Wu, Fan; Bansal, Loveleena; Bradshaw‐Pierce, Erica; Chan, Jason R.; Liederer, Bianca M.; Mettetal, Jerome T.; Schroeder, Patricia; Schuck, Edgar; Tsai, Alice; Xu, Christine; Chimalakonda, Anjaneya; Le, Kha; Penney, Mark; Topp, Brian; Yamada, Akihiro
2018-01-01
A cross‐industry survey was conducted to assess the landscape of preclinical quantitative systems pharmacology (QSP) modeling within pharmaceutical companies. This article presents the survey results, which provide insights on the current state of preclinical QSP modeling in addition to future opportunities. Our results call attention to the need for an aligned definition and consistent terminology around QSP, yet highlight the broad applicability and benefits preclinical QSP modeling is currently delivering. PMID:29349875
Methodologies for Quantitative Systems Pharmacology (QSP) Models: Design and Estimation.
Ribba, B; Grimm, H P; Agoram, B; Davies, M R; Gadkar, K; Niederer, S; van Riel, N; Timmis, J; van der Graaf, P H
2017-08-01
With the increased interest in the application of quantitative systems pharmacology (QSP) models within medicine research and development, there is an increasing need to formalize model development and verification aspects. In February 2016, a workshop was held at Roche Pharma Research and Early Development to focus discussions on two critical methodological aspects of QSP model development: optimal structural granularity and parameter estimation. We here report in a perspective article a summary of presentations and discussions. © 2017 The Authors CPT: Pharmacometrics & Systems Pharmacology published by Wiley Periodicals, Inc. on behalf of American Society for Clinical Pharmacology and Therapeutics.
Methodologies for quantitative systems pharmacology (QSP) models : Design and Estimation
Ribba, B.; Grimm, Hp; Agoram, B.; Davies, M.R.; Gadkar, K.; Niederer, S.; van Riel, N.; Timmis, J.; van der Graaf, Ph.
2017-01-01
With the increased interest in the application of quantitative systems pharmacology (QSP) models within medicine research and development, there is an increasing need to formalize model development and verification aspects. In February 2016, a workshop was held at Roche Pharma Research and Early
Methodologies for Quantitative Systems Pharmacology (QSP) Models: Design and Estimation
Ribba, B.; Grimm, H. P.; Agoram, B.; Davies, M. R.; Gadkar, K.; Niederer, S.; van Riel, N.; Timmis, J.; van der Graaf, P. H.
2017-01-01
With the increased interest in the application of quantitative systems pharmacology (QSP) models within medicine research and development, there is an increasing need to formalize model development and verification aspects. In February 2016, a workshop was held at Roche Pharma Research and Early
Rieger, Theodore R; Musante, Cynthia J
2016-10-30
Quantitative Systems Pharmacology (QSP) is an emerging science with increasing application to pharmaceutical research and development paradigms. Through case study we provide an overview of the benefits and challenges of applying QSP approaches to inform program decisions in the early stages of drug discovery and development. Specifically, we describe the use of a type 2 diabetes systems model to inform a No-Go decision prior to lead development for a potential GLP-1/GIP dual agonist program, enabling prioritization of exploratory programs with higher probability of clinical success. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.
Musante, CJ; Abernethy, DR; Allerheiligen, SR; Lauffenburger, DA
2016-01-01
Quantitative Systems Pharmacology (QSP) is experiencing increased application in the drug discovery and development process. Like its older sibling, systems biology, the QSP field is comprised of a mix of established disciplines and methods, from molecular biology to engineering to pharmacometrics.1 As a result, there exist critical segments of the discipline that differ dramatically in approach and a need to bring these groups together toward a common goal. PMID:27639191
Musante, C J; Abernethy, D R; Allerheiligen, S R; Lauffenburger, D A; Zager, M G
2016-09-01
Quantitative Systems Pharmacology (QSP) is experiencing increased application in the drug discovery and development process. Like its older sibling, systems biology, the QSP field is comprised of a mix of established disciplines and methods, from molecular biology to engineering to pharmacometrics. As a result, there exist critical segments of the discipline that differ dramatically in approach and a need to bring these groups together toward a common goal. © 2016 The Authors CPT: Pharmacometrics & Systems Pharmacology published by Wiley Periodicals, Inc. on behalf of American Society for Clinical Pharmacology and Therapeutics.
Supersonic Retropropulsion Flight Test Concepts
Post, Ethan A.; Dupzyk, Ian C.; Korzun, Ashley M.; Dyakonov, Artem A.; Tanimoto, Rebekah L.; Edquist, Karl T.
2011-01-01
NASA's Exploration Technology Development and Demonstration Program has proposed plans for a series of three sub-scale flight tests at Earth for supersonic retropropulsion, a candidate decelerator technology for future, high-mass Mars missions. The first flight test in this series is intended to be a proof-of-concept test, demonstrating successful initiation and operation of supersonic retropropulsion at conditions that replicate the relevant physics of the aerodynamic-propulsive interactions expected in flight. Five sub-scale flight test article concepts, each designed for launch on sounding rockets, have been developed in consideration of this proof-of-concept flight test. Commercial, off-the-shelf components are utilized as much as possible in each concept. The design merits of the concepts are compared along with their predicted performance for a baseline trajectory. The results of a packaging study and performance-based trade studies indicate that a sounding rocket is a viable launch platform for this proof-of-concept test of supersonic retropropulsion.
Kagenov, Anuar; Glazunov, Anatoliy; Kostyushin, Kirill; Eremin, Ivan; Shuvarikov, Vladimir
2017-10-01
This paper presents the results of numerical investigations of the interaction with the Mars surface of four supersonic jets of ExoMars landing platform propulsion system. The cases of impingement of supersonic jets on a curved surface are considered depending on the values of propulsion system thrust. According to the results of numerical studies are obtained the values of normal stresses on the surface of Mars at altitudes of 1.0, 0.5 and 0.3 meter to the surface of the landing. To define the occurring shear stresses Mohr-Coulomb theory was used. The maximum values of shear stresses were defined for the following types of soil of Mars: drift material, crusty to cloddy material, blocky material, sand and Mojave Mars simulant. The conducted evaluations showed, regardless of the propulsion system configuration, that when the final stage of the controlled landing of the ExoMars landing platform, the erosion of the Mars regolith would be insignificant. The estimates are consistent with the available data from previous Mars missions.
Directory of Open Access Journals (Sweden)
Jeffrey E Ming
2017-06-01
Full Text Available Reduction in low-density lipoprotein cholesterol (LDL-C is associated with decreased risk for cardiovascular disease. Alirocumab, an antibody to proprotein convertase subtilisin/kexin type 9 (PCSK9, significantly reduces LDL-C. Here, we report development of a quantitative systems pharmacology (QSP model integrating peripheral and liver cholesterol metabolism, as well as PCSK9 function, to examine the mechanisms of action of alirocumab and other lipid-lowering therapies, including statins. The model predicts changes in LDL-C and other lipids that are consistent with effects observed in clinical trials of single or combined treatments of alirocumab and other treatments. An exploratory model to examine the effects of lipid levels on plaque dynamics was also developed. The QSP platform, on further development and qualification, may support dose optimization and clinical trial design for PCSK9 inhibitors and lipid-modulating drugs. It may also improve our understanding of factors affecting therapeutic responses in different phenotypes of dyslipidemia and cardiovascular disease.
Energy-Deposition to Reduce Skin Friction in Supersonic Applications, Phase I
National Aeronautics and Space Administration — NASA has drawn attention to an impending need to improve energy-efficiency in low supersonic (M<~3) platforms. Aerodynamic efficiency is the foundation of...
Energy-Deposition to Reduce Skin Friction in Supersonic Applications, Phase II
National Aeronautics and Space Administration — NASA has drawn attention to an impending need to improve energy-efficiency in low supersonic (M<~3) platforms. Aerodynamic efficiency is the foundation of...
High Efficiency Low Cost CO2 Compression Using Supersonic Shock Wave Technology
Energy Technology Data Exchange (ETDEWEB)
Williams, J; Aarnio, M; Grosvenor, A; Taylor, D; Bucher, J
2010-12-31
Development and testing results from a supersonic compressor are presented. The compressor achieved record pressure ratio for a fully-supersonic stage and successfully demonstrated the technology potential. Several tasks were performed in compliance with the DOE award objectives. A high-pressure ratio compressor was retrofitted to improve rotordynamics behavior and successfully tested. An outside review panel confirmed test results and design approach. A computational fluid dynamics code used to analyze the Ramgen supersonic flowpath was extensively and successfully modified to improve use on high-performance computing platforms. A comprehensive R&D implementation plan was developed and used to lay the groundwork for a future full-scale compressor demonstration. Conceptual design for a CO2 demonstration compressor was developed and reviewed.
Trends in Supersonic Separator design development
Directory of Open Access Journals (Sweden)
Altam Rami Ali
2017-01-01
Full Text Available Supersonic separator is a new technology with applications in hydrocarbon dew pointing and gas dehydration which can be used to condensate and separate water and heavy hydrocarbons from natural gas. Many researchers have studied the design, performance and efficiency, economic viability, and industrial applications of these separators. The purpose of this paper is to succinctly review recent progress in the design and application of supersonic separators and their limitations. This review has found that while several aspects of this study are well studied, considerable gaps within the published literature still exists in the areas such as turndown flexibility which is a critical requirement to cater for variation of mass flow and since almost all the available designs have a fixed geometry and therefore cannot be considered suitable for variable mass flow rate, which is a common situation in actual site. Hence, the focus needs to be more on designing a flexible geometry that can maintain a high separation efficiency regardless of inlet conditions and mass flow variations. This review is focusing only on the design and application of the supersonic separators without going through the experimental facilities, industrial platform, pilot plants as well as theoretical, analytical, and numerical modelling.
Wei, Guangsheng; Zhu, Rong; Cheng, Ting; Dong, Kai; Yang, Lingzhi; Wu, Xuetao
2018-02-01
Supersonic oxygen-supplying technologies, including the coherent supersonic jet and the conventional supersonic jet, are now widely applied in electric arc furnace steelmaking processes to increase the bath stirring, reaction rates, and energy efficiency. However, there has been limited research on the impact characteristics of the two supersonic jets. In the present study, by integrating theoretical modeling and numerical simulations, a hybrid model was developed and modified to calculate the penetration depth and impact zone volume of the coherent and conventional supersonic jets. The computational fluid dynamics results were validated against water model experiments. The results show that the lance height has significant influence on the jet penetration depth and jet impact zone volume. The penetration depth decreases with increasing lance height, whereas the jet impact zone volume initially increases and then decreases with increasing lance height. In addition, the penetration depth and impact zone volume of the coherent supersonic jet are larger than those of the conventional supersonic jet at the same lance height, which illustrates the advantages of the coherent supersonic jet in delivering great amounts of oxygen to liquid melt with a better stirring effect compared to the conventional supersonic jet. A newly defined parameter, the k value, reflects the velocity attenuation and the potential core length of the main supersonic jet. Finally, a hybrid model and its modifications can well predict the penetration depth and impact zone volume of the coherent and conventional supersonic jets.
A supersonic fan equipped variable cycle engine for a Mach 2.7 supersonic transport
Tavares, T. S.
1985-01-01
The concept of a variable cycle turbofan engine with an axially supersonic fan stage as powerplant for a Mach 2.7 supersonic transport was evaluated. Quantitative cycle analysis was used to assess the effects of the fan inlet and blading efficiencies on engine performance. Thrust levels predicted by cycle analysis are shown to match the thrust requirements of a representative aircraft. Fan inlet geometry is discussed and it is shown that a fixed geometry conical spike will provide sufficient airflow throughout the operating regime. The supersonic fan considered consists of a single stage comprising a rotor and stator. The concept is similar in principle to a supersonic compressor, but differs by having a stator which removes swirl from the flow without producing a net rise in static pressure. Operating conditions peculiar to the axially supersonic fan are discussed. Geometry of rotor and stator cascades are presented which utilize a supersonic vortex flow distribution. Results of a 2-D CFD flow analysis of these cascades are presented. A simple estimate of passage losses was made using empirical methods.
Low Density Supersonic Decelerators
National Aeronautics and Space Administration — The Low-Density Supersonic Decelerator project will demonstrate the use of inflatable structures and advanced parachutes that operate at supersonic speeds to more...
Quantitative Systems Pharmacology: A Case for Disease Models.
Musante, C J; Ramanujan, S; Schmidt, B J; Ghobrial, O G; Lu, J; Heatherington, A C
2017-01-01
Quantitative systems pharmacology (QSP) has emerged as an innovative approach in model-informed drug discovery and development, supporting program decisions from exploratory research through late-stage clinical trials. In this commentary, we discuss the unique value of disease-scale "platform" QSP models that are amenable to reuse and repurposing to support diverse clinical decisions in ways distinct from other pharmacometrics strategies. © 2016 The Authors Clinical Pharmacology & Therapeutics published by Wiley Periodicals, Inc. on behalf of The American Society for Clinical Pharmacology and Therapeutics.
Temperature in subsonic and supersonic radiation fronts measured at OMEGA
Johns, Heather; Kline, John; Lanier, Nick; Perry, Ted; Fontes, Chris; Fryer, Chris; Brown, Colin; Morton, John
2017-10-01
Propagation of heat fronts relevant to astrophysical plasmas is challenging in the supersonic regime. Plasma Te changes affect opacity and equation of state without hydrodynamic change. In the subsonic phase density perturbations form at material interfaces as the plasma responds to radiation pressure of the front. Recent experiments at OMEGA studied this transition in aerogel foams driven by a hohlraum. In COAX, two orthogonal backlighters drive x-ray radiography and K-shell absorption spectroscopy to diagnose the subsonic shape of the front and supersonic Te profiles. Past experiments used absorption spectroscopy in chlorinated foams to measure the heat front; however, Cl dopant is not suitable for higher material temperatures at NIF. COAX has developed use of Sc and Ti dopants to diagnose Te between 60-100eV and 100-180eV. Analysis with PrismSPECT using OPLIB tabular opacity data will evaluate the platform's ability to advance radiation transport in this regime.
Supersonic induction plasma jet modeling
International Nuclear Information System (INIS)
Selezneva, S.E.; Boulos, M.I.
2001-01-01
Numerical simulations have been applied to study the argon plasma flow downstream of the induction plasma torch. It is shown that by means of the convergent-divergent nozzle adjustment and chamber pressure reduction, a supersonic plasma jet can be obtained. We investigate the supersonic and a more traditional subsonic plasma jets impinging onto a normal substrate. Comparing to the subsonic jet, the supersonic one is narrower and much faster. Near-substrate velocity and temperature boundary layers are thinner, so the heat flux near the stagnation point is higher in the supersonic jet. The supersonic plasma jet is characterized by the electron overpopulation and the domination of the recombination over the dissociation, resulting into the heating of the electron gas. Because of these processes, the supersonic induction plasma permits to separate spatially different functions (dissociation and ionization, transport and deposition) and to optimize each of them. The considered configuration can be advantageous in some industrial applications, such as plasma-assisted chemical vapor deposition of diamond and polymer-like films and in plasma spraying of nanoscaled powders
International Nuclear Information System (INIS)
Powers, D.E.; Hansen, S.G.; Geusic, M.E.; Michalopoulos, D.L.; Smalley, R.E.
1983-01-01
Copper clusters ranging in size from 1 to 29 atoms have been prepared in a supersonic beam by laser vaporization of a rotating copper target rod within the throat of a pulsed supersonic nozzle using helium for the carrier gas. The clusters were cooled extensively in the supersonic expansion [T(translational) 1 to 4 K, T(rotational) = 4 K, T(vibrational) = 20 to 70 K]. These clusters were detected in the supersonic beam by laser photoionization with time-of-flight mass analysis. Using a number of fixed frequency outputs of an exciplex laser, the threshold behavior of the photoionization cross section was monitored as a function of cluster size.nce two-photon ionization (R2PI) with mass selective detection allowed the detection of five new electronic band systems in the region between 2690 and 3200 A, for each of the three naturally occurring isotopic forms of Cu 2 . In the process of scanning the R2PI spectrum of these new electronic states, the ionization potential of the copper dimer was determined to be 7.894 +- 0.015 eV
A computational study of the supersonic coherent jet
International Nuclear Information System (INIS)
Jeong, Mi Seon; Kim, Heuy Dong
2003-01-01
In steel-making process of iron and steel industry, the purity and quality of steel can be dependent on the amount of CO contained in the molten metal. Recently, the supersonic oxygen jet is being applied to the molten metal in the electric furnace and thus reduces the CO amount through the chemical reactions between the oxygen jet and molten metal, leading to a better quality of steel. In this application, the supersonic oxygen jet is limited in the distance over which the supersonic velocity is maintained. In order to get longer supersonic jet propagation into the molten metal, a supersonic coherent jet is suggested as one of the alternatives which are applicable to the electric furnace system. It has a flame around the conventional supersonic jet and thus the entrainment effect of the surrounding gas into the supersonic jet is reduced, leading to a longer propagation of the supersonic jet. In this regard, gasdynamics mechanism about why the combustion phenomenon surrounding the supersonic jet causes the jet core length to be longer is not yet clarified. The present study investigates the major characteristics of the supersonic coherent jet, compared with the conventional supersonic jet. A computational study is carried out to solve the compressible, axisymmetric Navier-Stokes equations. The computational results of the supersonic coherent jet are compared with the conventional supersonic jets
Supersonic propulsion technology. [variable cycle engines
Powers, A. G.; Coltrin, R. E.; Stitt, L. E.; Weber, R. J.; Whitlow, J. B., Jr.
1979-01-01
Propulsion concepts for commercial supersonic transports are discussed. It is concluded that variable cycle engines, together with advanced supersonic inlets and low noise coannular nozzles, provide good operating performance for both supersonic and subsonic flight. In addition, they are reasonably quiet during takeoff and landing and have acceptable exhaust emissions.
Continuous supersonic plasma wind tunnel
DEFF Research Database (Denmark)
Andersen, S.A.; Jensen, Vagn Orla; Nielsen, P.
1969-01-01
The normal magnetic field configuration of a Q device has been modified to obtain a 'magnetic Laval nozzle'. Continuous supersonic plasma 'winds' are obtained with Mach numbers ~3. The magnetic nozzle appears well suited for the study of the interaction of supersonic plasma 'winds' with either...
Three-dimensional supersonic vortex breakdown
Kandil, Osama A.; Kandil, Hamdy A.; Liu, C. H.
1993-01-01
Three-dimensional supersonic vortex-breakdown problems in bound and unbound domains are solved. The solutions are obtained using the time-accurate integration of the unsteady, compressible, full Navier-Stokes (NS) equations. The computational scheme is an implicit, upwind, flux-difference splitting, finite-volume scheme. Two vortex-breakdown applications are considered in the present paper. The first is for a supersonic swirling jet which is issued from a nozzle into a supersonic uniform flow at a lower Mach number than that of the swirling jet. The second is for a supersonic swirling flow in a configured circular duct. In the first application, an extensive study of the effects of grid fineness, shape and grid-point distribution on the vortex breakdown is presented. Four grids are used in this study and they show a substantial dependence of the breakdown bubble and shock wave on the grid used. In the second application, the bubble-type and helix-type vortex breakdown have been captured.
Advanced supersonic propulsion study, phase 3
Howlett, R. A.; Johnson, J.; Sabatella, J.; Sewall, T.
1976-01-01
The variable stream control engine is determined to be the most promising propulsion system concept for advanced supersonic cruise aircraft. This concept uses variable geometry components and a unique throttle schedule for independent control of two flow streams to provide low jet noise at takeoff and high performance at both subsonic and supersonic cruise. The advanced technology offers a 25% improvement in airplane range and an 8 decibel reduction in takeoff noise, relative to first generation supersonic turbojet engines.
Continuous supersonic plasma wind tunnel
DEFF Research Database (Denmark)
Andersen, S.A.; Jensen, Vagn Orla; Nielsen, P.
1968-01-01
The B field configuration of a Q-device has been modified into a magnetic Laval nozzle. Continuous supersonic plasma flow is observed with M≈3......The B field configuration of a Q-device has been modified into a magnetic Laval nozzle. Continuous supersonic plasma flow is observed with M≈3...
Roberts, II, William Byron; Lawlor, Shawn P.; Breidenthal, Robert E.
2016-04-12
A supersonic compressor including a rotor to deliver a gas at supersonic conditions to a diffuser. The diffuser includes a plurality of aerodynamic ducts that have converging and diverging portions, for deceleration of gas to subsonic conditions and then for expansion of subsonic gas, to change kinetic energy of the gas to static pressure. The aerodynamic ducts include vortex generating structures for controlling boundary layer, and structures for changing the effective contraction ratio to enable starting even when the aerodynamic ducts are designed for high pressure ratios, and structures for boundary layer control. In an embodiment, aerodynamic ducts are provided having an aspect ratio of in excess of two to one, when viewed in cross-section orthogonal to flow direction at an entrance to the aerodynamic duct.
Store Separations From a Supersonic Cone
National Research Council Canada - National Science Library
Simko, Richard J
2006-01-01
... analyses of supersonic store separations. Also included in this research is a study of supersonic base pressure profiles, near-wake velocity profiles, wind tunnel shock interactions and force/moment studies on a conical store and parent vehicle...
A fundamental study of the supersonic microjet
Energy Technology Data Exchange (ETDEWEB)
Jeong, M. S.; Kim, H. S.; Kim, H. D. [Andong National Univ., Andong (Korea, Republic of)
2001-07-01
Microjet flows are often encountered in many industrial applications of micro-electro-mechanical systems as well as in medical engineering fields such as a transdermal drug delivery system for needle-free injection of drugs into the skin. The Reynolds numbers of such microjets are usually several orders of magnitude below those of larger-scale jets. The supersonic microjet physics with these low Reynolds numbers are not yet understood to date. Computational modeling and simulation can provide an effective predictive capability for the major features of the supersonic microjets. In the present study, computations using the axisymmetic, compressible, Navier-Stokes equations are applied to understand the supersonic microjet flow physics. The pressure ratio of the microjets is changed to obtain both the under-and over-expanded flows at the exit of the micronozzle. Sonic and supersonic microjets are simulated and compared with some experimental results available. Based on computational results; two microjets are discussed in terms of total pressure, jet decay and supersonic core length.
A fundamental study of the supersonic microjet
International Nuclear Information System (INIS)
Jeong, M. S.; Kim, H. S.; Kim, H. D.
2001-01-01
Microjet flows are often encountered in many industrial applications of micro-electro-mechanical systems as well as in medical engineering fields such as a transdermal drug delivery system for needle-free injection of drugs into the skin. The Reynolds numbers of such microjets are usually several orders of magnitude below those of larger-scale jets. The supersonic microjet physics with these low Reynolds numbers are not yet understood to date. Computational modeling and simulation can provide an effective predictive capability for the major features of the supersonic microjets. In the present study, computations using the axisymmetic, compressible, Navier-Stokes equations are applied to understand the supersonic microjet flow physics. The pressure ratio of the microjets is changed to obtain both the under-and over-expanded flows at the exit of the micronozzle. Sonic and supersonic microjets are simulated and compared with some experimental results available. Based on computational results; two microjets are discussed in terms of total pressure, jet decay and supersonic core length
Active Control of Supersonic Impinging Jets Using Supersonic Microjets
National Research Council Canada - National Science Library
Alvi, Farrukh
2005-01-01
.... Supersonic impinging jets occur in many applications including in STOVL aircraft where they lead to a highly oscillatory flow with very high unsteady loads on the nearby aircraft structures and the landing surfaces...
Clark, Ian G.; Adler, Mark; Manning, Rob
2015-01-01
NASA's Low-Density Supersonic Decelerator Project is developing and testing the next generation of supersonic aerodynamic decelerators for planetary entry. A key element of that development is the testing of full-scale articles in conditions relevant to their intended use, primarily the tenuous Mars atmosphere. To achieve this testing, the LDSD project developed a test architecture similar to that used by the Viking Project in the early 1970's for the qualification of their supersonic parachute. A large, helium filled scientific balloon is used to hoist a 4.7 m blunt body test vehicle to an altitude of approximately 32 kilometers. The test vehicle is released from the balloon, spun up for gyroscopic stability, and accelerated to over four times the speed of sound and an altitude of 50 kilometers using a large solid rocket motor. Once at those conditions, the vehicle is despun and the test period begins. The first flight of this architecture occurred on June 28th of 2014. Though primarily a shake out flight of the new test system, the flight was also able to achieve an early test of two of the LDSD technologies, a large 6 m diameter Supersonic Inflatable Aerodynamic Decelerator (SIAD) and a large, 30.5 m nominal diameter supersonic parachute. This paper summarizes this first flight.
Oblique-Flying-Wing Supersonic Transport Airplane
Van Der Velden, Alexander J. M.
1992-01-01
Oblique-flying-wing supersonic airplane proposed as possible alternative to B747B (or equivalent). Tranports passengers and cargo as fast as twice speed of sound at same cost as current subsonic transports. Flies at same holding speeds as present supersonic transports but requires only half takeoff distance.
Farr, Rebecca A.; Chang, Chau-Lyan; Jones, Jess H.; Dougherty, N. Sam
2015-01-01
Classic tonal screech noise created by under-expanded supersonic jets; Long Penetration Mode (LPM) supersonic phenomenon -Under-expanded counter-flowing jet in supersonic free stream -Demonstrated in several wind tunnel tests -Modeled in several computational fluid dynamics (CFD) simulations; Discussion of LPM acoustics feedback and fluid interactions -Analogous to the aero-acoustics interactions seen in screech jets; Lessons Learned: Applying certain methodologies to LPM -Developed and successfully demonstrated in the study of screech jets -Discussion of mechanically induced excitation in fluid oscillators in general; Conclusions -Large body of work done on jet screech, other aero-acoustic phenomenacan have direct application to the study and applications of LPM cold flow jets
Study on thermal-hydraulic behavior in supersonic steam injector
International Nuclear Information System (INIS)
Abe, Yutaka; Fukuichi, Akira; Kawamoto, Yujiro; Iwaki, Chikako; Narabayashi, Tadashi; Mori, Michitsugu; Ohmori, Shuichi
2007-01-01
Supersonic steam injector is the one of the most possible devices aiming at simplifying system and improving the safety and the credibility for next-generation nuclear reactor systems. The supersonic steam injector has dual functions of a passive jet pump without rotating machine and a compact and high efficiency heat exchanger, because it is operated by the direct contact condensation between supersonic steam and subcooled water jet. It is necessary to clarify the flow behavior in the supersonic steam injector which is governed by the complicated turbulent flow with a great shear stress of supersonic steam. However, in previous study, there is little study about the turbulent heat transfer and flow behavior under such a great shear stress at the gas-liquid interface. In the present study, turbulent flow behavior including the effect of the interface between water jet and supersonic steam is developed based on the eddy viscosity model. Radial velocity distributions and the turbulent heat transfer are calculated with the model. The calculation results are compared with the experimental results done with the transparent steam injector. (author)
An evaluation of supersonic STOVL technology
Kidwell, G. H., Jr.; Lampkin, B. A.
1983-01-01
The purpose of this paper is to document the status of supersonic STOVL aircraft technology. The major focus is the presentation of summaries of pertinent aspects of supersonic STOVL technology, such as justification for STOVL aircraft, current designs and their recognized areas of uncertainty, recent research programs, current activities, plans, etc. The remainder of the paper is an evaluation of the performance differential between a current supersonic STOVL design and three production (or near production) fighters, one of them the AV-8B. The results indicate that there is not a large range difference between a STOL aircraft and a STOVL aircraft, and that other aspects of performance, such as field performance or combat maneuverability, may more than make up for this decrement.
Supersonic flaw detection device for nozzle
International Nuclear Information System (INIS)
Hata, Moriki.
1996-01-01
In a supersonic flaw detection device to be attached to a body surface of a reactor pressure vessel for automatically detecting flaws of a welded portion of a horizontally connected nozzle by using supersonic waves, a running vehicle automatically running along a circumferential direction of the nozzle comprises a supersonic flaw detection means for detecting flaws of the welded portion of the nozzle by using supersonic waves, and an inclination angle sensor for detecting the inclination angle of the running vehicle relative to the central axis of the nozzle. The running distance of the vehicle running along the circumference of the nozzle, namely, the position of the running vehicle from a reference point of the nozzle can be detected accurately by dividing the distance around the nozzle by the inclination angle detected by the inclination angle sensor. Accordingly, disadvantages in the prior art, for example, that the detected values obtained by using an encoder are changed by slipping or idle running of the magnet wheels are eliminated, and accurate flaw detection can be conducted. In addition, an operation of visually adjusting the reference point for the device can be eliminated. An operator's exposure dose can be reduced. (N.H.)
The Trojan. [supersonic transport
1992-01-01
The Trojan is the culmination of thousands of engineering person-hours by the Cones of Silence Design Team. The goal was to design an economically and technologically viable supersonic transport. The Trojan is the embodiment of the latest engineering tools and technology necessary for such an advanced aircraft. The efficient design of the Trojan allows for supersonic cruise of Mach 2.0 for 5,200 nautical miles, carrying 250 passengers. The per aircraft price is placed at $200 million, making the Trojan a very realistic solution for tomorrows transportation needs. The following is a detailed study of the driving factors that determined the Trojan's super design.
Silent and Efficient Supersonic Bi-Directional Flying Wing
National Aeronautics and Space Administration — We propose a Phase I study for a novel concept of a supersonic bi-directional (SBiDir) flying wing (FW) that has the potential to revolutionize supersonic flight...
THERMAL AND AERODYNAMIC PERFORMANCES OF THE SUPERSONIC MOTION
Directory of Open Access Journals (Sweden)
Dejan P Ninković
2010-01-01
Full Text Available Generally speaking, Mach number of 4 can be taken as a boundary value for transition from conditions for supersonic, into the area of hypersonic flow, distinguishing two areas: area of supersonic in which the effects of the aerodynamic heating can be neglected and the area of hypersonic, in which the thermal effects become dominant. This paper presents the effects in static and dynamic areas, as well as presentation of G.R.O.M. software for determination of the values of aerodynamic derivatives, which was developed on the basis of linearized theory of supersonic flow. Validation of developed software was carried out through different types of testing, proving its usefulness for engineering practice in the area of supersonic wing aerodynamic loading calculations, even at high Mach numbers, with dominant thermal effects.
Entropy Minimization Design Approach of Supersonic Internal Passages
Directory of Open Access Journals (Sweden)
Jorge Sousa
2015-08-01
Full Text Available Fluid machinery operating in the supersonic regime unveil avenues towards more compact technology. However, internal supersonic flows are associated with high aerodynamic and thermal penalties, which usually prevent their practical implementation. Indeed, both shock losses and the limited operational range represent particular challenges to aerodynamic designers that should be taken into account at the initial phase of the design process. This paper presents a design methodology for supersonic passages based on direct evaluations of the velocity field using the method of characteristics and computation of entropy generation across shock waves. This meshless function evaluation tool is then coupled to an optimization scheme, based on evolutionary algorithms that minimize the entropy generation across the supersonic passage. Finally, we assessed the results with 3D Reynolds Averaged Navier Stokes calculations.
