadeau, Michael W; Tazelaar, Dustin L; Moore, Jeremy N; Kay, Denise P; Roark, Shaun A; Giesy, John P

    2010-10-01

    Soils and sediments in the floodplain of the Tittabawassee River downstream of Midland, Michigan, USA contain elevated concentrations of polychlorinated dibenzofurans (PCDF) and polychlorinated dibenzo-p-dioxins (PCDD). As a long-lived, resident top predator, the great horned owl (Bubo virginianus; GHO) has the potential to be exposed to bioaccumulative compounds such as PCDD/DF. Site-specific components of the GHO diet were collected along 115 km of the Tittabawassee, Pine, Chippewa, and Saginaw Rivers during 2005 and 2006. The site-specific GHO biomass-based diet was dominated by cottontail rabbits (Sylvilagus floridanus) and muskrats (Ondatra zibethicus). Incidental soil ingestion and cottontail rabbits were the primary contributors of PCDD/DF to the GHO diet. The great horned owl daily dietary exposure estimates were greater in the study area (SA) (3.3 to 5.0 ng 2,3,7,8-TCDD equivalents (TEQ(WHO-avian))/kg body wt/d) than the reference area (RA) (0.07 ng TEQ(WHO-Avian)/kg body wt/d). Hazard quotients (HQs) based on central tendency estimates of the average daily dose and no-observable-adverse effect level (NOAEL) for the screech owl and uncertainty factors were <1.0 for both the RA and the SA. Hazard quotients based on upper end estimates of the average daily dose and NOAEL were <1.0 in the RA and up to 3.4 in the SA. Environ. Toxicol. Chem. 2010;29:2350-2362. © 2010 SETAC.

  3. Black-tailed and white-tailed jackrabbits in the American West: History, ecology, ecological significance, and survey methods

    Science.gov (United States)

    Simes, Matthew; Longshore, Kathleen M.; Nussear, Kenneth E.; Beatty, Greg L.; Brown, David E.; Esque, Todd C.

    2015-01-01

    Across the western United States, Leporidae are the most important prey item in the diet of Golden Eagles (Aquila chrysaetos). Leporids inhabiting the western United States include black-tailed (Lepus californicus) and white-tailed jackrabbits (Lepus townsendii) and various species of cottontail rabbit (Sylvilagus spp.). Jackrabbits (Lepus spp.) are particularly important components of the ecological and economic landscape of western North America because their abundance influences the reproductive success and population trends of predators such as coyotes (Canis latrans), bobcats (Lynx rufus), and a number of raptor species. Here, we review literature pertaining to black-tailed and white-tailed jackrabbits comprising over 170 published journal articles, notes, technical reports, conference proceedings, academic theses and dissertations, and other sources dating from the late 19th century to the present. Our goal is to present information to assist those in research and management, particularly with regard to protected raptor species (e.g., Golden Eagles), mammalian predators, and ecological monitoring. We classified literature sources as (1) general information on jackrabbit species, (2) black-tailed or (3) white-tailed jackrabbit ecology and natural history, or (4) survey methods. These categories, especially 2, 3, and 4, were further subdivided as appropriate. The review also produced several tables on population trends, food habits, densities within various habitats, and jackrabbit growth and development. Black-tailed and white-tailed jackrabbits are ecologically similar in general behaviors, use of forms, parasites, and food habits, and they are prey to similar predators; but they differ in their preferred habitats. While the black-tailed jackrabbit inhabits agricultural land, deserts, and shrublands, the white-tailed jackrabbit is associated with prairies, alpine tundra, and sagebrush-steppe. Frequently considered abundant, jackrabbit numbers in western North

  4. The most ancient lagomorphs of Sardinia: An overview

    Czech Academy of Sciences Publication Activity Database

    Angelone, Ch.; Čermák, Stanislav; Kotsakis, T.

    2015-01-01

    Roč. 48, July/September (2015), s. 287-296 ISSN 0016-6995 Institutional support: RVO:67985831 Keywords : insularity * Leporidae * Mediterranean * Ochotonidae * palaeobiogeography * phylogeny * taxonomy Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.151, year: 2015

  5. 761-IJBCS-Article-Dr Bruno A Djossa

    African Journals Online (AJOL)

    DR GATSING

    +. Leporidae. Lepus crawshayi. Crawshay's hare. +. +. +. +. +. Cricetomydae. Cricetomys gambianus. Giant Gambian rat. +. +. +. +. +. Sciuridae. Euxerus erythropus. Stripped ground squirrel. +. +. +. +. +. Rodents. Thryonomyidae. Thryonomys swinderianus. Grasscutter or can rat. +. +. +. +. +. Reptiles. Boïdae. Python sebae.

  6. Host specific glycans are correlated with susceptibility to infection by lagoviruses, but not with their virulence.

    Science.gov (United States)

    Lopes, Ana M; Breiman, Adrien; Lora, Mónica; Le Moullac-Vaidye, Béatrice; Galanina, Oxana; Nyström, Kristina; Marchandeau, Stephane; Le Gall-Reculé, Ghislaine; Strive, Tanja; Neimanis, Aleksija; Bovin, Nicolai V; Ruvoën-Clouet, Nathalie; Esteves, Pedro J; Abrantes, Joana; Le Pendu, Jacques

    2017-11-29

    The rabbit hemorrhagic disease virus (RHDV) and the European brown hare syndrome virus (EBHSV) are two lagoviruses from the family Caliciviridae that cause fatal diseases in two leporid genera, Oryctolagus and Lepus , respectively. In the last few years, several examples of host jumps of lagoviruses among leporids were recorded. In addition, a new pathogenic genotype of RHDV emerged and many non-pathogenic strains of lagoviruses have been described. The molecular mechanisms behind host shifts and the emergence of virulence are unknown. Since RHDV uses glycans of the histo-blood group antigen type as attachment factors to initiate infection, we studied if glycan specificities of the new pathogenic RHDV genotype, non-pathogenic lagoviruses and EBHSV potentially play a role in determining host range and virulence of lagoviruses. We observed binding to A, B or H antigens of the histo-blood group family for all strains known to primarily infect European rabbits ( Oryctolagus cuniculus ), that have recently been classified as GI strains. Yet, we could not explain the emergence of virulence since similar glycan specificities were found between several pathogenic and non-pathogenic strains. By contrast, EBHSV, recently classified as GII.1, bound to terminal β-linked N-acetylglucosamine residues of O-glycans. Expression of these attachment factors in the upper respiratory and digestive tracts in three lagomorph species ( Oryctolagus cuniculus, Lepus europaeus and Sylvilagus floridanus ) showed species-specific patterns regarding the susceptibility to infection by these viruses, indicating that species-specific glycan expression is likely a major contributor to lagoviruses host specificity and range. IMPORTANCE Lagoviruses constitute a genus of the Caliciviridae family, comprising highly pathogenic viruses, RHDV and EBHSV, which infect rabbits and hares, respectively. Recently, non-pathogenic strains were discovered and new pathogenic strains have emerged. In addition, host

  7. Predation, Competition, and Abiotic Disturbance: Population Dynamics of Small Mammals

    Energy Technology Data Exchange (ETDEWEB)

    Yunger, John A.; /Northern Illinois U. /Northern Illinois U.

    1996-01-01

    Predation and food availability have been implicated in annual non-cyclic fluctuations of vertebrate prey at mid-latitudes. The timing and magnitude of these factors are unclear due to a lack of large-scale field experiments, little attention to interactions, and a failure to closely link vertebrate predators with their prey. From October 1992 to January 1996, small mammal populations were censused on eight 0.6 ha plots at monthly intervals in a 32-ha prairie restoration at Fermi National Accelerator Laboratory, Illinois. Terrestrial vertebrate predators were excluded after July 1993 from four of the eight plots and canid diets monitored. Both terrestrial and avian vertebrate predators were excluded in March 1994. During 1993 small mammal densities (i.e., Microtus Pennsylvanicus, Peromyscus leucopus, and P. maniculatus) were relatively high. Following peak densities in late summer, Microtus numbers wer 2-3x greater on exclusion plots relative to controls due to preferential selection of Microtus by canids, as reflected in dits. Following an ice-storm and crash in small mammal numbers (particularly Microtus), vertebrate predator exclusion had no detectable effect on P. leucopus numbers, probably due to an abundance of alternative prey (i.e., Sylvilagus floridanus). Meadow vole numbers began to increase in Fall 1995, and a numerical effect of predator exclusion, similar to that in 1993, was observed. Predator exclusion had no detectable effect on the movements and spatial patterns of Microtus during 1993. There was a significant decrease in home range and a significant increase in home range overlap for P. leucopus on the predator exclusion plots. The change in spatial behavior may be due to interspecific competition with Microtus resulting from increased densities on exclusion plots. Thus, predators had an indirect effect on P. leucopus spatial patterns mediated through M. Pennsylvanicus. The role of food limitation was studied using natural and manipulative

  8. Predation, Competition, and Abiotic Disturbance: Population Dynamics of Small Mammals

    Energy Technology Data Exchange (ETDEWEB)

    Yunger, John A. [Northern Illinois U.

    1996-01-01

    Predation and food availability have been implicated in annual non-cyclic fluctuations of vertebrate prey at mid-latitudes. The timing and magnitude of these factors are unclear due to a lack of large-scale field experiments, little attention to interactions, and a failure to closely link vertebrate predators with their prey. From October 1992 to January 1996, small mammal populations were censused on eight 0.6 ha plots at monthly intervals in a 32-ha prairie restoration at Fermi National Accelerator Laboratory, Illinois. Terrestrial vertebrate predators were excluded after July 1993 from four of the eight plots and canid diets monitored. Both terrestrial and avian vertebrate predators were excluded in March 1994. During 1993 small mammal densities (i.e., Microtus pennsylvanicus, Peromyscus leucopus, and P. maniculatus) were relatively high. Following peak densities in late summer, Microtus numbers were 2-3x greater on exclusion plots relative to controls due to preferential selection of Microtus by canids, as reflected in diets. Following an ice-storm and crash in small mammal numbers (particularly Microtus), vertebrate predator exclusion had no detectable effect on P. leucopus numbers, probably due to an abundance of alternative prey (i.e., Sylvilagus floridanus). Meadow vole numbers began to increase in Fall 1995, and a numerical effect of predator exclusion, similar to that in 1993, was observed. Predator exclusion had no detectable effect on the movements and spatial patterns of Microtus during 1993. There was a significant decrease in home range and a significant increase in home range overlap for £.. leucopus on the predator exclusion plots. The change in spatial behavior may be due to interspecific competition with Microtus resulting from increased densities on exclusion plots. Thus, predators had an indirect effect on .f.. leucopus spatial patterns mediated through M. pennsylvanicus. The role of food limitation was studied using natural and manipulative

  9. Tracking cats: problems with placing feline carnivores on δO, δD isoscapes.

    Directory of Open Access Journals (Sweden)

    Stephanie J Pietsch

    Full Text Available Several felids are endangered and threatened by the illegal wildlife trade. Establishing geographic origin of tissues of endangered species is thus crucial for wildlife crime investigations and effective conservation strategies. As shown in other species, stable isotope analysis of hydrogen and oxygen in hair (δD(h, δ(18O(h can be used as a tool for provenance determination. However, reliably predicting the spatial distribution of δD(h and δ(18O(h requires confirmation from animal tissues of known origin and a detailed understanding of the isotopic routing of dietary nutrients into felid hair.We used coupled δD(h and δ(18O(h measurements from the North American bobcat (Lynx rufus and puma (Puma concolor with precipitation-based assignment isoscapes to test the feasibility of isotopic geo-location of felidae. Hairs of felid and rabbit museum specimens from 75 sites across the United States and Canada were analyzed. Bobcat and puma lacked a significant correlation between H/O isotopes in hair and local waters, and also exhibited an isotopic decoupling of δ(18O(h and δD(h. Conversely, strong δD and δ(18O coupling was found for key prey, eastern cottontail rabbit (Sylvilagus floridanus; hair and white-tailed deer (Odocoileus virginianus; collagen, bone phosphate.Puma and bobcat hairs do not adhere to expected pattern of H and O isotopic variation predicted by precipitation isoscapes for North America. Thus, using bulk hair, felids cannot be placed on δ(18O and δD isoscapes for use in forensic investigations. The effective application of isotopes to trace the provenance of feline carnivores is likely compromised by major controls of their diet, physiology and metabolism on hair δ(18O and δD related to body water budgets. Controlled feeding experiments, combined with single amino acid isotope analysis of diets and hair, are needed to reveal mechanisms and physiological traits explaining why felid hair does not follow isotopic patterns

  10. Tracking Cats: Problems with Placing Feline Carnivores on δ18O, δD Isoscapes

    Science.gov (United States)

    Pietsch, Stephanie J.; Hobson, Keith A.; Wassenaar, Leonard I.; Tütken, Thomas

    2011-01-01

    Background Several felids are endangered and threatened by the illegal wildlife trade. Establishing geographic origin of tissues of endangered species is thus crucial for wildlife crime investigations and effective conservation strategies. As shown in other species, stable isotope analysis of hydrogen and oxygen in hair (δDh, δ18Oh) can be used as a tool for provenance determination. However, reliably predicting the spatial distribution of δDh and δ18Oh requires confirmation from animal tissues of known origin and a detailed understanding of the isotopic routing of dietary nutrients into felid hair. Methodology/Findings We used coupled δDh and δ18Oh measurements from the North American bobcat (Lynx rufus) and puma (Puma concolor) with precipitation-based assignment isoscapes to test the feasibility of isotopic geo-location of felidae. Hairs of felid and rabbit museum specimens from 75 sites across the United States and Canada were analyzed. Bobcat and puma lacked a significant correlation between H/O isotopes in hair and local waters, and also exhibited an isotopic decoupling of δ18Oh and δDh. Conversely, strong δD and δ18O coupling was found for key prey, eastern cottontail rabbit (Sylvilagus floridanus; hair) and white-tailed deer (Odocoileus virginianus; collagen, bone phosphate). Conclusions/Significance Puma and bobcat hairs do not adhere to expected pattern of H and O isotopic variation predicted by precipitation isoscapes for North America. Thus, using bulk hair, felids cannot be placed on δ18O and δD isoscapes for use in forensic investigations. The effective application of isotopes to trace the provenance of feline carnivores is likely compromised by major controls of their diet, physiology and metabolism on hair δ18O and δD related to body water budgets. Controlled feeding experiments, combined with single amino acid isotope analysis of diets and hair, are needed to reveal mechanisms and physiological traits explaining why felid hair does

  11. Associations of passerine birds, rabbits, and ticks with Borrelia miyamotoi and Borrelia andersonii in Michigan, U.S.A.

    Directory of Open Access Journals (Sweden)

    Hamer Sarah A

    2012-10-01

    Full Text Available Abstract Background Wild birds contribute to maintenance and dissemination of vectors and microbes, including those that impact human, domestic animal, and wildlife health. Here we elucidate roles of wild passerine birds, eastern cottontail rabbits (Sylvilagus floridanus, and Ixodes dentatus ticks in enzootic cycles of two spirochetes, Borrelia miyamotoi and B. andersonii in a region of Michigan where the zoonotic pathogen B. burgdorferi co-circulates. Methods Over a four-year period, wild birds (n = 19,631 and rabbits (n = 20 were inspected for tick presence and ear tissue was obtained from rabbits. Samples were tested for Borrelia spirochetes using nested PCR of the 16S-23S rRNA intergenic spacer region (IGS and bidirectional DNA sequencing. Natural xenodiagnosis was used to implicate wildlife reservoirs. Results Ixodes dentatus, a tick that specializes on birds and rabbits and rarely bites humans, was the most common tick found, comprising 86.5% of the 12,432 ticks collected in the study. The relapsing fever group spirochete B. miyamotoi was documented for the first time in ticks removed from wild birds (0.7% minimum infection prevalence; MIP, in I. dentatus, and included two IGS strains. The majority of B. miyamotoi-positive ticks were removed from Northern Cardinals (Cardinalis cardinalis. Borrelia andersonii infected ticks removed from birds (1.6% MIP, ticks removed from rabbits (5.3% MIP, and rabbit ear biopsies (5% comprised twelve novel IGS strains. Six species of wild birds were implicated as reservoirs for B. andersonii. Frequency of I. dentatus larval and nymphal co-feeding on birds was ten times greater than expected by chance. The relatively well-studied ecology of I. scapularis and the Lyme disease pathogen provides a context for understanding how the phenology of bird ticks may impact B. miyamotoi and B. andersonii prevalence and host associations. Conclusions Given the current invasion of I. scapularis, a human biting species

  12. ORF Alignment: NC_005061 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available or ... [Candidatus Blochmannia floridanus] ... Length = 63 ... Query: 356 LDIFMRVLNINEESAKVLIDSGF...SSLEELAYIPISELLSIGVFDKEEIDLLRF 408 ... LDIFMRVLNINEESAKVLIDSGFSSLEELAYIPIS...ELLSIGVFDKEEIDLLRF Sbjct: 1 ... LDIFMRVLNINEESAKVLIDSGFSSLEELAYIPISELLSIGVFDKEEIDLLRF 53

  13. Cultural Resources Survey of Four Construction Items Below New Orleans

    Science.gov (United States)

    1994-01-01

    include poison-ivy (Rhus toxicodendron var. vulgaris ), Virginia creeper (Parthenocissus quinquefolia), supple-Jack (Berchemia scandena), pepper- vine (Vitia...Mink (Mustela vision vulgivaga) Abundant? Skunk (Nephitis mephitis) Abundant? Squirrel ( Sciurus spp.) Very Abundant Rabbit (Sylvilagus spp.) Plentiful

  14. ectoparasites of the bush cep.a.pi, in the transvaal (rodentia: sciuridae)

    African Journals Online (AJOL)

    plague in Mrica and in some places it is probably the main vector. An additional record of the flea,. Xenopsylla sp., was also recorded from Naboom- spruit (July). The cat flea, CtenocepluJlidesfelis, is widespread over Mrica on Canidae, Felidae, Viver- ridae, Hyaenidae and Leporidae as well as on domestic animals and ...

  15. Environmental Assessment for a Commercial Vehicle Inspection Point at the Downs Road Gate

    Science.gov (United States)

    2013-02-01

    defense; information operations; precision aerospace fires; psychological operations; specialized air mobility; specialized refueling; and intelligence ...for Florida black bear (Ursus americanus floridanus), other mammals, amphibians and reptiles such as diamondback rattlesnakes (Crotalus adamanteus

  16. Final Environmental Assessment: Proposed Laser-Firing Tank Range and Artillery Maneuver Area Arnold Air Force Base Tullahoma Tennessee

    Science.gov (United States)

    2005-03-01

    Sciurus niger), and eastern cottontail rabbit (Syvilagus floridanus). Raptors on the site include Cooper’s hawk (Accipiter cooperii), red-tailed... vulgaris ), house sparrow (Passer domesticus), Eastern meadowlark (Sturnella magna), red-winged blackbird (Agelaius phoeniceus), northern cardinal

  17. Final Environmental Assessment, Horse Creek Bridge Replacement

    Science.gov (United States)

    2010-10-01

    bluestar (Amsonia tabernaemontana), mints ( Mentha spp.), nodding ladies’ tresses (Spiranthes cernua), clustered Blacksnakeroot (Sanicula odorata...Indian pink (Spigelia marilandica), bloodroot (Sanguinaria canadensis ), yellow passion flower (Passiflora lutea), and ruellia (Ruellia carolinensis...on Robins AFB), feral pig (Sus scrofa), raccoon (Procyon lotor), opos- sum, swamp rabbit (Sylvilagus aquaticus), beaver (Castor canadensis ), river

  18. Cultural Resources Survey of EABPL Off-Site Borrow Areas, Levee Items E- 64, E-76, and E-84A, Iberville, Iberia, and Assumption Parishes, Louisiana

    Science.gov (United States)

    1994-07-01

    and few trees are observed without them. The most common of these include poison-ivy (Rhus toxicodendron var. vulgaris ), Virginia creeper...swamp rabbit (Sylvilagus aquaticus), gray squirrel ( Sciurus carolinensis), and fox squirrel ( Sciurus niger). The non-native nutria (Myocastor coypus

  19. Final Environmental Assessment for the Military Family Housing Privatization Initiative Columbus Air Force Base, Mississippi

    Science.gov (United States)

    2005-05-03

    include gray squirrel ( Sciurus carolinensis), southern flying squirrel (Glaucomys volans), swamp rabbit (Sylvilagus aquaticus), and white-tailed deer...Cedar waxwing Starlings and allies Sturnus vulgaris European starling Vireos Vireo griseus White-eyed vireo Wood-warblers Dendroica coronata Yellow...volans Southern flying squirrel Marmot monax Woodchuck Sciurus carolinensis Gray squirrel Sciurus niger Fox squirrel Squirrels Tamias striatus

  20. Assault Airstrip Environmental Assessment

    Science.gov (United States)

    2010-11-01

    Ursus americanus floridanus Slash pine Pinus elliottii River otter Lutra canadensis Black titi Cliftonia monophylla Beaver Castor canadensis Pitcher...ecosystem, and they compete with native wildlife predators for food, can carry many diseases that can be transmitted to outdoor pet cats and native

  1. Revision of Hydroides Gunnerus, 1768 (Polychaeta: Serpulidae) from the Western Atlantic region

    NARCIS (Netherlands)

    Rolando Bastida-Zavala, J.; Hove, ten Harry A.

    2002-01-01

    A taxonomic revision of the Hydroides species (Polychaeta: Serpulidae) from the Western Atlantic Region is presented. Twenty-six taxa are described, including a comparison between four species with ‘winged’ verticil spines: Hydroides alatalateralis, H. elegantulus, H. floridanus and H. spongicola,

  2. African Journal of Aquatic Science - Vol 42, No 4 (2017)

    African Journals Online (AJOL)

    Invasion status of Florida bass Micropterus floridanus (Lesueur, 1822) in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O.L.F. Weyl, M.K. Schirrmann, J.S. Hargrove, T Bodill, E.R. Swartz, 359-365 ...

  3. 77 FR 7599 - Receipt of Applications for Endangered Species Permits

    Science.gov (United States)

    2012-02-13

    ... include your name and return address in your email message. If you do not receive a confirmation from the... floridanus) by netting, handling, marking and releasing for the purpose of conducting scientific research in... inornatus) and Virgin Island boa (Epicrates monensis granti) by capturing, handling, collecting blood and...

  4. Species Profiles. Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates (Gulf of Mexico). GRASS SHRIMP.

    Science.gov (United States)

    1985-03-01

    6 Parasites ................................................... 6 Behavioral Ecology........................................... 6 GROWTH...limited genera Macrobrachium and Palaemon. value as fish bait (Huner 1979) or food Furthermore, unlike Palaemonetes, for cultured fish or humans, their... Macrobrachium bears hepatic spines ecological importance is unquestioned. (Figure lh) and Palaemon floridanus Grass shrimp have been extensively has a

  5. A rabbit model for assessment of volatile metabolite changes observed from skin: a pressure ulcer case study.

    Science.gov (United States)

    Schivo, Michael; Aksenov, Alexander A; Pasamontes, Alberto; Cumeras, Raquel; Weisker, Sandra; Oberbauer, Anita M; Davis, Cristina E

    2017-01-09

    Human skin presents a large, easily accessible matrix that is potentially useful for diagnostic applications based on whole body metabolite changes-some of which will be volatile and detected using minimally invasive tools. Unfortunately, identifying skin biomarkers that can be reliably linked to a particular condition is challenging due to a large variability of genetics, dietary intake, and environmental exposures within human populations. This leads to a paucity of clinically validated volatile skin biomarker compounds. Animal models present a very convenient and attractive way to circumvent many of the variability issues. The rabbit (Leporidae) is a potentially logistically useful model to study the skin metabolome, but very limited knowledge of its skin metabolites exists. Here we present the first comprehensive assessment of the volatile fraction of rabbit skin metabolites using polydimethylsiloxane sorbent patch sampling in conjunction with gas chromatography/mass spectrometry. A collection of compounds that are secreted from rabbit skin was documented, and predominantly acyclic long-chain alkyls and alcohols were detected. We then utilized this animal model to study differences between intact skin and skin with early pressure ulcers, as the latter are a major problem in intensive care units. Four New Zealand female white rabbits underwent ulcer formation on one ear with the other ear as a control. Early-stage ulcers were created with neodymium magnets. Histologic analysis showed acute heterophilic dermatitis, edema, and micro-hemorrhage on the ulcerated ears with normal findings on the control ears. The metabolomic analysis revealed subtle but noticeable differences, with several compounds associated with the oxidative stress-related degradation of lipids found to be present in greater abundances in ulcerated ears. The metabolomic findings correlate with histologic evidence of early-stage ulcers. We postulate that the Leporidae model recapitulated the

  6. Environmental Assessment for Multiple Projects at Laughlin Air Forc Base, TX

    Science.gov (United States)

    2013-02-06

    and cool winters . The average high and low 23 temperatures at Laughlin AFB in January, the coldest month, is 62.8 degrees Fahrenheit (°F), 24 (17.1...emissions are from stationary sources such as boilers, generators, surface coatings , paint booths, 22 storage tanks, and fueling operations, among...cottontail (Sylvilagus audobonii), black-tailed jack rabbit (Lepus californicus), Mexican ground squirrel 20 (Spermophilus mexicanus), turkey vulture

  7. Archeological Test Excavations at Eight Sites in the Lake Sharpe Project Area of Hughes, Lyman, and Stanley Counties, South Dakota 1987. Appendixes A-O

    Science.gov (United States)

    1990-04-01

    College, Sioux Falls, South Dakota. 48/504 Shuster, Rita A., and Robert A. Bye, Jr. 1984 Preliminary Results from the Dolores Archaeological Program...Gardens In: Dolore Archaeological PrWram: Synthetic Report 1978-1981 , prepared under the supervision of David A. Breternitz, Section 4: Environmental...fragments, petrosal fragment, distal middle phalanx, 8 long bone fragments, other fragments, 8 tooth fragments Sylvilagus sp. (cottontail): lumbar vertebra

  8. Parasitic infections of wild rabbits and hares

    Directory of Open Access Journals (Sweden)

    Ilić Tamara

    2014-01-01

    Full Text Available The paper presents the most important parasitic infections of wild rabbits and hares, which harmful effect in this animal population is manifested as a gradual weakening of the immune system, reduction in fertility, weight loss and constant exhaustion. Order of Lagomorpha (hares or lagomorphs belongs to superorder of higher mammals which includes the family of rabbits (Leporidae which are represented in Europe as well as the family of whistleblowers (Ochotonidae which live only in North America and Northern regions of Asia. The most important representatives of Leporidae family are European hare (Lepus europeus and wild rabbit (Oryctolagus cuniculus. The most important endoparasitosis of hares and wild rabbits are: coccidiosis, encephalitozoonosis (nosemosis, toxoplasmosis, sarcocystosis, giardiasis, cryptosporidiosis, protostrongylosis, trichostrngylodosis, passalurosis, anoplocephalidosis, cysticercosis and fasciolosis. The most frequent ectoparasites of rabbits and wild hares are fleas, lice and ticks. Reduction in hare population, which is noticed in whole Europe including Serbia, is caused by changed living conditions, quantitatively and qualitatively insufficient nutrition, increased use of herbicides as well as various infectious diseases and the diseases of parasitic etiology. Since wild rabbits and hares pose a threat to health of domestic rabbits and people, knowledge of parasitic fauna of these wild animals is of extreme epizootiological and epidemiological importance.

  9. Unprecedented loss of ammonia assimilation capability in a urease-encoding bacterial mutualist

    Directory of Open Access Journals (Sweden)

    Wernegreen Jennifer J

    2010-12-01

    Full Text Available Abstract Background Blochmannia are obligately intracellular bacterial mutualists of ants of the tribe Camponotini. Blochmannia perform key nutritional functions for the host, including synthesis of several essential amino acids. We used Illumina technology to sequence the genome of Blochmannia associated with Camponotus vafer. Results Although Blochmannia vafer retains many nutritional functions, it is missing glutamine synthetase (glnA, a component of the nitrogen recycling pathway encoded by the previously sequenced B. floridanus and B. pennsylvanicus. With the exception of Ureaplasma, B. vafer is the only sequenced bacterium to date that encodes urease but lacks the ability to assimilate ammonia into glutamine or glutamate. Loss of glnA occurred in a deletion hotspot near the putative replication origin. Overall, compared to the likely gene set of their common ancestor, 31 genes are missing or eroded in B. vafer, compared to 28 in B. floridanus and four in B. pennsylvanicus. Three genes (queA, visC and yggS show convergent loss or erosion, suggesting relaxed selection for their functions. Eight B. vafer genes contain frameshifts in homopolymeric tracts that may be corrected by transcriptional slippage. Two of these encode DNA replication proteins: dnaX, which we infer is also frameshifted in B. floridanus, and dnaG. Conclusions Comparing the B. vafer genome with B. pennsylvanicus and B. floridanus refines the core genes shared within the mutualist group, thereby clarifying functions required across ant host species. This third genome also allows us to track gene loss and erosion in a phylogenetic context to more fully understand processes of genome reduction.

  10. Lagomorphs (rabbits, pikas and hares) do not use telomere-directed replicative aging in vitro.

    Science.gov (United States)

    Forsyth, Nicholas R; Elder, Frederick F B; Shay, Jerry W; Wright, Woodring E

    2005-01-01

    Telomere shortening is used for replicative aging in primates and ungulates but not rodents. We examined telomere biology in rabbits to expand the comparative biology of telomere-directed replicative senescence within mammals. The order Lagomorpha consists of two families; Leporidae and Ochotonidae. We examined telomere biology in species representing three leporid genera (European White Rabbit, Black-tailed Jack Rabbit, and Swamp Rabbit) and the monotypic ochotonid genus (North American Pika). Of the leporids one species was a laboratory strain and the others were wild caught. The leporids neither exhibited cellular senescence after sustained periods in culture nor displayed detectable telomerase activity. Continued culture was possible because of their extremely long telomeric arrays. Immunofluorescence showed robust telomere signals at chromosome ends and significant internal chromosomal staining in some instances. Pika was unique in displaying endogenous telomerase activity throughout time in culture. These results show that it is unlikely that lagomorphs use telomere shortening and replicative senescence as a tumor protective mechanism.

  11. Performance of SBR for the treatment of textile dye wastewater: Optimization and kinetic studies

    Directory of Open Access Journals (Sweden)

    S. Sathian

    2014-06-01

    Full Text Available In this work, sequential batch reactor (SBR was employed for the treatment of textile dye wastewater. The performance of four white rot fungi (WRF viz. Coriolus versicolor, Pleurotus floridanus, Ganoderma lucidum and Trametes pubescens was evaluated in pure and mixed combinations in terms of decolorization. From the results it was found that the combination of Pleurotus floridanus, Ganoderma lucidum and Trametes pubescens was best and they were used in the SBR. The process parameters like air flow rate, sludge retention time (SRT and cycle period were optimized using response surface methodology (RSM. At these optimized conditions, treatment of textile dye wastewater was carried out at various initial dye wastewater concentration and hydraulic retention time. The performance of SBR was analyzed in terms of decolorization, COD reduction and sludge volume index (SVI. From the results it was found that a maximum decolorization and COD reduction of 71.3% and 79.4%, respectively, was achieved in the SBR at an organic loading rate of 0.165 KgCOD/m3 d. The sludge volume index (SVI was found to be low in the range of 90–103 mL/g. The kinetic study was carried out using a first order based model and the degradation follows the first order system.

  12. Composição e caracterização da fauna de mamíferos do Parque Nacional das Emas, Goiás, Brasil Composition and characterization of the mammal fauna of Emas National Park, Goiás, Brasil

    Directory of Open Access Journals (Sweden)

    Flávio H.G. Rodrigues

    2002-06-01

    Full Text Available Emas National Park is a very importam Conservation Unit in the Cerrado Biome. Nevertheless the fauna of this region is still poorly known. In this study, a revised list of the mammal fauna of the Emas National Park with comments about the composition and the number of species surveyed is presented. Eighty six species of mammals were recorded in the Park and neighboring area, including several rare and threatened species, like the bush dog (Speothos venaticus (Lund, 1842, Marsh deer (Blastocerus dichotomus (Illiger, 1815 and others. The giant rat (Kunsia tomentosus (Lichtenstein, 1830 was recorded for the first time in a conservation unit. On the other hand, species usually very common in the Cerrado biome, don't occur in Emas National Park: the brazilian rabbit (Sylvilagus brasiliensis (Linnaeus, 1758, marmosets (Callithrix spp., and the punaré (Thrichomys apereoides (Lund, 1841.