Transonic and supersonic ground effect aerodynamics
Doig, G.
2014-08-01
A review of recent and historical work in the field of transonic and supersonic ground effect aerodynamics has been conducted, focussing on applied research on wings and aircraft, present and future ground transportation, projectiles, rocket sleds and other related bodies which travel in close ground proximity in the compressible regime. Methods for ground testing are described and evaluated, noting that wind tunnel testing is best performed with a symmetry model in the absence of a moving ground; sled or rail testing is ultimately preferable, though considerably more expensive. Findings are reported on shock-related ground influence on aerodynamic forces and moments in and accelerating through the transonic regime - where force reversals and the early onset of local supersonic flow is prevalent - as well as more predictable behaviours in fully supersonic to hypersonic ground effect flows.
75 FR 8427 - Civil Supersonic Aircraft Panel Discussion
2010-02-24
... entitled, ``State of the Art of Supersonics Aircraft Technology--What has progressed in science since 1973... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Civil Supersonic Aircraft Panel Discussion AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of meeting participation...
A second-generation supersonic transport
Humphrey, W.; Grayson, G.; Gump, J.; Hutko, G.; Kubicko, R.; Obrien, J.; Orndorff, R.; Oscher, R.; Polster, M.; Ulrich, C.
1989-01-01
Ever since the advent of commercial flight vehicles, one goal of designers has been to develop aircraft that can fly faster and carry more passengers than before. After the development of practical supersonic military aircraft, this desire was naturally manifested in a search for a practical supersonic commercial aircraft. The first and, to date, only supersonic civil transport is the Concorde, manufactured by a consortium of British and French aerospace companies. Unfortunately, due to a number of factors, including low passenger capacity and limited range, the Concorde has not been an economic success. It is for this reason that there is considerable interest in developing a design for a supersonic civil transport that addresses some of the inadequacies of the Concorde. For the design of such an aircraft to be feasible in the near term, certain guidelines must be established at the outset. Based upon the experience with the Concorde, whose 100-passenger capacity is not large enough for profitable operation, a minimum capacity of 250 passengers is desired. Second, to date, because of the limited range of the Concorde, supersonic commercial flight has been restricted to trans-Atlantic routes. In order to broaden the potential market, any new design must have the capability of trans-Pacific flight. A summary of the potential markets involved is presented. Also, because of both the cost and complexity involved with actively cooling an entire aircraft, an additional design constraint is that the aircraft as a whole be passively cooled. One additional design constraint is somewhat less quantitative in nature but of great importance nonetheless. Any time a new design is attempted, the tendency is to assume great strides in technology that serve as the basis for actual realization of the design. While it is not always possible to avoid this dependence on 'enabling technology,' since this design is desired for the near term, it is prudent, wherever possible, to rely on
Study of Pressure Oscillations in Supersonic Parachute
Dahal, Nimesh; Fukiba, Katsuyoshi; Mizuta, Kazuki; Maru, Yusuke
2018-04-01
Supersonic parachutes are a critical element of planetary mission whose simple structure, light-weight characteristics together with high ratio of aerodynamic drag makes them the most suitable aerodynamic decelerators. The use of parachute in supersonic flow produces complex shock/shock and wake/shock interaction giving rise to dynamic pressure oscillations. The study of supersonic parachute is difficult, because parachute has very flexible structure which makes obtaining experimental pressure data difficult. In this study, a supersonic wind tunnel test using two rigid bodies is done. The wind tunnel test was done at Mach number 3 by varying the distance between the front and rear objects, and the distance of a bundle point which divides suspension lines and a riser. The analysis of Schlieren movies revealed shock wave oscillation which was repetitive and had large pressure variation. The pressure variation differed in each case of change in distance between the front and rear objects, and the change in distance between riser and the rear object. The causes of pressure oscillation are: interaction of wake caused by front object with the shock wave, fundamental harmonic vibration of suspension lines, interference between shock waves, and the boundary layer of suspension lines.
Supersonic wave detection method and supersonic detection device
International Nuclear Information System (INIS)
Machida, Koichi; Seto, Takehiro; Ishizaki, Hideaki; Asano, Rin-ichi.
1996-01-01
The present invention provides a method of and device for a detection suitable to a channel box which is used while covering a fuel assembly of a BWR type reactor. Namely, a probe for transmitting/receiving supersonic waves scans on the surface of the channel box. A data processing device determines an index showing a selective orientation degree of crystal direction of the channel box based on the signals received by the probe. A judging device compares the determined index with a previously determined allowable range to judge whether the channel box is satisfactory or not based on the result of the comparison. The judgement are on the basis that (1) the bending of the channel box is caused by the difference of elongation of opposed surfaces, (2) the elongation due to irradiation is caused by the selective orientation of crystal direction, and (3) the bending of the channel box can be suppressed within a predetermined range by suppressing the index determined by the measurement of supersonic waves having a correlation with the selective orientation of the crystal direction. As a result, the performance of the channel box capable of enduring high burnup region can be confirmed in a nondestructive manner. (I.S.)
76 FR 30231 - Civil Supersonic Aircraft Panel Discussion
2011-05-24
... awareness of the continuing technological advancements in supersonic aircraft technology aimed at reducing... Wednesday, April 21, 2010, as part of the joint meeting of the 159th Acoustical Society of America and NOISE... advances in supersonic technology, and for the FAA, the National Aeronautics and Space Administration (NASA...
Do supersonic aircraft avoid contrails?
Directory of Open Access Journals (Sweden)
A. Stenke
2008-02-01
Full Text Available The impact of a potential future fleet of supersonic aircraft on contrail coverage and contrail radiative forcing is investigated by means of simulations with the general circulation model ECHAM4.L39(DLR including a contrail parameterization. The model simulations consider air traffic inventories of a subsonic fleet and of a combined fleet of sub- and supersonic aircraft for the years 2025 and 2050, respectively. In case of the combined fleet, part of the subsonic fleet is replaced by supersonic aircraft. The combined air traffic scenario reveals a reduction in contrail cover at subsonic cruise levels (10 to 12 km in the northern extratropics, especially over the North Atlantic and North Pacific. At supersonic flight levels (18 to 20 km, contrail formation is mainly restricted to tropical regions. Only in winter is the northern extratropical stratosphere above the 100 hPa level cold enough for the formation of contrails. Total contrail coverage is only marginally affected by the shift in flight altitude. The model simulations indicate a global annual mean contrail cover of 0.372% for the subsonic and 0.366% for the combined fleet in 2050. The simulated contrail radiative forcing is most closely correlated to the total contrail cover, although contrails in the tropical lower stratosphere are found to be optically thinner than contrails in the extratropical upper troposphere. The global annual mean contrail radiative forcing in 2050 (2025 amounts to 24.7 mW m−2 (9.4 mW m−2 for the subsonic fleet and 24.2 mW m−2 (9.3 mW m−2 for the combined fleet. A reduction of the supersonic cruise speed from Mach 2.0 to Mach 1.6 leads to a downward shift in contrail cover, but does not affect global mean total contrail cover and contrail radiative forcing. Hence the partial substitution of subsonic air traffic leads to a shift of contrail occurrence from mid to low latitudes, but the resulting change in
Directory of Open Access Journals (Sweden)
I.S.A. Isaksen
2007-10-01
Full Text Available The demand for intercontinental transportation is increasing and people are requesting short travel times, which supersonic air transportation would enable. However, besides noise and sonic boom issues, which we are not referring to in this investigation, emissions from supersonic aircraft are known to alter the atmospheric composition, in particular the ozone layer, and hence affect climate significantly more than subsonic aircraft. Here, we suggest a metric to quantitatively assess different options for supersonic transport with regard to the potential destruction of the ozone layer and climate impacts. Options for fleet size, engine technology (nitrogen oxide emission level, cruising speed, range, and cruising altitude, are analyzed, based on SCENIC emission scenarios for 2050, which underlay the requirements to be as realistic as possible in terms of e.g., economic markets and profitable market penetration. This methodology is based on a number of atmosphere-chemistry and climate models to reduce model dependencies. The model results differ significantly in terms of the response to a replacement of subsonic aircraft by supersonic aircraft, e.g., concerning the ozone impact. However, model differences are smaller when comparing the different options for a supersonic fleet. Those uncertainties were taken into account to make sure that our findings are robust. The base case scenario, where supersonic aircraft get in service in 2015, a first fleet fully operational in 2025 and a second in 2050, leads in our simulations to a near surface temperature increase in 2050 of around 7 mK and with constant emissions afterwards to around 21 mK in 2100. The related total radiative forcing amounts to 22 mWm2 in 2050, with an uncertainty between 9 and 29 mWm2. A reduced supersonic cruise altitude or speed (from Mach 2 to Mach 1.6 reduces both, climate impact and ozone destruction, by around 40%. An increase in the range of the supersonic aircraft leads to
Grewe, V.; Stenke, A.; Ponater, M.; Sausen, R.; Pitari, G.; Iachetti, D.; Rogers, H.; Dessens, O.; Pyle, J.; Isaksen, I. S. A.; Gulstad, L.; Søvde, O. A.; Marizy, C.; Pascuillo, E.
2007-10-01
The demand for intercontinental transportation is increasing and people are requesting short travel times, which supersonic air transportation would enable. However, besides noise and sonic boom issues, which we are not referring to in this investigation, emissions from supersonic aircraft are known to alter the atmospheric composition, in particular the ozone layer, and hence affect climate significantly more than subsonic aircraft. Here, we suggest a metric to quantitatively assess different options for supersonic transport with regard to the potential destruction of the ozone layer and climate impacts. Options for fleet size, engine technology (nitrogen oxide emission level), cruising speed, range, and cruising altitude, are analyzed, based on SCENIC emission scenarios for 2050, which underlay the requirements to be as realistic as possible in terms of e.g., economic markets and profitable market penetration. This methodology is based on a number of atmosphere-chemistry and climate models to reduce model dependencies. The model results differ significantly in terms of the response to a replacement of subsonic aircraft by supersonic aircraft, e.g., concerning the ozone impact. However, model differences are smaller when comparing the different options for a supersonic fleet. Those uncertainties were taken into account to make sure that our findings are robust. The base case scenario, where supersonic aircraft get in service in 2015, a first fleet fully operational in 2025 and a second in 2050, leads in our simulations to a near surface temperature increase in 2050 of around 7 mK and with constant emissions afterwards to around 21 mK in 2100. The related total radiative forcing amounts to 22 mWmargin-left: -1.3em; margin-right: .5em; vertical-align: -15%; font-size: .7em; color: #000;">m2 in 2050, with an uncertainty between 9 and 29 mWmargin-left: -1.3em; margin-right: .5em; vertical-align: -15%; font-size: .7em; color: #000;">m2. A reduced supersonic cruise
Effect of Axisymmetric Aft Wall Angle Cavity in Supersonic Flow Field
Jeyakumar, S.; Assis, Shan M.; Jayaraman, K.
2018-03-01
Cavity plays a significant role in scramjet combustors to enhance mixing and flame holding of supersonic streams. In this study, the characteristics of axisymmetric cavity with varying aft wall angles in a non-reacting supersonic flow field are experimentally investigated. The experiments are conducted in a blow-down type supersonic flow facility. The facility consists of a supersonic nozzle followed by a circular cross sectional duct. The axisymmetric cavity is incorporated inside the duct. Cavity aft wall is inclined with two consecutive angles. The performance of the aft wall cavities are compared with rectangular cavity. Decreasing aft wall angle reduces the cavity drag due to the stable flow field which is vital for flame holding in supersonic combustor. Uniform mixing and gradual decrease in stagnation pressure loss can be achieved by decreasing the cavity aft wall angle.
Interferometric analysis of laboratory photoionized plasmas utilizing supersonic gas jet targets.
Swanson, Kyle James; Ivanov, Vladimir; Mancini, Roberto; Mayes, Daniel C.
2018-06-01
Photoionized plasmas are an important component of active galactic nuclei, x-ray binary systems and other astrophysical objects. Laboratory produced photoionized plasmas have mainly been studied at large scale facilities, due to the need for high intensity broadband x-ray flux. Using supersonic gas jets as targets has allowed university scale pulsed power generators to begin similar research. The two main advantages of this approach with supersonic gas jets include: possibility of a closer location to the x-ray source and no attenuation related to material used for containment and or tamping. Due to these factors, this experimental platform creates a laboratory environment that more closely resembles astrophysical environments. This system was developed at the Nevada Terawatt Facility using the 1 MA pulsed power generator Zebra. Neon, argon, and nitrogen supersonic gas jets are produced approximately 7-8mm from the z-pinch axis. The high intensity broadband x-ray flux produced by the collapse of the z-pinch wire array implosion irradiates the gas jet. Cylindrical wire arrays are made with 4 and 8 gold 10µm thick wire. The z-pinch radiates approximately 12-16kj of x-ray energy, with x-ray photons under 1Kev in energy. The photoionized plasma is measured via x-ray absorption spectroscopy and interferometry. A Mach-Zehnder interferometer is used to the measure neutral density of the jet prior to the zebra shot at a wavelength of 266 nm. A dual channel air-wedge shearing interferometer is used to measure electron density of the ionized gas jet during the shot, at wavelengths of 532nm and 266nm. Using a newly developed interferometric analysis tool, average ionization state maps of the plasma can be calculated. Interferometry for nitrogen and argon show an average ionization state in the range of 3-8. Preliminary x-ray absorption spectroscopy collected show neon absorption lines. This work was sponsored in part by DOE Office of Science Grant DE-SC0014451.
JET TRANSPORT AIRCRAFT, *AIRFRAMES, SUPERSONIC AIRCRAFT, STEEL , STRUCTURAL PROPERTIES, FRACTURE(MECHANICS), FATIGUE(MECHANICS), STRESS CORROSION...MICROPHOTOGRAPHY, HIGH TEMPERATURE, NICKEL ALLOYS, COBALT ALLOYS, CARBON, BAINITE , COMMERCIAL AIRCRAFT.
Supersonic cruise vehicle research/business jet
Kelly, R. J.
1980-01-01
A comparison study of a GE-21 variable propulsion system with a Multimode Integrated Propulsion System (MMIPS) was conducted while installed in small M = 2.7 supersonic cruise vehicles with military and business jet possibilities. The 1984 state of the art vehicles were sized to the same transatlantic range, takeoff distance, and sideline noise. The results indicate the MMIPS would result in a heavier vehicle with better subsonic cruise performance. The MMIPS arrangement with one fan engine and two satellite turbojet engines would not be appropriate for a small supersonic business jet because of design integration penalties and lack of redundancy.
Vortex breakdown in a supersonic jet
Cutler, Andrew D.; Levey, Brian S.
1991-01-01
This paper reports a study of a vortex breakdown in a supersonic jet. A supersonic vortical jets were created by tangential injection and acceleration through a convergent-divergent nozzle. Vortex circulation was varied, and the nature of the flow in vortical jets was investigated using several types of flow visualization, including focusing schlieren and imaging of Rayleigh scattering from a laser light sheet. Results show that the vortical jet mixed much more rapidly with the ambient air than a comparable straight jet. When overexpanded, the vortical jet exhibited considerable unsteadiness and showed signs of vortex breakdown.
Agosta, Roxana; Bilbija, Dushan; Deutsch, Marc; Gallant, David; Rose, Don; Shreve, Gene; Smario, David; Suffredini, Brian
1992-01-01
As intercontinental business and tourism volumes continue their rapid expansion, the need to reduce travel times becomes increasingly acute. The Edge Supersonic Transport Aircraft is designed to meet this demand by the year 2015. With a maximum range of 5750 nm, a payload of 294 passengers and a cruising speed of M = 2.4, The Edge will cut current international flight durations in half, while maintaining competitive first class, business class, and economy class comfort levels. Moreover, this transport will render a minimal impact upon the environment, and will meet all Federal Aviation Administration Part 36, Stage III noise requirements. The cornerstone of The Edge's superior flight performance is its aerodynamically efficient, dual-configuration design incorporating variable-geometry wingtips. This arrangement combines the benefits of a high aspect ratio wing at takeoff and low cruising speeds with the high performance of an arrow-wing in supersonic cruise. And while the structural weight concerns relating to swinging wingtips are substantial, The Edge looks to ever-advancing material technologies to further increase its viability. Heeding well the lessons of the past, The Edge design holds economic feasibility as its primary focus. Therefore, in addition to its inherently superior aerodynamic performance, The Edge uses a lightweight, largely windowless configuration, relying on a synthetic vision system for outside viewing by both pilot and passengers. Additionally, a fly-by-light flight control system is incorporated to address aircraft supersonic cruise instability. The Edge will be produced at an estimated volume of 400 aircraft and will be offered to airlines in 2015 at $167 million per transport (1992 dollars).
Investigation of supersonic jets shock-wave structure
Zapryagaev, V. I.; Gubanov, D. A.; Kavun, I. N.; Kiselev, N. P.; Kundasev, S. G.; Pivovarov, A. A.
2017-10-01
The paper presents an experimental studies overview of the free supersonic jet flow structure Ma = 1.0, Npr = 5, exhausting from a convergent profiled nozzle into a ambient space. Also was observed the jets in the presence of artificial streamwise vortices created by chevrons and microjets located on the nozzle exit. The technique of experimental investigation, schlieren-photographs and schemes of supersonic jets, and Pitot pressure distributions, are presented. A significant effect of vortex generators on the shock-wave structure of the flow is shown.
Fundamental Aeronautics Program: Overview of Project Work in Supersonic Cruise Efficiency
Castner, Raymond
2011-01-01
The Supersonics Project, part of NASA?s Fundamental Aeronautics Program, contains a number of technical challenge areas which include sonic boom community response, airport noise, high altitude emissions, cruise efficiency, light weight durable engines/airframes, and integrated multi-discipline system design. This presentation provides an overview of the current (2011) activities in the supersonic cruise efficiency technical challenge, and is focused specifically on propulsion technologies. The intent is to develop and validate high-performance supersonic inlet and nozzle technologies. Additional work is planned for design and analysis tools for highly-integrated low-noise, low-boom applications. If successful, the payoffs include improved technologies and tools for optimized propulsion systems, propulsion technologies for a minimized sonic boom signature, and a balanced approach to meeting efficiency and community noise goals. In this propulsion area, the work is divided into advanced supersonic inlet concepts, advanced supersonic nozzle concepts, low fidelity computational tool development, high fidelity computational tools, and improved sensors and measurement capability. The current work in each area is summarized.
System design overview of JAXA small supersonic experimental airplane (NEXST-1)
Takami, Hikaru; 高見 光
2007-01-01
The system of JAXA small supersonic experimental airplane (NEXST-1: National EXperimental Supersonic Transport-1) has been briefly explained. Some design problems that the designers have encountered have also been briefly explained.
Supersonic laser spray of aluminium alloy on a ceramic substrate
International Nuclear Information System (INIS)
Riveiro, A.; Lusquinos, F.; Comesana, R.; Quintero, F.; Pou, J.
2007-01-01
Applying a ceramic coating onto a metallic substrate to improve its wear resistance or corrosion resistance has attracted the interest of many researchers during decades. However, only few works explore the possibility to apply a metallic layer onto a ceramic material. This work presents a novel technique to coat ceramic materials with metals: the supersonic laser spraying. In this technique a laser beam is focused on the surface of the precursor metal in such a way that the metal is transformed to the liquid state in the beam-metal interaction zone. A supersonic jet expels the molten material and propels it to the surface of the ceramic substrate. In this study, we present the preliminary results obtained using the supersonic laser spray to coat a commercial cordierite ceramic plate with an Al-Cu alloy using a 3.5 kW CO 2 laser and a supersonic jet of Argon. Coatings were characterized by scanning electron microscopy (SEM) and interferometric profilometry
Detonation in supersonic radial outflow
Kasimov, Aslan R.; Korneev, Svyatoslav
2014-01-01
We report on the structure and dynamics of gaseous detonation stabilized in a supersonic flow emanating radially from a central source. The steady-state solutions are computed and their range of existence is investigated. Two-dimensional simulations
Numerical simulation of gap effect in supersonic flows
Directory of Open Access Journals (Sweden)
Song Mo
2014-01-01
Full Text Available The gap effect is a key factor in the design of the heat sealing in supersonic vehicles subjected to an aerodynamic heat load. Built on S-A turbulence model and Roe discrete format, the aerodynamic environment around a gap on the surface of a supersonic aircraft was simulated by the finite volume method. As the presented results indicate, the gap effect depends not only on the attack angle, but also on the Mach number.
Growing quasi-modes in dynamics of supersonic collapse
International Nuclear Information System (INIS)
Malkin, V.M.; Khudik, V.N.
1989-01-01
The hypothesis of globally stable self-similar regimes existence for supersonic Langmuir collapse plays a significant role in the attempts to construct a theory of strong Langmuir turbulence. A possibility for destruction of the stable against infinitely small perturbations self-similar regime of supersonic collapse by growing quasi-modes is demonstrated via the numerical solution of Cauchi problem for Zakharov equations. The quantitative criterion for the destruction of self-similar regimes is formulated. 9 refs.; 5 figs
Gas chromatography-mass spectrometry with supersonic molecular beams.
Amirav, Aviv; Gordin, Alexander; Poliak, Marina; Fialkov, Alexander B
2008-02-01
Gas chromatography-mass spectrometry (GC-MS) with supersonic molecular beams (SMBs) (also named Supersonic GC-MS) is based on GC and MS interface with SMBs and on the electron ionization (EI) of vibrationally cold analytes in the SMBs (cold EI) in a fly-through ion source. This ion source is inherently inert and further characterized by fast response and vacuum background filtration capability. The same ion source offers three modes of ionization including cold EI, classical EI and cluster chemical ionization (CI). Cold EI, as a main mode, provides enhanced molecular ions combined with an effective library sample identification, which is supplemented and complemented by a powerful isotope abundance analysis method and software. The range of low-volatility and thermally labile compounds amenable for analysis is significantly increased owing to the use of the contact-free, fly-through ion source and the ability to lower sample elution temperatures through the use of high column carrier gas flow rates. Effective, fast GC-MS is enabled particularly owing to the possible use of high column flow rates and improved system selectivity in view of the enhancement of the molecular ion. This fast GC-MS with SMB can be further improved via the added selectivity of MS-MS, which by itself benefits from the enhancement of the molecular ion, the most suitable parent ion for MS-MS. Supersonic GC-MS is characterized by low limits of detection (LOD), and its sensitivity is superior to that of standard GC-MS, particularly for samples that are hard for analysis. The GC separation of the Supersonic GC-MS can be improved with pulsed flow modulation (PFM) GC x GC-MS. Electron ionization LC-MS with SMB can also be combined with the Supersonic GC-MS, with fast and easy switching between these two modes of operation. (c) 2008 John Wiley & Sons, Ltd.
Potential efficiencies of open- and closed-cycle CO, supersonic, electric-discharge lasers
Monson, D. J.
1976-01-01
Computed open- and closed-cycle system efficiencies (laser power output divided by electrical power input) are presented for a CW carbon monoxide, supersonic, electric-discharge laser. Closed-system results include the compressor power required to overcome stagnation pressure losses due to supersonic heat addition and a supersonic diffuser. The paper shows the effect on the system efficiencies of varying several important parameters. These parameters include: gas mixture, gas temperature, gas total temperature, gas density, total discharge energy loading, discharge efficiency, saturated gain coefficient, optical cavity size and location with respect to the discharge, and supersonic diffuser efficiency. Maximum open-cycle efficiency of 80-90% is predicted; the best closed-cycle result is 60-70%.
Mobley, B. L.; Smith, S. D.; Van Norman, J. W.; Muppidi, S.; Clark, I
2016-01-01
Provide plume induced heating (radiation & convection) predictions in support of the LDSD thermal design (pre-flight SFDT-1) Predict plume induced aerodynamics in support of flight dynamics, to achieve targeted freestream conditions to test supersonic deceleration technologies (post-flight SFDT-1, pre-flight SFDT-2)
A Level-set based framework for viscous simulation of particle-laden supersonic flows
Das, Pratik; Sen, Oishik; Jacobs, Gustaaf; Udaykumar, H. S.
2017-06-01
Particle-laden supersonic flows are important in natural and industrial processes, such as, volcanic eruptions, explosions, pneumatic conveyance of particle in material processing etc. Numerical study of such high-speed particle laden flows at the mesoscale calls for a numerical framework which allows simulation of supersonic flow around multiple moving solid objects. Only a few efforts have been made toward development of numerical frameworks for viscous simulation of particle-fluid interaction in supersonic flow regime. The current work presents a Cartesian grid based sharp-interface method for viscous simulations of interaction between supersonic flow with moving rigid particles. The no-slip boundary condition is imposed at the solid-fluid interfaces using a modified ghost fluid method (GFM). The current method is validated against the similarity solution of compressible boundary layer over flat-plate and benchmark numerical solution for steady supersonic flow over cylinder. Further validation is carried out against benchmark numerical results for shock induced lift-off of a cylinder in a shock tube. 3D simulation of steady supersonic flow over sphere is performed to compare the numerically obtained drag co-efficient with experimental results. A particle-resolved viscous simulation of shock interaction with a cloud of particles is performed to demonstrate that the current method is suitable for large-scale particle resolved simulations of particle-laden supersonic flows.
International Nuclear Information System (INIS)
Wu, C.Y.R.; Crooks, J.B.; Yang, S.C.; Way, K.R.; Stwalley, W.C.
1977-01-01
The characterization of a lithium supersonic nozzle beam was made using spectroscopic techniques. It is found that at a stagnation pressure of 5.3 kPa (40 torr) and a nozzle throat diameter of 0.4 mm the ground state vibrational population of Li 2 can be described by a Boltzmann distribution with T/sub v/ = 195 +- 30 0 K. The rotational temperature is found to be T/sub r/ = 70 +- 20 0 K by band shape analysis. Measurements by quadrupole mass spectrometer indicates that approximately 10 mole per cent Li 2 dimers are formed at an oven body temperature of 1370 0 K n the supersonic nozzle expansion. This measured mole fraction is in good agreement with the existing dimerization theory
Turbulence models in supersonic flows
International Nuclear Information System (INIS)
Shirani, E.; Ahmadikia, H.; Talebi, S.
2001-05-01
The aim of this paper is to evaluate five different turbulence models when used in rather complicated two-dimensional and axisymmetric supersonic flows. They are Baldwin-Lomax, k-l, k-ε, k-ω and k-ζ turbulence models. The compressibility effects, axisymmetric correction terms and some modifications for transition region are used and tested in the models. Two computer codes based on the control volume approach and two flux-splitting methods. Roe and Van Leer, are developed. The codes are used to simulate supersonic mixing layers, flow behind axisymmetric body, under expanded jet, and flow over hollow cylinder flare. The results are compared with experimental data and behavior of the turbulence models is examined. It is shown that both k-l and k-ζ models produce very good results. It is also shown that the compressibility correction in the model is required to obtain more accurate results. (author)
High-magnification velocity field measurements on high-frequency, supersonic microactuators
Kreth, Phil; Fernandez, Erik; Ali, Mohd; Alvi, Farrukh
2014-11-01
The Resonance-Enhanced Microjet (REM) actuator developed at our laboratory produces pulsed, supersonic microjets by utilizing a number of microscale, flow-acoustic resonance phenomena. The microactuator used in this study consists of an underexpanded source jet flowing into a cylindrical cavity with a single orifice through which an unsteady, supersonic jet issues at a resonant frequency of 7 kHz. The flowfields of a 1 mm underexpanded free jet and the microactuator are studied in detail using high-magnification, phase-locked flow visualizations (microschlieren) and 2-component particle image velocimetry. The challenges of these measurements at such small scales and supersonic velocities are discussed. The results clearly show that the microactuator produces supersonic pulsed jets with velocities exceeding 400 m/s. This is the first direct measurement of the velocity field and its temporal evolution produced by such actuators. Comparisons are made between the flow visualizations, velocity field measurements, and simulations using Implicit LES for a similar microactuator. With high, unsteady momentum output, this type of microactuator has potential in a range of flow control applications.
A study of air breathing rockets. 3: Supersonic mode combustors
Masuya, G.; Chinzel, N.; Kudo, K.; Murakami, A.; Komuro, T.; Ishii, S.
An experimental study was made on supersonic mode combustors of an air breathing rocket engine. Supersonic streams of room-temperature air and hot fuel-rich rocket exhaust were coaxially mixed and burned in a concially diverging duct of 2 deg half-angle. The effect of air inlet Mach number and excess air ratio was investigated. Axial wall pressure distribution was measured to calculate one dimensional change of Mach number and stagnation temperature. Calculated results showed that supersonic combustion occurred in the duct. At the exit of the duct, gas sampling and Pitot pressure measurement was made, from which radial distributions of various properties were deduced. The distribution of mass fraction of elements from rocket exhaust showed poor mixing performance in the supersonic mode combustors compared with the previously investigated cylindrical subsonic mode combustors. Secondary combustion efficiency correlated well with the centerline mixing parameter, but not with Annushkin's non-dimensional combustor length. No major effect of air inlet Mach number or excess air ratio was seen within the range of conditions under which the experiment was conducted.
Advanced supersonic propulsion study. [with emphasis on noise level reduction
Sabatella, J. A. (Editor)
1974-01-01
A study was conducted to determine the promising propulsion systems for advanced supersonic transport application, and to identify the critical propulsion technology requirements. It is shown that noise constraints have a major effect on the selection of the various engine types and cycle parameters. Several promising advanced propulsion systems were identified which show the potential of achieving lower levels of sideline jet noise than the first generation supersonic transport systems. The non-afterburning turbojet engine, utilizing a very high level of jet suppression, shows the potential to achieve FAR 36 noise level. The duct-heating turbofan with a low level of jet suppression is the most attractive engine for noise levels from FAR 36 to FAR 36 minus 5 EPNdb, and some series/parallel variable cycle engines show the potential of achieving noise levels down to FAR 36 minus 10 EPNdb with moderate additional penalty. The study also shows that an advanced supersonic commercial transport would benefit appreciably from advanced propulsion technology. The critical propulsion technology needed for a viable supersonic propulsion system, and the required specific propulsion technology programs are outlined.
Numerical simulation and physical aspects of supersonic vortex breakdown
Liu, C. H.; Kandil, O. A.; Kandil, H. A.
1993-01-01
Existing numerical simulations and physical aspects of subsonic and supersonic vortex-breakdown modes are reviewed. The solution to the problem of supersonic vortex breakdown is emphasized in this paper and carried out with the full Navier-Stokes equations for compressible flows. Numerical simulations of vortex-breakdown modes are presented in bounded and unbounded domains. The effects of different types of downstream-exit boundary conditions are studied and discussed.