  13. Nutritional upgrading for omnivorous carpenter ants by the endosymbiont Blochmannia

    Directory of Open Access Journals (Sweden)

    Mueller Martin J

    2007-10-01

    Full Text Available Abstract Background Carpenter ants (genus Camponotus are considered to be omnivores. Nonetheless, the genome sequence of Blochmannia floridanus, the obligate intracellular endosymbiont of Camponotus floridanus, suggests a function in nutritional upgrading of host resources by the bacterium. Thus, the strongly reduced genome of the endosymbiont retains genes for all subunits of a functional urease, as well as those for biosynthetic pathways for all but one (arginine of the amino acids essential to the host. Results Nutritional upgrading by Blochmannia was tested in 90-day feeding experiments with brood-raising in worker-groups on chemically defined diets with and without essential amino acids and treated or not with antibiotics. Control groups were fed with cockroaches, honey water and Bhatkar agar. Worker-groups were provided with brood collected from the queenright mother-colonies (45 eggs and 45 first instar larvae each. Brood production did not differ significantly between groups of symbiotic workers on diets with and without essential amino acids. However, aposymbiotic worker groups raised significantly less brood on a diet lacking essential amino acids. Reduced brood production by aposymbiotic workers was compensated when those groups were provided with essential amino acids in their diet. Decrease of endosymbionts due to treatment with antibiotic was monitored by qRT-PCR and FISH after the 90-day experimental period. Urease function was confirmed by feeding experiments using 15N-labelled urea. GC-MS analysis of 15N-enrichment of free amino acids in workers revealed significant labelling of the non-essential amino acids alanine, glycine, aspartic acid, and glutamic acid, as well as of the essential amino acids methionine and phenylalanine. Conclusion Our results show that endosymbiotic Blochmannia nutritionally upgrade the diet of C. floridanus hosts to provide essential amino acids, and that it may also play a role in nitrogen recycling

  14. Fauna de Coleoptera Associada a Carcaças de Coelhos Expostas em uma Área Urbana no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Richard Silva

    2012-11-01

    Abstract. Study of Coleoptera fauna associated with rabbit carcasses, Oryctolagus cuniculus Linnaeus (Lagomorpha, Leporidae, during the summer of 2010 and winter of 2011, is present at an urban area of Northern Paraná State, Southern Brazil. To capture the beetles were used pan, pitfall and modified Shannon traps. We collected 236 beetles belonging to 12 families and at least 25 species. Staphylinidae (52.5% and Histeridae (26.7% were the most abundant families in both seasons represented mainly by Aleochara bonariensis Lynch and Euspilotus "group" azureus sp., respectively. Among the seasons, both the decomposition of the carcasses and the succession of coleopterofauna of forensic interest occurred differently due to significant variation of abiotic factors. During the winter, most individuals of Euspilotus "group" azureus sp. (96.8% was captured at the stage of Black Putrefaction, showing an association at this stage. Despite the environment seasonality, there wasn’t significant difference of the abundance among seasons by main beetles neither by coleopterofauna.

  15. Endogenization of mouse mammary tumor virus (MMTV)-like elements in genomes of pikas (Ochotona sp.).

    Science.gov (United States)

    Lemos de Matos, Ana; de Sousa-Pereira, Patrícia; Lissovsky, Andrey A; van der Loo, Wessel; Melo-Ferreira, José; Cui, Jie; Esteves, Pedro J

    2015-12-02

    Despite the finding in European rabbit and other leporid genomes of the first ever described endogenous lentivirus and of a European rabbit exclusive endogenous gammaretrovirus, until now no exogenous retroviruses have been isolated in Lagomorpha species. Nevertheless, looking for the presence of endogenous retroviruses (ERVs) in the species genomes could lead to the discovery of retroviral lineages yet to be found in Lagomorpha. Different mammalian genomes harbor endogenous viral sequences phylogenetically close to the betaretrovirus mouse mammary tumor virus (MMTV), propelling us to look for such retroviral "fossil" in American pika (Ochotona princeps) and European rabbit (Oryctolagus cuniculus) genomes. By performing genomic mining using MMTV gag and LTR as query sequences, we found that such viral elements were absent from the European rabbit genome. Oppositely, significant matches were found in American pika, and more importantly, a nearly complete MMTV-like virus (Pika-BERV) was identified. Using Pika-BERV gag and LTR as templates, we found similar sequences endogenized in different pika (Ochotona sp.) species. The orthology of the LTR flanking region between some pika species supported shared ancestry of specific endogenous betaretroviruses, while in other pika species similar sequences, but not orthologous, should have resulted from independent insertions. Our study supports the possible existence of infecting exogenous betaretroviruses for a long term, after the divergence of Ochotonidae from Leporidae, but yet to be identified. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Experimental infection of wild-caught European rabbits (Oryctolagus cuniculus) with Sarcoptes scabiei from a naturally infected wild rabbit.

    Science.gov (United States)

    Millán, J; Casais, R; Colomar, V; Bach, E; Prieto, J M; Velarde, R

    2013-06-01

    Scabies was recently reported for the first time in the European wild rabbit, Oryctolagus cuniculus (Lagomorpha: Leporidae). We experimentally exposed 10 seronegative wild-caught rabbits to skin from a mangy wild rabbit. Serological, physiological, parasitological and histopathological changes were recorded. Three rabbits developed antibodies at 2-5 weeks post-infection (w.p.i.), two of which then developed lesions at 7 w.p.i. One of these had a small area of alopecia on the hind limb that healed naturally within 1 week; the other developed more extensive lesions restricted to the hind limbs (as typically observed in wild rabbits) that lasted until the rabbit died (12.5 w.p.i.). The third rabbit died of trauma 5 w.p.i. before developing any lesions. Antibodies in the healed rabbit disappeared from serum at 8 w.p.i., whereas antibody levels in the sick rabbit increased until its death. Disseminated intravascular coagulation and hepatic necrosis, probably arising from a concomitant infection with rabbit haemorrhagic disease virus, were the likely final cause of death in this rabbit. The mangy rabbit that served as a donor died of a multifocal fibrinosuppurative pneumonia that may have been secondary to the skin bacterial pyoderma. © 2012 The Authors. Medical and Veterinary Entomology © 2012 The Royal Entomological Society.

  17. Chitons (Mollusca, Polyplacophora from Alacranes Reef, Yucatan, Mexico

    Directory of Open Access Journals (Sweden)

    Adriana Reyes-Gómez

    2017-04-01

    Full Text Available This study represents the first comprehensive chiton study from Alacranes Reef, the largest reef system in the Gulf of Mexico. Nine chiton species were found in seven localities within the area, in the intertidal and subtidal to 12 m depth. SEM examination of C. janeirensis, A. hemphilli, T. schrammi and C. floridanus, showed variations in the sculpture and radular teeth morphology when compared to specimens of the same species from Florida Keys, Bahamas and Puerto Rico. The distribution ranges of T. schrammi, L. liozonis and S. floridana are extended into the south-western area of the Gulf of Mexico. Altogether, combining previous literature and the present survey, reports eleven chiton species which have now been recorded within the Alacranes reef area.

  18. Diversidad y microestructura de quitones (Mollusca: Polyplacophora del Caribe de Costa Rica

    Directory of Open Access Journals (Sweden)

    Cedar I García-Ríos

    2011-03-01

    Full Text Available Los poliplacóforos asociados a los arrecifes de coral en la costa caribeña de Costa Rica han sido poco estudiados. El examen del cascajo de coral acumulado en el sublitoral somero, en cuatro estaciones de colección, localizadas en la Provincia de Limón reveló una diversidad de quitones mayor a la documentada. Anteriormente se habían registrado ocho especies para el Caribe costaricense: Ischnochiton erythronotus (C.B. Adams, 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon, 1886; S. purpurascens (C.B. Adams, 1845; Acanthopleura granulata (Gmelin, 1791; Chiton marmoratus Gmelin, 1791; C. tuberculatus Linnaeus, 1758; Acanthochitona rhodea (Pilsbry, 1893. Otras cinco se registran aquí por primera vez: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954; Cryptoconchus floridanus (Dall 1889.

  19. Ecology of Florida black bears in the Okefenokee-Osceola ecosystem

    Science.gov (United States)

    Dobey, S.; Masters, D.V.; Scheick, B.K.; Clark, J.D.; Pelton, M.R.; Sunquist, M.E.

    2005-01-01

    The population status of the Florida black bear (Ursus americanus floridanus) is problematic within many portions of its range and its potential listing as a federally threatened species has been the subject of legal debate. We studied Florida black bears in 2 areas in the Okefenokee-Osceola ecosystem in southeast Georgia (i.e.,Okefenokee) and north Florida (i.e., Osceola) from 1995 to 1999 to evaluate relationships between population characteristics, habitat conditions, and human activities. Bears in Okefenokee were hunted and those in Osceola were not. We captured 205 different black bears (124M:81F) 345 times from June 1995 to September  1998. We obtained 13,573 radiolocations from 87 (16M:71F) individual bears during the study.

  20. Chitons (Mollusca, Polyplacophora) from Alacranes Reef, Yucatan, Mexico

    Science.gov (United States)

    Reyes-Gómez, Adriana; Ortigosa, Deneb; Simões, Nuno

    2017-01-01

    Abstract This study represents the first comprehensive chiton study from Alacranes Reef, the largest reef system in the Gulf of Mexico. Nine chiton species were found in seven localities within the area, in the intertidal and subtidal to 12 m depth. SEM examination of C. janeirensis, A. hemphilli, T. schrammi and C. floridanus, showed variations in the sculpture and radular teeth morphology when compared to specimens of the same species from Florida Keys, Bahamas and Puerto Rico. The distribution ranges of T. schrammi, L. liozonis and S. floridana are extended into the south-western area of the Gulf of Mexico. Altogether, combining previous literature and the present survey, reports eleven chiton species which have now been recorded within the Alacranes reef area. PMID:28769624

  1. Cuticular Hydrocarbon Pheromones for Social Behavior and Their Coding in the Ant Antenna

    Directory of Open Access Journals (Sweden)

    Kavita R. Sharma

    2015-08-01

    Full Text Available The sophisticated organization of eusocial insect societies is largely based on the regulation of complex behaviors by hydrocarbon pheromones present on the cuticle. We used electrophysiology to investigate the detection of cuticular hydrocarbons (CHCs by female-specific olfactory sensilla basiconica on the antenna of Camponotus floridanus ants through the utilization of one of the largest family of odorant receptors characterized so far in insects. These sensilla, each of which contains multiple olfactory receptor neurons, are differentially sensitive to CHCs and allow them to be classified into three broad groups that collectively detect every hydrocarbon tested, including queen and worker-enriched CHCs. This broad-spectrum sensitivity is conserved in a related species, Camponotus laevigatus, allowing these ants to detect CHCs from both nestmates and non-nestmates. Behavioral assays demonstrate that these ants are excellent at discriminating CHCs detected by the antenna, including enantiomers of a candidate queen pheromone that regulates the reproductive division of labor.

  2. Diversidad y microestructura de quitones (Mollusca: Polyplacophora del Caribe de Costa Rica

    Directory of Open Access Journals (Sweden)

    Cedar I García-Ríos

    2011-03-01

    Full Text Available Los poliplacóforos asociados a los arrecifes de coral en la costa caribeña de Costa Rica han sido poco estudiados. El examen del cascajo de coral acumulado en el sublitoral somero, en cuatro estaciones de colección, localizadas en la Provincia de Limón reveló una diversidad de quitones mayor a la documentada. Anteriormente se habían registrado ocho especies para el Caribe costaricense: Ischnochiton erythronotus (C.B. Adams, 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon, 1886; S. purpurascens (C.B. Adams, 1845; Acanthopleura granulata (Gmelin, 1791; Chiton marmoratus Gmelin, 1791; C. tuberculatus Linnaeus, 1758; Acanthochitona rhodea (Pilsbry, 1893. Otras cinco se registran aquí por primera vez: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954; Cryptoconchus floridanus (Dall 1889.Diversity and microstructure of quitons (Mollusca: Polyplacophora from the Caribbean of Costa Rica. The polyplacophorans of the coral reef on the Caribbean coast of Costa Rica have been insufficiently studied. The examination of coral rubble accumulated in the shallow sublitoral waters on four collection stations in Provincia Limón revealed a higher diversity of chitons than was documented. From the country eight species were previously known: Ischnochiton erythronotus (C.B. Adams 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon 1886; S. purpurascens (C.B. Adams 1845; Acanthopleura granulate (Gmelin 1791; Chiton marmoratus Gmelin 1791; C. tuberculatus Linnaeus 1758 and Acanthochitona rhodea (Pilsbry 1893. This study added five more species that are reported here for the first time: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954 and Cryptoconchus floridanus (Dall 1889. Rev. Biol. Trop. 59 (1: 129-136. Epub 2011 March 01.

  3. LaGomiCs-Lagomorph Genomics Consortium: An International Collaborative Effort for Sequencing the Genomes of an Entire Mammalian Order.

    Science.gov (United States)

    Fontanesi, Luca; Di Palma, Federica; Flicek, Paul; Smith, Andrew T; Thulin, Carl-Gustaf; Alves, Paulo C

    2016-07-01

    The order Lagomorpha comprises about 90 living species, divided in 2 families: the pikas (Family Ochotonidae), and the rabbits, hares, and jackrabbits (Family Leporidae). Lagomorphs are important economically and scientifically as major human food resources, valued game species, pests of agricultural significance, model laboratory animals, and key elements in food webs. A quarter of the lagomorph species are listed as threatened. They are native to all continents except Antarctica, and occur up to 5000 m above sea level, from the equator to the Arctic, spanning a wide range of environmental conditions. The order has notable taxonomic problems presenting significant difficulties for defining a species due to broad phenotypic variation, overlap of morphological characteristics, and relatively recent speciation events. At present, only the genomes of 2 species, the European rabbit (Oryctolagus cuniculus) and American pika (Ochotona princeps) have been sequenced and assembled. Starting from a paucity of genome information, the main scientific aim of the Lagomorph Genomics Consortium (LaGomiCs), born from a cooperative initiative of the European COST Action "A Collaborative European Network on Rabbit Genome Biology-RGB-Net" and the World Lagomorph Society (WLS), is to provide an international framework for the sequencing of the genome of all extant and selected extinct lagomorphs. Sequencing the genomes of an entire order will provide a large amount of information to address biological problems not only related to lagomorphs but also to all mammals. We present current and planned sequencing programs and outline the final objective of LaGomiCs possible through broad international collaboration. © The American Genetic Association. 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. LaGomiCs—Lagomorph Genomics Consortium: An International Collaborative Effort for Sequencing the Genomes of an Entire Mammalian Order

    Science.gov (United States)

    Di Palma, Federica; Flicek, Paul; Smith, Andrew T.; Thulin, Carl-Gustaf

    2016-01-01

    The order Lagomorpha comprises about 90 living species, divided in 2 families: the pikas (Family Ochotonidae), and the rabbits, hares, and jackrabbits (Family Leporidae). Lagomorphs are important economically and scientifically as major human food resources, valued game species, pests of agricultural significance, model laboratory animals, and key elements in food webs. A quarter of the lagomorph species are listed as threatened. They are native to all continents except Antarctica, and occur up to 5000 m above sea level, from the equator to the Arctic, spanning a wide range of environmental conditions. The order has notable taxonomic problems presenting significant difficulties for defining a species due to broad phenotypic variation, overlap of morphological characteristics, and relatively recent speciation events. At present, only the genomes of 2 species, the European rabbit (Oryctolagus cuniculus) and American pika (Ochotona princeps) have been sequenced and assembled. Starting from a paucity of genome information, the main scientific aim of the Lagomorph Genomics Consortium (LaGomiCs), born from a cooperative initiative of the European COST Action “A Collaborative European Network on Rabbit Genome Biology—RGB-Net” and the World Lagomorph Society (WLS), is to provide an international framework for the sequencing of the genome of all extant and selected extinct lagomorphs. Sequencing the genomes of an entire order will provide a large amount of information to address biological problems not only related to lagomorphs but also to all mammals. We present current and planned sequencing programs and outline the final objective of LaGomiCs possible through broad international collaboration. PMID:26921276

  5. History and status of introduced mammals and impacts to breeding seabirds on the California channel and Northwestern Baja California Islands

    Science.gov (United States)

    McChesney, G.J.; Tershy, B.R.

    1998-01-01

    The California Channel Islands, U.S.A., and Northwestern Baja California Islands, Mexico, host important breeding populations of several seabird species, including the endemic Black-vented Shearwater (Puffinus opisthomelas) and Xantus' Murrelet (Synthliboramphus hypoleucus). Mammals introduced to nearly all of the islands beginning in the late 1800s to early 1900s include: cats (Felis catus), dogs (Canis familiaris), Black Rats (Rattus rattus), rabbits and hares (Leporidae), goats (Capra hirca), sheep (Ovis ones), and other grazers. Cats, dogs and rats are seabird predators, grazers such as goats and sheep cause habitat degredation, and rabbits destroy habitat and compete with hole-nesting seabirds. Cats, which were introduced to at least 19 islands and currently occur on ten islands, have had the greatest impacts on seabirds, including the extinction of the endemic Guadalupe Storm-Petrel (Oceanodroma macrodactyla). Cats are known to have eliminated or severely reduced colonies of Black-vented Shearwaters, Cassin's Auklets (Ptychoramphus aleuticus) and Xantus' Murrelets. Black Rats have occurred on a minimum of seven islands and have reduced numbers of small, hole-nesting alcids on at least one island. At many islands, defoliation and erosion caused by rabbits and large grazing mammals has been severe. Their effects on seabirds are not well documented but potentially are serious. Impacts from introduced mammals have been most severe on islands with no native mammalian predators. On the Northwestern Baja California Islands, temporary and permanent human settlements have led to a greater diversity and source of introductions. Programs to remove introduced mammals and to reduce the possibility of future introductions are needed to restore seabird populations and to preserve the biodiversity of the region. Surveys are needed particularly on the Northwestern Baja California Islands to update the status and distribution of seabirds and to further assess impacts from

  6. The effect of low salinity on teredinids

    Directory of Open Access Journals (Sweden)

    Cristine C. Barreto

    2000-01-01

    Full Text Available Teredinids survival in low salinities was determined in aquaria. Panels previously immersed in Ponta de Leste, Ilha Grande Bay, Rio de Janeiro, were transferred to aquaria with salinities ranging from 5.0 to 15.0 Practical Salinity Unities (PSU. The waters of Ilha Grande Bay receive a large amount of wood from the marginal rainforest vegetation, being suitable for the development of teredinids. The coastal areas of the bay are subjected to wide salinity fluctuations due to strong and sudden tropical storms. Eleven different species of teredinids were found in the panels. The critical salinity concentration for the survival of the two most common species was 11.93 PSU for Lyrodus floridanus and 12.90 PSU for Teredo furcifera. The effect of time on the mortality of teredinids at low salinities is also discussed.A sobrevivência de moluscos bivalves perfurantes de madeira da família Teredinidae foi avaliada a partir de sua manutenção em aquários de baixa salinidade. Painéis de madeira previamente imersos em Ponta de Leste, Baía da Ilha Grande, RJ, foram transferidos para aquários, contendo água do mar, cujas concentrações salinas variaram de 5,0 a 15,0 PSU. A Baía da Ilha Grande recebe uma grande quantidade de madeira da vegetação marginal de Mata Atlântica, o que torna o ambiente particularmente favorável ao desenvolvimento de teredinídeos. As áreas costeiras da baía estão sujeitas a grandes variações salinas decorrentes de tempestades tropicais que ocorrem súbita e intensamente. A salinidade crítica à sobrevivência das duas espécies mais comuns nos painéis foi de 11,93, para Lyrodus floridanus e 12,90 para Teredo furcifera. O efeito do tempo na mortalidade dos teredinídeos, quando sujeitos a baixas salinidades, foi discutido.

  7. Using diets of Canis breeding pairs to assess resource partitioning between sympatric red wolves and coyotes

    Science.gov (United States)

    Hinton, Joseph W.; Ashley, Annaliese K.; Dellinger, Justin A.; Gittleman, John L.; van Manen, Frank T.; Chamberlain, Michael J.

    2017-01-01

    Foraging behaviors of red wolves (Canis rufus) and coyotes (Canis latrans) are complex and their ability to form congeneric breeding pairs and hybridize further complicates our understanding of factors influencing their diets. Through scat analysis, we assessed prey selection of red wolf, coyote, and congeneric breeding pairs formed by red wolves and coyotes, and found that all 3 had similar diets. However, red wolf and congeneric pairs consumed more white-tailed deer (Odocoileus virginianus) than coyote pairs. Coyotes forming breeding pairs with red wolves had 12% more white-tailed deer in their diet than conspecifics paired with coyotes. Contrary to many studies on coyotes in the southeastern United States, we found coyotes in eastern North Carolina to be primarily carnivorous with increased consumption of deer during winter. Although prey selection was generally similar among the 3 groups, differences in diet among different breeding pairs were strongly associated with body mass. Larger breeding pairs consumed more white-tailed deer, and fewer rabbits (Sylvilagus spp.) and other small mammals. Partitioning of food resources by sympatric red wolves and coyotes is likely via differences in the proportions of similar prey consumed, rather than differences in types of prey exploited. Consequently, our results suggest coexistence of red wolves and coyotes in the southeastern United States may not be possible because there are limited opportunities for niche partitioning to reduce competitive interactions.

  8. Food habits of pumas in northwestern Sonora, Mexico

    Science.gov (United States)

    Rosas-Rosas, O. C.; Valdez, R.; Bender, L.C.; Daniel, D.

    2003-01-01

    It is questionable whether food-habits studies of pumas conducted in the southwestern United States can be extrapolated to northwestern Mexico, because of differences in management, distribution, and abundance of wildlife. We determined food habits of pumas (Puma concolor) in the Sonoran Desert of northwestern Sonora, Mexico. Based on studies in the western United States, we hypothesized that desert mule deer (Odocoileus hemionus) were the major food source of pumas in Sonoran Desert habitats of Mexico. The study area supports populations of desert mule deer, white-tailed deer (Odocoileus virginianus), lagomorphs (Lepus spp. and Sylvilagus audubonii), collared peccary (Pecari tajacu), and the largest population (???300 individuals) of desert bighorn sheep (Ovis canadensis) in Sonora. Based on pugmark characteristics, we recorded 3 different adult resident pumas in approximately 90 km2. We analyzed 60 puma fecal samples collected September 1996-November 1998. Primary prey items based on frequency of occurrence and estimated biomass consumed were desert bighorn sheep (40% and 45%, respectively), lagomorphs (33%, 19%), deer (17%, 17%), and collared peccary (15%, 11%). The high percentage of desert bighorn sheep in puma diets may be due to high abundance relative to mule deer, which declined in number during our study. No differences were found in puma diets between seasons (??22=2.4526, P=0.2934). Fluctuations in mule deer populations in northwestern Sonora may influence prey selection by pumas.

  9. Shedding of a low pathogenic avian influenza virus in a common synanthropic mammal--the cottontail rabbit.

    Directory of Open Access Journals (Sweden)

    J Jeffrey Root

    Full Text Available BACKGROUND: Cottontails (Sylvilagus spp. are common mammals throughout much of the U.S. and are often found in peridomestic settings, potentially interacting with livestock and poultry operations. If these animals are susceptible to avian influenza virus (AIV infections and shed the virus in sufficient quantities they may pose a risk for movement of avian influenza viruses between wildlife and domestic animals in certain situations. METHODOLOGY/PRINCIPAL FINDINGS: To assess the viral shedding potential of AIV in cottontails, we nasally inoculated fourteen cottontails with a low pathogenic AIV (H4N6. All inoculated cottontails shed relatively large quantities of viral RNA both nasally (≤ 10(6.94 PCR EID50 equivalents/mL and orally (≤ 10(5.09 PCR EID50 equivalents/mL. However, oral shedding tended to decline more quickly than did nasal shedding. No animals showed any obvious signs of disease throughout the study. Evidence of a serological response was found in all infected rabbits at 22 days post infection in convalescent sera. CONCLUSIONS/SIGNIFICANCE: To our knowledge, cottontails have not been previously assessed for AIV shedding. However, it was obvious that they shed AIV RNA extensively via the nasal and oral routes. This is significant, as cottontails are widely distributed throughout the U.S. and elsewhere. These mammals are often found in highly peridomestic situations, such as farms, parks, and suburban neighborhoods, often becoming habituated to human activities. Thus, if infected these mammals could easily transport AIVs short distances.

  10. Late Neogene marine incursions and the ancestral Gulf of California

    Science.gov (United States)

    McDougall, K.

    2008-01-01

    The late Neogene section in the Salton Trough, California, and along the lower Colorado River in Arizona is composed of marine units bracketed by nonmarine units. Microfossils from the marine deposits indicate that a marine incursion inundated the Salton Trough during the late Miocene. Water depths increased rapidly in the Miocene and eventually flooded the region now occupied by the Colorado River as far north as Parker, Arizona. Marine conditions were restricted in the Pliocene as the Colorado River filled the Salton Trough with sediments and the Gulf of California assumed its present configuration. Microfossils from the early part of this incursion include a diverse assemblage of benthic foraminifers (Amphistegina gibbosa, Uvigerina peregrina, Cassidulina delicata, and Bolivina interjuncta), planktic foraminifers (Globigerinoides obliquus, G. extremus, and Globigerina nepenthes), and calcareous nannoplankton (Discoaster brouweri, Discoaster aff. Discoaster surculus, Sphenolithus abies, and S. neoabies), whereas microfossils in the final phase contain a less diverse assemblage of benthic foraminifers that are diagnostic of marginal shallow-marine conditions (Ammonia, Elphidium, Bolivina, Cibicides, and Quinqueloculina). Evidence of an earlier middle Miocene marine incursion comes from reworked microfossils found near Split Mountain Gorge in the Fish Creek Gypsum (Sphenolithus moriformis) and near San Gorgonio Pass (Cyclicargolithus floridanus and Sphenolithus heteromorphus and planktic foraminifers). The middle Miocene incursion may also be represented by the older marine sedimentary rocks encountered in the subsurface near Yuma, Arizona, where rare middle Miocene planktic foraminifers are found. ?? 2008 The Geological Society of America.

  11. A review of the Cercyon Leach (Coleoptera, Hydrophilidae, Sphaeridiinae of the Greater Antilles

    Directory of Open Access Journals (Sweden)

    Emmanuel Arriaga-Varela

    2017-06-01

    Full Text Available The representatives of the genus Cercyon Leach occurring in the Greater Antilles are reviewed. Ten species are recorded, of which five are described here as new: C. gimmeli sp. n. (Dominican Republic, C. armatipenis sp. n. (Dominican Republic, C. taino sp. n. (Dominican Republic, C. sklodowskae sp. n. (Jamaica and C. spiniventris sp. n. (Dominican Republic. Diagnoses and detailed distributional data are also provided for C. floridanus Horn, 1890 (distributed in southeastern United States of America and Cayman Islands, C. insularis Chevrolat, 1863 (endemic to the Antilles C. praetextatus (Say, 1825 (widely distributed in the New World incl. Greater Antilles, C. quisquilius (Linnaeus, 1761 (an adventive species of Paleartic origin and C. nigriceps (Marshall, 1802 (an adventive species probably of Oriental origin. Cercyon armatipenis, C. gimmeli, C. taino form a group of closely related species only distinguishable by male genitalia and DNA sequences. A key to the Great Antillean Cercyon is provided and important diagnostic characters are illustrated. The larvae of C. insularis and C. taino were associated with adults using COI barcode sequences, illustrated and diagnosed. Full occurrence data, additional images and COI barcode sequences were submitted to open access on-line depositories in an effort to provide access to complete data.

  12. Reproductive and biochemical biomarkers in largemouth bass sampled downstream of a pulp and paper mill in Florida

    Science.gov (United States)

    Sepulveda, M.S.; Gallagher, E.P.; Wieser, C.M.; Gross, T.S.

    2004-01-01

    The objective of this study was to evaluate the effects of bleached/unbleached kraft mill effluents (B/UKME) on the reproductive parameters of free-ranging Florida largemouth bass (Micropterus salmoides floridanus). The reproductive parameters measured included gonadosomatic index (GSI), histological evaluation of gonads, and plasma concentrations of vitellogenin (VTG), 17??-estradiol, and 11-ketotestosterone (11-KT). Hepatic ethoxyresorufin-O-deethylase (EROD) activity was measured as a marker of exposure to cytochrome P450-inducing agents in these effluents. Endpoints were compared among adult bass sampled from tributary and mainstream effluent-contaminated and reference sites. Females sampled from the site closest to the mill outfall had a significant five-fold increase in EROD activity compared to bass sampled from reference streams. Although sex hormones were significantly reduced in bass from exposed sites, there were no differences in VTG and GSI across sites. The absence of organism-level responses was probably not related to a lack of sensitivity, as previous studies in our laboratory have shown that bass exposed to these effluents exhibit changes in GSI and in other measures associated with reproductive success. In females, inverse relationships were observed between VTG and GSI and EROD activity. These relationship, however, were not consistent within all of the sites studied. Collectively, our findings indicate that hepatic EROD induction is an effective marker of B/UKME exposure in largemouth bass and that it might be associated with antiestrogenic effects in this species. ?? 2003 Elsevier Inc. All rights reserved.

  13. Anisaldehyde production and aryl-alcohol oxidase and dehydrogenase activities in ligninolytic fungi of the genus Pleurotus.

    Science.gov (United States)

    Gutiérrez, A; Caramelo, L; Prieto, A; Martínez, M J; Martínez, A T

    1994-01-01

    A variety of simple aromatic compounds were identified in liquid cultures of the basidiomycetes Pleurotus cornucopiae, P. eryngii, P. floridanus, P. pulmonarius, P. ostreatus, and P. sajor-caju by using gas chromatography-mass spectrometry. Such compounds were detected in fungal cultures on lignin- and straw-containing media, but it was found that they were also produced in the absence of aromatic precursors. Anisylic and hydroxybenzylic compounds (such as alcohols, aldehydes, and acids) were identified, p-anisaldehyde being the most characteristic extracellular metabolite synthesized by these ligninolytic fungi. Small amounts of 3-chloro-p-anisaldehyde were also detected in several species. It is postulated that the balance between the more-or-less-oxidized aromatic compounds can be explained in terms of the activity of fungal enzymes, including aryl-alcohol oxidase and dehydrogenase. The former enzyme shows high affinity for p-anisyl alcohol, which is oxidized to p-anisaldehyde with production of H2O2. The aryl-alcohol dehydrogenase was detected only in the mycelium, where it reduces aromatic aldehydes in the presence of NADPH. Both enzymes could be involved in the redox cycling of these aromatic compounds, providing H2O2 to ligninolytic peroxidases. PMID:8031078

  14. Nestmate recognition in ants is possible without tactile interaction

    Science.gov (United States)

    Brandstaetter, Andreas Simon; Endler, Annett; Kleineidam, Christoph Johannes

    2008-07-01

    Ants of the genus Camponotus are able to discriminate recognition cues of colony members (nestmates) from recognition cues of workers of a different colony (non-nestmates) from a distance of 1 cm. Free moving, individual Camponotus floridanus workers encountered differently treated dummies on a T-bar and their behavior was recorded. Aggressive behavior was scored as mandibular threat towards dummies. Dummies were treated with hexane extracts of postpharyngeal glands (PPGs) from nestmates or non-nestmates which contain long-chain hydrocarbons in ratios comparable to what is found on the cuticle. The cuticular hydrocarbon profile bears cues which are essential for nestmate recognition. Although workers were prevented from antennating the dummies, they showed significantly less aggressive behavior towards dummies treated with nestmate PPG extracts than towards dummies treated with non-nestmate PPG extracts. In an additional experiment, we show that cis-9-tricosene, an alkene naturally not found in C. floridanus’ cuticular profile, is behaviorally active and can interfere with nestmate recognition when presented together with a nestmate PPG extract. Our study demonstrates for the first time that the complex multi-component recognition cues can be perceived and discriminated by ants at close range. We conclude that contact chemosensilla are not crucial for nestmate recognition since tactile interaction is not necessary.