Characterization of supersonic radiation diffusion waves
International Nuclear Information System (INIS)
Moore, Alastair S.; Guymer, Thomas M.; Morton, John; Williams, Benjamin; Kline, John L.; Bazin, Nicholas; Bentley, Christopher; Allan, Shelly; Brent, Katie; Comley, Andrew J.; Flippo, Kirk; Cowan, Joseph; Taccetti, J. Martin; Mussack-Tamashiro, Katie; Schmidt, Derek W.; Hamilton, Christopher E.; Obrey, Kimberly; Lanier, Nicholas E.; Workman, Jonathan B.; Stevenson, R. Mark
2015-01-01
Supersonic and diffusive radiation flow is an important test problem for the radiative transfer models used in radiation-hydrodynamics computer codes owing to solutions being accessible via analytic and numeric methods. We present experimental results with which we compare these solutions by studying supersonic and diffusive flow in the laboratory. We present results of higher-accuracy experiments than previously possible studying radiation flow through up to 7 high-temperature mean free paths of low-density, chlorine-doped polystyrene foam and silicon dioxide aerogel contained by an Au tube. Measurements of the heat front position and absolute measurements of the x-ray emission arrival at the end of the tube are used to test numerical and analytical models. We find excellent absolute agreement with simulations provided that the opacity and the equation of state are adjusted within expected uncertainties; analytical models provide a good phenomenological match to measurements but are not in quantitative agreement due to their limited scope. - Highlights: • The supersonic, diffusion of x-rays through sub-solid density materials is studied. • The data are more diffusive and of higher velocity than any prior work. • Scaled 1D analytic diffusion models reproduce the heat front evolution. • Refined radiation transport approximations are tested in numerical simulations. • Simulations match the data if material properties are adjusted within uncertainties
Supersonic expansion of argon into vacuum
Energy Technology Data Exchange (ETDEWEB)
Habets, A H.M.
1977-01-21
A theoretical description of a free supersonic expansion process is given. Three distinct regions in the expansion are discussed, namely the continuum region, the gradual transition to the collisionless regime, and the free-molecular-flow stage. Important topics are the peaking-factor formalism, the thermal-conduction model, and the virtual-source formalism. The formation of the molecular beam from the expansion and condensation phenomena occurring in the expanding gas are discussed. The molecular beam machine used in the measurements is described and special attention is given to the cryopumps used in the supersonic sources as well as to the time-of-flight analysis of the molecular beam velocity distributions. Finally, the processing of experimental data is discussed, particularly the least-squares determination of best-fit representations of the measurements.
Supersonic expansion of argon into vacuum
International Nuclear Information System (INIS)
Habets, A.H.M.
1977-01-01
A theoretical description of a free supersonic expansion process is given. Three distinct regions in the expansion are discussed, namely the continuum region, the gradual transition to the collisionless regime, and the free-molecular-flow stage. Important topics are the peaking-factor formalism, the thermal-conduction model, and the virtual-source formalism. The formation of the molecular beam from the expansion and condensation phenomena occurring in the expanding gas are discussed. The molecular beam machine used in the measurements is described and special attention is given to the cryopumps used in the supersonic sources as well as to the time-of-flight analysis of the molecular beam velocity distributions. Finally, the processing of experimental data is discussed, particularly the least-squares determination of best-fit representations of the measurements
Absolute intensities of supersonic beams
International Nuclear Information System (INIS)
Beijerinck, H.C.W.; Habets, A.H.M.; Verster, N.F.
1977-01-01
In a molecular beam experiment the center-line intensity I(0) (particles s -1 sterad -1 ) and the flow rate dN/dt (particles s -1 ) of a beam source are important features. To compare the performance of different types of beam sources the peaking factor, kappa, is defined as the ratio kappa=π(I(0)/dN/dt). The factor π is added to normalize to kappa=1 for an effusive source. The ideal peaking factor for the supersonic flow from a nozzle follows from continuum theory. Numerical values of kappa are available. Experimental values of kappa for an argon expansion are presented in this paper, confirming these calculations. The actual center-line intensity of a supersonic beam source with a skimmer is reduced in comparison to this ideal intensity if the skimmer shields part of the virtual source from the detector. Experimental data on the virtual source radius are given enabling one to predict this shielding quantitatively. (Auth.)
A note on supersonic flow control with nanosecond plasma actuator
Zheng, J. G.; Cui, Y. D.; Li, J.; Khoo, B. C.
2018-04-01
A concept study on supersonic flow control using nanosecond pulsed plasma actuator is conducted by means of numerical simulation. The nanosecond plasma discharge is characterized by the generation of a micro-shock wave in ambient air and a residual heat in the discharge volume arising from the rapid heating of near-surface gas by the quick discharge. The residual heat has been found to be essential for the flow separation control over aerodynamic bodies like airfoil and backward-facing step. In this study, novel experiment is designed to utilize the other flow feature from discharge, i.e., instant shock wave, to control supersonic flow through shock-shock interaction. Both bow shock in front of a blunt body and attached shock anchored at the tip of supersonic projectile are manipulated via the discharged-induced shock wave in an appropriate manner. It is observed that drag on the blunt body is reduced appreciably. Meanwhile, a lateral force on sharp-edged projectile is produced, which can steer the body and give it an effective angle of attack. This opens a promising possibility for extending the applicability of this flow control technique in supersonic flow regime.
Velocity field measurements on high-frequency, supersonic microactuators
Kreth, Phillip A.; Ali, Mohd Y.; Fernandez, Erik J.; Alvi, Farrukh S.
2016-05-01
The resonance-enhanced microjet actuator which was developed at the Advanced Aero-Propulsion Laboratory at Florida State University is a fluidic-based device that produces pulsed, supersonic microjets by utilizing a number of microscale, flow-acoustic resonance phenomena. The microactuator used in this study consists of an underexpanded source jet that flows into a cylindrical cavity with a single, 1-mm-diameter exhaust orifice through which an unsteady, supersonic jet issues at a resonant frequency of 7 kHz. The flowfields of a 1-mm underexpanded free jet and the microactuator are studied in detail using high-magnification, phase-locked flow visualizations (microschlieren) and two-component particle image velocimetry. These are the first direct measurements of the velocity fields produced by such actuators. Comparisons are made between the flow visualizations and the velocity field measurements. The results clearly show that the microactuator produces pulsed, supersonic jets with velocities exceeding 400 m/s for roughly 60 % of their cycles. With high unsteady momentum output, this type of microactuator has potential in a range of ow control applications.
Underwood, Matthew C.; Guminsky, Michael D.
2015-01-01
Several public sector businesses and government agencies, including the National Aeronautics and Space Administration are currently working on solving key technological barriers that must be overcome in order to realize the vision of low-boom supersonic flights conducted over land. However, once these challenges are met, the manner in which this class of aircraft is integrated in the National Airspace System may become a potential constraint due to the significant environmental, efficiency, and economic repercussions that their integration may cause. Background research was performed on historic supersonic operations in the National Airspace System, including both flight deck procedures and air traffic controller procedures. Using this information, an experiment was created to test some of these historic procedures in a current-day, emerging Next Generation Air Transportation System (NextGen) environment and observe the interactions between commercial supersonic transport aircraft and modern-day air traffic. Data was gathered through batch simulations of supersonic commercial transport category aircraft operating in present-day traffic scenarios as a base-lining study to identify the magnitude of the integration problems and begin the exploration of new air traffic management technologies and architectures which will be needed to seamlessly integrate subsonic and supersonic transport aircraft operations. The data gathered include information about encounters between subsonic and supersonic aircraft that may occur when supersonic commercial transport aircraft are integrated into the National Airspace System, as well as flight time data. This initial investigation is being used to inform the creation and refinement of a preliminary Concept of Operations and for the subsequent development of technologies that will enable overland supersonic flight.
Two-dimensional unsteady lift problems in supersonic flight
Heaslet, Max A; Lomax, Harvard
1949-01-01
The variation of pressure distribution is calculated for a two-dimensional supersonic airfoil either experiencing a sudden angle-of-attack change or entering a sharp-edge gust. From these pressure distributions the indicial lift functions applicable to unsteady lift problems are determined for two cases. Results are presented which permit the determination of maximum increment in lift coefficient attained by an unrestrained airfoil during its flight through a gust. As an application of these results, the minimum altitude for safe flight through a specific gust is calculated for a particular supersonic wing of given strength and wing loading.
Effect of swirling device on flow behavior in a supersonic separator for natural gas dehydration
DEFF Research Database (Denmark)
Wen, Chuang; Li, Anqi; Walther, Jens Honore
2016-01-01
is designed for an annular supersonic separator. The supersonic swirling separation flow of natural gas is calculated using the Reynolds Stress model. The results show that the viscous heating and strong swirling flow cause the adverse pressure in the annular channel, which may negatively affect......The supersonic separator is a revolutionary device to remove the condensable components from gas mixtures. One of the key issues for this novel technology is the complex supersonic swirling flow that is not well understood. A swirling device composed of an ellipsoid and several helical blades...
Heat, mass and force flows in supersonic shockwave interaction
Dixon, John Michael
There is no cost effective way to deliver a payload to space and, with rising fuel prices, currently the price to travel commercially is also becoming more prohibitive to the public. During supersonic flight, compressive shock waves form around the craft which could be harnessed to deliver an additional lift on the craft. Using a series of hanging plates below a lifting wing design, the total lift generated can be increased above conventional values, while still maintaining a similar lift-to-drag ratio. Here, we study some of the flows involved in supersonic shockwave interaction. This analysis uses ANSYS Fluent Computational Fluid Dynamics package as the modeler. Our findings conclude an increase of up to 30% lift on the modeled craft while maintaining the lift-to-drag profile of the unmodified lifting wing. The increase in lift when utilizing the shockwave interaction could increase transport weight and reduce fuel cost for space and commercial flight, as well as mitigating negative effects associated with supersonic travel.
Dual-Pump CARS Development and Application to Supersonic Combustion
Magnotti, Gaetano; Cutler, Andrew D.
2012-01-01
A dual-pump Coherent Anti-Stokes Raman Spectroscopy (CARS) instrument has been developed to obtain simultaneous measurements of temperature and absolute mole fractions of N2, O2 and H2 in supersonic combustion and generate databases for validation and development of CFD codes. Issues that compromised previous attempts, such as beam steering and high irradiance perturbation effects, have been alleviated or avoided. Improvements in instrument precision and accuracy have been achieved. An axis-symmetric supersonic combusting coaxial jet facility has been developed to provide a simple, yet suitable flow to CFD modelers. Approximately one million dual-pump CARS single shots have been collected in the supersonic jet for varying values of flight and exit Mach numbers at several locations. Data have been acquired with a H2 co-flow (combustion case) or a N2 co-flow (mixing case). Results are presented and the effects of the compressibility and of the heat release are discussed.
Sexton, Scott Michael
Combustion in scramjet engines is faced with the limitation of brief residence time in the combustion chamber, requiring fuel and preheated air streams to mix and ignite in a matter of milliseconds. Accurate predictions of autoignition times are needed to design reliable supersonic combustion chambers. Most efforts in estimating non-premixed autoignition times have been devoted to hydrogen-air mixtures. The present work addresses hydrocarbon-air combustion, which is of interest for future scramjet engines. Computation of ignition in supersonic flows requires adequate characterization of ignition chemistry and description of the flow, both of which are derived in this work. In particular, we have shown that activation energy asymptotics combined with a previously derived reduced chemical kinetic mechanism provides analytic predictions of autoignition times in homogeneous systems. Results are compared with data from shock tube experiments, and previous expressions which employ a fuel depletion criterion. Ignition in scramjet engines has a strong dependence on temperature, which is found by perturbing the chemically frozen mixing layer solution. The frozen solution is obtained here, accounting for effects of viscous dissipation between the fuel and air streams. We investigate variations of thermodynamic and transport properties, and compare these to simplified mixing layers which neglect these variations. Numerically integrating the mixing layer problem reveals a nonmonotonic temperature profile, with a peak occurring inside the shear layer for sufficiently high Mach numbers. These results will be essential in computation of ignition distances in supersonic combustion chambers.
Castner, Ray
2012-01-01
The Supersonics Project, part of NASA's Fundamental Aeronautics Program, contains a number of technical challenge areas which include sonic boom community response, airport noise, high altitude emissions, cruise efficiency, light weight durable engines/airframes, and integrated multi-discipline system design. This presentation provides an overview of the current (2012) activities in the supersonic cruise efficiency technical challenge, and is focused specifically on propulsion technologies. The intent is to develop and validate high-performance supersonic inlet and nozzle technologies. Additional work is planned for design and analysis tools for highly-integrated low-noise, low-boom applications. If successful, the payoffs include improved technologies and tools for optimized propulsion systems, propulsion technologies for a minimized sonic boom signature, and a balanced approach to meeting efficiency and community noise goals. In this propulsion area, the work is divided into advanced supersonic inlet concepts, advanced supersonic nozzle concepts, low fidelity computational tool development, high fidelity computational tools, and improved sensors and measurement capability. The current work in each area is summarized.
Towards an Aero-Propulso-Servo-Elasticity Analysis of a Commercial Supersonic Transport
Connolly, Joseph W.; Kopasakis, George; Chwalowski, Pawel; Sanetrik, Mark D.; Carlson, Jan-Renee; Silva, Walt A.; McNamara, Jack
2016-01-01
This paper covers the development of an aero-propulso-servo-elastic (APSE) model using computational fluid dynamics (CFD) and linear structural deformations. The APSE model provides the integration of the following two previously developed nonlinear dynamic simulations: a variable cycle turbofan engine and an elastic supersonic commercial transport vehicle. The primary focus of this study is to provide a means to include relevant dynamics of a turbomachinery propulsion system into the aeroelastic studies conducted during a vehicle design, which have historically neglected propulsion effects. A high fidelity CFD tool is used here for the integration platform. The elastic vehicle neglecting the propulsion system serves as a comparison of traditional approaches to the APSE results. An overview of the methodology is presented for integrating the propulsion system and elastic vehicle. Static aeroelastic analysis comparisons between the traditional and developed APSE models for a wing tip detection indicate that the propulsion system impact on the vehicle elastic response could increase the detection by approximately ten percent.
Supersonic and transonic Mach probe for calibration control in the Trisonic Wind Tunnel
Directory of Open Access Journals (Sweden)
Alexandru Marius PANAIT
2017-12-01
Full Text Available A supersonic and high speed transonic Pitot Prandtl is described as it can be implemented in the Trisonic Wind Tunnel for calibration and verification of Mach number precision. A new calculation method for arbitrary precision Mach numbers is proposed and explained. The probe is specially designed for the Trisonic wind tunnel and would greatly simplify obtaining a precise Mach calibration in the critical high transonic and low supersonic regimes, where typically wind tunnels exhibit poor performance. The supersonic Pitot Prandtl combined probe is well known in the aerospace industry, however the proposed probe is a derivative of the standard configuration, combining a stout cone-cylinder probe with a supersonic Pitot static port which allows this configuration to validate the Mach number by three methods: conical flow method – using the pressure ports on a cone generatrix, the Schlieren-optical method of shock wave angle photogrammetry and the Rayleigh supersonic Pitot equation, while having an aerodynamic blockage similar to that of a scaled rocket model commonly used in testing. The proposed probe uses an existing cone-cylinder probe forebody and support, adding only an afterbody with a support for a static port.
Fialkov, Alexander B; Amirav, Aviv
2004-11-26
Several novel synthetic organic compounds were successfully analyzed with a unique type of GC-MS titled Supersonic GC-MS following a failure in their analysis with standard GC-MS. Supersonic GC-MS is based on interfacing GC and MS with a supersonic molecular beam (SMB) and on electron ionization of sample compounds as vibrationally cold molecules while in the SMB, or by cluster chemical ionization. The analyses of novel synthetic organic compounds significantly benefited from the extended range of compounds amenable to analyses with the Supersonic GC-MS. The Supersonic GC-MS enabled the analysis of thermally labile compounds that usually degrade in the GC injector, column and/or ion source. Due to the high carrier gas flow rate at the injector liner and column these compounds eluted without degradation at significantly lower elution temperatures and the use of fly-through EI ion source eliminated any sample degradation at the ion source. The cold EI feature of providing trustworthy enhanced molecular ion (M+), complemented by its optional further confirmation with cluster CI was highly valued by the synthetic organic chemists that were served by the Supersonic GC-MS. Furthermore, the provision of extended mass spectral structural, isomer and isotope information combined with short (a few minutes) GC-MS analysis times also proved beneficial for the analysis of unknown synthetic organic compounds. As a result, the synthetic organic chemists were provided with both qualitative and quantitative data on the composition of their synthetic mixture, and could better follow the path of their synthetic chemistry. Ten cases of such analyses are demonstrated in figures and discussed.
Jet arrays in supersonic crossflow — An experimental study
Ali, Mohd Yousuf; Alvi, Farrukh
2015-12-01
Jet injection into a supersonic crossflow is a classical fluid dynamics problem with many engineering applications. Several experimental and numerical studies have been taken up to analyze the interaction of a single jet with the incoming crossflow. However, there is a dearth of the literature on the interaction of multiple jets with one another and with the crossflow. Jets in a supersonic crossflow are known to produce a three-dimensional bow-shock structure due to the blockage of the flow. Multiple jets in a streamwise linear array interact with both one another and the incoming supersonic flow. In this paper, a parametric study is carried out to analyze the effect of microjet (sub-mm diameter) injection in a Mach 1.5 supersonic crossflow using flow visualization and velocity field measurements. The variation of the microjet orifice diameter and spacing within an array is used to study the three-dimensional nature of the flow field around the jets. The strength of the microjet-generated shock, scaling of the shock wave angle with the momentum coefficient, averaged streamwise, spanwise, and cross-stream velocity fields, and microjet array trajectories are detailed in the paper. It was found that shock angles of the microjet-generated shocks scale with the momentum coefficient for the three actuator configurations tested. As the microjets issue in the crossflow, a pair of longitudinal counter-rotating vortices (CVPs) are formed. The vortex pairs remain coherent for arrays with larger spanwise spacing between the micro-orifices and exhibit significant three-dimensionality similar to that of a single jet in crossflow. As the spacing between the jets is reduced, the CVPs merge resulting in a more two-dimensional flow field. The bow shock resulting from microjet injection also becomes nearly two-dimensional as the spacing between the micro-orifices is reduced. Trajectory estimations yield that microjets in an array have similar penetration as single jets. A notional
Dual-Pump CARS Development and Application to Supersonic Combustion
Magnotti, Gaetano
Successful design of hypersonic air-breathing engines requires new computational fluid dynamics (CFD) models for turbulence and turbulence-chemistry interaction in supersonic combustion. Unfortunately, not enough data are available to the modelers to develop and validate their codes, due to difficulties in taking measurements in such a harsh environment. Dual-pump coherent anti-Stokes Raman spectroscopy (CARS) is a non-intrusive, non-linear, laser-based technique that provides temporally and spatially resolved measurements of temperature and absolute mole fractions of N2, O2 and H2 in H2-air flames. A dual-pump CARS instrument has been developed to obtain measurements in supersonic combustion and generate databases for the CFD community. Issues that compromised previous attempts, such as beam steering and high irradiance perturbation effects, have been alleviated or avoided. Improvements in instrument precision and accuracy have been achieved. An axis-symmetric supersonic combusting coaxial jet facility has been developed to provide a simple, yet suitable flow to CFD modelers. The facility provides a central jet of hot "vitiated air" simulating the hot air entering the engine of a hypersonic vehicle flying at Mach numbers between 5 and 7. Three different silicon carbide nozzles, with exit Mach number 1, 1.6 and 2, are used to provide flows with the effects of varying compressibility. H2 co-flow is available in order to generate a supersonic combusting free jet. Dual-pump CARS measurements have been obtained for varying values of flight and exit Mach numbers at several locations. Approximately one million Dual-pump CARS single shots have been collected in the supersonic jet for varying values of flight and exit Mach numbers at several locations. Data have been acquired with a H2 co-flow (combustion case) or a N 2 co-flow (mixing case). Results are presented and the effects of the compressibility and of the heat release are discussed.
New methods for analyzing transport phenomena in supersonic ejectors
International Nuclear Information System (INIS)
Lamberts, Olivier; Chatelain, Philippe; Bartosiewicz, Yann
2017-01-01
Highlights: • Simulation of a supersonic ejector with the open source software for CFD OpenFOAM. • Validation of the numerical tool based on flow structures obtained by schlieren. • Application of the momentum and energy tube analysis tools to a supersonic ejector. • Extension of this framework to exergy to construct exergy transport tubes. • Quantification of local transfers and losses of exergy within the ejector. - Abstract: This work aims at providing novel insights into the quantification and the location of the transfers and the irreversibilities within supersonic ejectors, and their connection with the entrainment. In this study, we propose two different and complementary approaches. First of all, recent analysis tools based on momentum and energy tubes (Meyers and Meneveau (2013)) are extended to the present compressible flow context and applied to the mean-flow structure of turbulent flow within the ejector. Furthermore, the transport equation for the mean-flow total exergy is derived and exergy transport tubes are proposed as a tool for the investigation of transport phenomena within supersonic ejectors. In addition to this topological approach, an analysis based on classical stream tubes is performed in order to quantitatively investigate transfers between the primary and the secondary streams all along the ejector. Finally, the present work identifies the location of exergy losses and their origins. Throughout this analysis, new local and cumulative parameters related to transfers and irreversibilities are introduced. The proposed methodology sheds light on the complex phenomena at play and may serve as a basis for the analysis of transport phenomena within supersonic ejectors. For the ejector under consideration, although global transfers are more important in on-design conditions, it is shown that the net gain in exergy of the secondary stream is maximum for a value of the back pressure that is close to the critical back pressure, as
A model for supersonic and hypersonic impactors for nanoparticles
International Nuclear Information System (INIS)
Abouali, Omid; Ahmadi, Goodarz
2005-01-01
In this study the performance of supersonic and hypersonic impactors for collection efficiency of nanoparticles (in the size range of 2-100 nm) under various operating conditions is analyzed. Axisymmetric forms of the compressible Navier-Stokes and energy equations are solved and the airflow and thermal condition in the impactor are evaluated. A Lagrangian particle trajectory analysis procedure is used and the deposition rates of different size particles under various operating conditions are studied. For dilute particle concentrations, the assumption of one-way interaction is used and the effect of particles on gas flow field is ignored. The importance of drag, lift and Brownian forces on particle motions in supersonic impactors is discussed. Sensitivity of the simulation results to the use of different assumptions for the Cunningham correction coefficient is studied. It is shown that accurate evaluation of the gas mean free path and the Cunningham correction factor is important for accurate simulation of nano-particle transport and deposition in supersonic/hypersonic impactors. The computer simulation results are compared favorably with the available experimental data
Efficient solutions to the Euler equations for supersonic flow with embedded subsonic regions
Walters, Robert W.; Dwoyer, Douglas L.
1987-01-01
A line Gauss-Seidel (LGS) relaxation algorithm in conjunction with a one-parameter family of upwind discretizations of the Euler equations in two dimensions is described. Convergence of the basic algorithm to the steady state is quadratic for fully supersonic flows and is linear for other flows. This is in contrast to the block alternating direction implicit methods (either central or upwind differenced) and the upwind biased relaxation schemes, all of which converge linearly, independent of the flow regime. Moreover, the algorithm presented herein is easily coupled with methods to detect regions of subsonic flow embedded in supersonic flow. This allows marching by lines in the supersonic regions, converging each line quadratically, and iterating in the subsonic regions, and yields a very efficient iteration strategy. Numerical results are presented for two-dimensional supersonic and transonic flows containing oblique and normal shock waves which confirm the efficiency of the iteration strategy.
Performance of a CW double electric discharge for supersonic CO lasers
Stanton, A. C.; Hanson, R. K.; Mitchner, M.
1980-01-01
The results of an experimental investigation of a CW double discharge in supersonic CO mixtures are reported. Stable discharges in CO/N2 and CO/Ar mixtures, with a maximum energy loading of 0.5 eV/CO molecule, were achieved in a small-scale continuous-flow supersonic channel. Detailed measurements of the discharge characteristics were performed, including electrostatic probe measurements of floating potential and electron number density and spectroscopic measurements of the CO vibrational population distributions. The results of these measurements indicate that the vibrational excitation efficiency of the discharge is approximately 60%, for moderate levels of main discharge current. These experiments, on a small scale, demonstrate that the double-discharge scheme provides adequate vibrational energy loading for efficient CO laser operation under CW supersonic flow conditions.
Factors Influencing Pitot Probe Centerline Displacement in a Turbulent Supersonic Boundary Layer
Grosser, Wendy I.
1997-01-01
When a total pressure probe is used for measuring flows with transverse total pressure gradients, a displacement of the effective center of the probe is observed (designated Delta). While this phenomenon is well documented in incompressible flow and supersonic laminar flow, there is insufficient information concerning supersonic turbulent flow. In this study, three NASA Lewis Research Center Supersonic Wind Tunnels (SWT's) were used to investigate pitot probe centerline displacement in supersonic turbulent boundary layers. The relationship between test conditions and pitot probe centerline displacement error was to be determined. For this investigation, ten circular probes with diameter-to-boundary layer ratios (D/delta) ranging from 0.015 to 0.256 were tested in the 10 ft x 10 ft SWT, the 15 cm x 15 cm SWT, and the 1 ft x 1 ft SWT. Reynolds numbers of 4.27 x 10(exp 6)/m, 6.00 x 10(exp 6)/in, 10.33 x 10(exp 6)/in, and 16.9 x 10(exp 6)/m were tested at nominal Mach numbers of 2.0 and 2.5. Boundary layer thicknesses for the three tunnels were approximately 200 mm, 13 mm, and 30 mm, respectively. Initial results indicate that boundary layer thickness, delta, and probe diameter, D/delta play a minimal role in pitot probe centerline offset error, Delta/D. It appears that the Mach gradient, dM/dy, is an important factor, though the exact relationship has not yet been determined. More data is needed to fill the map before a conclusion can be drawn with any certainty. This research provides valuable supersonic, turbulent boundary layer data from three supersonic wind tunnels with three very different boundary layers. It will prove a valuable stepping stone for future research into the factors influencing pitot probe centerline offset error.
Supersonic Combustion of Hydrogen Jets System in Hypersonic Stream
International Nuclear Information System (INIS)
Zhapbasbaev, U.K.; Makashev, E.P.
2003-01-01
The data of calculated theoretical investigations of diffusive combustion of plane supersonic hydrogen jets in hypersonic stream received with Navier-Stokes parabola equations closed by one-para metrical (k-l) model of turbulence and multiply staged mechanism of hydrogen oxidation are given. Combustion mechanisms depending on the operating parameters are discussing. The influences of air stream composition and ways off fuel feed to the length of ignition delay and level quantity of hydrogen bum-out have been defined. The calculated theoretical results of investigations permit to make the next conclusions: 1. The diffusive combustion of the system of plane supersonic hydrogen jets in hypersonic flow happens in the cellular structures with alternation zones of intensive running of chemical reactions with their inhibition zones. 2. Gas dynamic and heat Mach waves cause a large - scale viscous formation intensifying mixing of fuel with oxidizer. 3. The system ignition of plane supersonic hydrogen jets in hypersonic airy co-flow happens with the formation of normal flame front of hydrogen airy mixture with transition to the diffusive combustion. 4. The presence of active particles in the flow composition initiates the ignition of hydrogen - airy mixture, provides the intensive running of chemical reactions and shortens the length of ignition delay. 5. The supersonic combustion of hydrogel-airy mixture is characterized by two zones: the intensive chemical reactions with an active energy heat release is occurring in the first zone and in the second - a slow hydrogen combustion limited by the mixing of fuel with oxidizer. (author)
Advanced supersonic technology and its implications for the future
Driver, C.
1979-01-01
A brief overview of the NASA Supersonic Cruise Research (SCR) program is presented. The SCR program has identified significant improvements in the areas of aerodynamics, structures, propulsion, noise reduction, takeoff and landing procedures, and advanced configuration concepts. These improvements tend to overcome most of the problems which led to the cancellation of the National SST program. They offer the promise of an advanced SST family of aircraft which are environmentally acceptable, have flexible range-payload capability, and are economically viable. The areas of technology addressed by the SCR program have direct application to advanced military aircraft and to supersonic executive aircraft.
Data Quality Assurance for Supersonic Jet Noise Measurements
Brown, Clifford A.; Henderson, Brenda S.; Bridges, James E.
2010-01-01
The noise created by a supersonic aircraft is a primary concern in the design of future high-speed planes. The jet noise reduction technologies required on these aircraft will be developed using scale-models mounted to experimental jet rigs designed to simulate the exhaust gases from a full-scale jet engine. The jet noise data collected in these experiments must accurately predict the noise levels produced by the full-scale hardware in order to be a useful development tool. A methodology has been adopted at the NASA Glenn Research Center s Aero-Acoustic Propulsion Laboratory to insure the quality of the supersonic jet noise data acquired from the facility s High Flow Jet Exit Rig so that it can be used to develop future nozzle technologies that reduce supersonic jet noise. The methodology relies on mitigating extraneous noise sources, examining the impact of measurement location on the acoustic results, and investigating the facility independence of the measurements. The methodology is documented here as a basis for validating future improvements and its limitations are noted so that they do not affect the data analysis. Maintaining a high quality jet noise laboratory is an ongoing process. By carefully examining the data produced and continually following this methodology, data quality can be maintained and improved over time.
THE TURBULENT DYNAMO IN HIGHLY COMPRESSIBLE SUPERSONIC PLASMAS
Energy Technology Data Exchange (ETDEWEB)
Federrath, Christoph [Research School of Astronomy and Astrophysics, The Australian National University, Canberra, ACT 2611 (Australia); Schober, Jennifer [Universität Heidelberg, Zentrum für Astronomie, Institut für Theoretische Astrophysik, Albert-Ueberle-Strasse 2, D-69120 Heidelberg (Germany); Bovino, Stefano; Schleicher, Dominik R. G., E-mail: christoph.federrath@anu.edu.au [Institut für Astrophysik, Georg-August-Universität Göttingen, Friedrich-Hund-Platz 1, D-37077 Göttingen (Germany)
2014-12-20
The turbulent dynamo may explain the origin of cosmic magnetism. While the exponential amplification of magnetic fields has been studied for incompressible gases, little is known about dynamo action in highly compressible, supersonic plasmas, such as the interstellar medium of galaxies and the early universe. Here we perform the first quantitative comparison of theoretical models of the dynamo growth rate and saturation level with three-dimensional magnetohydrodynamical simulations of supersonic turbulence with grid resolutions of up to 1024{sup 3} cells. We obtain numerical convergence and find that dynamo action occurs for both low and high magnetic Prandtl numbers Pm = ν/η = 0.1-10 (the ratio of viscous to magnetic dissipation), which had so far only been seen for Pm ≥ 1 in supersonic turbulence. We measure the critical magnetic Reynolds number, Rm{sub crit}=129{sub −31}{sup +43}, showing that the compressible dynamo is almost as efficient as in incompressible gas. Considering the physical conditions of the present and early universe, we conclude that magnetic fields need to be taken into account during structure formation from the early to the present cosmic ages, because they suppress gas fragmentation and drive powerful jets and outflows, both greatly affecting the initial mass function of stars.
Features of the laminar-turbulent transition in supersonic axisymmetric microjets
Maslov, A. A.; Aniskin, V. M.; Mironov, S. G.