  15. Distributed representation of social odors indicates parallel processing in the antennal lobe of ants.

    Science.gov (United States)

    Brandstaetter, Andreas Simon; Kleineidam, Christoph Johannes

    2011-11-01

    In colonies of eusocial Hymenoptera cooperation is organized through social odors, and particularly ants rely on a sophisticated odor communication system. Neuronal information about odors is represented in spatial activity patterns in the primary olfactory neuropile of the insect brain, the antennal lobe (AL), which is analog to the vertebrate olfactory bulb. The olfactory system is characterized by neuroanatomical compartmentalization, yet the functional significance of this organization is unclear. Using two-photon calcium imaging, we investigated the neuronal representation of multicomponent colony odors, which the ants assess to discriminate friends (nestmates) from foes (nonnestmates). In the carpenter ant Camponotus floridanus, colony odors elicited spatial activity patterns distributed across different AL compartments. Activity patterns in response to nestmate and nonnestmate colony odors were overlapping. This was expected since both consist of the same components at differing ratios. Colony odors change over time and the nervous system has to constantly adjust for this (template reformation). Measured activity patterns were variable, and variability was higher in response to repeated nestmate than to repeated nonnestmate colony odor stimulation. Variable activity patterns may indicate neuronal plasticity within the olfactory system, which is necessary for template reformation. Our results indicate that information about colony odors is processed in parallel in different neuroanatomical compartments, using the computational power of the whole AL network. Parallel processing might be advantageous, allowing reliable discrimination of highly complex social odors.

  16. Atropelamentos de vertebrados na Floresta Nacional de Carajás, Pará, Brasil Roadkills of vertebrates in Carajas National Forest, Para, Brazil

    Directory of Open Access Journals (Sweden)

    Fabiano Gumier-Costa

    2009-01-01

    Full Text Available Vários pesquisadores têm avaliado impactos de estradas. Estes podem envolver aspectos paisagísticos, degradação do solo, poluição do ar e impactos sobre a fauna, como atropelamentos. Na estrada Raimundo Mascarenhas, que atravessa a Floresta Nacional de Carajás (ca. 400 mil hectares, há intenso tráfego de veículos automotores. O objetivo deste trabalho foi testar se há diferenças entre trechos da estrada, em três escalas espaciais; se há alteração ao longo dos anos; se alguns táxons são mais freqüentemente atropelados, e se a freqüência de atropelamentos aumenta com a precipitação mensal. Analisamos a freqüência de atropelamentos de vertebrados de abril/2003 até outubro/2006 ao longo dos 25 km iniciais da estrada. Registramos 155 atropelamentos. O número de atropelamentos diminui ao longo dos anos (P=0,01, e com a distância do início da estrada (P=0,0002. Serpentes (Ophidia e gambás Didelphis marsupialis foram mais atropelados (7,5/ano, seguidos de aves, raposas Cerdocyon thous, quatis Nasua nasua, roedores (Rodentia, e não identificados (4,9/ano; cuíca Marmosops sp., tapeti Sylvilagus brasiliensis, guariba Alouatta sp., irara Eira barbara, jabuti Geochelone sp., lagartos (Lacertilia e macaco prego Cebus apella (1/ano. Não houve relação significativa entre o número mensal de atropelamentos e a precipitação mensal.Several researchers have evaluated impacts of highways. These can involve landscape aspects, soil degradation, air pollution, and impacts upon wildlife, such as roadkills. At the Raimundo Mascarenhas highway, that crosses the Carajás National Forest (ca. 400.000 ha, there is intense traffic of automotive vehicles. The aim of this work was to test if there were differences among higway sections on three spatial scales; if there was alteration along the years; if some taxa suffered more frequently roadkills; and if roadkill frequency increased with monthly precipitation. We analysed roadkill

  17. Composição e caracterização da fauna de mamíferos de médio e grande porte em uma pequena reserva de cerrado em Mato Grosso, Brasil Composition and characterization of the medium and large size mammal fauna in a small cerrado reserve in Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    Ednaldo Cândido Rocha

    2006-08-01

    Full Text Available Este estudo foi realizado na Reserva Biológica Municipal "Mário Viana", Nova Xavantina, MT, objetivando inventariar e avaliar a abundância e diversidade de mamíferos terrestres de médio e grande porte. Para tanto, foram realizadas duas visitas mensais a um transecto com 2.820 m de extensão, durante todo o ano de 2001, para o levantamento de pegadas (rastreamentos e outras evidências de mamíferos. Um total de 29 espécies foram registradas na área de estudo, sendo que 22 ocorreram no transecto e tiveram suas seqüências individuais de pegadas quantificadas para realização do cálculo dos índices de abundância e de diversidade de Shannon-Wiener (H'. De acordo com seus índices de abundância, as espécies foram classificadas em raras, comuns e abundantes. Dentre outras, onça-parda (Puma concolor - Linnaeus, 1771 e tatu-canastra (Priodontes maximus - Keer, 1792 mostraram-se raras; jaguatirica (Leopardus pardalis - Linnaeus, 1758, e tamanduá-bandeira (Myrmecophaga tridactyla - Linnaeus, 1758, comuns; e cutia (Dasyprocta azarae - Lichtenstein, 1823 e tapeti (Sylvilagus brasiliensis - Linnaeus, 1758, abundantes. O H' encontrado foi 2,40, sendo considerado significativo. O presente trabalho apontou que, apesar de pequena (470 ha, a área de estudo desempenha importante papel para a conservação da mastofauna da região de Nova Xavantina, MT.This study was carried out at the 'Mario Viana' Municipal Biological Reserve in Nova Xavantina, MT, aiming to make an inventory and evaluate the abundance and diversity of terrestrial mammals of medium and large size. Thus, two monthly visits were made to a 2.820 m long transect throughout 2001 to assess tracking and other evidences of mammals. Twenty-nine species were recorded in the study area, with 22 in the transect and two individual tracking sequences being quantified for calculation of the Shannon-Wiener (H' abundance and diversity indices. According to the abundance indices, the species were

  18. Spatial and temporal use of a prairie dog colony by coyotes and rabbits: potential indirect effects on endangered black-footed ferrets

    Science.gov (United States)

    Eads, David A.; Biggins, Dean E.; Livieri, Travis M.

    2015-01-01

    In western North America, endangered black-footed ferrets Mustela nigripes are conserved via reintroduction to colonies of prairie dogs Cynomys spp., their primary prey. Predation is an important source of mortality; coyotes Canis latrans appear to be the most problematic predator, accounting for 67% of known predation events on radio-tagged ferrets. Little is known about what factors affect spatial use of prairie dog colonies by coyotes, or how other animals might affect interactions between coyotes and ferrets. During June–October 2007–2008, we used spotlight surveys to monitor coyotes and ferrets (both years) and rabbits Sylvilagus spp. (first year) on a 452-ha colony of black-tailed prairie dogs Cynomys ludovicianus in the Conata Basin, South Dakota. Coyotes appeared to select areas of the colony used by rabbits, suggesting coyotes hunted rabbits, a common item in their diet. Between midnight and sunrise, ferrets were most commonly observed during early morning (01:00–03:00 h), whereas coyotes were observed mostly during dawn (04:00 h – sunrise) when ferrets were rarely seen. These temporal differences in the timing of observations suggest ferrets tend to remain underground in burrows when coyotes are most active. Coyotes appeared to be attracted to rabbits in both space and time, suggesting the risk of predation for ferrets might relate to the abundance and locations of rabbits in prairie dog colonies.

  19. Interacting effects of ambient temperature and food quality on the foraging ecology of small mammalian herbivores.

    Science.gov (United States)

    Camp, Meghan J; Shipley, Lisa A; Milling, Charlotte R; Rachlow, Janet L; Forbey, Jennifer S

    2018-01-01

    Both temperature and diet quality play an important role in the time and energy budgets of small mammalian herbivores. However, little is known about how temperature and diet quality interact to influence diet selection, nutrient extraction, and energetics, and how these effects might differ among species. Therefore, we examined the effects of diet quality and temperature on aspects of the foraging ecology of two species of lagomorphs, pygmy rabbits (Brachylagus idahoensis), which are small dietary specialists, and mountain cottontail rabbits (Sylvilagus nuttallii), which are larger dietary and habitat generalists. In a series of feeding experiments, we investigated 1) the effects of temperature on selection of plant fiber and the plant secondary metabolite 1,8 cineole in their diets, 2) effects of temperature and plant fiber on daily intake, digestion, and passage of food, 3) effects of plant fiber and 1,8 cineole on resting metabolic rate, and 4) how these interactions differ between the rabbit species. Both species chose to eat more total food and a greater proportion of high fiber food that passed more quickly through the digestive system in colder temperatures. However, temperature did not affect how much 1,8 cineole the rabbits consumed nor how thoroughly they digested food. Food quality affected how well they digested the dry matter in the food, but not their resting metabolic rate. Understanding how the interactions between ambient temperature and food quality affect selection of diets and intake by small mammalian herbivores, and the physiological mechanisms governing these choices, is useful for predicting how these species might respond to changes in both temperature and food quality and inform conservation and restoration strategies. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Anthropogenic Habitats Facilitate Dispersal of an Early Successional Obligate: Implications for Restoration of an Endangered Ecosystem.

    Directory of Open Access Journals (Sweden)

    Katrina E Amaral

    Full Text Available Landscape modification and habitat fragmentation disrupt the connectivity of natural landscapes, with major consequences for biodiversity. Species that require patchily distributed habitats, such as those that specialize on early successional ecosystems, must disperse through a landscape matrix with unsuitable habitat types. We evaluated landscape effects on dispersal of an early successional obligate, the New England cottontail (Sylvilagus transitionalis. Using a landscape genetics approach, we identified barriers and facilitators of gene flow and connectivity corridors for a population of cottontails in the northeastern United States. We modeled dispersal in relation to landscape structure and composition and tested hypotheses about the influence of habitat fragmentation on gene flow. Anthropogenic and natural shrubland habitats facilitated gene flow, while the remainder of the matrix, particularly development and forest, impeded gene flow. The relative influence of matrix habitats differed between study areas in relation to a fragmentation gradient. Barrier features had higher explanatory power in the more fragmented site, while facilitating features were important in the less fragmented site. Landscape models that included a simultaneous barrier and facilitating effect of roads had higher explanatory power than models that considered either effect separately, supporting the hypothesis that roads act as both barriers and facilitators at all spatial scales. The inclusion of LiDAR-identified shrubland habitat improved the fit of our facilitator models. Corridor analyses using circuit and least cost path approaches revealed the importance of anthropogenic, linear features for restoring connectivity between the study areas. In fragmented landscapes, human-modified habitats may enhance functional connectivity by providing suitable dispersal conduits for early successional specialists.

  1. Ecological survey for the siting of the Mixed and Low-Level Waste Treatment Facility and the Idaho Waste Processing Facility

    International Nuclear Information System (INIS)

    Hoskinson, R.L.

    1994-05-01

    This report summarizes the results of field ecological surveys conducted by the Center for Integrated Environmental Technologies (CIET) on the Idaho National Engineering Laboratory (INEL) at four candidate locations for the siting of the Mixed and Low-Level Waste Treatment Facility (MLLWTF) and the Idaho Waste Processing Facility (IWPF). The purpose of these surveys was to comply with all Federal laws and Executive Orders to identify and evaluate any potential environmental impacts because of the project. The boundaries of the candidate location were marked with blaze-orange lath survey marker stakes by the project management. Global Positioning System (GPS) measurements of the marker stakes were made, and input to the Arc/Info reg-sign geographic information system (GIS). Field surveys were conducted to assess any potential impact to any important species, important habitats, and to any environmental study areas. The GIS location data was overlayed onto the INEL vegetation map and an analysis of vegetation classes on the locations was done. Results of the field surveys indicate use of Candidate Location number-sign 1 by pygmy rabbits (Sylvilagus idahoensis) and expected use by them of Candidate Locations number-sign 3 and number-sign 9. Pygmy rabbits are categorized as a C2 species by the US Fish and Wildlife Service (USFWS). Two other C2 species, the ferruginous hawk (Buteo regalis) and the loggerhead shrike (Lanius ludovicianus) would also be expected to frequent the candidate locations. Candidate Location number-sign 5 at the north end of the INEL is in the winter range of a large number of pronghorn antelope (Antilocapra americana)

  2. Free-ranging farm cats: home range size and predation on a livestock unit in Northwest Georgia.

    Directory of Open Access Journals (Sweden)

    Susanna E Kitts-Morgan

    Full Text Available This study's objective was to determine seasonal and diurnal vs. nocturnal home range size, as well as predation for free-ranging farm cats at a livestock unit in Northwest Georgia. Seven adult cats were tracked with attached GPS units for up to two weeks for one spring and two summer seasons from May 2010 through August 2011. Three and five cats were tracked for up to two weeks during the fall and winter seasons, respectively. Feline scat was collected during this entire period. Cats were fed a commercial cat food daily. There was no seasonal effect (P > 0.05 on overall (95% KDE and 90% KDE or core home range size (50% KDE. Male cats tended (P = 0.08 to have larger diurnal and nocturnal core home ranges (1.09 ha compared to female cats (0.64 ha. Reproductively intact cats (n = 2 had larger (P < 0.0001 diurnal and nocturnal home ranges as compared to altered cats. Feline scat processing separated scat into prey parts, and of the 210 feline scats collected during the study, 75.24% contained hair. Of these 158 scat samples, 86 contained non-cat hair and 72 contained only cat hair. Other prey components included fragments of bone in 21.43% of scat and teeth in 12.86% of scat. Teeth were used to identify mammalian prey hunted by these cats, of which the Hispid cotton rat (Sigmodon hispidus was the primary rodent. Other targeted mammals were Peromyscus sp., Sylvilagus sp. and Microtus sp. Invertebrates and birds were less important as prey, but all mammalian prey identified in this study consisted of native animals. While the free-ranging farm cats in this study did not adjust their home range seasonally, sex and reproductive status did increase diurnal and nocturnal home range size. Ultimately, larger home ranges of free-ranging cats could negatively impact native wildlife.

  3. Sacral Variability in Tailless Species: Homo sapiens and Ochotona princeps.

    Science.gov (United States)

    Tague, Robert G

    2017-05-01

    Homo sapiens is variable in number of sacral vertebrae, and this variability can lead to obstetrical complication. This study uses the comparative method to test the hypothesis that sacral variability in H. sapiens is associated with absence of a tail. Three species of lagomorphs are studied: Ochotona princeps (N = 271), which is tailless, and Lepus californicus (N = 212) and Sylvilagus audubonii (N = 206), which have tails. Results show that O. princeps has (1) higher diversity index for number of sacral vertebrae (0.49) compared to L. californicus (0.25) and S. audubonii (0.26) and (2) significantly higher percentage of individuals with the species-specific nonmodal number of sacral vertebrae (43.9%) compared to L. californicus (14.2%) and S. audubonii (15.5%). Comparison of H. sapiens (N = 1,030; individuals of age 20-39 years) with O. princeps shows similarities between the species in diversity index (also 0.49 in H. sapiens) and percentage of individuals with nonmodal number of sacral vertebrae (37.3% in H. sapiens). Homeotic transformation best explains the results. H. sapiens and O. princeps show propensity for caudal shift at the sacral-caudal border (i.e., homeotic transformation of the first caudal vertebra to a sacral vertebra). Caudal and cranial shift among presacral vertebrae increases or decreases this propensity, respectively. Increase in number of sacral vertebrae in H. sapiens by homeotic transformation reduces pelvic outlet capacity and can be obstetrically hazardous. Anat Rec, 300:798-809, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  4. Reduced population variance in strontium isotope values informs domesticated turkey use at Chaco Canyon, New Mexico, USA

    Science.gov (United States)

    Grimstead, Deanna N; Reynolds, Amanda C; Hudson, Adam M; Akins, Nancy J; Betancourt, Julio L.

    2016-01-01

    Traditionally strontium isotopes (87Sr/86Sr) have been used as a sourcing tool in numerous archaeological artifact classes. The research presented here demonstrates that 87Sr/86Srbioapatite ratios also can be used at a population level to investigate the presence of domesticated animals and methods of management. The proposed methodology combines ecology, isotope geochemistry, and behavioral ecology to assess the presence and nature of turkey (Meleagris gallopavo) domestication. This case study utilizes 87Sr/86Srbioapatite ratios from teeth and bones of archaeological turkey, deer (Odocoileus sp.), lagomorph (Lepus sp. and Sylvilagus sp.), and prairie-dog (Cynomys sp.) from Chaco Canyon, New Mexico, U.S.A. (ca. A.D. 800 – 1250). Wild deer and turkey from the southwestern U.S.A. have much larger home ranges and dispersal behaviors (measured in kilometers) when compared to lagomorphs and prairie dogs (measured in meters). Hunted deer and wild turkey from archaeological contexts at Chaco Canyon are expected to have a higher variance in their 87Sr/86Srbioapatite ratios, when compared to small range taxa (lagomorphs and prairie dogs). Contrary to this expectation, 87Sr/86Srbioapatite values of turkey bones from Chacoan assemblages have a much lower variance than deer and are similar to that of smaller mammals. The sampled turkey values show variability most similar to lagomorphs and prairie dogs, suggesting the turkeys from Chaco Canyon were consuming a uniform diet and/or were constrained within a limited home range, indicating at least proto-domestication. The population approach has wide applicability for evaluating the presence and nature of domestication when combined with paleoecology and behavioral ecology in a variety of animals and environments.

  5. Co‐occurrence dynamics of endangered Lower Keys marsh rabbits and free‐ranging domestic cats: Prey responses to an exotic predator removal program

    Science.gov (United States)

    Cove, Michael V.; Gardner, Beth; Simons, Theodore R.; O'Connell, Allan F.

    2018-01-01

    The Lower Keys marsh rabbit (Sylvilagus palustris hefneri) is one of many endangered endemic species of the Florida Keys. The main threats are habitat loss and fragmentation from sea‐level rise, development, and habitat succession. Exotic predators such as free‐ranging domestic cats (Felis catus) pose an additional threat to these endangered small mammals. Management strategies have focused on habitat restoration and exotic predator control. However, the effectiveness of predator removal and the effects of anthropogenic habitat modifications and restoration have not been evaluated. Between 2013 and 2015, we used camera traps to survey marsh rabbits and free‐ranging cats at 84 sites in the National Key Deer Refuge, Big Pine Key, Florida, USA. We used dynamic occupancy models to determine factors associated with marsh rabbit occurrence, colonization, extinction, and the co‐occurrence of marsh rabbits and cats during a period of predator removal. Rabbit occurrence was positively related to freshwater habitat and patch size, but was negatively related to the number of individual cats detected at each site. Furthermore, marsh rabbit colonization was negatively associated with relative increases in the number of individual cats at each site between survey years. Cat occurrence was negatively associated with increasing distance from human developments. The probability of cat site extinction was positively related to a 2‐year trapping effort, indicating that predator removal reduced the cat population. Dynamic co‐occurrence models suggested that cats and marsh rabbits co‐occur less frequently than expected under random conditions, whereas co‐detections were site and survey‐specific. Rabbit site extinction and colonization were not strongly conditional on cat presence, but corresponded with a negative association. Our results suggest that while rabbits can colonize and persist at sites where cats occur, it is the number of individual cats at a site that

  6. Free-Ranging Farm Cats: Home Range Size and Predation on a Livestock Unit In Northwest Georgia

    Science.gov (United States)

    Kitts-Morgan, Susanna E.; Caires, Kyle C.; Bohannon, Lisa A.; Parsons, Elizabeth I.; Hilburn, Katharine A.

    2015-01-01

    This study’s objective was to determine seasonal and diurnal vs. nocturnal home range size, as well as predation for free-ranging farm cats at a livestock unit in Northwest Georgia. Seven adult cats were tracked with attached GPS units for up to two weeks for one spring and two summer seasons from May 2010 through August 2011. Three and five cats were tracked for up to two weeks during the fall and winter seasons, respectively. Feline scat was collected during this entire period. Cats were fed a commercial cat food daily. There was no seasonal effect (P > 0.05) on overall (95% KDE and 90% KDE) or core home range size (50% KDE). Male cats tended (P = 0.08) to have larger diurnal and nocturnal core home ranges (1.09 ha) compared to female cats (0.64 ha). Reproductively intact cats (n = 2) had larger (P cats. Feline scat processing separated scat into prey parts, and of the 210 feline scats collected during the study, 75.24% contained hair. Of these 158 scat samples, 86 contained non-cat hair and 72 contained only cat hair. Other prey components included fragments of bone in 21.43% of scat and teeth in 12.86% of scat. Teeth were used to identify mammalian prey hunted by these cats, of which the Hispid cotton rat (Sigmodon hispidus) was the primary rodent. Other targeted mammals were Peromyscus sp., Sylvilagus sp. and Microtus sp. Invertebrates and birds were less important as prey, but all mammalian prey identified in this study consisted of native animals. While the free-ranging farm cats in this study did not adjust their home range seasonally, sex and reproductive status did increase diurnal and nocturnal home range size. Ultimately, larger home ranges of free-ranging cats could negatively impact native wildlife. PMID:25894078

  7. Response of early Paleogene nannofossils to periodically increased nutrient availability in the NE Peri-Tethys

    Science.gov (United States)

    Shcherbinina, Ekaterina

    2010-05-01

    ) shows dramatic change from assemblage dominated by Discoaster, elliptical Coccolithus (C. pelagicus) and, to a lesser extend, Chiasmolithus to assemblage highly enriched in Reticulofenestra, Dictyococcites and round Coccolithus (Cyclicargolithus floridanus), when discoasters reduce but still persist while chiasmoliths and Zygrhablithus bijugatus become extremely poor. This pattern in nannofossil distribution during periods of enhanced nutrient input in the basin provides information for better understanding paleoecological affinities of nannofossil taxa. Thus, Discoaster, Toweius and Fasciculithus appeared to be warm water mesotrophic/eutrophic genera, warm water Sphenolithus and cool water Chiasmolithus, as well as Zygrhablithus bijugatus, seem to prefer oligotrophic conditions. Reticulofenestra and, possibly, Cyclicargolithus floridanus are more likely euritopic genera and their paleoecological affinity seems to be similar to Mesozoic Watznaueria thrived under a large spectrum of environments. This conclusion contrasts to recent interpretation of discoasters as warm oligotrophic taxon and chiasmoliths as cool eutrophic taxon (Aubry, 1998; Bralower, 2002). Dramatic decline of Chiasmolithus with the onset of enhanced nutrient input under both warm and cool climatic conditions does not support this suggestion or the only assumption can be made considering chiasmoliths as relatively deep dwellers affected by anoxia corresponding TOC-rich sediment accumulation in the shallow epeiric basin of NE Peri-Tethys. Supported by RFBR Project no. 09-05-00872.

  8. Micropaleontological data (dinocysts, nannoplankton, spores and pollen) and biostratigraphy of the Alkun Formation, North Ossetia

    Science.gov (United States)

    Filippova, N. Yu.; Beluzhenko, E. V.; Golovina, L. A.

    2010-06-01

    The initially obtained data characterize organic-walled phytoplankton (dinocysts), nannoplankton, spores, and pollen from the Upper Argun, Alkun, and Lower Assa deposits of the Fiagdon and Mairamadag sections situated on the southeast of North Ossetia (North Caucasus) in the Alkun Formation stratotype area. The lithology of the formation is described, and its position in the Oligocene-Miocene succession is considered. According to the analyzed data on organic-walled phytoplankton from the Fiagdon and Mairamadag sections, the transitional late Oligocene-early Miocene dinoflora from the top of the Argun Formation and the lower part of the Alkun Formation is in general of the Miocene aspect. Based on the dinocysts, deposits from the upper part of the Alkun Formation coupled with the Assa Formation are attributed to the lower Miocene. The entire interval of the studied deposits corresponds to the acme subzone Def of the Ebu Zone in the Mediterranean dinocyst zonation by D. Zevenboom, where it spans the top of the Chattian and lower part of the Aquitanian Stage. Nannoplankton assemblages from the Alkun deposits are tentatively correlated with the nannoplankton assemblage of Zone NN1 in the standard zonation by E. Martini. It is impossible to date precisely the Alkun Formation based on nannoplankton, as the respective deposits are lacking index species and characteristic taxa of the standard zonation. The dominance of the cosmopolitan species Cyclicargolithus floridanus is a peculiar feature of nannoplankton assemblages from the Alkun Formation. Palynological data are used to consider the dynamics of the evolution of the vegetation cover and climate. Four episodes of relative cooling are distinguished against a background of warm-temperate climatic conditions in general. The most significant episodes occurred in the mid-Alkun time and during the early phase of the Assa time.

  9. Parasites of native and nonnative fishes of the Little Colorado River, Grand Canyon, Arizona

    Science.gov (United States)

    Choudhury, A.; Hoffnagle, T.L.; Cole, Rebecca A.

    2004-01-01

    A 2-yr, seasonal, parasitological study of 1,435 fish, belonging to 4 species of native fishes and 7 species of nonnative fishes from the lower Little Colorado River (LCR) and tributary creeks, Grand Canyon, Arizona, yielded 17 species of parasites. These comprised 1 myxozoan (Henneguya exilis), 2 copepods (Ergasilus arthrosis and Lernaea cyprinacea), 1 acarine (Oribatida gen. sp.), 1 piscicolid leech (Myzobdella lugubris), 4 monogeneans (Gyrodactylus hoffmani, Gyrodactylus sp., Dactylogyrus extensus, and Ligictaluridus floridanus), 4 nematodes (Contracaecum sp., Eustrongylides sp., Rhabdochona sp., and Truttaedacnitis truttae), 3 cestodes (Bothriocephalus acheilognathi, Corallobothrium fimbriatum, and Megathylacoides giganteum), and 2 trematodes (Ornithodiplostomum sp. and Posthodiplostomum sp.). Rhabdochona sp. was the only adult parasite native to the LCR. Infection intensities of Ornithodiplostomum sp. and B. acheilognathi were positively correlated with length of the humpback chub Gila cypha. Adult helminths showed a high degree of host specificity, except B. acheilognathi, which was recovered from all fish species examined but was most abundant in cyprinids. Abundance of B. acheilognathi in the humpback chub was highest in the fall and lowest in the summer in both reaches of the LCR. There was no major taxonomic difference in parasite assemblages between the 2 different reaches of the river (LC1 and LC2). Parasite community diversity was very similar in humpback chub, regardless of sampling site or time. The parasite fauna of the LCR is numerically dominated by B. acheilognathi and metacercariae of Ornithodiplostomum sp. The richest and most diverse component community occurred in a nonnative species, the channel catfish Ictalurus punctatus, but infracommunity species richness was highest in a native host, humpback chub.

  10. Microhabitat features influencing habitat use by Florida black bears

    Directory of Open Access Journals (Sweden)

    Dana L. Karelus

    2018-01-01

    Full Text Available Understanding fine-scale habitat needs of species and the factors influencing heterogeneous use of habitat within home range would help identify limiting resources and inform habitat management practices. This information is especially important for large mammals living in fragmented habitats where resources may be scarcer and more patchily distributed than in contiguous habitats. Using bihourly Global Position System (GPS location data collected from 10 individuals during 2011–2014, we investigated microhabitat features of areas within home ranges that received high vs. low intensity of use by Florida black bears (Ursus americanus floridanus in north-central, Florida. We identified areas receiving high and low levels of use by bears based on their utilization distributions estimated with the dynamic Brownian bridge movement model, and performed vegetation sampling at bear locations within high- and low-use areas. Using univariate analyses and generalized linear mixed models, we found that (1 canopy cover, visual obstruction, and hardwood density were important in defining high-use sites; (2 the probability of high use was positively associated with principal components that represented habitat closer to creeks and with high canopy and shrub cover and higher hardwood densities, likely characteristic of forested wetlands; and (3 the probability of high use was, to a lesser extent, associated with principal components that represented habitat with high canopy cover, high pine density, and low visual obstruction and hardwood density; likely representing sand pine and pine plantations. Our results indicate that the high bear-use sites were in forested wetlands, where cover and food resources for bears are likely to occur in higher abundance. Habitat management plans whereby bears are a focal species should aim to increase the availability and quality of forested wetlands. Keywords: Habitat selection, Heterogeneous habitat use, Forest management

  11. Consequences of severe habitat fragmentation on density, genetics, and spatial capture-recapture analysis of a small bear population.

    Directory of Open Access Journals (Sweden)

    Sean M Murphy

    Full Text Available Loss and fragmentation of natural habitats caused by human land uses have subdivided several formerly contiguous large carnivore populations into multiple small and often isolated subpopulations, which can reduce genetic variation and lead to precipitous population declines. Substantial habitat loss and fragmentation from urban development and agriculture expansion relegated the Highlands-Glades subpopulation (HGS of Florida, USA, black bears (Ursus americanus floridanus to prolonged isolation; increasing human land development is projected to cause ≥ 50% loss of remaining natural habitats occupied by the HGS in coming decades. We conducted a noninvasive genetic spatial capture-recapture study to quantitatively describe the degree of contemporary habitat fragmentation and investigate the consequences of habitat fragmentation on population density and genetics of the HGS. Remaining natural habitats sustaining the HGS were significantly more fragmented and patchier than those supporting Florida's largest black bear subpopulation. Genetic diversity was low (AR = 3.57; HE = 0.49 and effective population size was small (NE = 25 bears, both of which remained unchanged over a period spanning one bear generation despite evidence of some immigration. Subpopulation density (0.054 bear/km2 was among the lowest reported for black bears, was significantly female-biased, and corresponded to a subpopulation size of 98 bears in available habitat. Conserving remaining natural habitats in the area occupied by the small, genetically depauperate HGS, possibly through conservation easements and government land acquisition, is likely the most important immediate step to ensuring continued persistence of bears in this area. Our study also provides evidence that preferentially placing detectors (e.g., hair traps or cameras primarily in quality habitat across fragmented landscapes poses a challenge to estimating density-habitat covariate relationships using spatial

  12. Phylogeographic Analyses of American Black Bears (Ursus americanus) Suggest Four Glacial Refugia and Complex Patterns of Postglacial Admixture.

    Science.gov (United States)

    Puckett, Emily E; Etter, Paul D; Johnson, Eric A; Eggert, Lori S

    2015-09-01

    Studies of species with continental distributions continue to identify intraspecific lineages despite continuous habitat. Lineages may form due to isolation by distance, adaptation, divergence across barriers, or genetic drift following range expansion. We investigated lineage diversification and admixture within American black bears (Ursus americanus) across their range using 22 k single nucleotide polymorphisms and mitochondrial DNA sequences. We identified three subcontinental nuclear clusters which we further divided into nine geographic regions: Alaskan (Alaska-East), eastern (Central Interior Highlands, Great Lakes, Northeast, Southeast), and western (Alaska-West, West, Pacific Coast, Southwest). We estimated that the western cluster diverged 67 ka, before eastern and Alaskan divergence 31 ka; these divergence dates contrasted with those from the mitochondrial genome where clades A and B diverged 1.07 Ma, and clades A-east and A-west diverged 169 ka. We combined estimates of divergence timing with hindcast species distribution models to infer glacial refugia for the species in Beringia, Pacific Northwest, Southwest, and Southeast. Our results show a complex arrangement of admixture due to expansion out of multiple refugia. The delineation of the genomic population clusters was inconsistent with the ranges for 16 previously described subspecies. Ranges for U. a. pugnax and U. a. cinnamomum were concordant with admixed clusters, calling into question how to order taxa below the species level. Additionally, our finding that U. a. floridanus has not diverged from U. a. americanus also suggests that morphology and genetics should be reanalyzed to assess taxonomic designations relevant to the conservation management of the species. © The Author 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution. All rights reserved.For permissions please email: journals.permissions@oup.com.

  13. Thysanoptera (thrips) within citrus orchards in Florida: species distribution, relative and seasonal abundance within trees, and species on vines and ground cover plants.