2016-10-01
In this paper, a supersonic core length of microjets is studied in terms of laminar-turbulent transition in the microjet mixing layer. Previously, it was discovered that this transition has a determining influence on the supersonic core length. A possibility of simulation of microjet flows is estimated through the use of Reynolds number computed by the nozzle diameter and the nozzle exit gas parameters. These experimental data were obtained using Pitot tube when the jets escaping from the nozzle of 0.6 mm into the low-pressure space. This experiment made it possible to achieve a large jet pressure ratio when the Reynolds number values were low which specify the microjets' behavior. The supersonic core length, phase of the laminar-turbulent transition and flow characteristics in the space are obtained. Such an approach provides simulation of the characteristics of microjets and macrojets, and also explains preliminary proposition and some data obtained for microjets.
Advanced supersonic propulsion study, phases 3 and 4. [variable cycle engines
Allan, R. D.; Joy, W.
1977-01-01
An evaluation of various advanced propulsion concepts for supersonic cruise aircraft resulted in the identification of the double-bypass variable cycle engine as the most promising concept. This engine design utilizes special variable geometry components and an annular exhaust nozzle to provide high take-off thrust and low jet noise. The engine also provides good performance at both supersonic cruise and subsonic cruise. Emission characteristics are excellent. The advanced technology double-bypass variable cycle engine offers an improvement in aircraft range performance relative to earlier supersonic jet engine designs and yet at a lower level of engine noise. Research and technology programs required in certain design areas for this engine concept to realize its potential benefits include refined parametric analysis of selected variable cycle engines, screening of additional unconventional concepts, and engine preliminary design studies. Required critical technology programs are summarized.
Numerical Studies of a Supersonic Fluidic Diverter Actuator for Flow Control
Gokoglu, Suleyman A.; Kuczmarski, Maria A.; Culley, Dennis e.; Raghu, Surya
2010-01-01
The analysis of the internal flow structure and performance of a specific fluidic diverter actuator, previously studied by time-dependent numerical computations for subsonic flow, is extended to include operation with supersonic actuator exit velocities. The understanding will aid in the development of fluidic diverters with minimum pressure losses and advanced designs of flow control actuators. The self-induced oscillatory behavior of the flow is successfully predicted and the calculated oscillation frequencies with respect to flow rate have excellent agreement with our experimental measurements. The oscillation frequency increases with Mach number, but its dependence on flow rate changes from subsonic to transonic to supersonic regimes. The delay time for the initiation of oscillations depends on the flow rate and the acoustic speed in the gaseous medium for subsonic flow, but is unaffected by the flow rate for supersonic conditions
Direct Connect Supersonic Combustion Facility (Research Cell 22)
Federal Laboratory Consortium — Description: RC22 is a continuous-flow, direct-connect supersonic-combustion research facility that is capable of simulating flight conditions from Mach 3.0 to Mach...
Supersonic laser-induced jetting of aluminum micro-droplets
International Nuclear Information System (INIS)
Zenou, M.; Sa'ar, A.; Kotler, Z.
2015-01-01
The droplet velocity and the incubation time of pure aluminum micro-droplets, printed using the method of sub-nanosecond laser induced forward transfer, have been measured indicating the formation of supersonic laser-induced jetting. The incubation time and the droplet velocity were extracted by measuring a transient electrical signal associated with droplet landing on the surface of the acceptor substrate. This technique has been exploited for studying small volume droplets, in the range of 10–100 femto-litters for which supersonic velocities were measured. The results suggest elastic propagation of the droplets across the donor-to-acceptor gap, a nonlinear deposition dynamics on the surface of the acceptor and overall efficient energy transfer from the laser beam to the droplets
Supersonic laser-induced jetting of aluminum micro-droplets
Energy Technology Data Exchange (ETDEWEB)
Zenou, M. [Racah Institute of Physics and the Harvey M. Kruger Family Center for Nano-science and Nanotechnology, The Hebrew University of Jerusalem, 91904 Jerusalem (Israel); Additive Manufacturing Lab, Orbotech Ltd., P.O. Box 215, 81101 Yavne (Israel); Sa' ar, A. [Racah Institute of Physics and the Harvey M. Kruger Family Center for Nano-science and Nanotechnology, The Hebrew University of Jerusalem, 91904 Jerusalem (Israel); Kotler, Z. [Additive Manufacturing Lab, Orbotech Ltd., P.O. Box 215, 81101 Yavne (Israel)
2015-05-04
The droplet velocity and the incubation time of pure aluminum micro-droplets, printed using the method of sub-nanosecond laser induced forward transfer, have been measured indicating the formation of supersonic laser-induced jetting. The incubation time and the droplet velocity were extracted by measuring a transient electrical signal associated with droplet landing on the surface of the acceptor substrate. This technique has been exploited for studying small volume droplets, in the range of 10–100 femto-litters for which supersonic velocities were measured. The results suggest elastic propagation of the droplets across the donor-to-acceptor gap, a nonlinear deposition dynamics on the surface of the acceptor and overall efficient energy transfer from the laser beam to the droplets.
Supersonic acoustic intensity with statistically optimized near-field acoustic holography
DEFF Research Database (Denmark)
Fernandez Grande, Efren; Jacobsen, Finn
2011-01-01
The concept of supersonic acoustic intensity was introduced some years ago for estimating the fraction of the flow of energy radiated by a source that propagates to the far field. It differs from the usual (active) intensity by excluding the near-field energy resulting from evanescent waves...... to the information provided by the near-field acoustic holography technique. This study proposes a version of the supersonic acoustic intensity applied to statistically optimized near-field acoustic holography (SONAH). The theory, numerical results and an experimental study are presented. The possibility of using...
The Intensity of the Light Diffraction by Supersonic Longitudinal Waves in Solid
Directory of Open Access Journals (Sweden)
Minasyan V.
2010-04-01
Full Text Available First, we predict existence of transverse electromagnetic field created by supersonic longitudinal waves in solid. This electromagnetic wave with frequency of ultrasonic field is moved by velocity of supersonic field toward of direction propagation of one. The average Poynting vector of superposition field is calculated by presence of the transverse electromagnetic and the optical fields which in turn provides appearance the diffraction of light.
Supersonic particle in a low damped complex plasma under microgravity conditions
Zaehringer, E.; Zhdanov, S.; Schwabe, M.; Mohr, D. P.; Knapek, C. A.; Huber, P.; Semenov, I.; Thomas, H. M.
2018-01-01
We discuss the diagnostics of a complex plasma cloud recorded in experiments performed in the framework of the Ekoplasma project. A supersonic extra particle is used as a probe of the cloud dynamics. A fine-structured Mach cone behind the supersonic particle is observed. We investigate the spatial and temporal development of the Mach cone with a computer based measurement to determine the speed of sound of the particle cloud. Also time and position dependent characteristics of the velocity field are recorded.
Design and Testing of CO2 Compression Using Supersonic Shockware Technology
Energy Technology Data Exchange (ETDEWEB)
Joe Williams; Michael Aarnio; Kirk Lupkes; Sabri Deniz
2010-08-31
Documentation of work performed by Ramgen and subcontractors in pursuit of design and construction of a 10 MW supersonic CO{sub 2} compressor and supporting facility. The compressor will demonstrate application of Ramgen's supersonic compression technology at an industrial scale using CO{sub 2} in a closed-loop. The report includes details of early feasibility studies, CFD validation and comparison to experimental data, static test experimental results, compressor and facility design and analyses, and development of aero tools.
Advanced nuclear turbojet powerplant characteristics summary for supersonic aircraft
International Nuclear Information System (INIS)
Larson, John W.
1959-01-01
The estimated powerplant characteristics of an advanced nuclear powerplant intended for use in a nuclear supersonic manned airplane is contained in this report. This nuclear powerplant consists of a 575 MW, high temperature, lithium-cooled, solid fuel element-type reactor coupled to six turbojet engines especially designed for a supersonic nuclear airplane. The lithium coolant passes from the reactor at 2000F directly to the engine radiators without the use of an intermediate heat exchanger. The engines are fitted with burners enabling the thrust produced by the nuclear powerplant to be augmented by the use of chemical fuel for the take-off, transonic acceleration and landing portions of the flight. The powerplant components have been selected for a maximum thrust-to-weight ratio at Mach 3 and 55,000 feet altitude on nuclear heat only operation compromised for net thrust produced with chemical fuel augmentation during the transonic portion of flight. The power plant data presented, therefore, are primarily applicable to an all supersonic mission on nuclear heat alone. The powerplant data presented in this report are an extension of data contained in PWAC-243, 'NJ-14 All-Nuclear Supersonic Bomber Powerplant Characteristics Summary, March 11, 1958', to a higher reactor power. In addition, the engine compressor pressure ratio has been increased to improve transonic thrust characteristics. Weight data are tabulated for the 575 MW powerplant. The engine envelope based on preliminary radiator size estimates is illustrated. A liquid metal system flow schematic and piping data are included. Shield information including reactor shield outline, assumptions, weights, and direct dose pattern at 50 feet is also included. Estimated performance on nuclear heat only operation and nuclear heat plus burning is presented for an envelope of flight conditions.
Tangential inlet supersonic separators: a novel apparatus for gas purification
DEFF Research Database (Denmark)
Wen, Chuang; Walther, Jens Honore; Yang, Yan
2016-01-01
A novel supersonic separator with a tangential inlet is designed to remove the condensable components from gas mixtures. The dynamic parameters of natural gas in the supersonic separation process are numerically calculated using the Reynolds stress turbulence model with the Peng-Robinson real gas...... be generated by the tangential inlet, and it increases to the maximum of 200 m/s at the nozzle throat due to decrease of the nozzle area of the converging part. The tangential velocity can maintain the value of about 160 m/s at the nozzle exit, and correspondingly generates the centrifugal acceleration of 3...
Effect of delta wing on the particle flow in a novel gas supersonic separator
DEFF Research Database (Denmark)
Wen, Chuang; Yang, Yan; Walther, Jens Honore
2016-01-01
The present work presents numerical simulations of the complex particle motion in a supersonic separator with a delta wing located in the supersonic flow. The effect of the delta wing on the strong swirling flow is analysed using the Discrete Particle Method. The results show that the delta wings...
Freedman, M. I.; Sipcic, S.; Tseng, K.
1985-01-01
A frequency domain Green's Function Method for unsteady supersonic potential flow around complex aircraft configurations is presented. The focus is on the supersonic range wherein the linear potential flow assumption is valid. In this range the effects of the nonlinear terms in the unsteady supersonic compressible velocity potential equation are negligible and therefore these terms will be omitted. The Green's function method is employed in order to convert the potential flow differential equation into an integral one. This integral equation is then discretized, through standard finite element technique, to yield a linear algebraic system of equations relating the unknown potential to its prescribed co-normalwash (boundary condition) on the surface of the aircraft. The arbitrary complex aircraft configuration (e.g., finite-thickness wing, wing-body-tail) is discretized into hyperboloidal (twisted quadrilateral) panels. The potential and co-normalwash are assumed to vary linearly within each panel. The long range goal is to develop a comprehensive theory for unsteady supersonic potential aerodynamic which is capable of yielding accurate results even in the low supersonic (i.e., high transonic) range.
Lifescience Database Archive (English)
Full Text Available _MACMU Mediator of DNA damage checkpoint protein 1... 29 8.4 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus...DFPTGSMILGISG----IRSAYLTGRGSIIMRGKAEIENIGNSRQAIIITE 263 >sp|Q8JTG9|L_ABLVH Large structural protein OS=Australian bat lyssavirus...) Link to BlastX Result : Swiss-Prot sp_hit_id Q9QSP0 Definition sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavi...rus (isolate Bat/AUS/1996) Align length 52 Score (bit) 3
Lifescience Database Archive (English)
Full Text Available esult : Swiss-Prot sp_hit_id Q9QSP0 Definition sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus.... 30 8.0 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lyssavirus (isolate Bat/AUS/1996) GN=...avirus (isolate Human/AUS/1998) GN=L PE=3 SV=1 Length = 2127 Score = 32.7 bits (73)...RSRKCLSDLTQFYQKSSPIE--KLLNYTLGNRGLR 145 >sp|Q8JTG9|L_ABLVH Large structural protein OS=Australian bat lyss
An experimental study of the supersonic, dual, coaxial jets impinging on an inclined flat plate
International Nuclear Information System (INIS)
Kim, Jung Bae; Lee, Jun Hee; Woo, Sun Hoon; Kim, Heuy Dong
2002-01-01
The impinging supersonic jets have been applied for rocket launching system, thrust control, gas turbine blade cooling, etc. Recently the supersonic, dual, coaxial jets are being extensively used in many diverse fields of industrial processes since they lead to more improved performance, compared with the conventional supersonic jets impinging on an object. In the present study, experimentation is carried out to investigate the supersonic, dual, coaxial jets impinging on an inclined flat plate. A convergent-divergent nozzle with a design Mach number of 2.0 and annular sonic nozzle are used to make the dual, coaxial jet flows. The angle of the impinging flat plate is varied from 30 .deg. to 60 .deg. and the distance between the dual coaxial nozzle and flat plate is also varied. Detailed pressures on the impinging plate are measured to analyze the flow fields, which are also visualized using Schlieren optical method
Kr-PLIF for scalar imaging in supersonic flows.
Narayanaswamy, V; Burns, R; Clemens, N T
2011-11-01
Experiments were performed to explore the use of two-photon planar laser-induced fluorescence (PLIF) of krypton gas for applications of scalar imaging in supersonic flows. Experiments were performed in an underexpanded jet of krypton, which exhibited a wide range of conditions, from subsonic to hypersonic. Excellent signal-to-noise ratios were obtained, showing the technique is suitable for single-shot imaging. The data were used to infer the distribution of gas density and temperature by correcting the fluorescence signal for quenching effects and using isentropic relations. The centerline variation of the density and temperature from the experiments agree very well with those predicted with an empirical correlation and a CFD simulation (FLUENT). Overall, the high signal levels and quantifiable measurements indicate that Kr-PLIF could be an effective scalar marker for use in supersonic and hypersonic flow applications.
Benson, Thomas J.
2014-01-01
The Method of Characteristics (MOC) is a classic technique for designing supersonic nozzles. An interactive computer program using MOC has been developed to allow engineers to design and analyze supersonic nozzle flow fields. The program calculates the internal flow for many classic designs, such as a supersonic wind tunnel nozzle, an ideal 2D or axisymmetric nozzle, or a variety of plug nozzles. The program also calculates the plume flow produced by the nozzle and the external flow leading to the nozzle exit. The program can be used to assess the interactions between the internal, external and plume flows. By proper design and operation of the nozzle, it may be possible to lessen the strength of the sonic boom produced at the rear of supersonic aircraft. The program can also calculate non-ideal nozzles, such as simple cone flows, to determine flow divergence and nonuniformities at the exit, and its effect on the plume shape. The computer program is written in Java and is provided as free-ware from the NASA Glenn central software server.
Erosion of graphite surface exposed to hot supersonic hydrogen gas
Sharma, O. P.
1972-01-01
A theoretical model based on laminar boundary layer flow equations was developed to predict the erosion rate of a graphite (AGCarb-101) surface exposed to a hot supersonic stream of hydrogen gas. The supersonic flow in the nozzle outside the boundary layer formed over the surface of the specimen was determined by assuming one-dimensional isentropic conditions. An overall surface reaction rate expression based on experimental studies was used to describe the interaction of hydrogen with graphite. A satisfactory agreement was found between the results of the computation, and the available experimental data. Some shortcomings of the model and further possible improvements are discussed.
International Nuclear Information System (INIS)
Podestà, Alessandro; Borghi, Francesca; Indrieri, Marco; Bovio, Simone; Piazzoni, Claudio; Milani, Paolo
2015-01-01
Great emphasis is placed on the development of integrated approaches for the synthesis and the characterization of ad hoc nanostructured platforms, to be used as templates with controlled morphology and chemical properties for the investigation of specific phenomena of great relevance in interdisciplinary fields such as biotechnology, medicine, and advanced materials. Here, we discuss the crucial role and the advantages of thin film deposition strategies based on cluster-assembling from supersonic cluster beams. We select cluster-assembled nanostructured titania (ns-TiO 2 ) as a case study to demonstrate that accurate control over morphological parameters can be routinely achieved, and consequently, over several relevant interfacial properties and phenomena, like surface charging in a liquid electrolyte, and proteins and nanoparticles adsorption. In particular, we show that the very good control of nanoscale morphology is obtained by taking advantage of simple scaling laws governing the ballistic deposition regime of low-energy, mass-dispersed clusters with reduced surface mobility
Energy Technology Data Exchange (ETDEWEB)
Podestà, Alessandro, E-mail: alessandro.podesta@mi.infn.it, E-mail: pmilani@mi.infn.it; Borghi, Francesca; Indrieri, Marco; Bovio, Simone; Piazzoni, Claudio; Milani, Paolo, E-mail: alessandro.podesta@mi.infn.it, E-mail: pmilani@mi.infn.it [Centro Interdisciplinare Materiali e Interfacce Nanostrutturati (C.I.Ma.I.Na.), Dipartimento di Fisica, Università degli Studi di Milano, via Celoria 16, 20133 Milano (Italy)
2015-12-21
Great emphasis is placed on the development of integrated approaches for the synthesis and the characterization of ad hoc nanostructured platforms, to be used as templates with controlled morphology and chemical properties for the investigation of specific phenomena of great relevance in interdisciplinary fields such as biotechnology, medicine, and advanced materials. Here, we discuss the crucial role and the advantages of thin film deposition strategies based on cluster-assembling from supersonic cluster beams. We select cluster-assembled nanostructured titania (ns-TiO{sub 2}) as a case study to demonstrate that accurate control over morphological parameters can be routinely achieved, and consequently, over several relevant interfacial properties and phenomena, like surface charging in a liquid electrolyte, and proteins and nanoparticles adsorption. In particular, we show that the very good control of nanoscale morphology is obtained by taking advantage of simple scaling laws governing the ballistic deposition regime of low-energy, mass-dispersed clusters with reduced surface mobility.
Podestà, Alessandro; Borghi, Francesca; Indrieri, Marco; Bovio, Simone; Piazzoni, Claudio; Milani, Paolo
2015-12-01
Great emphasis is placed on the development of integrated approaches for the synthesis and the characterization of ad hoc nanostructured platforms, to be used as templates with controlled morphology and chemical properties for the investigation of specific phenomena of great relevance in interdisciplinary fields such as biotechnology, medicine, and advanced materials. Here, we discuss the crucial role and the advantages of thin film deposition strategies based on cluster-assembling from supersonic cluster beams. We select cluster-assembled nanostructured titania (ns-TiO2) as a case study to demonstrate that accurate control over morphological parameters can be routinely achieved, and consequently, over several relevant interfacial properties and phenomena, like surface charging in a liquid electrolyte, and proteins and nanoparticles adsorption. In particular, we show that the very good control of nanoscale morphology is obtained by taking advantage of simple scaling laws governing the ballistic deposition regime of low-energy, mass-dispersed clusters with reduced surface mobility.
Flow control of micro-ramps on supersonic forward-facing step flow
International Nuclear Information System (INIS)
Zhang Qing-Hu; Zhu Tao; Wu Anping; Yi Shihe
2016-01-01
The effects of the micro-ramps on supersonic turbulent flow over a forward-facing step (FFS) was experimentally investigated in a supersonic low-noise wind tunnel at Mach number 3 using nano-tracer planar laser scattering (NPLS) and particle image velocimetry (PIV) techniques. High spatiotemporal resolution images and velocity fields of supersonic flow over the testing model were captured. The fine structures and their spatial evolutionary characteristics without and with the micro-ramps were revealed and compared. The large-scale structures generated by the micro-ramps can survive the downstream FFS flowfield. The micro-ramps control on the flow separation and the separation shock unsteadiness was investigated by PIV results. With the micro-ramps, the reduction in the range of the reversal flow zone in streamwise direction is 50% and the turbulence intensity is also reduced. Moreover, the reduction in the average separated region and in separation shock unsteadiness are 47% and 26%, respectively. The results indicate that the micro-ramps are effective in reducing the flow separation and the separation shock unsteadiness. (paper)
Nonlinear Dynamic Modeling and Controls Development for Supersonic Propulsion System Research
Connolly, Joseph W.; Kopasakis, George; Paxson, Daniel E.; Stuber, Eric; Woolwine, Kyle
2012-01-01
This paper covers the propulsion system component modeling and controls development of an integrated nonlinear dynamic simulation for an inlet and engine that can be used for an overall vehicle (APSE) model. The focus here is on developing a methodology for the propulsion model integration, which allows for controls design that prevents inlet instabilities and minimizes the thrust oscillation experienced by the vehicle. Limiting thrust oscillations will be critical to avoid exciting vehicle aeroelastic modes. Model development includes both inlet normal shock position control and engine rotor speed control for a potential supersonic commercial transport. A loop shaping control design process is used that has previously been developed for the engine and verified on linear models, while a simpler approach is used for the inlet control design. Verification of the modeling approach is conducted by simulating a two-dimensional bifurcated inlet and a representative J-85 jet engine previously used in a NASA supersonics project. Preliminary results are presented for the current supersonics project concept variable cycle turbofan engine design.
Effect of Microjet Injection on Supersonic Jet Noise
Zaman, K. B. M. Q.; Podboy, G. G.
2010-01-01
The effect of microjet (jet) injection on the noise from supersonic jets is investigated. Three convergent-divergent (C-D) nozzles and one convergent nozzle, all having the same exit diameters, are used in the study. The jets are injected perpendicular to the primary jet close to the nozzle lip from six equally-spaced ports having a jet-to-primary-jet diameter ratio of 0.0054. Effects in the over-expanded, fully expanded as well as underexpanded flow regimes are explored. Relative to the effect on subsonic jets, larger reductions in the overall sound pressure level (OASPL) are achieved in most supersonic conditions. The largest reductions are typically associated with suppression of screech and transonic tones. For a shock-free, fully expanded case, the OASPL reductions achieved are comparable to that in the subsonic case; the same correlation, found for subsonic jet noise reduction at shallow observation angle, applies.
Visualization of supersonic diesel fuel jets using a shadowgraph technique
Pianthong, Kulachate; Behnia, Masud; Milton, Brian E.
2001-04-01
High-speed liquid jets have been widely used to cut or penetrate material. It has been recently conjectured that the characteristics of high-speed fuel jets may also be of benefit to engines requiring direct fuel injection into the combustion chamber. Important factors are combustion efficiency and emission control enhancement for better atomization. Fundamental studies of very high velocity liquid jets are therefore very important. The characteristics and behavior of supersonic liquid jets have been studied with the aid of a shadowgraph technique. The high-speed liquid jet (in the supersonic range) is generated by the use of a vertical, single stage powder gun. The performance of the launcher and its relation to the jet exit velocity, with a range of nozzle shapes, has been examined. This paper presents the visual evidence of supersonic diesel fuel jets (velocity around 2000 m/s) investigated by the shadowgraph method. An Argon jet has been used as a light source. With a rise time of 0.07 microseconds, light duration of 0.2 microseconds and the use of high speed Polaroid film, the shadowgraph method can effectively capture the hypersonic diesel fuel jet and its strong leading edge shock waves. This provides a clearer picture of each stage of the generation of hypersonic diesel fuel jets and makes the study of supersonic diesel fuel jet characteristics and the potential for auto-ignition possible. Also, in the experiment, a pressure relief section has been used to minimize the compressed air or blast wave ahead of the projectile. However, the benefit of using a pressure relief section in the design is not clearly known. To investigate this effect, additional experiments have been performed with the use of the shadowgraph method, showing the projectile leaving and traveling inside the nozzle at a velocity around 1100 m/s.
Investigation of nozzle contours in the CSIR supersonic wind tunnel
CSIR Research Space (South Africa)
Vallabh, Bhavya
2017-09-01
Full Text Available Contours in the CSIR Supersonic Wind Tunnel B Vallabha,b and BW Skewsa Received 17 February 2017, in revised form 23 June 2017 and accepted 25 June 2017 R & D Journal of the South African Institution of Mechanical Engineering 2017, 33, 32-41 http... with the Sivellsâ nozzle design method and the method of characteristics technique to design the nozzle profiles for the full supersonic Mach number range ðð †ðŽðŽ †ðð.5 of the facility. Automatic computation was used for the profile...
Ethylene tetrafluoroethylene nanofibers prepared by CO2 laser supersonic drawing
Directory of Open Access Journals (Sweden)
A. Suzuki
2013-06-01
Full Text Available Ethylene tetrafluoroethylene (ETFE nanofibers were prepared by carbon dioxide (CO2 laser irradiation of asspun ETFE fibers with four different melt flow rates (MFRs in a supersonic jet that was generated by blowing air into a vacuum chamber through the fiber injection orifice. The drawability and superstructure of fibers produced by CO2 laser supersonic drawing depend on the laser power, the chamber pressure, the fiber injection speed, and the MFR. Nanofibers obtained using a laser power of 20 W, a chamber pressure of 20 kPa, and an MFR of 308 g•10 min–1 had an average diameter of 0.303 µm and a degree of crystallinity of 54%.
On the Scaling Law for Broadband Shock Noise Intensity in Supersonic Jets
Kanudula, Max
2009-01-01
A theoretical model for the scaling of broadband shock noise intensity in supersonic jets was formulated on the basis of linear shock-shear wave interaction. An hypothesis has been postulated that the peak angle of incidence (closer to the critical angle) for the shear wave primarily governs the generation of sound in the interaction process rather than the noise generation contribution from off-peak incident angles. The proposed theory satisfactorily explains the well-known scaling law for the broadband shock -associated noise in supersonic jets.
An atomic coilgun: using pulsed magnetic fields to slow a supersonic beam
International Nuclear Information System (INIS)
Narevicius, E; Parthey, C G; Libson, A; Narevicius, J; Chavez, I; Even, U; Raizen, M G
2007-01-01
We report the experimental demonstration of a novel method to slow atoms and molecules with permanent magnetic moments using pulsed magnetic fields. In our experiments, we observe the slowing of a supersonic beam of metastable neon from 461.0 ± 7.7 to 403 ± 16 m s -1 in 18 stages, where the slowed peak is clearly separated from the initial distribution. This method has broad applications as it may easily be generalized, using seeding and entrainment into supersonic beams, to all paramagnetic atoms and molecules
Commercial supersonic flight; the past and the future
Van Moorselaar, M.
2013-01-01
Contemporary world is all about going faster than ever before. Various communication technologies allow us to interact and trade almost instantly with the entire world. Computers are faster than ever before. One thing, however, has slowed down, the speed at which we travel. Supersonic travel is no
Large Eddy simulation of turbulent hydrogen-fuelled supersonic combustion in an air cross-flow
Ingenito, A.; Cecere, D.; Giacomazzi, E.
2013-09-01
The main aim of this article is to provide a theoretical understanding of the physics of supersonic mixing and combustion. Research in advanced air-breathing propulsion systems able to push vehicles well beyond is of interest around the world. In a scramjet, the air stream flow captured by the inlet is decelerated but still maintains supersonic conditions. As the residence time is very short , the study of an efficient mixing and combustion is a key issue in the ongoing research on compressible flows. Due to experimental difficulties in measuring complex high-speed unsteady flowfields, the most convenient way to understand unsteady features of supersonic mixing and combustion is to use computational fluid dynamics. This work investigates supersonic combustion physics in the Hyshot II combustion chamber within the Large Eddy simulation framework. The resolution of this turbulent compressible reacting flow requires: (1) highly accurate non-dissipative numerical schemes to properly simulate strong gradients near shock waves and turbulent structures away from these discontinuities; (2) proper modelling of the small subgrid scales for supersonic combustion, including effects from compressibility on mixing and combustion; (3) highly detailed kinetic mechanisms (the Warnatz scheme including 9 species and 38 reactions is adopted) accounting for the formation and recombination of radicals to properly predict flame anchoring. Numerical results reveal the complex topology of the flow under investigation. The importance of baroclinic and dilatational effects on mixing and flame anchoring is evidenced. Moreover, their effects on turbulence-scale generation and the scaling law are analysed.
Cryptococcus neoformans sexual reproduction is controlled by a quorum sensing peptide.
Tian, Xiuyun; He, Guang-Jun; Hu, Pengjie; Chen, Lei; Tao, Changyu; Cui, Ying-Lu; Shen, Lan; Ke, Weixin; Xu, Haijiao; Zhao, Youbao; Xu, Qijiang; Bai, Fengyan; Wu, Bian; Yang, Ence; Lin, Xiaorong; Wang, Linqi
2018-06-01
Bacterial quorum sensing is a well-characterized communication system that governs a large variety of collective behaviours. By comparison, quorum sensing regulation in eukaryotic microbes remains poorly understood, especially its functional role in eukaryote-specific behaviours, such as sexual reproduction. Cryptococcus neoformans is a prevalent fungal pathogen that has two defined sexual cycles (bisexual and unisexual) and is a model organism for studying sexual reproduction in fungi. Here, we show that the quorum sensing peptide Qsp1 serves as an important signalling molecule for both forms of sexual reproduction. Qsp1 orchestrates various differentiation and molecular processes, including meiosis, the hallmark of sexual reproduction. It activates bisexual mating, at least in part through the control of pheromone, a signal necessary for bisexual activation. Notably, Qsp1 also plays a major role in the intercellular regulation of unisexual initiation and coordination, in which pheromone is not strictly required. Through a multi-layered genetic screening approach, we identified the atypical zinc finger regulator Cqs2 as an important component of the Qsp1 signalling cascade during both bisexual and unisexual reproduction. The absence of Cqs2 eliminates the Qsp1-stimulated mating response. Together, these findings extend the range of behaviours governed by quorum sensing to sexual development and meiosis.
Manufacturing of a micro-tungsten carbide electrode using a supersonic-aided electrolysis process
International Nuclear Information System (INIS)
Weng, Feng-Tsai; Ho, Chi-Ting
2008-01-01
In this study, a novel micromachining technology for fabricating micro parts was described. The original diameter of a tungsten carbide rod was 3 mm, and it was first processed to a rod with a diameter of 50 µm by a precision-grinding process. It could then be machined to the desired diameter by a supersonic-aided electrolysis process. A high-aspect ratio of the micro-tungsten carbide rod was easily obtained by this process. The surface roughness of the sample that was processed by electrolysis with supersonic-aided agitation was compared with that of the sample obtained without agitation. The machined surface of the sample was smooth, and the reason may be that ionized particles in the anode could be removed by supersonic-aided agitation during the electrolysis process. A microelectrode with a tip of approximately 1 µm could be obtained by this process. (technical note)
Conservation of power of the supersonic acoustic intensity
DEFF Research Database (Denmark)
Fernandez Grande, Efren; Jacobsen, Finn
2014-01-01
The supersonic intensity is a quantity that represents the net acoustic output that a source couples into the medium; it can be regarded as a spatially low-pass filtered version of the active intensity. This spatial filtering can lead to significant error due to spatial truncation. In this paper,...
Sub-scale Direct Connect Supersonic Combustion Facility (Research Cell 18)
Federal Laboratory Consortium — Description: RC18 is a continuous-flow, direct-connect, supersonic-combustion research facility that is capable of simulating flight conditions from Mach 3.0 to Mach...