    Science.gov (United States)

    Childers, Carl C; Nakahara, Sueo

    2006-01-01

    Seven citrus orchards on reduced to no pesticide spray programs were sampled for Thysanoptera in central and south central Florida. Inner and outer canopy leaves, fruits, twigs, trunk scrapings, vines and ground cover plants were sampled monthly between January 1995 and January 1996. Thirty-six species of thrips were identified from 2,979 specimens collected from within citrus tree canopies and 18,266 specimens from vines and ground cover plants within the seven citrus orchards. The thrips species included seven predators [Aleurodothrips fasciapennis (Franklin), Karnyothrips flavipes (Jones), K. melaleucus (Bagnall), Leptothrips cassiae (Watson), L. macroocellatus (Watson), L. pini (Watson), and Scolothrips sexmaculatus (Pergande)] 21 plant feeding species [Anaphothrips n. sp., Arorathrips mexicanus (Crawford), Aurantothrips orchidaceous (Bagnall), Baileyothrips limbatus (Hood), Chaetanaphothrips orchidii (Moulton), Danothrips trifasciatus (Sakimura), Echinothrips americanus (Morgan), Frankliniella bispinosa (Morgan), F. cephalica (Crawford), F. fusca (Hinds), F. gossypiana (Hood), Frankliniella sp. (runneri group), Haplothrips gowdeyi (Franklin), Heliothrips haemorrhoidalis (Bouché), Leucothrips piercei (Morgan), Microcephalothrips abdominalis (Crawford), Neohydatothrips floridanus (Watson), N. portoricensis (Morgan), Pseudothrips inequalis (Beach), Scirtothrips sp., and Thrips hawaiiensis (Morgan)]; and eight fungivorous feeding species [Adraneothrips decorus (Hood), Hoplandrothrips pergandei (Hinds), Idolothripinae sp., Merothrips floridensis (Watson), M. morgani (Hood), Neurothrips magnafemoralis (Hinds), Stephanothrips occidentalis Hood and Williams, and Symphyothrips sp.]. Only F. bispinosa, C. orchidii, D. trifasciatus, and H. haemorrhoidalis have been considered economic pests on Florida citrus. Scirtothrips sp. and T. hawaiiensis were recovered in low numbers within Florida citrus orchards. Both are potential pest species to citrus and possibly other

  14. DIAGNÓSTICO TAXONÓMICO DE LA FAMILIA TENUIPALPIDAE (ACARI: TETRANYCHOIDEA EN EL VALLE DEL CAUCA (COLOMBIA

    Directory of Open Access Journals (Sweden)

    Mesa Nora Cristina

    2013-07-01

    Full Text Available Varias especies de ácaros de la familia Tenuipalpidae, especialmente las del géneroBrevipalpus Donnadieu, son reconocidas como vectores de enfermedades viralesen diferentes cultivos comerciales. La falta de estudios taxonómicos en esta familiade ácaros en Colombia y la posibilidad de introducir en forma accidental especiesde estos ácaros planos, son una amenaza para la bioseguridad de la producciónfrutícola del país. El objetivo de este trabajo es contribuir a la identificación de lasespecies de Tenuipalpidae en la vegetación silvestre y cultivada en el departamentodel Valle del Cauca y confirmar la identidad taxonómica de las especies deBrevipalpus en cítricos, guayaba, maracuyá, café y orquídeas. Las recoleccionesde ejemplares se realizaron en épocas seca y lluviosa en varios municipios deldepartamento. El montaje de los ácaros se realizó en medio Hoyer. La especiepredominante en todas las localidades y en los hospedantes recolectados fueBrevipalpus phoenicis Geijskes (1939. Por el contrario, B. obovatus Donnadieuse encontró en poblaciones muy bajas en limón Tahití y mandarina en algunaslocalidades de Palmira. Tenuipalpus anacardii De León se presentó en Anacardiumexcelsum (Bertero y Balb. ex Kunth Skeels, en el municipio de Roldanillo y T.pacificus Baker se encontró en el corregimiento de Rozo, municipio de Palmira,sobre plantas importadas de un cultivo comercial de Dendrobium sp., mientrasque Dolichotetranychus floridanus (Banks solamente se encontró sobre Ananascomosus (L. Merr., en muestras recolectadas en Cali

  15. The formation placement and palaeoenvironment of the Middle Miocene Los Atajos Member, Trinidad

    Science.gov (United States)

    Wilson, Brent; Farfan, Philip; Hughes, Chantelle

    2017-07-01

    The age, palaeoenvironment and formation placement of the conglomeratic Los Atajos Member of central Trinidad have long been unclear. Seven samples (four from calcareous silts near the member's base exposed by building work at the Los Atajos Community Centre, and three from the underlying calcareous claystones of the Brasso Formation) were examined for calcareous microfossils. These indicate a conformable succession encompassing an overall regression. The oldest of the claystone samples, of uppermost early Middle Miocene Globorotalia fohsi fohsi Zone age (N11), contained an upper bathyal benthic foraminiferal assemblage, while the younger claystone samples yielded abundant, shallow neritic Hanzawaia carstensi. The recovery of the planktonic foraminifera Globorotalia mayeri but absence of Globigerinoides subquadratus suggest a Middle Miocene age (Globorotalia mayeri planktonic foraminiferal Zone; N14) for both the uppermost Brasso claystone sample and the Los Atajos Member. The benthic foraminiferal fauna in the Los Atajos is dominated by Rosalina subaraucana, with subdominant Cibicides ex gr. aknerianus and C. floridanus sensu Galloway and Heminway, and common Elphidium spp. This faunal succession has a close affinity with that of parts of the Lower to Middle Miocene Brasso Formation, especially the N10 Guaracara Limestone Member and the clays on which it sits. However, the Los Atajos Member assemblage differs markedly from that of the overlying Late Miocene San José Calcareous Silt Member of the Manzanilla Formation, from which the Los Atajos is separated by an unconformity of Globorotalia menardii (N15) Zone age. On these grounds, the Los Atajos Member is here placed within the Brasso Formation. The low diversity, high dominance benthic foraminiferal fauna and the associated ostracod assemblage in the Los Atajos are indicative of inner to shallower middle neritic palaeodepths in a carbonate-prone palaeoenvironment with marine vegetation and strong current action

  16. Evidence for and geomorphologic consequences of a reptilian ecosystem engineer: The burrowing cascade initiated by the Gopher Tortoise

    Science.gov (United States)

    Kinlaw, A.; Grasmueck, M.

    2012-07-01

    Physical ecosystem engineers often make major, durable physical constructs that can provide living space for other species and can structure local animal communities over evolutionary time. In Florida, a medium sized chelonian, the Gopher Tortoise (Gopherus polyphemus) will excavate extensive subterranean chambers that can endure for long periods of time. The tortoise starts a 'burrowing cascade', by first excavating a larger burrow that may extend 10 m, which is then re-engineered by Florida Mice (Podomys floridanus) and other rodents that dig smaller side-burrows and pockets. This sequence is often followed by an invertebrate, the camel cricket (Ceuthophilus labibuli) which is reported to excavate even smaller chambers. Our first aim was to quantify the zoogeomorphic impact of this burrowing cascade by measuring the amount of soil excavated in a large sample of burrows in two communities. Secondly, we hypothesized that the high biodiversity reported for these structures might be related to the quasi-fractal nature of the geometry, following the work of Frontier (1987). To visualize this underground geometry, we used high-resolution 3D Ground Penetrating Radar (GPR), which provided images and insights previously unobtainable using excavations or 2D GPR. Our images verified that the active tortoise burrow had a spiraling shape, but also showed splits in the larger burrow apparently dug by tortoises. For the first time, the smaller Florida Mouse burrows were imaged, showing side loops that exit and re-renter the tortoise burrow. This study also presents new information by making the discovery of numerous remnants of past tortoise burrows underground in the sampling grid surrounding the active burrow. Our third aim was to interpret our field results with previous ecological field studies to evaluate the strength of evidence that this species ranks as an ecosystem engineer.

  17. Friends and foes from an ant brain's point of view--neuronal correlates of colony odors in a social insect.

    Science.gov (United States)

    Brandstaetter, Andreas Simon; Rössler, Wolfgang; Kleineidam, Christoph Johannes

    2011-01-01

    Successful cooperation depends on reliable identification of friends and foes. Social insects discriminate colony members (nestmates/friends) from foreign workers (non-nestmates/foes) by colony-specific, multi-component colony odors. Traditionally, complex processing in the brain has been regarded as crucial for colony recognition. Odor information is represented as spatial patterns of activity and processed in the primary olfactory neuropile, the antennal lobe (AL) of insects, which is analogous to the vertebrate olfactory bulb. Correlative evidence indicates that the spatial activity patterns reflect odor-quality, i.e., how an odor is perceived. For colony odors, alternatively, a sensory filter in the peripheral nervous system was suggested, causing specific anosmia to nestmate colony odors. Here, we investigate neuronal correlates of colony odors in the brain of a social insect to directly test whether they are anosmic to nestmate colony odors and whether spatial activity patterns in the AL can predict how odor qualities like "friend" and "foe" are attributed to colony odors. Using ant dummies that mimic natural conditions, we presented colony odors and investigated their neuronal representation in the ant Camponotus floridanus. Nestmate and non-nestmate colony odors elicited neuronal activity: In the periphery, we recorded sensory responses of olfactory receptor neurons (electroantennography), and in the brain, we measured colony odor specific spatial activity patterns in the AL (calcium imaging). Surprisingly, upon repeated stimulation with the same colony odor, spatial activity patterns were variable, and as variable as activity patterns elicited by different colony odors. Ants are not anosmic to nestmate colony odors. However, spatial activity patterns in the AL alone do not provide sufficient information for colony odor discrimination and this finding challenges the current notion of how odor quality is coded. Our result illustrates the enormous challenge

  18. Ocorrência e recrutamento larval de Teredinidae (Mollusca, Bivalvia na região do Sistema Costeiro Cananéia-Iguape, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Daniela T. de Moraes

    2015-03-01

    Full Text Available A ocorrência e o recrutamento larval de Teredinidae na região do Sistema Costeiro Cananéia-Iguape foram acompanhados por doze meses utilizando-se coletores laminados de pinho, instalados em três estações dentro do bosque de mangue (mediolitoral e em uma estação, localizada no infralitoral. No manguezal, a colonização por larvas de teredinídeos ocorreu após quatro meses de permanência dos coletores na estação mais frequentemente inundada pela maré e somente após oito meses nas duas estações com menor frequência de inundação. No infralitoral, após quatro meses, os coletores já estavam consideravelmente danificados. Ao longo do experimento, houve um decréscimo no número de teredinídeos, especialmente no infralitoral, ocasionado possivelmente pela competição por alimento e espaço entre teredinídeos e foladídeos. Foram encontrados 2.658 indivíduos, sendo 704 de Teredinidae e 1.954 de Pholadidae. Entre os teredinídeos, Bankia fimbriatula foi a espécie mais abundante tanto no infralitoral quanto no manguezal, seguida de Bankia gouldi e Lyrodus floridanus que ocorreram somente no infralitoral, e Nausitora fusticula encontrada somente no manguezal. Martesia striata, único foladídeo, ocorreu somente no infralitoral.

  19. Consequences of severe habitat fragmentation on density, genetics, and spatial capture-recapture analysis of a small bear population.

    Science.gov (United States)

    Murphy, Sean M; Augustine, Ben C; Ulrey, Wade A; Guthrie, Joseph M; Scheick, Brian K; McCown, J Walter; Cox, John J

    2017-01-01

    Loss and fragmentation of natural habitats caused by human land uses have subdivided several formerly contiguous large carnivore populations into multiple small and often isolated subpopulations, which can reduce genetic variation and lead to precipitous population declines. Substantial habitat loss and fragmentation from urban development and agriculture expansion relegated the Highlands-Glades subpopulation (HGS) of Florida, USA, black bears (Ursus americanus floridanus) to prolonged isolation; increasing human land development is projected to cause ≥ 50% loss of remaining natural habitats occupied by the HGS in coming decades. We conducted a noninvasive genetic spatial capture-recapture study to quantitatively describe the degree of contemporary habitat fragmentation and investigate the consequences of habitat fragmentation on population density and genetics of the HGS. Remaining natural habitats sustaining the HGS were significantly more fragmented and patchier than those supporting Florida's largest black bear subpopulation. Genetic diversity was low (AR = 3.57; HE = 0.49) and effective population size was small (NE = 25 bears), both of which remained unchanged over a period spanning one bear generation despite evidence of some immigration. Subpopulation density (0.054 bear/km2) was among the lowest reported for black bears, was significantly female-biased, and corresponded to a subpopulation size of 98 bears in available habitat. Conserving remaining natural habitats in the area occupied by the small, genetically depauperate HGS, possibly through conservation easements and government land acquisition, is likely the most important immediate step to ensuring continued persistence of bears in this area. Our study also provides evidence that preferentially placing detectors (e.g., hair traps or cameras) primarily in quality habitat across fragmented landscapes poses a challenge to estimating density-habitat covariate relationships using spatial capture

  20. New records of stink bugs (Hemiptera: Pentatomidae) from Colombia.

    Science.gov (United States)

    Castro-Huertas, Valentina; Schwertner, Cristiano F; Fernández, Fernando

    2015-06-18

    New records of genera and species of stink bugs (Hemiptera: Pentatomidae) from Colombia are provided. Two genera are new records for South America: Alathetus and Schraderiellus. Fifteen genera are new record for Colombia: Agaclitus, Boea, Ceratozygum, Euthyrhynchus, Eritrachys, Doesburguedessa, Lopadusa, Marmessulus, Paralincus, Patanius, Peromatus, Phalaecus, Phoeacia, Rio, and Tyrannocoris. Forty-nine species from five subfamiles are recorded for the first time in Colombia. Asopinae: Coryzorhaphis carneolus Erichson, Coryzorhaphis superba Breddin, Euthyrhynchus floridanus (Linnaeus), Podisus sagitta Fabricius, Stiretrus anchorago (Fabricius), Stiretrus cinctellus Germar, Tylospilus peruvianus Horvath, Tyrannocoris nigriceps Thomas. Cyrtocorinae: Ceratozygum horridum (Germar). Discocephalinae: Agaclitus dromedarius Stål, Antiteuchus melanoleucus (Westwood), Antiteuchus sepulcralis (Fabricius), Dinocoris gibbosus (Fallou), Dinocoris variolosus (Linnaeus), Discocephalessa terminalis (Walker), Dryptocephala crenata Ruckes, Dryptocephala dentifrons (Latreille), Eurystethus ovalis Ruckes, Paralcippus dimidiatus (Ruckes), Alathetus rufitarsus Dallas, Eritrachys bituberculata Ruckes, Paralincus bimaculatus (Ruckes), Schraderiellus cinctus (Ruckes), Xynocoris recavus (Garbelotto & Campos). Edessinae: Brachystethus cribus (Fabricius), Brachystethus tricolor Bolívar, Doesburguedessa elongatispina Fernandes and Lopadusa fuscopunctata (Distant). Pentatominae: Banasa fulgida Thomas, Banasa paraexpallescens Thomas, Dichelops divisus (Walker), Dichelops nigrum Bergroth, Euschistus carbonerus Rolston, Mormidea bovilla (Distant), Mormidea triangularis (Walker), Murgantia bifasciata Herrich-Schaeffer, Murgantia violascens (Westwood), Oebalus pugnax (Fabricius), Oebalus ypsilon-griseus (DeGeer), Odmalea concolor (Walker), Patanius vittatus Rolston, Proxys albopunctulatus (Palisot), Proxys punctulatus (Palisot), Rhyncholepta grandicallosa Bergroth, Rio insularis Ruckes, Roferta

  1. Medium-Sized Mammals around a Radioactive Liquid Waste Lagoon at Los Alamos National Laboratory: Uptake of Contaminants and Evaluation of Radio-Frequency Identification Technology

    Energy Technology Data Exchange (ETDEWEB)

    Leslie A. Hansen; Phil R. Fresquez; Rhonda J. Robinson; John D. Huchton; Teralene S. Foxx