Characteristics of pulsed plasma synthetic jet and its control effect on supersonic flow
Directory of Open Access Journals (Sweden)
Di Jin
2015-02-01
Full Text Available The plasma synthetic jet is a novel flow control approach which is currently being studied. In this paper its characteristic and control effect on supersonic flow is investigated both experimentally and numerically. In the experiment, the formation of plasma synthetic jet and its propagation velocity in quiescent air are recorded and calculated with time resolved schlieren method. The jet velocity is up to 100 m/s and no remarkable difference has been found after changing discharge parameters. When applied in Mach 2 supersonic flow, an obvious shockwave can be observed. In the modeling of electrical heating, the arc domain is not defined as an initial condition with fixed temperature or pressure, but a source term with time-varying input power density, which is expected to better describe the influence of heating process. Velocity variation with different heating efficiencies is presented and discussed and a peak velocity of 850 m/s is achieved in still air with heating power density of 5.0 × 1012 W/m3. For more details on the interaction between plasma synthetic jet and supersonic flow, the plasma synthetic jet induced shockwave and the disturbances in the boundary layer are numerically researched. All the results have demonstrated the control authority of plasma synthetic jet onto supersonic flow.
Development and Testing of a New Family of Supersonic Decelerators
Clark, Ian G.; Adler, Mark; Rivellini, Tommaso P.
2013-01-01
The state of the art in Entry, Descent, and Landing systems for Mars applications is largely based on technologies developed in the late 1960's and early 1970's for the Viking Lander program. Although the 2011 Mars Science Laboratory has made advances in EDL technology, these are predominantly in the areas of entry (new thermal protection systems and guided hypersonic flight) and landing (the sky crane architecture). Increases in entry mass, landed mass, and landed altitude beyond MSL capabilities will require advances predominantly in the field of supersonic decelerators. With this in mind, a multi-year program has been initiated to advance three new types of supersonic decelerators that would enable future large-robotic and human-precursor class missions to Mars.
Flowing of supersonic underexpanded micro-jets in the range of moderate Reynolds numbers
Mironov, S. G.; Aniskin, V. M.; Maslov, A. A.
2017-10-01
The paper presents new experimental results on the simulation of supersonic underexpanded micro-jets by macro-jet in the range of moderate Reynolds numbers of air outflow from the nozzle. A correlation is shown between the variations in the Pitot pressure in the model micro-jet with variations in the length of the supersonic core of real the micro-jets. The results of experiments on the effect of humidity on the pulsation of mass flow rate in a micro-jet are presented.
An Opportunity for Hydrogen Fueled Supersonic Airliners
Directory of Open Access Journals (Sweden)
Alex Forbes
2011-02-01
Full Text Available This paper takes a new look at the prospects for developing supersonic civil airliners, considering global demographics, climate change issues, fuel prices and technological advances. Dramatic changes have occurred in the demographics, economics, and market intensity of the Eastern Hemisphere since the 1990s. Carbon reduction imperatives provide a major incentive to invest in developing hydrogen-fueled airliners. The “point-to-point” air route architecture has proved viable with long range mid-size airliners. With a cruise Mach number of 1.4, a large number of destinations become viable for overland supersonic flight. A conceptual design process is used to estimate cost per seat mile for a range of hydrocarbon and hydrogen fuel costs. An argument based on the ideal shape for minimal wave drag, estimates the drag penalty from using hydrogen. Viable aircraft geometries are shown to exist, that match the theoretical ideal shape, showing that the drag estimate is achievable. Conservative design arguments and market estimates suggest that hydrogen-fueled airliners can achieve seat-mile costs low enough to open a large worldwide market and justify a viable fleet size.
Hydrogen tube vehicle for supersonic transport: 2. Speed and energy
Energy Technology Data Exchange (ETDEWEB)
Miller, Arnold R. [Vehicle Projects Inc and Supersonic Tubevehicle LLC, 200 Violet St, Suite 100, Golden, CO 80401 (United States)
2010-06-15
The central concept of a new idea in high-speed transport is that operation of a vehicle in a hydrogen atmosphere, because of the low density of hydrogen, would increase sonic speed by a factor of 3.8 and decrease drag by 15 relative to air. A hydrogen atmosphere requires that the vehicle operate within a hydrogen-filled tube or pipeline, which serves as a phase separator. The supersonic tube vehicle (STV) can be supersonic with respect to air outside the tube while remaining subsonic inside. It breathes hydrogen fuel for its propulsion fuel cells from the tube itself. This paper, second in a series on the scientific foundations of the supersonic tube vehicle, tests the hypothesis that the STV will be simultaneously fast and energy efficient by comparing its predicted speed and energy consumption with that of four long-haul passenger transport modes: road, rail, maglev, and air. The study establishes the speed ranking STV >> airplane > maglev > train > coach (intercity bus) and the normalized energy consumption ranking Airplane >> coach > maglev > train > STV. Consistent with the hypothesis, the concept vehicle is both the fastest and lowest energy consuming mode. In theory, the vehicle can cruise at Mach 2.8 while consuming less than half the energy per passenger of a Boeing 747 at a cruise speed of Mach 0.81. (author)
Lifescience Database Archive (English)
Full Text Available rase, cytosolic OS... 29 6.3 sp|Q9QSP1|VGLG_ABLVB Glycoprotein G OS=Australian bat lyssavirus... 29 8.2 >sp|...9QSP1|VGLG_ABLVB Glycoprotein G OS=Australian bat lyssavirus (isolate Bat/AUS/1996) GN=G PE=1 SV=1 Length =
Commercial Supersonics Technology Project - Status of Airport Noise
Bridges, James
2016-01-01
The Commercial Supersonic Technology Project has been developing databases, computational tools, and system models to prepare for a level 1 milestone, the Low Noise Propulsion Tech Challenge, to be delivered Sept 2016. Steps taken to prepare for the final validation test are given, including system analysis, code validation, and risk reduction testing.
Towards numerical simulations of supersonic liquid jets using ghost fluid method
International Nuclear Information System (INIS)
Majidi, Sahand; Afshari, Asghar
2015-01-01
Highlights: • A ghost fluid method based solver is developed for numerical simulation of compressible multiphase flows. • The performance of the numerical tool is validated via several benchmark problems. • Emergence of supersonic liquid jets in quiescent gaseous environment is simulated using ghost fluid method for the first time. • Bow-shock formation ahead of the liquid jet is clearly observed in the obtained numerical results. • Radiation of mach waves from the phase-interface witnessed experimentally is evidently captured in our numerical simulations. - Abstract: A computational tool based on the ghost fluid method (GFM) is developed to study supersonic liquid jets involving strong shocks and contact discontinuities with high density ratios. The solver utilizes constrained reinitialization method and is capable of switching between the exact and approximate Riemann solvers to increase the robustness. The numerical methodology is validated through several benchmark test problems; these include one-dimensional multiphase shock tube problem, shock–bubble interaction, air cavity collapse in water, and underwater-explosion. A comparison between our results and numerical and experimental observations indicate that the developed solver performs well investigating these problems. The code is then used to simulate the emergence of a supersonic liquid jet into a quiescent gaseous medium, which is the very first time to be studied by a ghost fluid method. The results of simulations are in good agreement with the experimental investigations. Also some of the famous flow characteristics, like the propagation of pressure-waves from the liquid jet interface and dependence of the Mach cone structure on the inlet Mach number, are reproduced numerically. The numerical simulations conducted here suggest that the ghost fluid method is an affordable and reliable scheme to study complicated interfacial evolutions in complex multiphase systems such as supersonic liquid
Wave-driven Rotation in Supersonically Rotating Mirrors
Energy Technology Data Exchange (ETDEWEB)
A. Fetterman and N.J. Fisch
2010-02-15
Supersonic rotation in mirrors may be produced by radio frequency waves. The waves produce coupled diffusion in ion kinetic and potential energy. A population inversion along the diffusion path then produces rotation. Waves may be designed to exploit a natural kinetic energy source or may provide the rotation energy on their own. Centrifugal traps for fusion and isotope separation may benefit from this wave-driven rotation.
Wave-driven Rotation in Supersonically Rotating Mirrors
International Nuclear Information System (INIS)
Fetterman, A.; Fisch, N.J.
2010-01-01
Supersonic rotation in mirrors may be produced by radio frequency waves. The waves produce coupled diffusion in ion kinetic and potential energy. A population inversion along the diffusion path then produces rotation. Waves may be designed to exploit a natural kinetic energy source or may provide the rotation energy on their own. Centrifugal traps for fusion and isotope separation may benefit from this wave-driven rotation.
Volume Dynamics Propulsion System Modeling for Supersonics Vehicle Research
Kopasakis, George; Connolly, Joseph W.; Paxson, Daniel E.; Ma, Peter
2010-01-01
Under the NASA Fundamental Aeronautics Program the Supersonics Project is working to overcome the obstacles to supersonic commercial flight. The proposed vehicles are long slim body aircraft with pronounced aero-servo-elastic modes. These modes can potentially couple with propulsion system dynamics; leading to performance challenges such as aircraft ride quality and stability. Other disturbances upstream of the engine generated from atmospheric wind gusts, angle of attack, and yaw can have similar effects. In addition, for optimal propulsion system performance, normal inlet-engine operations are required to be closer to compressor stall and inlet unstart. To study these phenomena an integrated model is needed that includes both airframe structural dynamics as well as the propulsion system dynamics. This paper covers the propulsion system component volume dynamics modeling of a turbojet engine that will be used for an integrated vehicle Aero-Propulso-Servo-Elastic model and for propulsion efficiency studies.
Cosmic ray acceleration in sources of the supersonic turbulence
International Nuclear Information System (INIS)
Bykov, A.M.; Toptygin, I.N.
1981-01-01
The mechanism of particle acceleration by the supersonic turbulence is studied. The supersonic turbulence is defined as an ensemble of large- and small-scale plasma motions, in which along with the ranges of smooth parameter variation there are randomly distributed shock wave fronts. Particle interaction with the large-scale turbulence is described by the transfer equation which is true at any relation between the Larmor radius and the transport length. The large-scale turbulence can accelerate particles only due to compressibility effects of the medium. The basic theoretical results concerning turbulence properties in compressed media are presented. Concrete physical conditions and the possibility of acceleration of cosmic rays in the interplanetary space, in the vicinity of suppergiant stars of the O and B class with a great loss of mass and strong stellar winds, in supernova remnants, in the interstellar medium and some extragalactic radio sources are considered [ru
1 Ft. x 1 Ft. Supersonic Wind Tunnel, Bldg. 37
Federal Laboratory Consortium — The 1- by 1-Foot Supersonic Wind Tunnel (1x), located in the Engine Research Building, is one of the most active test facilities at the Glenn Research Center. Used...
Properties of Supersonic Impinging Jets
Alvi, F. S.; Iyer, K. G.; Ladd, J.
1999-11-01
A detailed study examining the behavior of axisymmetric supersonic jets impinging on a ground plane is described. Our objective is to better understand the aeroacoustics governing this complex flowfield which commonly occurs in the vicinity of STOVL aircraft. Flow issuing through a Mach 1.5 C-D and a converging sonic nozzle is examined over a wide parametric range. For some cases a large diameter circular 'lift' plate, with an annular hole through which the jet is issued, is attached at the nozzle exit to simulate a generic airframe. The impinging jet flowfield was examined using Particle Image Velocimetry (PIV), which provides the velocity field for the entire region and shadowgraph visualization techniques. Near-field acoustic, as well as, mean and unsteady pressure measurements on the ground and lift plate surfaces were also obtained. The velocity field data, together with the surface flow measurements have resulted in a much better understanding of this flow from a fundamental standpoint while also identifying critical regions of interest for practical applications. Some of these findings include the presence of a stagnation bubble with recirculating flow; a very high speed (transonic/supersonic) radial wall jet; presence of large, spatially coherent turbulent structures in the primary jet and wall jet and high unsteady loads on the ground plane and lift plates. The results of a companion CFD investigation and its comparison to the experimental data will also be presented. Very good agreement has been found between the computational and experimental results thus providing confidence in the development of computational tools for the study of such flows.
Jet Noise Modeling for Supersonic Business Jet Application
Stone, James R.; Krejsa, Eugene A.; Clark, Bruce J.
2004-01-01
This document describes the development of an improved predictive model for coannular jet noise, including noise suppression modifications applicable to small supersonic-cruise aircraft such as the Supersonic Business Jet (SBJ), for NASA Langley Research Center (LaRC). For such aircraft a wide range of propulsion and integration options are under consideration. Thus there is a need for very versatile design tools, including a noise prediction model. The approach used is similar to that used with great success by the Modern Technologies Corporation (MTC) in developing a noise prediction model for two-dimensional mixer ejector (2DME) nozzles under the High Speed Research Program and in developing a more recent model for coannular nozzles over a wide range of conditions. If highly suppressed configurations are ultimately required, the 2DME model is expected to provide reasonable prediction for these smaller scales, although this has not been demonstrated. It is considered likely that more modest suppression approaches, such as dual stream nozzles featuring chevron or chute suppressors, perhaps in conjunction with inverted velocity profiles (IVP), will be sufficient for the SBJ.
Design and Testing of CO2 Compression Using Supersonic Shock Wave Technology
Energy Technology Data Exchange (ETDEWEB)
Koopman, Aaron [Seattle Technology Center, Bellevue, WA (United States)
2015-06-01
This report summarizes work performed by Ramgen and subcontractors in pursuit of the design and construction of a 10 MW supersonic CO2 compressor and supporting facility. The compressor will demonstrate application of Ramgen’s supersonic compression technology at an industrial scale using CO2 in a closed-loop. The report includes details of early feasibility studies, CFD validation and comparison to experimental data, static test experimental results, compressor and facility design and analyses, and development of aerodynamic tools. A summary of Ramgen's ISC Engine program activity is also included. This program will demonstrate the adaptation of Ramgen's supersonic compression and advanced vortex combustion technology to result in a highly efficient and cost effective alternative to traditional gas turbine engines. The build out of a 1.5 MW test facility to support the engine and associated subcomponent test program is summarized.
Low Density Supersonic Decelerator Flight Dynamics Test-1 Flight Design and Targeting
Ivanov, Mark
2015-01-01
NASA's Low Density Supersonic Decelerator (LDSD) program was established to identify, develop, and eventually qualify to Test [i.e. Technology] Readiness Level (TRL) - 6 aerodynamic decelerators for eventual use on Mars. Through comprehensive Mars application studies, two distinct Supersonic Inflatable Aerodynamic Decelerator (SIAD) designs were chosen that afforded the optimum balance of benefit, cost, and development risk. In addition, a Supersonic Disk Sail (SSDS) parachute design was chosen that satisfied the same criteria. The final phase of the multi-tiered qualification process involves Earth Supersonic Flight Dynamics Tests (SFDTs) within environmental conditions similar to those that would be experienced during a Mars Entry, Descent, and Landing (EDL) mission. The first of these flight tests (i.e. SFDT-1) was completed on June 28, 2014 with two more tests scheduled for the summer of 2015 and 2016, respectively. The basic flight design for all the SFDT flights is for the SFDT test vehicle to be ferried to a float altitude of 120 kilo-feet by a 34 thousand cubic feet (Mcf) heavy lift helium balloon. Once float altitude is reached, the test vehicle is released from the balloon, spun-up for stability, and accelerated to supersonic speeds using a Star48 solid rocket motor. After burnout of the Star48 motor the vehicle decelerates to pre-flight selected test conditions for the deployment of the SIAD system. After further deceleration with the SIAD deployed, the SSDS parachute is then deployed stressing the performance of the parachute in the wake of the SIAD augmented blunt body. The test vehicle/SIAD/parachute system then descends to splashdown in the Pacific Ocean for eventual recovery. This paper will discuss the development of both the test vehicle and the trajectory sequence including design trade-offs resulting from the interaction of both engineering efforts. In addition, the SFDT-1 nominal trajectory design and associated sensitivities will be discussed
Highly Supersonic Ion Pulses in a Collisionless Magnetized Plasma
DEFF Research Database (Denmark)
Juul Rasmussen, Jens; Schrittwieser, R.
1982-01-01
The initial transient response of a collisionless plasma to a high positive voltage step is investigated. Four different pulses are observed. An electron plasma wave pulse is followed by an ion burst. The latter is overtaken and absorbed by a highly supersonic ion pulse. Thereafter, an ion...
Zeroth-order flutter prediction for cantilevered plates in supersonic flow
CSIR Research Space (South Africa)
Meijer, M-C
2015-08-01
Full Text Available An aeroelastic prediction framework in MATLAB with modularity in the quasi-steady aerodynamic methodology is developed. Local piston theory (LPT) is integrated with quasi-steady methods including shock-expansion theory and the Supersonic Hypersonic...
NASA's Pursuit of Low-Noise Propulsion for Low-Boom Commercial Supersonic Vehicles
Bridges, James; Brown, Clifford A.; Seidel, Jonathan A.
2018-01-01
Since 2006, when the Fundamental Aeronautics Program was instituted within NASA's Aeronautics Mission Directorate, there has been a Project looking at the technical barriers to commercial supersonic flight. Among the barriers is the noise produced by aircraft during landing and takeoff. Over the years that followed, research was carried out at NASA aeronautics research centers, often in collaboration with academia and industry, addressing the problem. In 2013, a high-level milestone was established, described as a Technical Challenge, with the objective of demonstrating the feasibility of a low-boom supersonic airliner that could meet current airport noise regulations. The Technical Challenge was formally called "Low Noise Propulsion for Low Boom Aircraft", and was completed in late 2016. This paper reports the technical findings from this Technical Challenge, reaching back almost 10 years to review the technologies and tools that were developed along the way. It also discusses the final aircraft configuration and propulsion systems required for a supersonic civilian aircraft to meet noise regulations using the technologies available today. Finally, the paper documents the model-scale tests that validated the acoustic performance of the study aircraft.
An extended supersonic combustion model for the dynamic analysis of hypersonic vehicles
Bossard, J. A.; Peck, R. E.; Schmidt, D. K.
1993-01-01
The development of an advanced dynamic model for aeroelastic hypersonic vehicles powered by air breathing engines requires an adequate engine model. This report provides a discussion of some of the more important features of supersonic combustion and their relevance to the analysis and design of supersonic ramjet engines. Of particular interest are those aspects of combustion that impact the control of the process. Furthermore, the report summarizes efforts to enhance the aeropropulsive/aeroelastic dynamic model developed at the Aerospace Research Center of Arizona State University by focusing on combustion and improved modeling of this flow. The expanded supersonic combustor model described here has the capability to model the effects of friction, area change, and mass addition, in addition to the heat addition process. A comparison is made of the results from four cases: (1) heat addition only; (2) heat addition plus friction; (3) heat addition, friction, and area reduction, and (4) heat addition, friction, area reduction, and mass addition. The relative impact of these effects on the Mach number, static temperature, and static pressure distributions within the combustor are then shown. Finally, the effects of frozen versus equilibrium flow conditions within the exhaust plume is discussed.
A Comparison of Prominent LES Combustion Models for Nonpremixed Supersonic Combustion
National Aeronautics and Space Administration — The capability of accurately simulating supersonic combustion is a vital topic for designing and advancing hypersonic air-breathing vehicles. As a consequence, there...
Modeling of Supersonic Combustion Systems for Sustained Hypersonic Flight
Directory of Open Access Journals (Sweden)
Stephen M. Neill
2017-11-01
Full Text Available Through Computational Fluid Dynamics and validation, an optimal scramjet combustor has been designed based on twin-strut Hydrogen injection to sustain flight at a desired speed of Mach 8. An investigation undertaken into the efficacy of supersonic combustion through various means of injection saw promising results for Hydrogen-based systems, whereby strut-style injectors were selected over transverse injectors based on their pressure recovery performance and combustive efficiency. The final configuration of twin-strut injectors provided robust combustion and a stable region of net thrust (1873 kN in the nozzle. Using fixed combustor inlet parameters and injection equivalence ratio, the finalized injection method advanced to the early stages of two-dimensional (2-D and three-dimensional (3-D scramjet engine integration. The overall investigation provided a feasible supersonic combustion system, such that Mach 8 sustained cruise could be achieved by the aircraft concept in a computational design domain.
Compilation and Review of Supersonic Business Jet Studies from 1963 through 1995
Maglieri, Domenic J.
2011-01-01
This document provides a compilation of all known supersonic business jet studies/activities conducted from 1963 through 1995 by university, industry and the NASA. First, an overview is provided which chronologically displays all known supersonic business jet studies/activities conducted by universities, industry, and the NASA along with the key features of the study vehicles relative to configuration, planform, operation parameters, and the source of study. This is followed by a brief description of each study along with some comments on the study. Mention will be made as to whether the studies addressed cost, market needs, and the environmental issues of airport-community noise, sonic boom, and ozone.
Advanced supersonic propulsion study, phase 4
Howlett, R. A.
1977-01-01
Installation characteristics for a Variable Stream Control Engine (VSCE) were studied for three advanced supersonic airplane designs. Sensitivity of the VSCE concept to change in technology projections was evaluated in terms of impact on overall installed performance. Based on these sensitivity results, critical technology requirements were reviewed, resulting in the reaffirmation of the following requirements: low-noise nozzle system; a high performance, low emissions duct burner and main burner; hot section technology; variable geometry components; and propulsion integration features, including an integrated electronic control system.
Directory of Open Access Journals (Sweden)
Yan Yang
Full Text Available A supersonic separator has been introduced to remove water vapour from natural gas. The mechanisms of the upstream and downstream influences are not well understood for various flow conditions from the wellhead and the back pipelines. We used a computational model to investigate the effect of the inlet and outlet flow conditions on the supersonic separation process. We found that the shock wave was sensitive to the inlet or back pressure compared to the inlet temperature. The shock position shifted forward with a higher inlet or back pressure. It indicated that an increasing inlet pressure declined the pressure recovery capacity. Furthermore, the shock wave moved out of the diffuser when the ratio of the back pressure to the inlet one was greater than 0.75, in which the state of the low pressure and temperature was destroyed, resulting in the re-evaporation of the condensed liquids. Natural gas would be the subsonic flows in the whole supersonic separator, if the mass flow rate was less than the design value, and it could not reach the low pressure and temperature for the condensation and separation of the water vapor. These results suggested a guidance mechanism for natural gas supersonic separation in various flow conditions.
Direct formulation of the supersonic acoustic intensity in space domain
DEFF Research Database (Denmark)
Fernandez Grande, Efren; Jacobsen, Finn; Leclre, Quentin
2012-01-01
into the far field. To date, its calculation has been formulated in the wave number domain, filtering out the evanescent waves outside the radiation circle and reconstructing the acoustic field with only the propagating waves. In this study, the supersonic intensity is calculated directly in space domain......This paper proposes and examines a direct formulation in space domain of the so-called supersonic acoustic intensity. This quantity differs from the usual (active) intensity by excluding the circulating energy in the near-field of the source, providing a map of the acoustic energy that is radiated...... by means of a two-dimensional convolution between the acoustic field and a spatial filter mask that corresponds to the space domain representation of the radiation circle. Therefore, the acoustic field that propagates effectively to the far field is calculated via direct filtering in space domain...
Advanced Supersonic Nozzle Concepts: Experimental Flow Visualization Results Paired With LES
Berry, Matthew; Magstadt, Andrew; Stack, Cory; Gaitonde, Datta; Glauser, Mark; Syracuse University Team; The Ohio State University Team
2015-11-01
Advanced supersonic nozzle concepts are currently under investigation, utilizing multiple bypass streams and airframe integration to bolster performance and efficiency. This work focuses on the parametric study of a supersonic, multi-stream jet with aft deck. The single plane of symmetry, rectangular nozzle, displays very complex and unique flow characteristics. Flow visualization techniques in the form of PIV and schlieren capture flow features at various deck lengths and Mach numbers. LES is compared to the experimental results to both validate the computational model and identify limitations of the simulation. By comparing experimental results to LES, this study will help create a foundation of knowledge for advanced nozzle designs in future aircraft. SBIR Phase II with Spectral Energies, LLC under direction of Barry Kiel.
Howlett, R. A.
1975-01-01
A continuation of the NASA/P and WA study to evaluate various types of propulsion systems for advanced commercial supersonic transports has resulted in the identification of two very promising engine concepts. They are the Variable Stream Control Engine which provides independent temperature and velocity control for two coannular exhaust streams, and a derivative of this engine, a Variable Cycle Engine that employs a rear flow-inverter valve to vary the bypass ratio of the cycle. Both concepts are based on advanced engine technology and have the potential for significant improvements in jet noise, exhaust emissions and economic characteristics relative to current technology supersonic engines. Extensive research and technology programs are required in several critical areas that are unique to these supersonic Variable Cycle Engines to realize these potential improvements. Parametric cycle and integration studies of conventional and Variable Cycle Engines are reviewed, features of the two most promising engine concepts are described, and critical technology requirements and required programs are summarized.
Flutter analysis of hybrid metal-composite low aspect ratio trapezoidal wings in supersonic flow
Directory of Open Access Journals (Sweden)
Shokrollahi Saeed
2017-02-01
Full Text Available An effective 3D supersonic Mach box approach in combination with non-classical hybrid metal-composite plate theory has been used to investigate flutter boundaries of trapezoidal low aspect ratio wings. The wing structure is composed of two main components including aluminum material (in-board section and laminated composite material (out-board section. A global Ritz method is used with simple polynomials being employed as the trial functions. The most important objective of the present research is to study the effect of composite to metal proportion of hybrid wing structure on flutter boundaries in low supersonic regime. In addition, the effect of some important geometrical parameters such as sweep angle, taper ratio and aspect ratio on flutter boundaries were studied. The results obtained by present approach for special cases like pure metallic wings and results for high supersonic regime based on piston theory show a good agreement with those obtained by other investigators.
PIV Measurements of Supersonic Internally-Mixed Dual-Stream Jets
Bridges, James E.; Wernet, Mark P.
2012-01-01
While externally mixed, or separate flow, nozzle systems are most common in high bypass-ratio aircraft, they are not as attractive for use in lower bypass-ratio systems and on aircraft that will fly supersonically. The noise of such propulsion systems is also dominated by jet noise, making the study and noise reduction of these exhaust systems very important, both for military aircraft and future civilian supersonic aircraft. This paper presents particle image velocimetry of internally mixed nozzle with different area ratios between core and bypass, and nozzles that are ideally expanded and convergent. Such configurations independently control the geometry of the internal mixing layer and of the external shock structure. These allow exploration of the impact of shocks on the turbulent mixing layers, the impact of bypass ratio on broadband shock noise and mixing noise, and the impact of temperature on the turbulent flow field. At the 2009 AIAA/CEAS Aeroacoustics Conference the authors presented data and analysis from a series of tests that looked at the acoustics of supersonic jets from internally mixed nozzles. In that paper the broadband shock and mixing noise components of the jet noise were independently manipulated by holding Mach number constant while varying bypass ratio and jet temperature. Significant portions of that analysis was predicated on assumptions regarding the flow fields of these jets, both shock structure and turbulence. In this paper we add to that analysis by presenting particle image velocimetry measurements of the flow fields of many of those jets. In addition, the turbulent velocity data documented here will be very useful for validation of computational flow codes that are being developed to design advanced nozzles for future aircraft.
Heaslet, Max A; Lomax, Harvard
1948-01-01
A direct analogy is established between the use of source-sink and doublet distributions in the solution of specific boundary-value problems in subsonic wing theory and the corresponding problems in supersonic theory. The correct concept of the "finite part" of an integral is introduced and used in the calculation of the improper integrals associated with supersonic doublet distributions. The general equations developed are shown to include several previously published results and particular examples are given for the loading on rolling and pitching triangular wings with supersonic leading edges.
Flow Studies of Decelerators at Supersonic Speeds
1959-01-01
Wind tunnel tests recorded the effect of decelerators on flow at various supersonic speeds. Rigid parachute models were tested for the effects of porosity, shroud length, and number of shrouds. Flexible model parachutes were tested for effects of porosity and conical-shaped canopy. Ribbon dive brakes on a missile-shaped body were tested for effect of tension cable type and ribbon flare type. The final test involved a plastic sphere on riser lines.
Supersonic plasma jet interaction with gases and plasmas
Czech Academy of Sciences Publication Activity Database
Nicolai, P.; Stenz, C.; Tikhonchuk, V.; Ribeyre, X.; Kasperczuk, A.; Pisarczyk, T.; Juha, Libor; Krouský, Eduard; Mašek, Karel; Pfeifer, Miroslav; Rohlena, Karel; Skála, Jiří; Ullschmied, Jiří; Kálal, M.; Klír, D.; Kravárik, J.; Kubeš, P.; Pisarczyk, P.
2009-01-01
Roč. 322, 1-4 (2009), 11-17 ISSN 0004-640X R&D Projects: GA MŠk(CZ) LC528; GA MŠk LA08024 Institutional research plan: CEZ:AV0Z10100523; CEZ:AV0Z20430508 Keywords : supersonic plasma jet * laser experiment * shock Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.404, year: 2009
Makino, Yoshikazu; Ohira, Keisuke; Makimoto, Takuya; Mitomo, Toshiteru; 牧野, 好和; 大平, 啓介; 牧本, 卓也; 三友, 俊輝
2011-01-01
Effects of static aeroelastic deformation of a wind-tunnel test model on the aerodynamic characteristics are discussed in wind-tunnel tests in the preliminary design phase of the silent supersonic technology demonstrator (S3TD). The static aeroelastic deformation of the main wing is estimated for JAXA 2m x 2m transonic wind-tunnel and 1m x 1m supersonic wind-tunnel by a finite element method (FEM) structural analysis in which its structural model is tuned with the model deformation calibratio...
Multi-fidelity and multi-disciplinary design optimization of supersonic business jets
Choi, Seongim
Supersonic jets have been drawing great attention after the end of service for the Concorde was announced on April of 2003. It is believed, however, that civilian supersonic aircraft may make a viable return in the business jet market. This thesis focuses on the design optimization of feasible supersonic business jet configurations. Preliminary design techniques for mitigation of ground sonic boom are investigated while ensuring that all relevant disciplinary constraints are satisfied (including aerodynamic performance, propulsion, stability & control and structures.) In order to achieve reasonable confidence in the resulting designs, high-fidelity simulations are required, making the entire design process both expensive and complex. In order to minimize the computational cost, surrogate/approximate models are constructed using a hierarchy of different fidelity analysis tools including PASS, A502/Panair and Euler/NS codes. Direct search methods such as Genetic Algorithms (GAs) and a nonlinear SIMPLEX are employed to designs in searches of large and noisy design spaces. A local gradient-based search method can be combined with these global search methods for small modifications of candidate optimum designs. The Mesh Adaptive Direct Search (MADS) method can also be used to explore the design space using a solution-adaptive grid refinement approach. These hybrid approaches, both in search methodology and surrogate model construction, are shown to result in designs with reductions in sonic boom and improved aerodynamic performance.
Detonation in supersonic radial outflow
Kasimov, Aslan R.
2014-11-07
We report on the structure and dynamics of gaseous detonation stabilized in a supersonic flow emanating radially from a central source. The steady-state solutions are computed and their range of existence is investigated. Two-dimensional simulations are carried out in order to explore the stability of the steady-state solutions. It is found that both collapsing and expanding two-dimensional cellular detonations exist. The latter can be stabilized by putting several rigid obstacles in the flow downstream of the steady-state sonic locus. The problem of initiation of standing detonation stabilized in the radial flow is also investigated numerically. © 2014 Cambridge University Press.
Supersonic quasi-axisymmetric vortex breakdown
Kandil, Osama A.; Kandil, Hamdy A.; Liu, C. H.
1991-01-01
An extensive computational study of supersonic quasi-axisymmetric vortex breakdown in a configured circular duct is presented. The unsteady, compressible, full Navier-Stokes (NS) equations are used. The NS equations are solved for the quasi-axisymmetric flows using an implicit, upwind, flux difference splitting, finite volume scheme. The quasi-axisymmetric solutions are time accurate and are obtained by forcing the components of the flowfield vector to be equal on two axial planes, which are in close proximity of each other. The effect of Reynolds number, for laminar flows, on the evolution and persistence of vortex breakdown, is studied. Finally, the effect of swirl ration at the duct inlet is investigated.
High-fidelity large eddy simulation for supersonic jet noise prediction
Aikens, Kurt M.
The problem of intense sound radiation from supersonic jets is a concern for both civil and military applications. As a result, many experimental and computational efforts are focused at evaluating possible noise suppression techniques. Large-eddy simulation (LES) is utilized in many computational studies to simulate the turbulent jet flowfield. Integral methods such as the Ffowcs Williams-Hawkings (FWH) method are then used for propagation of the sound waves to the farfield. Improving the accuracy of this two-step methodology and evaluating beveled converging-diverging nozzles for noise suppression are the main tasks of this work. First, a series of numerical experiments are undertaken to ensure adequate numerical accuracy of the FWH methodology. This includes an analysis of different treatments for the downstream integration surface: with or without including an end-cap, averaging over multiple end-caps, and including an approximate surface integral correction term. Secondly, shock-capturing methods based on characteristic filtering and adaptive spatial filtering are used to extend a highly-parallelizable multiblock subsonic LES code to enable simulations of supersonic jets. The code is based on high-order numerical methods for accurate prediction of the acoustic sources and propagation of the sound waves. Furthermore, this new code is more efficient than the legacy version, allows cylindrical multiblock topologies, and is capable of simulating nozzles with resolved turbulent boundary layers when coupled with an approximate turbulent inflow boundary condition. Even though such wall-resolved simulations are more physically accurate, their expense is often prohibitive. To make simulations more economical, a wall model is developed and implemented. The wall modeling methodology is validated for turbulent quasi-incompressible and compressible zero pressure gradient flat plate boundary layers, and for subsonic and supersonic jets. The supersonic code additions and the
Steady supersonic rotation in the Maryland Centrifugal Experiment
International Nuclear Information System (INIS)
Ellis, R.F.; Messer, S.; Case, A.; DeSilva, A.; Elton, R.; Ghosh, J.; Griem, H.; Gupta, D.; Hassam, A.; Lunsford, R.; McLaren, R.; Rodgers, J.; Teodorescu, C.
2005-01-01
The Maryland Centrifugal Experiment (MCX) studies enhanced confinement and stability produced by sheared supersonic rotation about a linear confining magnetic field. MCX has a mirror geometry of 2.5 m length, mirror ratio 2-20, maximum mirror field 1.9T, maximum midplane field 0.33T. Biasing of an inner electrode relative to the outer wall produces a radial electric field which drives azimuthal rotation. MCX has achieved high density (n>10 20 m -3 ) fully ionized plasmas rotating supersonically with velocities of ∼100 km/sec for times exceeding 8 ms under a wide range of conditions. Ion temperatures are 30 eV and confinement times ∼100 microseconds. Sonic Mach numbers are 1-2 and Alfven Mach numbers somewhat less than 0.5 for standard discharges. Plasmas remain grossly stable, or steady, for many milliseconds, much longer than MHD instability timescales for MCX, though significant magnetic fluctuations are clearly seen on magnetic probes. Recently MCX has demonstrated an enhanced mode of operation with sonic Mach numbers greater than 3, confinement times of several hundred microseconds and Alfven Mach numbers near one. (author)
National Research Council Canada - National Science Library
Ghenai, C; Philippidis, G. P; Lin, C. X
2005-01-01
... (subsonic- supersonic) combustion studies. A high-speed imaging system was used for the visualization of pure liquid jet, aerated liquid jet and pulsed aerated jet injection into a supersonic cross flow at Mach number 1.5...
Effects of the shear layer growth rate on the supersonic jet noise
Ozawa, Yuta; Nonomura, Taku; Oyama, Akira; Mamori, Hiroya; Fukushima, Naoya; Yamamoto, Makoto
2017-11-01
Strong acoustic waves emitted from rocket plume might damage to rocket payloads because their payloads consist of fragile structure. Therefore, understanding and prediction of acoustic wave generation are of importance not only in science, but also in engineering. The present study makes experiments of a supersonic jet flow at the Mach number of 2.0 and investigates a relationship between growth rate of a shear layer and noise generation of the supersonic jet. We conducted particle image velocimetry (PIV) and acoustic measurements for three different shaped nozzles. These nozzles were employed to control the condition of a shear layer of the supersonic jet flow. We applied single-pixel ensemble correlation method (Westerweel et al., 2004) for the PIV images to obtain high-resolution averaged velocity profiles. This correlation method enabled us to obtain detailed data of the shear layer. For all cases, acoustic measurements clearly shows the noise source position at the end of a potential core of the jet. In the case where laminar to turbulent transition occurred in the shear layer, the sound pressure level increased by 4 dB at the maximum. This research is partially supported by Presto, JST (JPMJPR1678) and KAKENHI (25709009 and 17H03473).
Teodorescu, C; Young, W C; Swan, G W S; Ellis, R F; Hassam, A B; Romero-Talamas, C A
2010-08-20
Interferometric density measurements in plasmas rotating in shaped, open magnetic fields demonstrate strong confinement of plasma parallel to the magnetic field, with density drops of more than a factor of 10. Taken together with spectroscopic measurements of supersonic E × B rotation of sonic Mach 2, these measurements are in agreement with ideal MHD theory which predicts large parallel pressure drops balanced by centrifugal forces in supersonically rotating plasmas.
Seemann, Boaz; Alon, Tal; Tsizin, Svetlana; Fialkov, Alexander B; Amirav, Aviv
2015-11-01
A new type of electron ionization LC-MS with supersonic molecular beams (EI-LC-MS with SMB) is described. This system and its operational methods are based on pneumatic spray formation of the LC liquid flow in a heated spray vaporization chamber, full sample thermal vaporization and subsequent electron ionization of vibrationally cold molecules in supersonic molecular beams. The vaporized sample compounds are transferred into a supersonic nozzle via a flow restrictor capillary. Consequently, while the pneumatic spray is formed and vaporized at above atmospheric pressure the supersonic nozzle backing pressure is about 0.15 Bar for the formation of supersonic molecular beams with vibrationally cold sample molecules without cluster formation with the solvent vapor. The sample compounds are ionized in a fly-though EI ion source as vibrationally cold molecules in the SMB, resulting in 'Cold EI' (EI of vibrationally cold molecules) mass spectra that exhibit the standard EI fragments combined with enhanced molecular ions. We evaluated the EI-LC-MS with SMB system and demonstrated its effectiveness in NIST library sample identification which is complemented with the availability of enhanced molecular ions. The EI-LC-MS with SMB system is characterized by linear response of five orders of magnitude and uniform compound independent response including for non-polar compounds. This feature improves sample quantitation that can be approximated without compound specific calibration. Cold EI, like EI, is free from ion suppression and/or enhancement effects (that plague ESI and/or APCI) which facilitate faster LC separation because full separation is not essential. The absence of ion suppression effects enables the exploration of fast flow injection MS-MS as an alternative to lengthy LC-MS analysis. These features are demonstrated in a few examples, and the analysis of the main ingredients of Cannabis on a few Cannabis flower extracts is demonstrated. Finally, the advantages of
Partial admission effect on the performance and vibration of a supersonic impulse turbine
Lee, Hang Gi; Shin, Ju Hyun; Choi, Chang-Ho; Jeong, Eunhwan; Kwon, Sejin
2018-04-01
This study experimentally investigates the effects of partial admission on the performance and vibration outcomes of a supersonic impulse turbine with circular nozzles. The turbine of a turbopump for a gas-generator-type liquid rocket engine in the Korea Space Launch Vehicle-II is of the supersonic impulse type with the partial admission configuration for obtaining a high specific power. Partial admission turbines with a low-flow-rate working gas exhibit benefits over turbines with full admission, such as loss reduction, ease of controllability of the turbine power output, and simple turbine configurations with separate starting sections. However, the radial force of the turbine rotor due to the partial admission causes an increase in turbine vibration. Few experimental studies have previously been conducted regarding the partial admission effects on supersonic impulse turbines with circular nozzles. In the present study, performance tests of supersonic impulse turbines with circular nozzles were conducted for various partial admission ratios using a turbine test facility with high-pressure air in order to investigate the resulting aerodynamic performance and vibration. Four types of turbines with partial admission ratios of 0.17, 0.42, 0.75 and 0.83 were tested. Results show that the efficiencies at the design point increase linearly as the partial admission ratios increase. Moreover, as the velocity ratios increase, the difference in efficiency from the reference turbine with a partial admission ratio of 0.83 becomes increasingly significant, and the magnitudes of these differences are proportional to the square of the velocity ratios. Likewise, the decrease in the partial admission ratio results in an increase in the turbine vibration level owing to the increase in the radial force.
Thermonuclear dynamo inside ultracentrifuge with supersonic plasma flow stabilization
Energy Technology Data Exchange (ETDEWEB)
Winterberg, F. [University of Nevada, Reno, Reno, Nevada (United States)
2016-01-15
Einstein's general theory of relativity implies the existence of virtual negative masses in the rotational reference frame of an ultracentrifuge with the negative mass density of the same order of magnitude as the positive mass density of a neutron star. In an ultracentrifuge, the repulsive gravitational field of this negative mass can simulate the attractive positive mass of a mini-neutron star, and for this reason can radially confine a dense thermonuclear plasma placed inside the centrifuge, very much as the positive mass of a star confines its plasma by its own attractive gravitational field. If the centrifuge is placed in an externally magnetic field to act as the seed field of a magnetohydrodynamic generator, the configuration resembles a magnetar driven by the release of energy through nuclear fusion, accelerating the plasma to supersonic velocities, with the magnetic field produced by the thermomagnetic Nernst effect insulating the hot plasma from the cold wall of the centrifuge. Because of the supersonic flow and the high plasma density the configuration is stable.
Thermonuclear dynamo inside ultracentrifuge with supersonic plasma flow stabilization
Winterberg, F.
2016-01-01
Einstein's general theory of relativity implies the existence of virtual negative masses in the rotational reference frame of an ultracentrifuge with the negative mass density of the same order of magnitude as the positive mass density of a neutron star. In an ultracentrifuge, the repulsive gravitational field of this negative mass can simulate the attractive positive mass of a mini-neutron star, and for this reason can radially confine a dense thermonuclear plasma placed inside the centrifuge, very much as the positive mass of a star confines its plasma by its own attractive gravitational field. If the centrifuge is placed in an externally magnetic field to act as the seed field of a magnetohydrodynamic generator, the configuration resembles a magnetar driven by the release of energy through nuclear fusion, accelerating the plasma to supersonic velocities, with the magnetic field produced by the thermomagnetic Nernst effect insulating the hot plasma from the cold wall of the centrifuge. Because of the supersonic flow and the high plasma density the configuration is stable.
Thermonuclear dynamo inside ultracentrifuge with supersonic plasma flow stabilization
International Nuclear Information System (INIS)
Winterberg, F.
2016-01-01
Einstein's general theory of relativity implies the existence of virtual negative masses in the rotational reference frame of an ultracentrifuge with the negative mass density of the same order of magnitude as the positive mass density of a neutron star. In an ultracentrifuge, the repulsive gravitational field of this negative mass can simulate the attractive positive mass of a mini-neutron star, and for this reason can radially confine a dense thermonuclear plasma placed inside the centrifuge, very much as the positive mass of a star confines its plasma by its own attractive gravitational field. If the centrifuge is placed in an externally magnetic field to act as the seed field of a magnetohydrodynamic generator, the configuration resembles a magnetar driven by the release of energy through nuclear fusion, accelerating the plasma to supersonic velocities, with the magnetic field produced by the thermomagnetic Nernst effect insulating the hot plasma from the cold wall of the centrifuge. Because of the supersonic flow and the high plasma density the configuration is stable
Supersonic liquid jets: Their generation and shock wave characteristics
Pianthong, K.; Zakrzewski, S.; Behnia, M.; Milton, B. E.
The generation of high-speed liquid (water and diesel fuel) jets in the supersonic range using a vertical single-stage powder gun is described. The effect of projectile velocity and mass on the jet velocity is investigated experimentally. Jet exit velocities for a set of nozzle inner profiles (e.g. straight cone with different cone angles, exponential, hyperbolic etc.) are compared. The optimum condition to achieve the maximum jet velocity and hence better atomization and mixing is then determined. The visual images of supersonic diesel fuel jets (velocity about 2000 m/s) were obtained by the shadowgraph method. This provides better understanding of each stage of the generation of the jets and makes the study of their characteristics and the potential for auto-ignition possible. In the experiments, a pressure relief section has been used to minimize the compressed air wave ahead of the projectile. To clarify the processes inside the section, additional experiments have been performed with the use of the shadowgraph method, showing the projectile travelling inside and leaving the pressure relief section at a velocity of about 1100 m/s.
Evolution of the Orszag-Tang vortex system in a compressible medium. II - Supersonic flow
Picone, J. Michael; Dahlburg, Russell B.
1991-01-01
A study is presented on the effect of embedded supersonic flows and the resulting emerging shock waves on phenomena associated with MHD turbulence, including reconnection, the formation of current sheets and vortex structures, and the evolution of spatial and temporal correlations among physical variables. A two-dimensional model problem, the Orszag-Tang (1979) vortex system, is chosen, which involves decay from nonrandom initial conditions. The system is doubly periodic, and the initial conditions consist of single-mode solenoidal velocity and magnetic fields, each containing X points and O points. The initial mass density is flat, and the initial pressure fluctuations are incompressible, balancing the local forces for a magnetofluid of unit mass density. Results on the evolution of the local structure of the flow field, the global properties of the system, and spectral correlations are presented. The important dynamical properties and observational consequences of embedded supersonic regions and emerging shocks in the Orszag-Tang model of an MHD system undergoing reconnection are discussed. Conclusions are drawn regarding the effects of local supersonic regions on MHD turbulence.
Korte, John J.; Kumar, Ajay; Singh, D. J.; White, J. A.
1992-01-01
A design program is developed which incorporates a modern approach to the design of supersonic/hypersonic wind-tunnel nozzles. The approach is obtained by the coupling of computational fluid dynamics (CFD) with design optimization. The program can be used to design a 2D or axisymmetric, supersonic or hypersonic, wind-tunnel nozzles that can be modeled with a calorically perfect gas. The nozzle design is obtained by solving a nonlinear least-squares optimization problem (LSOP). The LSOP is solved using an iterative procedure which requires intermediate flowfield solutions. The nozzle flowfield is simulated by solving the Navier-Stokes equations for the subsonic and transonic flow regions and the parabolized Navier-Stokes equations for the supersonic flow regions. The advantages of this method are that the design is based on the solution of the viscous equations eliminating the need to make separate corrections to a design contour, and the flexibility of applying the procedure to different types of nozzle design problems.
Nonlinear stability of supersonic jets
Tiwari, S. N. (Principal Investigator); Bhat, T. R. S. (Principal Investigator)
1996-01-01
The stability calculations made for a shock-free supersonic jet using the model based on parabolized stability equations are presented. In this analysis the large scale structures, which play a dominant role in the mixing as well as the noise radiated, are modeled as instability waves. This model takes into consideration non-parallel flow effects and also nonlinear interaction of the instability waves. The stability calculations have been performed for different frequencies and mode numbers over a range of jet operating temperatures. Comparisons are made, where appropriate, with the solutions to Rayleigh's equation (linear, inviscid analysis with the assumption of parallel flow). The comparison of the solutions obtained using the two approaches show very good agreement.
Characteristics of an under-expanded supersonic flow in arcjet plasmas
Namba, Shinichi; Shikama, Taiichi; Sasano, Wataru; Tamura, Naoki; Endo, Takuma
2018-06-01
A compact apparatus to produce arcjet plasma was fabricated to investigate supersonic flow dynamics. Periodic bright–dark emission structures were formed in the arcjets, depending on the plasma source and ambient gas pressures in the vacuum chamber. A directional Langmuir probe (DLP) and emission spectroscopy were employed to characterize plasma parameters such as the Mach number of plasma flows and clarify the mechanism for the generation of the emission pattern. In particular, in order to investigate the influence of the Mach number on probe size, we used two DLPs of different probe size. The results indicated that the arcjets could be classified into shock-free expansion and under-expansion, and the behavior of plasma flow could be described by compressible fluid dynamics. Comparison of the Langmuir probe results with emission and laser absorption spectroscopy showed that the small diameter probe was reliable to determine the Mach number, even for the supersonic jet.
Tests of a thermal acoustic shield with a supersonic jet
Pickup, N.; Mangiarotty, R. A.; Okeefe, J. V.
1981-10-01
Fuel economy is a key element in the design of a future supersonic transport (SST). Variable cycle engines are being developed to provide the most economic combination of characteristics for a range of cruise speeds extending from subsonic speeds for overland flights to the supersonic cruise speeds. For one of these engines, the VCE-702, some form of noise suppression is needed for takeoff/sideline thrusts. The considered investigation is primarily concerned with scale model static tests of one particular concept for achieving that reduction, the thermal acoustic shield (TAS), which could also benefit other candidate SST engines. Other noise suppression devices being considered for SST application are the coannular nozzle, an internally ventilated nozzle, and mechanical suppressors. A test description is provided, taking into account the model configurations, the instrumentation, the test jet conditions, and aspects of screech noise control. Attention is given to shield thickness effects, a spectrum analysis, suppression and performance loss, and installed performance.
Investigation of Cooling Water Injection into Supersonic Rocket Engine Exhaust
Jones, Hansen; Jeansonne, Christopher; Menon, Shyam
2017-11-01
Water spray cooling of the exhaust plume from a rocket undergoing static testing is critical in preventing thermal wear of the test stand structure, and suppressing the acoustic noise signature. A scaled test facility has been developed that utilizes non-intrusive diagnostic techniques including Focusing Color Schlieren (FCS) and Phase Doppler Particle Anemometry (PDPA) to examine the interaction of a pressure-fed water jet with a supersonic flow of compressed air. FCS is used to visually assess the interaction of the water jet with the strong density gradients in the supersonic air flow. PDPA is used in conjunction to gain statistical information regarding water droplet size and velocity as the jet is broken up. Measurement results, along with numerical simulations and jet penetration models are used to explain the observed phenomena. Following the cold flow testing campaign a scaled hybrid rocket engine will be constructed to continue tests in a combusting flow environment similar to that generated by the rocket engines tested at NASA facilities. LaSPACE.
Large-Amplitude Long-Wave Instability of a Supersonic Shear Layer
Messiter, A. F.
1995-01-01
For sufficiently high Mach numbers, small disturbances on a supersonic vortex sheet are known to grow in amplitude because of slow nonlinear wave steepening. Under the same external conditions, linear theory predicts slow growth of long-wave disturbances to a thin supersonic shear layer. An asymptotic formulation is given here which adds nonzero shear-layer thickness to the weakly nonlinear formulation for a vortex sheet. Spatial evolution is considered, for a spatially periodic disturbance having amplitude of the same order, in Reynolds number, as the shear-layer thickness. A quasi-equilibrium inviscid nonlinear critical layer is found, with effects of diffusion and slow growth appearing through nonsecularity condition. Other limiting cases are also considered, in an attempt to determine a relationship between the vortex-sheet limit and the long-wave limit for a thin shear layer; there appear to be three special limits, corresponding to disturbances of different amplitudes at different locations along the shear layer.
International Nuclear Information System (INIS)
Airoldi, V.J.T.
1987-01-01
A method of measuring SF 6 cluster formation and inhibition in pulsed supersonic expansion in the presence of intense electromagnetic radiation is presented. The characterization of the expansion of SF 6 molecules was done and, the extension of the collision region was determined. An improved unidimensional theory of supersonic expansion showed good agreement with the experimental results. The spectra of multiphoton absorption of SF 6 molecules in supersonic jet and the average energy absorved by each molecule were determined. The absorption spectra of molecule in the collision region present absorption maxima different from those obtained in the collisionless region. The results, if compared with the literature data, show good agreement, with a small difference in the spetra corresponding to the collisionless region. This difference was observed, for the first time in the multiphoton absorption and is attribuited to cluster formation in the jet. A new technique for measuring cluster formation in the supersonic jet, based on determination of the spatial distribution of the energy of molecules in the jet after passing through a skimmer located in the collision region is shown. The inhibition of cluster formation, due to the incidence of intense electromagnetic radiation from a CO 2 -TEA pulsed laser in the initial collision region of the jet, causes a second expansion in the skimmer. The results obtained show that this method can lead to a new isotope separation process. All the parts of the experimental set up, for example, high vacuum system, pulsed valve and pyroelectric detector, were developed and constructed specially for the experiment. (Author) [pt
Vortex Generators in a Streamline-Traced, External-Compression Supersonic Inlet
Baydar, Ezgihan; Lu, Frank K.; Slater, John W.; Trefny, Charles J.
2017-01-01
Vortex generators within a streamline-traced, external-compression supersonic inlet for Mach 1.66 were investigated to determine their ability to increase total pressure recovery and reduce total pressure distortion. The vortex generators studied were rectangular vanes arranged in counter-rotating and co-rotating arrays. The vane geometric factors of interest included height, length, spacing, angle-of-incidence, and positions upstream and downstream of the inlet terminal shock. The flow through the inlet was simulated numerically through the solution of the steady-state, Reynolds-averaged Navier-Stokes equations on multi-block, structured grids using the Wind-US flow solver. The vanes were simulated using a vortex generator model. The inlet performance was characterized by the inlet total pressure recovery and the radial and circumferential total pressure distortion indices at the engine face. Design of experiments and statistical analysis methods were applied to quantify the effect of the geometric factors of the vanes and search for optimal vane arrays. Co-rotating vane arrays with negative angles-of-incidence positioned on the supersonic diffuser were effective in sweeping low-momentum flow from the top toward the sides of the subsonic diffuser. This distributed the low-momentum flow more evenly about the circumference of the subsonic diffuser and reduced distortion. Co-rotating vane arrays with negative angles-of-incidence or counter-rotating vane arrays positioned downstream of the terminal shock were effective in mixing higher-momentum flow with lower-momentum flow to increase recovery and decrease distortion. A strategy of combining a co-rotating vane array on the supersonic diffuser with a counter-rotating vane array on the subsonic diffuser was effective in increasing recovery and reducing distortion.
IPCS implications for future supersonic transport aircraft
Billig, L. O.; Kniat, J.; Schmidt, R. D.
1976-01-01
The Integrated Propulsion Control System (IPCS) demonstrates control of an entire supersonic propulsion module - inlet, engine afterburner, and nozzle - with an HDC 601 digital computer. The program encompasses the design, build, qualification, and flight testing of control modes, software, and hardware. The flight test vehicle is an F-111E airplane. The L.H. inlet and engine will be operated under control of a digital computer mounted in the weapons bay. A general description and the current status of the IPCS program are given.
A pulser-sustainer carbon monoxide electric-discharge supersonic laser
Monson, D. J.; Srinivasan, G.
1977-01-01
Operation of a CW CO electric-discharge supersonic laser with a pulser-sustainer discharge is described. High-power operation as well as independent control over electron energy and density are demonstrated. Maximum input power achieved to date is 100 kW. The maximum output power is 6 kW or 10% of the sustainer positive-column power. Much improved performance appears possible.
Aerodynamic shape optimization directed toward a supersonic transport using sensitivity analysis
Baysal, Oktay
1995-01-01
This investigation was conducted from March 1994 to August 1995, primarily, to extend and implement the previously developed aerodynamic design optimization methodologies for the problems related to a supersonic transport design. These methods had demonstrated promise to improve the designs (more specifically, the shape) of aerodynamic surfaces, by coupling optimization algorithms (OA) with Computational Fluid Dynamics (CFD) algorithms via sensitivity analyses (SA) with surface definition methods from Computer Aided Design (CAD). The present extensions of this method and their supersonic implementations have produced wing section designs, delta wing designs, cranked-delta wing designs, and nacelle designs, all of which have been reported in the open literature. Despite the fact that these configurations were highly simplified to be of any practical or commercial use, they served the algorithmic and proof-of-concept objectives of the study very well. The primary cause for the configurational simplifications, other than the usual simplify-to-study the fundamentals reason, were the premature closing of the project. Only after the first of the originally intended three-year term, both the funds and the computer resources supporting the project were abruptly cut due to their severe shortages at the funding agency. Nonetheless, it was shown that the extended methodologies could be viable options in optimizing the design of not only an isolated single-component configuration, but also a multiple-component configuration in supersonic and viscous flow. This allowed designing with the mutual interference of the components being one of the constraints all along the evolution of the shapes.
ARBITRARY INTERACTION OF PLANE SUPERSONIC FLOWS
Directory of Open Access Journals (Sweden)
P. V. Bulat
2015-11-01
Full Text Available Subject of study.We consider the Riemann problem for parameters at collision of two plane flows at a certain angle. The problem is solved in the exact statement. Most cases of interference, both stationary and non-stationary gas-dynamic discontinuities, followed by supersonic flows can be reduced to the problem of random interaction of two supersonic flows. Depending on the ratio of the parameters in the flows, outgoing discontinuities turn out to be shock waves, or rarefactionwaves. In some cases, there is no solution at all. It is important to know how to find the domain of existence for the relevant decisions, as the type of shock-wave structures in these domains is known in advance. The Riemann problem is used in numerical methods such as the method of Godunov. As a rule, approximate solution is used, known as the Osher solution, but for a number of problems with a high precision required, solution of this problem needs to be in the exact statement. Main results.Domains of existence for solutions with different types of shock-wave structure have been considered. Boundaries of existence for solutions with two outgoing shock waves are analytically defined, as well as with the outgoing shock wave and rarefaction wave. We identify the area of Mach numbers and angles at which the flows interact and there is no solution. Specific flows with two outgoing rarefaction waves are not considered. Practical significance. The results supplement interference theory of stationary gas-dynamic discontinuities and can be used to develop new methods of numerical calculation with extraction of discontinuities.
International Nuclear Information System (INIS)
Milani, P.
2002-01-01
By using a pulsed micro-plasma cluster source and by exploiting aero-dynamical effects typical of supersonic beams it is possible to obtain very high deposition rates with a control on neutral cluster mass distribution, allowing the deposition of thin films with controlled nanostructure. Due to high deposition rates, high lateral resolution, low temperature processing supersonic cluster beams can also be used for the micro and nano-patterning of cluster-assembled films when little or no post-growth manipulation or assembly is required. For example the nano and meso-structure of films obtained by carbon cluster beam deposition can be controlled by selecting in the beam the elemental building blocks, moreover functional properties such as field emission can be controlled and tailored. The use of supersonic cluster beams opens also new perspectives for the production of nano-structured films with novel physico-chemical and topological properties such as nano-structured carbon matrices containing carbide and transition metal particles. (Author)
Tseng, K.; Morino, L.
1975-01-01
A general theory for study, oscillatory or fully unsteady potential compressible aerodynamics around complex configurations is presented. Using the finite-element method to discretize the space problem, one obtains a set of differential-delay equations in time relating the potential to its normal derivative which is expressed in terms of the generalized coordinates of the structure. For oscillatory flow, the motion consists of sinusoidal oscillations around a steady, subsonic or supersonic flow. For fully unsteady flow, the motion is assumed to consist of constant subsonic or supersonic speed for time t or = 0 and of small perturbations around the steady state for time t 0.
A systematic study of supersonic jet noise.
Louis, J. F.; Letty, R. P.; Patel, J. R.
1972-01-01
The acoustic fields for a rectangular and for an axisymmetric nozzle configuration are studied. Both nozzles are designed for identical flow parameters. It is tried to identify the dominant noise mechanisms. The other objective of the study is to establish scaling laws of supersonic jet noise. A shock tunnel is used in the investigations. Measured sound directivity, propagation direction of Mach waves obtained by shadowgraphs, and the slight dependence of the acoustic efficiency on the level of expansion indicate that Mach waves contribute significantly to the noise produced by a rectangular jet.
Results from flamelet and non-flamelet models for supersonic combustion
Ladeinde, Foluso; Li, Wenhai
2017-11-01
Air-breathing propulsion systems (scramjets) have been identified as a viable alternative to rocket engines for improved efficiency. A scramjet engine, which operates at flight Mach numbers around 7 or above, is characterized by the existence of supersonic flow conditions in the combustor. In a dual-mode scramjet, this phenomenon is possible because of the relatively low value of the equivalence ratio and high stagnation temperature, which, together, inhibits thermal choking downstream of transverse injectors. The flamelet method has been our choice for turbulence-combustion interaction modeling and we have extended the basic approach in several dimensions, with a focus on the way the pressure and progress variable are modeled. Improved results have been obtained. We have also examined non-flamelet models, including laminar chemistry (QL), eddy dissipation concept (EDC), and partially-stirred reactor (PaSR). The pressure/progress variable-corrected simulations give better results compared with the original model, with reaction rates that are lower than those from EDC and PaSR. In general, QL tends to over-predict the reaction rate for the supersonic combustion problems investigated in our work.
Viscoelasticity evaluation of rubber by surface reflection of supersonic wave.
Omata, Nobuaki; Suga, Takahiro; Furusawa, Hirokazu; Urabe, Shinichi; Kondo, Takeru; Ni, Qing-Qing
2006-12-22
The main characteristic of rubber is a viscoelasticity. So it is important to research the characteristic of the viscoelasticity of the high frequency band for the friction between a rubber material and the hard one with roughness, for instance, the tire and the road. As for the measurement of the viscoelasticity of rubber, DMA (dynamic mechanical analysis) is general. However, some problems are pointed out to the measurement of the high frequency band by DMA. Then, we evaluated the viscoelasticity characteristic by the supersonic wave measurement. However, attenuation of rubber is large, and when the viscoelasticity is measured by the supersonic wave therefore, it is inconvenient and limited in a past method by means of bottom reflection. In this report, we tried the viscoelasticity evaluation by the method of using complex surface reflection coefficient and we compared with the friction coefficient under wide-range friction velocity. As a result, some relationships had been found for two properties. We report the result that character of viscoelasticity of rubber was comparable to friction coefficient.
Fishbach, L. H.