    1999-11-01

    Use of a radioactive liquid waste lagoon by medium-sized mammals and levels of tritium, other selected radionuclides, and metals in biological tissues of the animals were documented at Technical Area 53 (TA-53) of Los Alamos National Laboratory during 1997 and 1998. Rock squirrel (Spermophilus variegates), raccoon (Procyon lotor), striped skunk (Mephitis mephitis), and bobcat (Lynx rufus) were captured at TA-53 and at a control site on the Santa Fe National Forest. Captured animals were anesthetized and marked with radio-frequency identification (RFD) tags and/or ear tags. We collected urine and hair samples for tritium and metals (aluminum, antimony, arsenic, barium, beryllium, cadmium, chromium, copper, lead, mercury, nickel, selenium, silver, and thallium) analyses, respectively. In addition, muscle and bone samples from two rock squirrels collected from each of TA-53, perimeter, and regional background sites were tested for tritium, {sup 137}Cs, {sup 90}Sr, {sup 238}Pu, {sup 239,240}Pu, {sup 241}Am, and total uranium. Animals at TA-53 were monitored entering and leaving the lagoon area using a RFID monitor to read identification numbers from the RFID tags of marked animals and a separate camera system to photograph all animals passing through the monitor. Cottontail rabbit (Sylvilagus spp.), rock squirrel, and raccoon were the species most frequently photographed going through the RFID monitor. Less than half of all marked animals in the lagoon area were detected using the lagoon. Male and female rock squirrels from the lagoon area had significantly higher tritium concentrations compared to rock squirrels from the control area. Metals tested were not significantly higher in rock squirrels from TA-53, although there was a trend toward increased levels of lead in some individuals at TA-53. Muscle and bone samples from squirrels in the lagoon area appeared to have higher levels of tritium, total uranium, and {sup 137}Cs than samples collected from perimeter and

  2. Weather and Prey Predict Mammals' Visitation to Water.

    Directory of Open Access Journals (Sweden)

    Grant Harris

    Full Text Available Throughout many arid lands of Africa, Australia and the United States, wildlife agencies provide water year-round for increasing game populations and enhancing biodiversity, despite concerns that water provisioning may favor species more dependent on water, increase predation, and reduce biodiversity. In part, understanding the effects of water provisioning requires identifying why and when animals visit water. Employing this information, by matching water provisioning with use by target species, could assist wildlife management objectives while mitigating unintended consequences of year-round watering regimes. Therefore, we examined if weather variables (maximum temperature, relative humidity [RH], vapor pressure deficit [VPD], long and short-term precipitation and predator-prey relationships (i.e., prey presence predicted water visitation by 9 mammals. We modeled visitation as recorded by trail cameras at Sevilleta National Wildlife Refuge, New Mexico, USA (June 2009 to September 2014 using generalized linear modeling. For 3 native ungulates, elk (Cervus Canadensis, mule deer (Odocoileus hemionus, and pronghorn (Antilocapra americana, less long-term precipitation and higher maximum temperatures increased visitation, including RH for mule deer. Less long-term precipitation and higher VPD increased oryx (Oryx gazella and desert cottontail rabbits (Sylvilagus audubonii visitation. Long-term precipitation, with RH or VPD, predicted visitation for black-tailed jackrabbits (Lepus californicus. Standardized model coefficients demonstrated that the amount of long-term precipitation influenced herbivore visitation most. Weather (especially maximum temperature and prey (cottontails and jackrabbits predicted bobcat (Lynx rufus visitation. Mule deer visitation had the largest influence on coyote (Canis latrans visitation. Puma (Puma concolor visitation was solely predicted by prey visitation (elk, mule deer, oryx. Most ungulate visitation peaked during

  3. Mechanisms of social regulation change across colony development in an ant.

    Science.gov (United States)

    Moore, Dani; Liebig, Jürgen

    2010-10-27

    Mutual policing is an important mechanism for reducing conflict in cooperative groups. In societies of ants, bees, and wasps, mutual policing of worker reproduction can evolve when workers are more closely related to the queen's sons than to the sons of workers or when the costs of worker reproduction lower the inclusive fitness of workers. During colony growth, relatedness within the colony remains the same, but the costs of worker reproduction may change. The costs of worker reproduction are predicted to be greatest in incipient colonies. If the costs associated with worker reproduction outweigh the individual direct benefits to workers, policing mechanisms as found in larger colonies may be absent in incipient colonies. We investigated policing behaviour across colony growth in the ant Camponotus floridanus. In large colonies of this species, worker reproduction is policed by the destruction of worker-laid eggs. We found workers from incipient colonies do not exhibit policing behaviour, and instead tolerate all conspecific eggs. The change in policing behaviour is consistent with changes in egg surface hydrocarbons, which provide the informational basis for policing; eggs laid by queens from incipient colonies lack the characteristic hydrocarbons on the surface of eggs laid by queens from large colonies, making them chemically indistinguishable from worker-laid eggs. We also tested the response to fertility information in the context of queen tolerance. Workers from incipient colonies attacked foreign queens from large colonies; whereas workers from large colonies tolerated such queens. Workers from both incipient and large colonies attacked foreign queens from incipient colonies. Our results provide novel insights into the regulation of worker reproduction in social insects at both the proximate and ultimate levels. At the proximate level, our results show that mechanisms of social regulation, such as the response to fertility signals, change dramatically over

  4. Mechanisms of social regulation change across colony development in an ant

    Directory of Open Access Journals (Sweden)

    Liebig Jürgen

    2010-10-01

    Full Text Available Abstract Background Mutual policing is an important mechanism for reducing conflict in cooperative groups. In societies of ants, bees, and wasps, mutual policing of worker reproduction can evolve when workers are more closely related to the queen's sons than to the sons of workers or when the costs of worker reproduction lower the inclusive fitness of workers. During colony growth, relatedness within the colony remains the same, but the costs of worker reproduction may change. The costs of worker reproduction are predicted to be greatest in incipient colonies. If the costs associated with worker reproduction outweigh the individual direct benefits to workers, policing mechanisms as found in larger colonies may be absent in incipient colonies. Results We investigated policing behaviour across colony growth in the ant Camponotus floridanus. In large colonies of this species, worker reproduction is policed by the destruction of worker-laid eggs. We found workers from incipient colonies do not exhibit policing behaviour, and instead tolerate all conspecific eggs. The change in policing behaviour is consistent with changes in egg surface hydrocarbons, which provide the informational basis for policing; eggs laid by queens from incipient colonies lack the characteristic hydrocarbons on the surface of eggs laid by queens from large colonies, making them chemically indistinguishable from worker-laid eggs. We also tested the response to fertility information in the context of queen tolerance. Workers from incipient colonies attacked foreign queens from large colonies; whereas workers from large colonies tolerated such queens. Workers from both incipient and large colonies attacked foreign queens from incipient colonies. Conclusions Our results provide novel insights into the regulation of worker reproduction in social insects at both the proximate and ultimate levels. At the proximate level, our results show that mechanisms of social regulation, such as

  5. Friends and Foes from an Ant Brain's Point of View – Neuronal Correlates of Colony Odors in a Social Insect

    Science.gov (United States)

    Brandstaetter, Andreas Simon; Rössler, Wolfgang; Kleineidam, Christoph Johannes

    2011-01-01

    Background Successful cooperation depends on reliable identification of friends and foes. Social insects discriminate colony members (nestmates/friends) from foreign workers (non-nestmates/foes) by colony-specific, multi-component colony odors. Traditionally, complex processing in the brain has been regarded as crucial for colony recognition. Odor information is represented as spatial patterns of activity and processed in the primary olfactory neuropile, the antennal lobe (AL) of insects, which is analogous to the vertebrate olfactory bulb. Correlative evidence indicates that the spatial activity patterns reflect odor-quality, i.e., how an odor is perceived. For colony odors, alternatively, a sensory filter in the peripheral nervous system was suggested, causing specific anosmia to nestmate colony odors. Here, we investigate neuronal correlates of colony odors in the brain of a social insect to directly test whether they are anosmic to nestmate colony odors and whether spatial activity patterns in the AL can predict how odor qualities like “friend” and “foe” are attributed to colony odors. Methodology/Principal Findings Using ant dummies that mimic natural conditions, we presented colony odors and investigated their neuronal representation in the ant Camponotus floridanus. Nestmate and non-nestmate colony odors elicited neuronal activity: In the periphery, we recorded sensory responses of olfactory receptor neurons (electroantennography), and in the brain, we measured colony odor specific spatial activity patterns in the AL (calcium imaging). Surprisingly, upon repeated stimulation with the same colony odor, spatial activity patterns were variable, and as variable as activity patterns elicited by different colony odors. Conclusions Ants are not anosmic to nestmate colony odors. However, spatial activity patterns in the AL alone do not provide sufficient information for colony odor discrimination and this finding challenges the current notion of how odor

  6. Nutritional and neutraceutical composition of five wild culinary-medicinal species of genus Pleurotus (higher Basidiomycetes) from northwest India.

    Science.gov (United States)

    Atri, N; Sharma, Sapan Kumar; Joshi, Robin; Gulati, Ashu; Gulati, Arvind

    2013-01-01

    Five wild culinary-medicinal species of genus Pleurotus (Fr.) P. Kumm. (P. floridanus Singer, P. pulmonarius (Fr.) Quél., P. sapidus Quél., P. cystidiosus O.K. Miller, and P. sajor-caju (Fr.) Singer), collected from different localities of Northwest India, were studied for their nutritional and nutraceutical composition. Composition analysis of nutrients involved determining proteins, fats, ash, fiber, and carbohydrates using standard biochemical techniques. Minerals were estimated by an atomic absorption spectrophotometer and toxic metals were determined by the Reinsch test method. The analysis of nutraceuticals included determination of sugars by high-performance liquid chromatography, fatty acids by gas chromatography, and antioxidants such as β-carotene, lycopene, and total phenolic compounds with methanolic extract using a colorimetric assay. In the samples analyzed, carbohydrates dominated over protein and other macronutrients. Carbohydrates ranged from 85.86 to 88.38%, protein 0.98 to 2.17%, crude fat 0.62 to 0.84%, crude fibers 2.76 to 3.12%, and ash content 1.03 to 2.20%. Macro- and microminerals (calcium, magnesium, sodium, potassium, copper, zinc, and iron) also were found in substantial amount, whereas toxic metals (lead, silver, arsenic, mercury, and antimony) were not detected. Three main sugars-sucrose (0.338-2.011%), glucose (0.553-0.791%), and xylose (0.01%)-were detected. Among fatty acids, monounsaturated fatty (37.17-68.29%) acids were documented in a higher proportion than saturated fatty acids (26.07-47.77%). In terms of antioxidant composition, all species contained ascorbic acid, phenols, carotene, and lycopene. Ascorbic acid content ranged from 0.46 to 0.49 mg/100 g, total phenolic compounds ranged from 6.76 to 16.92 mg/100 g of gallic acid, β-carotene ranged from 0.134 to 0.221 μg/100 g, and lycopene from 0.055 to 0 .075 μg/100 g.

  7. Diversidad,historia natural y conservación de los mamíferos de San Vito de Coto Brus, Costa Rica

    Directory of Open Access Journals (Sweden)

    Jesús Pacheco

    2006-03-01

    Full Text Available Aunque Costa Rica ha sido biológicamente bien estudiada, pocas áreas tiene inventarios de mamíferos completos y actualizados,lo que es para llevar a cabo estudios ecológicos y de conservación. La región de San Vito es considerada entre las mas importantes para la investigación científica en el país, debido a la presencia del Jardín Botánico Wilson y la Estación Biológica Las Cruces. Sin embargo, el conocimiento de la mastofauna es incompleto. Por lo tanto se evaluó intensamente los mamíferos de San Vito, y se compiló una lista de especies, con una evaluación de su composición, abundancia relativa, distribución en los habitats, y su estado de conservación. Se registraron 105 especies, que representaron a 85 géneros, 29 familias y 10 órdenes. Los mamíferos no voladores representaron 62 especies, 59 géneros, 23 familias y 9 órdenes. Los murciélagos pertenecieron a 6 familias, 26 géneros y 43 especies. La extensa deforestación y cacería son factores que han causado la extinción local de 7especies, pero la región todavía mantiene un número relativamente alto de su diversidad original, incluyendo a especie raras. Pocas especies fueron comunes o abundantes. La riqueza de especies fue alta en el bosque y los fragmentos de bosque, y más baja en las plantaciones de café, pastizales inducidos y vegetación secundaria. Alrededor del 21% (13 de las espcies estan incluidad en el libro rojo de la UICN. Tres especies (Saimiri oerstedii, Tapirus bairdii y Sylvilagus dicei son consideradas en peligro y dos (Myrmecophaga trydactila y Caluromys derbianus como amenazadas:de estas, dos especies (T. bairdii and M. trydactila se encuentran localmente extintas. Las otras especies son consideradas de bajo riesgo (i. e. Chironectes minimus o con poca información (i. e. Lontra longicaudis . Adicionalmente, 24 especies (39% están incluidas en CITES.Diversity, natural history and conservation of mammals from San Vito de Coto Brus, Costa

  8. Trophic niche of the fox Vulpes vulpes in the Ticino Valley (Northern Italy / Nicchia trofica della volpe Vulpes vulpes nella valle del Ticino

    Directory of Open Access Journals (Sweden)

    Claudio Prigioni

    1991-07-01

    Roditori sono la componente principale della dieta (Vm% annuale=43,7 e raggiungono i valori più elevati di presenza in inverno (Vm%=74,6 in gennaio. La specie preda in particolare i ratti Rattus sp. (Vm% annuale=20,6 che sembra catturare principalmente in vicinanza di piccoli centri abitati e cascine dove sono presenti diversi cumuli di rifiuti. Gli Uccelli sono la seconda componente trofica in ordine di importanza (Vm% annuale=26,1, compaiono tutto l'anno e sono ripartiti quasi equamente tra Rallidi, Fasianidi, Anatidi e Passeriformi. Anche i Vegetali (Vm% annuale=20,2 sono rappresentati per l'intero arco dell'anno, hanno valori massimi di presenza in estate (Vm%=82,2 in agosto e sono composti soprattutto da frutti delle Rosaceae (Vm% annuale=7,1 e delle Berberidaceae (Vm%=3,5. Gli Insetti, costituiti quasi esclusivamente da Coleotteri, le Carogne e i Rifiuti sono componenti integrative della dieta. La predazione di selvaggina di particolare interesse venatorio (Leporidae, Phasianidae e Anatidae è stimabile nell'ordine del 23% del volume medio di prede ingerito dalla specie nell'arco dell'anno. La nicchia trofica valutata utilizzando le frequenze relative non è risultata significativamente più ampia (BFr=0,61 cumulando i dati 1985-86 di quella rilevata sulla base dei volumi medi delle categorie alimentari consumate (BVm=0,49. Nell'arco dell'anno, entrambi gli indici così calcolati mostrano un andamento bimodale con i valori più elevati in primavera (BVm=0,79 in maggio e autunno (BVm=0,91 in novembre, intercalati da quelli più bassi in inverno (BVm=0,31 in gennaio e metà estate (BVm=0,40 in agosto. La Volpe tende ad utilizzare diverse categorie alimentari privilegiandone però solo alcune.

  9. Competitive interactions and resource partitioning between northern spotted owls and barred owls in western Oregon

    Science.gov (United States)

    Wiens, J. David; Anthony, Robert G.; Forsman, Eric D.

    2014-01-01

    with minimal spatial overlap among core-use areas. We used an information-theoretic approach to rank discrete-choice models representing alternative hypotheses about the influence of forest conditions, topography, and interspecific interactions on species-specific patterns of nighttime resource selection. Spotted owls spent a disproportionate amount of time foraging on steep slopes in ravines dominated by old (>120 yr) conifer trees. Barred owls used available forest types more evenly than spotted owls, and were most strongly associated with patches of large hardwood and conifer trees that occupied relatively flat areas along streams. Spotted and barred owls differed in the relative use of old conifer forest (greater for spotted owls) and slope conditions (steeper slopes for spotted owls), but we found no evidence that the 2 species differed in their use of young, mature, and riparian-hardwood forest types. Mean overlap in proportional use of different forest types between individual spotted owls and barred owls in adjacent territories was 81% (range = 30–99%). The best model of habitat use for spotted owls indicated that the relative probability of a location being used was substantially reduced if the location was within or in close proximity to a core-use area of a barred owl. We used pellet analysis and measures of food-niche overlap to determine the potential for dietary competition between spatially associated pairs of spotted owls and barred owls. We identified 1,223 prey items from 15 territories occupied by spotted owls and 4,299 prey items from 24 territories occupied by barred owls. Diets of both species were dominated by nocturnal mammals, but diets of barred owls included many terrestrial, aquatic, and diurnal prey species that were rare or absent in diets of spotted owls. Northern flying squirrels (Glaucomys sabrinus), woodrats (Neotoma fuscipes, N. cinerea), and lagomorphs (Lepus americanus, Sylvilagus bachmani) were primary prey for both owl