1978-01-01
The effect of turbofan engine overall pressure ratio, fan pressure ratio, and ductburner temperature rise on the engine weight and cruise fuel consumption for a mach 2.4 supersonic transport was investigated. Design point engines, optimized purely for the supersonic cruising portion of the flight where the bulk of the fuel is consumed, are considered. Based on constant thrust requirements at cruise, fuel consumption considerations would favor medium by pass ratio engines (1.5 to 1.8) of overall pressure ratio of about 16. Engine weight considerations favor low bypass ratio (0.6 or less) and low wverall pressure ratio (8). Combination of both effects results in bypass ratios of 0.6 to 0.8 and overall pressure ratio of 12 being the overall optimum.
International Nuclear Information System (INIS)
Takahashi, Yuya; Chen, Lin; Okajima, Junnosuke; Iga, Yuka; Komiya, Atsuki; Maruyama, Shigenao
2016-01-01
Highlights: • Effective cooling design by super-/sub-sonic air flow in microchannels is proposed. • Microscale supersonic flows is successfully generated and examined. • Microchannel flow density field were visualized quantitatively by interferometer. • The bump design shows great potential of heat transfer enhancement in microscale. - Abstract: With the fast development of electronic systems and the ever-increasing demand of thermally “smart” design in space and aeronautic engineering, the heat transfer innovations and high heat flux challenges have become a hot topic for decades. This study is aimed at the effective cooling heat transfer design by super-/sub-sonic air flow in microscale channels for high heat flux devices. The design is based on the low temperature flows with supersonic expansion in microscale, which yields a compact and simple design. By careful microelectromechanical process, microscale straight and bumped channels (with simple arc curve) are fabricated and experimentally tested in this study. The microscale flow field and density distributions under new designs are visualized quantitatively by an advanced phase-shifting interferometer system, which results are then compared carefully with numerical simulations. In this study, large differences between the two designs in density distribution and temperature changes (around 50 K) are found. The high heat flux potential for supersonic microchannel flows is realized and discussion into detail. It is confirmed that the bump design contributes significantly to the heat transfer enhancement, which shows potential for future application in novel system designs.
Equations for the kinetic modeling of supersonically flowing electrically excited lasers
International Nuclear Information System (INIS)
Lind, R.C.
1973-01-01
The equations for the kinetic modeling of a supersonically flowing electrically excited laser system are presented. The work focuses on the use of diatomic gases, in particular carbon monoxide mixtures. The equations presented include the vibrational rate equation which describes the vibrational population distribution, the electron, ion and electronic level rate equations, the gasdynamic equations for an ionized gas in the presence of an applied electric field, and the free electron Boltzmann equation including flow and gradient coupling terms. The model developed accounts for vibration--vibration collisions, vibration-translation collisions, electron-molecule inelastic excitation and superelastic de-excitation collisions, charge particle collisions, ionization and three body recombination collisions, elastic collisions, and radiative decay, all of which take place in such a system. A simplified form of the free electron Boltzmann equation is developed and discussed with emphasis placed on its coupling with the supersonic flow. A brief description of a possible solution procedure for the set of coupled equations is discussed
Probing the Conformational Landscape of Polyether Building Blocks in Supersonic Jets
Bocklitz, Sebastian; Hewett, Daniel M.; Zwier, Timothy S.; Suhm, Martin A.
2016-06-01
Polyethylene oxides (Polyethylene glycoles) and their phenoxy-capped analogs represent a prominent class of important polymers that are highly used as precursor molecules in supramolecular reactions. After a detailed study on the simplest representative (1,2-dimethoxyethane) [1], we present results on oligoethylene oxides with increasing chain lengths obtained by spontaneous Raman scattering in a supersonic jet. Through variation of stagnation pressure, carrier gas, nozzle distance and temperature we gain information on the conformational landscape as well as the mutual interconversion of low energy conformers. The obtained results are compared to state-of-the-art quantum chemical calculations. Additionally, we present UV as well as IR-UV and UV-UV double resonance studies on 1-methoxy-2-phenoxyethane in a supersonic jet. These complementary techniques allow for conformationally selective electronic and vibrational spectra in a closely related conformational landscape. [1] S. Bocklitz, M. A. Suhm, Constraining the Conformational Landscape of a Polyether Building Block by Raman Jet Spectroscopy, Z. Phys. Chem. 2015, 229, 1625-1648.
Modelling and simulation of the compressible turbulence in supersonic shear flows
International Nuclear Information System (INIS)
Guezengar, Dominique
1997-02-01
This research thesis addresses the modelling of some specific physical problems of fluid mechanics: compressibility (issue of mixing layers), large variations of volumetric mass (boundary layers), and anisotropy (compression ramps). After a presentation of the chosen physical modelling and numerical approximation, the author pays attention to flows at the vicinity of a wall, and to boundary conditions. The next part addresses existing compressibility models and their application to the calculation of supersonic mixing layers. A critical assessment is also performed through calculations of boundary layers and of compression ramps. The next part addresses problems related to large variations of volumetric mass which are not taken by compressibility models into account. A modification is thus proposed for the diffusion term, and is tested for the case of supersonic boundary layers and of mixing layers with high density rates. Finally, anisotropy effects are addressed through the implementation of Explicit Algebraic Stress k-omega Turbulence models (EARSM), and their tests on previously studied cases [fr
Fan Noise for a Concept Commercial Supersonic Transport
Stephens, David
2017-01-01
NASA is currently studying a commercial supersonic transport (CST) aircraft that could carry 35+ passengers at Mach 1.6+ with a 4000+nm range. The aircraft should also meet environmental goals for sonic boom, airport noise and emissions at cruise. With respect to airport noise, considerable effort has been put into predicting the noise due to the jet exhaust. This report describes an internal NASA effort to consider the contribution of fan noise to the overall engine noise of this class of aircraft.
Pulsed, supersonic fuel jets-A review of their characteristics and potential for fuel injection
International Nuclear Information System (INIS)
Milton, B.E.; Pianthong, K.
2005-01-01
High pressure fuel injection has provided considerable benefits for diesel engines, substantially reducing smoke levels while increasing efficiency. Current maximum pressures provide jets that are at less than the sonic velocity of the compressed air in the cylinders at injection. It has been postulated that a further increase into the supersonic range may benefit the combustion process due to increased aerodynamic atomization and the presence of jet bow shock waves that provide higher temperatures around the fuel. Pulsed, supersonic injection may also be beneficial for scramjet engines. The current program is examining pulsed, supersonic jets from a fundamental viewpoint both experimentally and numerically. Shock wave structures have been viewed for jets ranging from 600 to 2400 m/s, velocity attenuation and penetration distance measured, different nozzle designs examined and autoignition experiments carried out. Inside the nozzle, numerical simulation using the Autodyne code has been used to support an analytic approach while in the spray, the FLUENT code has been used. While benefits have not yet been defined, it appears that some earlier claims regarding autoignition at atmospheric conditions were optimistic but that increased evaporation and mixing are probable. The higher jet velocities are likely to mean that wall interactions are increased and hence matching such injectors to engine size and airflow patterns will be important
Development of supersonic plasma flows by use of a magnetic nozzle and an ICRF heating
Energy Technology Data Exchange (ETDEWEB)
Inutake, M.; Ando, A.; Hattori, K.; Tobari, H.; Hosokawa, Y.; Sato, R.; Hatanaka, M.; Harata, K. [Tohoku Univ., Dept. of Electrical Engineering, Sendai (Japan)
2004-07-01
A high-beta, supersonic plasma flow plays a crucial role in MHD phenomena in space and fusion plasmas. There are a few experimental researches on production and control of a fast flowing plasma in spite of a growing significance in the magnetized-plasma flow dynamics. A magneto-plasma-dynamic arc-jet (MPDA) is one of promising devices to produce a supersonic plasma flow and has been utilized as an electric propulsion device with a higher specific impulse and a relatively larger thrust. We have improved the performance of an MPDA to produce a quasi-steady plasma flow with a transonic and supersonic Mach number in a highly-ionized state. There are two methods in order to control an ion-acoustic Mach number of the plasma flow exhausted from an MPDA: one is to use a magnetic Laval nozzle to convert a thermal energy to a flow energy and the other is a combined system of an ion heating and a divergent magnetic nozzle. The former is an analogous method to a compressible air flow and the latter is the method proposed in an advanced thruster for a manned interplanetary space mission. We have clarified the plasma flow characteristics in various shapes of a magnetic field configuration. It was demonstrated that the Mach number of the plasma flow could increase up to almost 3 in a divergent magnetic nozzle field. This paper reports recent results on the flow field improvements: one is on a magnetic-Laval-nozzle effects observed at the muzzle region of the MPDA, and the other is on ICRF (ion-cyclotron-range of frequency) heating of a supersonic plasma by use of a helical antenna. (authors)
Gas turbine engine with supersonic compressor
Roberts, II, William Byron; Lawlor, Shawn P.
2015-10-20
A gas turbine engine having a compressor section using blades on a rotor to deliver a gas at supersonic conditions to a stator. The stator includes one or more of aerodynamic ducts that have converging and diverging portions for deceleration of the gas to subsonic conditions and to deliver a high pressure gas to combustors. The aerodynamic ducts include structures for changing the effective contraction ratio to enable starting even when designed for high pressure ratios, and structures for boundary layer control. In an embodiment, aerodynamic ducts are provided having an aspect ratio of two to one (2:1) or more, when viewed in cross-section orthogonal to flow direction at an entrance to the aerodynamic duct.
Flow Simulation of Supersonic Inlet with Bypass Annular Duct
Kim, HyoungJin; Kumano, Takayasu; Liou, Meng-Sing; Povinelli, Louis A.; Conners, Timothy R.
2011-01-01
A relaxed isentropic compression supersonic inlet is a new concept that produces smaller cowl drag than a conventional inlet, but incurs lower total pressure recovery and increased flow distortion in the (radially) outer flowpath. A supersonic inlet comprising a bypass annulus to the relaxed isentropic compression inlet dumps out airflow of low quality through the bypass duct. A reliable computational fluid dynamics solution can provide considerable useful information to ascertain quantitatively relative merits of the concept, and further provide a basis for optimizing the design. For a fast and reliable performance evaluation of the inlet performance, an equivalent axisymmetric model whose area changes accounts for geometric and physical (blockage) effects resulting from the original complex three-dimensional configuration is proposed. In addition, full three-dimensional calculations are conducted for studying flow phenomena and verifying the validity of the equivalent model. The inlet-engine coupling is carried out by embedding numerical propulsion system simulation engine data into the flow solver for interactive boundary conditions at the engine fan face and exhaust plane. It was found that the blockage resulting from complex three-dimensional geometries in the bypass duct causes significant degradation of inlet performance by pushing the terminal normal shock upstream.
International Nuclear Information System (INIS)
Song, Zhi-Guang; Li, Feng-Ming
2011-01-01
The active vibration control of all kinds of structures by using the piezoelectric material has been extensively investigated. In this paper, the active aeroelastic flutter characteristics and vibration control of supersonic beams applying the piezoelectric material are studied further. The piezoelectric materials are bonded on the top and bottom surfaces of the beams to act as the actuator and sensor so that the active aeroelastic flutter suppression for the supersonic beams can be conducted. The supersonic piston theory is adopted to evaluate the aerodynamic pressure. Hamilton's principle with the assumed mode method is used to develop the dynamical model of the structural systems. By using the standard eigenvalue methodology, the solutions for the complex eigenvalue problem are obtained. A negative velocity feedback control strategy is used to obtain active damping. The aeroelastic flutter bounds are calculated and the active aeroelastic flutter characteristics are analyzed. The impulse responses of the structural system are obtained by using the Houbolt numerical algorithm to study the active aeroelastic vibration control. The influences of the non-dimensional aerodynamic pressure on the active flutter control are analyzed. From the numerical results it is observed that the aeroelastic flutter characteristics of the supersonic beams can be significantly improved and that the aeroelastic vibration amplitudes can be remarkably reduced, especially at the flutter points, by using the piezoelectric actuator/sensor pairs which can provide an active damping. Within a certain value of the feedback control gain, with the increase of it, the flutter aerodynamic pressure (or flutter velocity) can be increased and the control results are also improved
Micro Ramps in Supersonic Turbulent Boundary Layers : An experimental and numerical study
Sun, Z.
2014-01-01
The micro vortex generator (MVG) is used extensively in low speed aerodynamic problems and is now extended into the supersonic flow regime to solve undesired flow features that are associated with shock wave boundary layer interactions (SWBLI) such as flow separation and associated unsteadiness of
Supersonic impinging jet noise reduction using a hybrid control technique
Wiley, Alex; Kumar, Rajan
2015-07-01
Control of the highly resonant flowfield associated with supersonic impinging jet has been experimentally investigated. Measurements were made in the supersonic impinging jet facility at the Florida State University for a Mach 1.5 ideally expanded jet. Measurements included unsteady pressures on a surface plate near the nozzle exit, acoustics in the nearfield and beneath the impingement plane, and velocity field using particle image velocimetry. Both passive control using porous surface and active control with high momentum microjet injection are effective in reducing nearfield noise and flow unsteadiness over a range of geometrical parameters; however, the type of noise reduction achieved by the two techniques is different. The passive control reduces broadband noise whereas microjet injection attenuates high amplitude impinging tones. The hybrid control, a combination of two control methods, reduces both broadband and high amplitude impinging tones and surprisingly its effectiveness is more that the additive effect of the two control techniques. The flow field measurements show that with hybrid control the impinging jet is stabilized and the turbulence quantities such as streamwise turbulence intensity, transverse turbulence intensity and turbulent shear stress are significantly reduced.
Mironov, S. G.; Poplavskaya, T. V.; Kirilovskiy, S. V.
2017-10-01
The paper presents the results of an experimental investigation of supersonic flow around a solid cylinder with a gas-permeable porous insert on its front end and of supersonic flow around a hollow cylinder with internal porous inserts in the presence of heating of the porous material. The experiments were performed in a supersonic wind tunnel with Mach number 4.85 and 7 with porous inserts of cellular-porous nickel. The results of measurements on the filtration stand of the air filtration rate through the cellular-porous nickel when it is heated are also shown. For a number of experiments, numerical modeling based on the skeletal model of a cellular-porous material was carried out.
Energy Technology Data Exchange (ETDEWEB)
Jung, Jong-Kil; Yoon, Jun-Kyu [Gachon Univ., Sungnam (Korea, Republic of); Kim, Kwang-Chu [KEPCO-E& C, Kimchun (Korea, Republic of)
2017-10-15
A rupture in a high-pressure pipe causes the fluid in the pipe to be discharged in the atmosphere at a high speed resulting in a supersonic jet that generates the compressible flow. This supersonic jet may display complicated and unsteady behavior in general . In this study, Computational Fluid Dynamics (CFD) analysis was performed to investigate the compressible flow generated by a supersonic jet ejected from a high-pressure pipe. A Shear Stress Transport (SST) turbulence model was selected to analyze the unsteady nature of the flow, which depends upon the various gases as well as the diameter of the pipe. In the CFD analysis, the basic boundary conditions were assumed to be as follows: pipe of diameter 10 cm, jet pressure ratio of 5, and an inlet gas temperature of 300 K. During the analysis, the behavior of the shockwave generated by a supersonic jet was observed and it was found that the blast wave was generated indirectly. The pressure wave characteristics of hydrogen gas, which possesses the smallest molecular mass, showed the shortest distance to the safety zone. There were no significant difference observed for nitrogen gas, air, and oxygen gas, which have similar molecular mass. In addition, an increase in the diameter of the pipe resulted in the ejected impact caused by the increased flow rate to become larger and the zone of jet influence to extend further.
Directory of Open Access Journals (Sweden)
Hugo eGeerts
2016-02-01
Full Text Available The current treatment of Parkinson’s disease with dopamine-centric approaches such as L-DOPA and dopamine agonists, although very succesfull, is in need of alternative treatment strategies, both in terms of disease modification and symptom management. Various non-dopaminergic treatment approaches did not result in a clear clinical benefit, despite showing a clear effect in preclinical animal models. In addition, polypharmacy is common, sometimes leading to unintended effects on non-motor symptoms such as in cognitive and psychiatric domains. To explore novel targets for symptomatic treatment and possible synergistic pharmacodynamic effects between different drugs, we developed a Quantitative Systems Pharmacology (QSP platform of the closed cortico-striatal-thalamic-cortical basal ganglia loop of the dorsal motor circuit. This mechanism-based simulation platform is based on the known neuro-anatomy and neurophysiology of the basal ganglia and explicitly incorporates domain expertise in a formalized way. The calculated beta/gamma power ratio of the local field potential in the subthalamic nucleus correlates well (R2=0.71 with clinically observed extra-pyramidal symptoms triggered by antipsychotics during schizophrenia treatment (43 drug-dose combinations. When incorporating Parkinsonian (PD pathology and reported compensatory changes, the computer model suggests a major increase in b/g ratio (corresponding to bradykinesia and rigidity from a dopamine depletion of 70% onwards. The correlation between the outcome of the QSP model and the reported changes in UPDRS III Motor Part for 22 placebo-normalized drug-dose combinations is R2=0.84. The model also correctly recapitulates the lack of clinical benefit for perampanel, MK-0567 and flupirtine and offers a hypothesis for the translational disconnect. Finally, using human PET imaging studies with placebo response, the computer model predicts well the placebo response for chronic treatment, but not
SGS Modeling of the Internal Energy Equation in LES of Supersonic Channel Flow
Raghunath, Sriram; Brereton, Giles
2011-11-01
DNS of fully-developed turbulent supersonic channel flows (Reτ = 190) at up to Mach 3 indicate that the turbulent heat fluxes depend only weakly on Mach number, while the viscous dissipation and pressure dilatation do so strongly. Moreover, pressure dilatation makes a significant contribution to the internal energy budget at Mach 3 and higher. The balance between these terms is critical to determining the temperature (and so molecular viscosity) from the internal energy equation and so, in LES of these flows, it is essential to use accurate SGS models for the viscous dissipation and the pressure dilatation. In this talk, we present LES results for supersonic channel flow, using SGS models for these terms that are based on the resolved-scale dilatation, an inverse timescale, and SGS momentum fluxes, which intrinsically represent this Mach number effect.
Effect of outer stagnation pressure on jet structure in supersonic coaxial jet
International Nuclear Information System (INIS)
Kim, Myoung Jong; Woo, Sang Woo; Lee, Byeong Eun; Kwon, Soon Bum
2001-01-01
The characteristics of dual coaxial jet which composed of inner supersonic nozzle of 26500 in constant expansion rate with 1.91 design Mach number and outer converging one with 40 .deg. C converging angle with the variation of outer nozzle stagnation pressure are experimentally investigated in this paper. In which the stagnation pressure for the inner supersonic nozzle is 750kPa thus, the inner jet leaving the nozzle is slightly underexpanded. The plenum pressure of outer nozzle are varied from 200 to 600kPa. Flow visualizations by shadowgraph method, impact pressure and centerline static pressure measurements of dual coaxial jet are presented. The results show that the presence of outer jet affects significantly the structures and pressure distributions of inner jet. And outer jet causes Mach disk which does not appear for the case of single jet stream. As the stagnation pressure of outer jet increases, impact pressure undulation is severe, but the average impact pressure keeps high far downstream
Unsteady Flow in a Supersonic Turbine with Variable Specific Heats
Dorney, Daniel J.; Griffin, Lisa W.; Huber, Frank; Sondak, Douglas L.; Turner, James (Technical Monitor)
2001-01-01
Modern high-work turbines can be compact, transonic, supersonic, counter-rotating, or use a dense drive gas. The vast majority of modern rocket turbine designs fall into these Categories. These turbines usually have large temperature variations across a given stage, and are characterized by large amounts of flow unsteadiness. The flow unsteadiness can have a major impact on the turbine performance and durability. For example, the Space Transportation Main Engine (STME) fuel turbine, a high work, transonic design, was found to have an unsteady inter-row shock which reduced efficiency by 2 points and increased dynamic loading by 24 percent. The Revolutionary Reusable Technology Turbopump (RRTT), which uses full flow oxygen for its drive gas, was found to shed vortices with such energy as to raise serious blade durability concerns. In both cases, the sources of the problems were uncovered (before turbopump testing) with the application of validated, unsteady computational fluid dynamics (CFD) to the designs. In the case of the RRTT and the Alternate Turbopump Development (ATD) turbines, the unsteady CFD codes have been used not just to identify problems, but to guide designs which mitigate problems due to unsteadiness. Using unsteady flow analyses as a part of the design process has led to turbine designs with higher performance (which affects temperature and mass flow rate) and fewer dynamics problems. One of the many assumptions made during the design and analysis of supersonic turbine stages is that the values of the specific heats are constant. In some analyses the value is based on an average of the expected upstream and downstream temperatures. In stages where the temperature can vary by 300 to 500 K, however, the assumption of constant fluid properties may lead to erroneous performance and durability predictions. In this study the suitability of assuming constant specific heats has been investigated by performing three-dimensional unsteady Navier
Increased Mach Number Capability for the NASA Glenn 10x10 Supersonic Wind Tunnel
Slater, J. W.; Saunders, J. D.
2015-01-01
Computational simulations and wind tunnel testing were conducted to explore the operation of the Abe Silverstein Supersonic Wind Tunnel at the NASA Glenn Research Center at test section Mach numbers above the current limit of Mach 3.5. An increased Mach number would enhance the capability for testing of supersonic and hypersonic propulsion systems. The focus of the explorations was on understanding the flow within the second throat of the tunnel, which is downstream of the test section and is where the supersonic flow decelerates to subsonic flow. Methods of computational fluid dynamics (CFD) were applied to provide details of the shock boundary layer structure and to estimate losses in total pressure. The CFD simulations indicated that the tunnel could be operated up to Mach 4.0 if the minimum width of the second throat was made smaller than that used for previous operation of the tunnel. Wind tunnel testing was able to confirm such operation of the tunnel at Mach 3.6 and 3.7 before a hydraulic failure caused a stop to the testing. CFD simulations performed after the wind tunnel testing showed good agreement with test data consisting of static pressures along the ceiling of the second throat. The CFD analyses showed increased shockwave boundary layer interactions, which was also observed as increased unsteadiness of dynamic pressures collected in the wind tunnel testing.
Firouz-Abadi, R. D.; Alavi, S. M.; Salarieh, H.
2013-07-01
The flutter of a 3-D rigid fin with double-wedge section and free-play in flapping, plunging and pitching degrees-of-freedom operating in supersonic and hypersonic flight speed regimes have been considered. Aerodynamic model is obtained by local usage of the piston theory behind the shock and expansion analysis, and structural model is obtained based on Lagrange equation of motion. Such model presents fast, accurate algorithm for studying the aeroelastic behavior of the thick supersonic fin in time domain. Dynamic behavior of the fin is considered over large number of parameters that characterize the aeroelastic system. Results show that the free-play in the pitching, plunging and flapping degrees-of-freedom has significant effects on the oscillation exhibited by the aeroelastic system in the supersonic/hypersonic flight speed regimes. The simulations also show that the aeroelastic system behavior is greatly affected by some parameters, such as the Mach number, thickness, angle of attack, hinge position and sweep angle.
International Nuclear Information System (INIS)
Kawakatu, Nozomu; Kino, Motoki; Nagai, Hiroshi
2009-01-01
We argue that the origin of 'FRI/FRII dichotomy' - the division between Fanaroff-Riley class I (FRI) with subsonic lobes and class II (FRII) radio sources with supersonic lobes is sharp in the radio-optical luminosity plane (Owen-White diagram) - can be explained by the deceleration of advancing radio lobes. The deceleration is caused by the growth of the effective cross-sectional area of radio lobes. We derive the condition in which an initially supersonic lobe turns into a subsonic lobe, combining the ram pressure equilibrium between the hot spots and the ambient medium with the relation between 'the hot spot radius' and 'the linear size of radio sources' obtained from the radio observations. We find that the dividing line between the supersonic lobes and subsonic ones is determined by the ratio of the jet power L j to the number density of the ambient matter at the core radius of the host galaxy n-bar a . It is also found that the maximal ratio of (L j ,n-bar a ) exists and its value resides in (L j ,n-bar a ) max ∼10 44-47 er s -1 cm 3 , taking into account considerable uncertainties. This suggests that the maximal value (L j ,n-bar a ) max separates between FRIs and FRIIs.
Nickel–copper hybrid electrodes self-adhered onto a silicon wafer by supersonic cold-spray
International Nuclear Information System (INIS)
Lee, Jong-Gun; Kim, Do-Yeon; Kang, Byungjun; Kim, Donghwan; Song, Hee-eun; Kim, Jooyoung; Jung, Woonsuk; Lee, Dukhaeng; Al-Deyab, Salem S.; James, Scott C.; Yoon, Sam S.
2015-01-01
High-performance electrodes are fabricated through supersonic spraying of nickel and copper particles. These electrodes yield low specific resistivities, comparable to electrodes produced by screen-printed silver paste and light-induced plating. The appeal of this fabrication method is the low cost of copper and large area scalability of supersonic spray-coating techniques. The copper and nickel electrode was fabricated in the open air without any pre- or post-treatment. The spray-coated copper–nickel electrode was characterized by optical microscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction, and energy dispersive spectroscopy. Although both SEM and TEM images confirmed voids trapped between flattened particles in the fabricated electrode, this electrode’s resistivity was order 10 −6 Ω cm, which is comparable to the bulk value for pure copper
International Nuclear Information System (INIS)
Haufler, R.E.; Puretzky, A.A.; Compton, R.N.
1993-01-01
Concepts which guide the design of atomic cluster supersonic beam sources have been developed. These ideas are founded on the knowledge of laser ablation dynamics and are structured in order to take advantage of certain features of the ablation event. Some of the drawbacks of previous cluster source designs become apparent when the sequence of events following laser ablation are clarified. Key features of the new cluster source design include control of the cluster size distribution, uniform performance with a variety of solid materials and elements, high beam intensity, and significant removal of internal energy during the supersonic expansion
Pulsed molecular beams: A lower limit on pulse duration for fully developed supersonic expansions
International Nuclear Information System (INIS)
Saenger, K.L.
1981-01-01
We derive an expression for Δt/sub min/, the mimimum pulse duration (''valve open time'') required if a pulsed nozzle is to produce a supersonic beam comparably ''cold'' to that obtained from a continuous source
Axdahl, Erik L.
2015-01-01
Removing human interaction from design processes by using automation may lead to gains in both productivity and design precision. This memorandum describes efforts to incorporate high fidelity numerical analysis tools into an automated framework and applying that framework to applications of practical interest. The purpose of this effort was to integrate VULCAN-CFD into an automated, DAKOTA-enabled framework with a proof-of-concept application being the optimization of supersonic test facility nozzles. It was shown that the optimization framework could be deployed on a high performance computing cluster with the flow of information handled effectively to guide the optimization process. Furthermore, the application of the framework to supersonic test facility nozzle flowpath design and optimization was demonstrated using multiple optimization algorithms.
QUALIFICAÇÁO PROFISSIONAL PARA O EMPREENDEDORISMO: uma alternativa ao desemprego?
Directory of Open Access Journals (Sweden)
Geórgia Patrícia Guimarães dos Santos
2006-01-01
Full Text Available The analyse the development of the Qualification State Plan (QSP in the state of Ceará, in Brazil, based on the testimony of some of the involved parIs (education institutioris and the State Secretariat of Labor in its performance. lt includes the performance process of this Plan as of its most important goal: focusing ot lhe vocation education courses on the demand of lhe labor market in the state of Ceará. This study based on lhe articulation between the literature on lhe relationship between labor and education, within the scope of lhe later changes on international capitalism and on lhe organizalion of labor, and lhe reflections lhat approaches labor force education policies, Iocusing on QSP and the elements collected in lhe interviews carried oul with the QSP administralor agencies of lhe state of Ceará and the executor group that took part in the program, as well as those included by means of reading and analysis oflicial documents.
International Nuclear Information System (INIS)
Kumar, Virendra; Singhal, Gaurav; Subbarao, P.M.V.
2013-01-01
The constant rate of momentum change (CRMC) is a new approach towards design of supersonic ejectors. CRMC methodology was first proposed by Eames [1] in a study which was primarily based on isentropic flow inside the diffusing region of a supersonic ejector. The prime benefit that accrues from employing a CRMC ejector is that it can effectively eliminate the irreversibility associated with occurrence of thermodynamic shock process. The present study examines the supersonic flow in a CRMC ejector from the perspective of an adiabatic flow with frictional effects inside the variable cross-section of supersonic ejector, which is apparently more realistic. An analytical model has been discussed for the prediction of flow parameter variation in a space marching formulation taking into account change in localized frictional coefficient due to corresponding changes at each step. The analytical results have been validated by conducting a computational study based on 2-D axi-symmetric viscous compressible flow formulation with turbulence in FLUENT. The results are in good agreement at on-design conditions. The predictions especially for the recovered pressure made through the analytical formulation incorporating friction are found to be in significantly better agreement than the isentropic approach. The experimental validation for the approach has also been presented with the results being in close agreement with analytically predicted values. -- Highlights: • CRMC ejector eliminates the irreversibility due to occurrence of thermodynamic shock. • Frictional effect based apparently present more realistic solution for ejector. • Static pressure variation between proposed model and numerical study is nearly 2.29%. • Static pressure variation between analytical and experimental values is nearly 4%. • Experimentally observed entrainment ratio shows 3% variation w.r.t. design point value
A multiple-scales model of the shock-cell structure of imperfectly expanded supersonic jets
Tam, C. K. W.; Jackson, J. A.; Seiner, J. M.
1985-01-01
The present investigation is concerned with the development of an analytical model of the quasi-periodic shock-cell structure of an imperfectly expanded supersonic jet. The investigation represents a part of a program to develop a mathematical theory of broadband shock-associated noise of supersonic jets. Tam and Tanna (1982) have suggested that this type of noise is generated by the weak interaction between the quasi-periodic shock cells and the downstream-propagating large turbulence structures in the mixing layer of the jet. In the model developed in this paper, the effect of turbulence in the mixing layer of the jet is simulated by the addition of turbulent eddy-viscosity terms to the momentum equation. Attention is given to the mean-flow profile and the numerical solution, and a comparison of the numerical results with experimental data.
Aerodynamic forces estimation on jet vanes exposed to supersonic exhaust of a CD Nozzle
International Nuclear Information System (INIS)
Bukhari, S.B.H.; Jehan, I.; Zahir, S.; Khan, M.A.
2003-01-01
A comprehensive study has been made for the estimation of aerodynamic forces on the jet Vane placed in the supersonic exhaust of a Convergent Divergent, CD-Nozzle. Such a system is used to provide the control forces that consist of four orthogonal vanes mounted in the supersonic exhaust of the CD-Nozzles. The flow field parameters for a CD Nozzle were analyzed and validated earlier. In this paper the published experimental and CFD results from RAMPANT Code from Fluent Inc. were used to estimate the axial and normal forces by using PAK-3D, a Computational Fluid Dynamics (CFD) software based on Navier-Stokes Equations solver. Results got verified quantitatively with a maximum error of 8% between PAK-3D and experiment, while 4% between PAK-3D and a CFD code, RAMPANT for the axial force. (author)
Design for LTE EOS and opacity experiments using supersonic radiation waves
Tierney, T. E.; Peterson, R. R.; Tierney, H. E.
2007-11-01
Opacity and EOS at 100-200 eV are important physical parameters in ICF experiments. We describe an experiment design that uses the supersonic propagation of hohlraum radiation in foams to isochorically heat samples. Laser and Z-pinch experiments frequently use 150 to 220-eV quasi-blackbody emission from hohlraums to drive physics experiments. A foam target encapsulated in a gold-wall cylinder is placed next to the hohlraum. The low density and opacity foam captures some hohlraum emission and generates a supersonically-propagating radiation wave. The material heated by the wave is cooler towards the high-albedo gold wall. Modeling and past measurements show that core regions of the foam have small thermal gradients. We place a small, thin sample (e.g., Al, Si, or Fe) in the thermally-uniform region. X-ray emission of tracers and the sample as well as quasi-continuum x-ray absorption will be measured using time-resolved x-ray spectroscopy. The foam's EOS can be measured to ±5% by blast waves with a well characterized drive. This experiment could use the OMEGA, Z-Beamlet, and/or ZR facilities to explore temperature-dependent conditions.
Reduction of the suction pressure of a liquid ring vacuum pump with a supersonic gas ejector
Directory of Open Access Journals (Sweden)
Olšiak Róbert
2018-01-01
Full Text Available A supersonic gas ejector in conjunction with a liquid ring vacuum pump is used for creating and maintaining vacuum in a chamber for technological purposes. In this paper the authors submit an overview about the problematics of suction pressure reduction with a supersonic gas ejector used as a pre-stage of a liquid ring vacuum pump. This system has also the function of a cavitation protection due to the higher pressure present at the suction throat of the vacuum pump. A part of this paper is devoted to the governing equations used at the definition of the flow through an ejector. The experimental studies are then carried out in or own laboratory for verification purposes.
Toward Active Control of Noise from Hot Supersonic Jets
2014-04-21
Mechanisms AGARD - CP -131, 1974, pp. 13.1-13.12. [23] Goldstein, M.E., "On identifying the true sources of aerodynamic sound," Journal of Fluid Mechanics Vol...either constant or begins to decay. For the resampled data (1/8 inch microphones resampled at 100 kHz), the change in 7( 73 ) follows the originally...supersonic jet and their acoustic radiation," Journal of Fluid Mechanics, Vol. 69, No.l, 1975, pp. 73 95. [5] Tain, C. K. W., "Mach wave radiation from high
Numerical simulation of the generation mechanism of axisymmetric supersonic jet screech tones
Li, X. D.; Gao, J. H.
2005-08-01
In this paper an axisymmetric computational aeroacoustic procedure is developed to investigate the generation mechanism of axisymmetric supersonic jet screech tones. The axisymmetric Navier-Stokes equations and the two equations standard k-ɛ turbulence model modified by Turpin and Troyes ["Validation of a two-equation turbulence model for axisymmetric reacting and non-reaction flows," AIAA Paper No. 2000-3463 (2000)] are solved in the generalized curvilinear coordinate system. A generalized wall function is applied in the nozzle exit wall region. The dispersion-relation-preserving scheme is applied for space discretization. The 2N storage low-dissipation and low-dispersion Runge-Kutta scheme is employed for time integration. Much attention is paid to far-field boundary conditions and turbulence model. The underexpanded axisymmetric supersonic jet screech tones are simulated over the Mach number from 1.05 to 1.2. Numerical results are presented and compared with the experimental data by other researchers. The simulated wavelengths of A0, A1, A2, and B modes and part of simulated amplitudes agree very well with the measurement data by Ponton and Seiner ["The effects of nozzle exit lip thickness on plume resonance," J. Sound Vib. 154, 531 (1992)]. In particular, the phenomena of modes jumping have been captured correctly although the numerical procedure has to be improved to predict the amplitudes of supersonic jet screech tones more accurately. Furthermore, the phenomena of shock motions are analyzed. The predicted splitting and combination of shock cells are similar with the experimental observations of Panda ["Shock oscillation in underexpanded screeching jets," J. Fluid. Mech. 363, 173 (1998)]. Finally, the receptivity process is numerically studied and analyzed. It is shown that the receptivity zone is associated with the initial thin shear layer, and the incoming and reflected sound waves.
Laser driven supersonic flow over a compressible foam surface on the Nike lasera)
Harding, E. C.; Drake, R. P.; Aglitskiy, Y.; Plewa, T.; Velikovich, A. L.; Gillespie, R. S.; Weaver, J. L.; Visco, A.; Grosskopf, M. J.; Ditmar, J. R.
2010-05-01
A laser driven millimeter-scale target was used to generate a supersonic shear layer in an attempt to create a Kelvin-Helmholtz (KH) unstable interface in a high-energy-density (HED) plasma. The KH instability is a fundamental fluid instability that remains unexplored in HED plasmas, which are relevant to the inertial confinement fusion and astrophysical environments. In the experiment presented here the Nike laser [S. P. Obenschain et al., Phys. Plasmas 3, 2098 (1996)] was used to create and drive Al plasma over a rippled foam surface. In response to the supersonic Al flow (Mach=2.6±1.1) shocks should form in the Al flow near the perturbations. The experimental data were used to infer the existence and location of these shocks. In addition, the interface perturbations show growth that has possible contributions from both KH and Richtmyer-Meshkov instabilities. Since compressible shear layers exhibit smaller growth, it is important to use the KH growth rate derived from the compressible dispersion relation.
Laser driven supersonic flow over a compressible foam surface on the Nike laser
International Nuclear Information System (INIS)
Harding, E. C.; Drake, R. P.; Gillespie, R. S.; Visco, A.; Grosskopf, M. J.; Ditmar, J. R.; Aglitskiy, Y.; Velikovich, A. L.; Weaver, J. L.; Plewa, T.
2010-01-01
A laser driven millimeter-scale target was used to generate a supersonic shear layer in an attempt to create a Kelvin-Helmholtz (KH) unstable interface in a high-energy-density (HED) plasma. The KH instability is a fundamental fluid instability that remains unexplored in HED plasmas, which are relevant to the inertial confinement fusion and astrophysical environments. In the experiment presented here the Nike laser [S. P. Obenschain et al., Phys. Plasmas 3, 2098 (1996)] was used to create and drive Al plasma over a rippled foam surface. In response to the supersonic Al flow (Mach=2.6±1.1) shocks should form in the Al flow near the perturbations. The experimental data were used to infer the existence and location of these shocks. In addition, the interface perturbations show growth that has possible contributions from both KH and Richtmyer-Meshkov instabilities. Since compressible shear layers exhibit smaller growth, it is important to use the KH growth rate derived from the compressible dispersion relation.
Field of infrasound wave on the earth from blast wave, produced by supersonic flight of a rocket
International Nuclear Information System (INIS)
Drobzheva, Ya.V.; Krasnov, V.M.
2006-01-01
It was developed a physical model, which allowed calculating a field of infrasound wave on the earth from blast wave, produced by supersonic flight of a rocket. For space launching site Baikonur it is shown that the nearest horizontal distance from launching site of rocket up to which arrive infrasound waves, produced by supersonic flight of a rocket, is 56 km. Amplitude of acoustic impulse decreases in 5 times on distance of 600 km. Duration of acoustic impulse increases from 1.5 to 3 s on the same distance. Values of acoustic field parameters on the earth surface, practically, do not depend from season of launching of rocket. (author)
Radiative forcing from particle emissions by future supersonic aircraft
Directory of Open Access Journals (Sweden)
G. Pitari
2008-07-01
Full Text Available In this work we focus on the direct radiative forcing (RF of black carbon (BC and sulphuric acid particles emitted by future supersonic aircraft, as well as on the ozone RF due to changes produced by emissions of both gas species (NOx, H2O and aerosol particles capable of affecting stratospheric ozone chemistry. Heterogeneous chemical reactions on the surface of sulphuric acid stratospheric particles (SSA-SAD are the main link between ozone chemistry and supersonic aircraft emissions of sulphur precursors (SO2 and particles (H2O–H2SO4. Photochemical O3 changes are compared from four independent 3-D atmosphere-chemistry models (ACMs, using as input the perturbation of SSA-SAD calculated in the University of L'Aquila model, which includes on-line a microphysics code for aerosol formation and growth. The ACMs in this study use aircraft emission scenarios for the year 2050 developed by AIRBUS as a part of the EU project SCENIC, assessing options for fleet size, engine technology (NOx emission index, Mach number, range and cruising altitude. From our baseline modeling simulation, the impact of supersonic aircraft on sulphuric acid aerosol and BC mass burdens is 53 and 1.5 μg/m2, respectively, with a direct RF of −11.4 and 4.6 mW/m2 (net RF=−6.8 mW/m2. This paper discusses the similarities and differences amongst the participating models in terms of changes to O3 precursors due to aircraft emissions (NOx, HOx,Clx,Brx and the stratospheric ozone sensitivity to them. In the baseline case, the calculated global ozone change is −0.4 ±0.3 DU, with a net radiative forcing (IR+UV of −2.5± 2 mW/m2. The fraction of this O3-RF attributable to SSA-SAD changes is, however, highly variable among the models, depending on the NOx removal
Fialkov, Alexander B; Gordin, Alexander; Amirav, Aviv
2008-06-27
Hydrocarbon analysis with standard GC-MS is confronted by the limited range of volatile compounds amenable for analysis and by the similarity of electron ionization mass spectra for many compounds which show weak or no molecular ions for heavy hydrocarbons. The use of GC-MS with supersonic molecular beams (Supersonic GC-MS) significantly extends the range of heavy hydrocarbons that can be analyzed, and provides trustworthy enhanced molecular ion to all hydrocarbons. In addition, unique isomer mass spectral features are obtained in the ionization of vibrationally cold hydrocarbons. The availability of molecular ions for all hydrocarbons results in the ability to obtain unique chromatographic isomer distribution patterns that can serve as a new method for fuel characterization and identification. Examples of the applicability and use of this novel isomer abundance analysis (IAA) method to diesel fuel, kerosene and oil analyses are shown. It is suggested that in similarity to the "three ions method" for identification purposes, three isomer abundance patterns can serve for fuel characterization. The applications of the Supersonic GC-MS for engine motor oil analysis and transformer oil analysis are also demonstrated and discussed, including the capability to achieve fast 1-2s sampling without separation for oil and fuel fingerprinting. The relatively fast analysis of biodiesel is described, demonstrating the provision of molecular ions to heavy triglycerides. Isomer abundance analysis with the Supersonic GC-MS could find broad range of applications including petrochemicals and fuel analysis, arson analysis, environmental oil/fuel spill analysis, fuel adulteration analysis and motor oil analysis.
Liu, Yu; Liu, Jingfei; Fite, Brett Z; Foiret, Josquin; Ilovitsh, Asaf; Leach, J Kent; Dumont, Erik; Caskey, Charles F; Ferrara, Katherine W
2017-05-21
Non-invasive, quantitative methods to assess the properties of biological tissues are needed for many therapeutic and tissue engineering applications. Magnetic resonance elastography (MRE) has historically relied on external vibration to generate periodic shear waves. In order to focally assess a biomaterial or to monitor the response to ablative therapy, the interrogation of a specific region of interest by a focused beam is desirable and transient MRE (t-MRE) techniques have previously been developed to accomplish this goal. Also, strategies employing a series of discrete ultrasound pulses directed to increasing depths along a single line-of-sight have been designed to generate a quasi-planar shear wave. Such 'supersonic' excitations have been applied for ultrasound elasticity measurements. The resulting shear wave is higher in amplitude than that generated from a single excitation and the properties of the media are simply visualized and quantified due to the quasi-planar wave geometry and the opportunity to generate the wave at the site of interest. Here for the first time, we extend the application of supersonic methods by developing a protocol for supersonic transient magnetic resonance elastography (sst-MRE) using an MR-guided focused ultrasound system capable of therapeutic ablation. We apply the new protocol to quantify tissue elasticity in vitro using biologically-relevant inclusions and tissue-mimicking phantoms, compare the results with elasticity maps acquired with ultrasound shear wave elasticity imaging (US-SWEI), and validate both methods with mechanical testing. We found that a modified time-of-flight (TOF) method efficiently quantified shear modulus from sst-MRE data, and both the TOF and local inversion methods result in similar maps based on US-SWEI. With a three-pulse excitation, the proposed sst-MRE protocol was capable of visualizing quasi-planar shear waves propagating away from the excitation location and detecting differences in shear
High-speed and supersonic upward plasma drifts: multi-instrumental study
Astafyeva, E.; Zakharenkova, I.; Hairston, M. R.; Huba, J.; Coley, W. R.
2017-12-01
Since the pioneering observations by Aggson et al. (1992, JGR, doi: 10.1002/92JA00644), there have been several reports of the occurrence of high-speed (Vz>800 m/s) and supersonic plasma flows in the post-sunset (e.g., Hysell et al., 1994, JGR, doi: 10.1029/94JA00476; Hanson et al., 1997, JGR, doi: 10.1029/96JA03376) and the pre-dawn sector (Astafyeva and Zakharenkova, 2015, GRL, doi:10.1002/2015GL066369). However, despite this observational evidence, these events remain rare and are not well understood. The main issue is to determine the background conditions leading to the occurrence of these high-speed plasma drifts. In this work, we perform a multi-instrumental study of high-speed and supersonic upward plasma drift events/structures. For this purpose, we analyze data from several ground-based and space-borne instruments, including data from the DMSP, Swarm and C/NOFS (IVM instrument) satellites. In addition to the space-borne instruments, we use data from ground-based GPS-receivers and ionosondes to further investigate the background ionosphere conditions, as well as the effects produced by the plasma bubbles and ionospheric irregularities. Besides the observations, we add the SAMI3/ESF modeling results on plasma bubble simulations and high-speed drifts inside plasma bubbles. TIE-GCM runs (from the CCMC, https://ccmc.gsfc.nasa.gov) are used to define the background atmospheric/ionospheric and electrodynamical conditions leading to the occurrence of the high-speed and supersonic plasma drift events. Our search of events with upward plasma drift exceeding 800 m/s in the data of DMSP for the years 2002-2016 shows that such high-speed events are extremely rare. During this period of time, only 6 events were found, two of them occurred during the recovery phase of a geomagnetic storm, while the other four were detected during geomagnetically quiet conditions. Concerning the generation of such events, our preliminary results show that enhanced electric fields are
Benson, Thomas J.
1988-01-01
Supersonic external compression inlets are introduced, and the computational fluid dynamics (CFD) codes and tests needed to study flow associated with these inlets are outlined. Normal shock wave turbulent boundary layer interaction is discussed. Boundary layer control is considered. Glancing sidewall shock interaction is treated. The CFD validation of hypersonic inlet configurations is explained. Scramjet inlet modules are shown.
A review and development of correlations for base pressure and base heating in supersonic flow
Energy Technology Data Exchange (ETDEWEB)
Lamb, J.P. [Texas Univ., Austin, TX (United States). Dept. of Mechanical Engineering; Oberkampf, W.L. [Sandia National Labs., Albuquerque, NM (United States)
1993-11-01
A comprehensive review of experimental base pressure and base heating data related to supersonic and hypersonic flight vehicles has been completed. Particular attention was paid to free-flight data as well as wind tunnel data for models without rear sting support. Using theoretically based correlation parameters, a series of internally consistent, empirical prediction equations has been developed for planar and axisymmetric geometries (wedges, cones, and cylinders). These equations encompass the speed range from low supersonic to hypersonic flow and laminar and turbulent forebody boundary layers. A wide range of cone and wedge angles and cone bluntness ratios was included in the data base used to develop the correlations. The present investigation also included preliminary studies of the effect of angle of attack and specific-heat ratio of the gas.
Hwang, Danny P.
1999-01-01
A new turbulent skin friction reduction technology, called the microblowing technique has been tested in supersonic flow (Mach number of 1.9) on specially designed porous plates with microholes. The skin friction was measured directly by a force balance and the boundary layer development was measured by a total pressure rake at the tailing edge of a test plate. The free stream Reynolds number was 1.0(10 exp 6) per meter. The turbulent skin friction coefficient ratios (C(sub f)/C(sub f0)) of seven porous plates are given in this report. Test results showed that the microblowing technique could reduce the turbulent skin friction in supersonic flow (up to 90 percent below a solid flat plate value, which was even greater than in subsonic flow).
Plasma-enhanced mixing and flameholding in supersonic flow.
Firsov, Alexander; Savelkin, Konstantin V; Yarantsev, Dmitry A; Leonov, Sergey B
2015-08-13
The results of experimental study of plasma-based mixing, ignition and flameholding in a supersonic model combustor are presented in the paper. The model combustor has a length of 600 mm and cross section of 72 mm width and 60 mm height. The fuel is directly injected into supersonic airflow (Mach number M=2, static pressure P(st)=160-250 Torr) through wall orifices. Two series of tests are focused on flameholding and mixing correspondingly. In the first series, the near-surface quasi-DC electrical discharge is generated by flush-mounted electrodes at electrical power deposition of W(pl)=3-24 kW. The scope includes parametric study of ignition and flame front dynamics, and comparison of three schemes of plasma generation: the first and the second layouts examine the location of plasma generators upstream and downstream from the fuel injectors. The third pattern follows a novel approach of combined mixing/ignition technique, where the electrical discharge distributes along the fuel jet. The last pattern demonstrates a significant advantage in terms of flameholding limit. In the second series of tests, a long discharge of submicrosecond duration is generated across the flow and along the fuel jet. A gasdynamic instability of thermal cavity developed after a deposition of high-power density in a thin plasma filament promotes the air-fuel mixing. The technique studied in this work has weighty potential for high-speed combustion applications, including cold start/restart of scramjet engines and support of transition regime in dual-mode scramjet and at off-design operation. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Characteristics and measurement of supersonic projectile shock waves by a 32-microphone ring array
Chang, Ho; Wu, Yan-Chyuan; Tsung, Tsing-Tshih
2011-08-01
This paper discusses about the characteristics of supersonic projectile shock wave in muzzle region during firing of high explosive anti-tank (HEAT) and high explosive (HE) projectiles. HEAT projectiles are fired horizontally at a muzzle velocity of Mach 3.5 from a medium caliber tank gun equipped with a newly designed multi-perforated muzzle brake, whereas HE projectiles are fired at elevation angles at a muzzle velocity of Mach 2 from a large caliber howitzer equipped with a newly designed double-baffle muzzle brake. In the near field, pressure signatures of the N-wave generated from projectiles are measured by 32-microphone ring array wrapped by cotton sheath. Records measured by the microphone array are used to demonstrate several key characteristics of the shock wave of supersonic projectile. All measurements made in this study can be a significant reference for developing guns, tanks, or the chassis of fighting vehicles.
Measurements of gas velocity in supersonic flow using a laser beam
International Nuclear Information System (INIS)
Airoldi, V.J.T.; Santos, R. dos
1982-01-01
A study of measurements of supersonic velocities in a wind tunnel using a laser beam was performed. Techniques using lasers are most suitable because they do not disturb the gas flow. This work presents the technique entitled as fringe technique. It works using interference patterns due to two perpendicular laser beams crossing the sample (i.e. the gas flow). Experimental results are compared with other usual techniques. (R.S.)
The electron beam diagnostic of the clustered supersonic nitrogen jets
Avtaeva, S. V.; Yakovleva, T. S.; Kalyada, V. V.; Zarvin, A. E.
2017-11-01
Axial and radial distributions of the rotational temperature and density of N2 molecules in supersonic nitrogen jets formed with conic nozzles (critical diameters dcr of 0.17 and 0.21 mm) were studied using the electron beam fluorescence technique at stagnation pressures P0 of 0.1-0.6 MPa. A rotational temperature Tr , equaling a gas temperature Tg owing to fast RT relaxation, was obtained using the rotational line relative intensity distribution in (0-1) vibrational band of the N2 first negative system. Gas density profiles in the jets were obtained using the integral intensity of the band. It is found, Tr at the nozzle outlet is of the order of a few tens of Kelvin and at further expansion Tr drops up to 15-20K at distance of (100-200) dcr . The gas temperature and density distributions in the studied supersonic nitrogen jets are not similar to the isentropic distributions. It is shown that the lower is the stagnation pressure the faster the gas density and temperature decrease with distance from the nozzle. Increase in P0 leads to elevating Tg in the jets. A reason for this effect may be cluster formation in the jets. Estimations of cluster mean sizes in the jets using Hagena’s parameter show presence of large clusters (M≥200) at P0 = 0.4-0.6 MPa.
Garden hose separation of gaseous isotopes. Part II. Supersonic accelerations
International Nuclear Information System (INIS)
Wang, C.G.; Davis, A.G.M.
1979-01-01
A mechanical process for separating gaseous mixtures according to their respective molecular weights, by a variation of the time-of-flight process, is proposed. The separative apparatus consists of several sets of nozzle-deflector combinations surrounded by a stationary collector housed in an evacuated chamber. From a rotating supersonic nozzle, a contiguous plurality of successive groups of molecules is ejected to form a continuous stream of the mixture. The molecules of each group of molecules are allowed to accelerate for a predetermined period of time following their supersonic expansion, thereby allowing each group of molecules to form a generally spherical configuration, the outer radius of which will be enriched in molecules of lighter mass, relative to lesser radii. A deflector means co-rotating with the nozzle is used to deflect molecules that have been allowed to move for the predetermined period of time in accordance with their expansion velocities, from at least one desired portion of the stream, and a stationary collector means is disposed to receive the deflected molecules. The estimated separative work produced from such a unit is about the same or better than that of a modern giant diffuser of similar dimensions. However, with an essentially empty chamber, the unit capital cost as well as the energy required is competitive with any of the well-known methods, mechanical or otherwise
CFD investigations on supersonic ejectors for refrigeration applications
International Nuclear Information System (INIS)
Bartosiewicz, Y.; Aidoun, Z.; Mercadier, Y.
2004-01-01
This paper presents numerical results of a supersonic ejector for refrigeration applications. One of the interesting features is that the current model is based on the NIST properties for the R142b refrigerant: to the authors knowledge, it is the first paper dealing with a local CFD model which takes into account shock-boundary layer interactions in a real refrigerant. The numerical results put demonstrate the crucial role of the secondary nozzle for the mixing rate performance. In addition, these results point out the need of an extensive validation of the turbulence model, especially in the modeling of the off-design mode. (author)
Linear stability analysis of supersonic axisymmetric jets
Directory of Open Access Journals (Sweden)
Zhenhua Wan
2014-01-01
Full Text Available Stabilities of supersonic jets are examined with different velocities, momentum thicknesses, and core temperatures. Amplification rates of instability waves at inlet are evaluated by linear stability theory (LST. It is found that increased velocity and core temperature would increase amplification rates substantially and such influence varies for different azimuthal wavenumbers. The most unstable modes in thin momentum thickness cases usually have higher frequencies and azimuthal wavenumbers. Mode switching is observed for low azimuthal wavenumbers, but it appears merely in high velocity cases. In addition, the results provided by linear parabolized stability equations show that the mean-flow divergence affects the spatial evolution of instability waves greatly. The most amplified instability waves globally are sometimes found to be different from that given by LST.
Numerical study of MHD supersonic flow control
Ryakhovskiy, A. I.; Schmidt, A. A.
2017-11-01
Supersonic MHD flow around a blunted body with a constant external magnetic field has been simulated for a number of geometries as well as a range of the flow parameters. Solvers based on Balbas-Tadmor MHD schemes and HLLC-Roe Godunov-type method have been developed within the OpenFOAM framework. The stability of the solution varies depending on the intensity of magnetic interaction The obtained solutions show the potential of MHD flow control and provide insights into for the development of the flow control system. The analysis of the results proves the applicability of numerical schemes, that are being used in the solvers. A number of ways to improve both the mathematical model of the process and the developed solvers are proposed.
International Nuclear Information System (INIS)
Lee, Jong-Gun; Joshi, Bhavana N.; Lee, Jong-Hyuk; Kim, Tae-Gun; Kim, Do-Yeon; Al-Deyab, Salem S.; Seong, Il Won; Swihart, Mark T.; Yoon, Woo Young; Yoon, Sam S.
2017-01-01
Hematite (Fe 2 O 3 ) nanoparticles and reduced graphene oxide (rGO) were supersonically sprayed onto copper current collectors to create high-performance, binder-free lithium ion battery (LIB) electrodes. Supersonic spray deposition is rapid, low-cost, and suitable for large-scale production. Supersonic impact of rGO sheets and Fe 2 O 3 nanoparticles on the substrate produces compacted nanocomposite films with short diffusion lengths for Li + ions. This structure produces high reversible capacity and markedly improved capacity retention over many cycles. Decomposition of lithium oxide generated during cycling activates the solid electrolyte interface layer, contributing to high capacity retention. The optimal composition ratio of rGO to Fe 2 O 3 was 9.1 wt.%, which produced a reversible capacity of 1242 mAh g −1 after N = 305 cycles at a current density of 1000 mA g −1 (1C).
Description of a laser vaporization source and a supersonic cluster beam apparatus
International Nuclear Information System (INIS)
Doverstaal, M.; Lindgren, B.; Sassenberg, U.; Yu, H.
1993-11-01
Laser vaporization of an appropriate target and recent developments in molecular beam technology have now made it possible to produce supersonic cluster beams of virtually any element in the periodic table. This paper describes the design and principles of a cluster source combined with a time of flight mass spectrometer built for reaction experiments and spectroscopic investigations at Stockholm University
UV-Visible Spectra of PAHs and Derivatives Seeded in Supersonic Jet. Astrophysical Implications
Salma, Bejaoui; Salama, Farid
2018-06-01
Laboratory absorption spectra of Polycyclic Aromatic Hydrocarbons (PAHs) and PAH derivatives measured under astrophysical relevant conditions are crucial to test the PAHs-DIBs hypothesis as well as the PAH model for the IR emission bands. Our dedicated experimental setup on the COsmic SImulation Chamber (COSmIC) provides an excellent platform to study neutral and ionized PAHs under the low temperature and pressure conditions that are representative of interstellar environments [1]. In this work, we study the effect of the substitution of CH bond(s) by a nitrogen atom(s) on the electronic spectra of phenanthrene. The electronic transitions associated with the lower excited states of neutral phenanthrene (C14H10) and phenanthridine (C13H9N) are measured in gas phase in the 315-345 nm region. Molecules are seeded in a supersonic expansion of argon gas and the absorption spectra are measured using the Cavity Ring Down Spectroscopy (CRDS) technique. Additional measurements of the absorption spectra of phenanthrene, phenantridine and 1,10-phenanthroline (C12H8N2) isolated in 10 K argon matrices are also performed. The comparison between the CRDS spectra with the absorption of the matrix-isolated molecules highlight the matrix-induced perturbations in band position, profiles and broadening and illustrates the need of gas phase measurements for more accurate comparisons with astronomical spectra.[1] Salama, F., Galazutdinov, G., Krelowski, et al. ApJ 728, 154[FS1] (2011).[2] A. Tielens, ApJ 526 Pt 1265–273 (2008),Acknowledgements: This research is supported by the APRA Program of NASA SMD
DEFF Research Database (Denmark)
Hjelholt, Morten; Damsgaard, Jan
2012-01-01
thoroughly and substitute current payment standards in the decades to come. This paper portrays how digital payment platforms evolve in socio-technical niches and how various technological platforms aim for institutional attention in their attempt to challenge earlier platforms and standards. The paper...... applies a co-evolutionary multilevel perspective to model the interplay and processes between technology and society wherein digital payment platforms potentially will substitute other payment platforms just like the credit card negated the check. On this basis this paper formulate a multilevel conceptual...
Supersonic beams at high particle densities: model description beyond the ideal gas approximation.
Christen, Wolfgang; Rademann, Klaus; Even, Uzi
2010-10-28
Supersonic molecular beams constitute a very powerful technique in modern chemical physics. They offer several unique features such as a directed, collision-free flow of particles, very high luminosity, and an unsurpassed strong adiabatic cooling during the jet expansion. While it is generally recognized that their maximum flow velocity depends on the molecular weight and the temperature of the working fluid in the stagnation reservoir, not a lot is known on the effects of elevated particle densities. Frequently, the characteristics of supersonic beams are treated in diverse approximations of an ideal gas expansion. In these simplified model descriptions, the real gas character of fluid systems is ignored, although particle associations are responsible for fundamental processes such as the formation of clusters, both in the reservoir at increased densities and during the jet expansion. In this contribution, the various assumptions of ideal gas treatments of supersonic beams and their shortcomings are reviewed. It is shown in detail that a straightforward thermodynamic approach considering the initial and final enthalpy is capable of characterizing the terminal mean beam velocity, even at the liquid-vapor phase boundary and the critical point. Fluid properties are obtained using the most accurate equations of state available at present. This procedure provides the opportunity to naturally include the dramatic effects of nonideal gas behavior for a large variety of fluid systems. Besides the prediction of the terminal flow velocity, thermodynamic models of isentropic jet expansions permit an estimate of the upper limit of the beam temperature and the amount of condensation in the beam. These descriptions can even be extended to include spinodal decomposition processes, thus providing a generally applicable tool for investigating the two-phase region of high supersaturations not easily accessible otherwise.
Kopasakis, George; Connolly, Joseph; Seidel, Jonathan
2014-01-01
A summary of the propulsion system modeling under NASA's High Speed Project (HSP) AeroPropulsoServoElasticity (APSE) task is provided with a focus on the propulsion system for the low-boom supersonic configuration developed by Lockheed Martin and referred to as the N+2 configuration. This summary includes details on the effort to date to develop computational models for the various propulsion system components. The objective of this paper is to summarize the model development effort in this task, while providing more detail in the modeling areas that have not been previously published. The purpose of the propulsion system modeling and the overall APSE effort is to develop an integrated dynamic vehicle model to conduct appropriate unsteady analysis of supersonic vehicle performance. This integrated APSE system model concept includes the propulsion system model, and the vehicle structural-aerodynamics model. The development to date of such a preliminary integrated model will also be summarized in this report.propulsion system dynamics, the structural dynamics, and aerodynamics.
Impingement of water droplets on wedges and diamond airfoils at supersonic speeds
Serafini, John S
1953-01-01
An analytical solution has been obtained for the equations of motion of water droplets impinging on a wedge in a two-dimensional supersonic flow field with a shock wave attached to the wedge. The closed-form solution yields analytical expressions for the equation of the droplet trajectory, the local rate of impingement and the impingement velocity at any point on the wedge surface, and the total rate of impingement. The analytical expressions are utilized to determine the impingement on the forward surfaces of diamond airfoils in supersonic flow fields with attached shock waves. The results presented include the following conditions: droplet diameters from 2 to 100 microns, pressure altitudes from sea level to 30,000 feet, free-stream static temperatures from 420 degrees to 460 degrees R. Also, free-stream Mach numbers from 1.1 to 2.0, semi-apex angles for the wedge from 1.14 degrees to 7.97 degrees, thickness-to-chord ratios for the diamond airfoil from 0.02 to 0.14, chord lengths from 1 to 20 feet, and angles of attack from zero to the inverse tangent of the airfoil thickness-to-chord ratio.
Study of thermal and hydraulic efficiency of supersonic tube of temperature stratification
Tsynaeva, Anna A.; Nikitin, Maxim N.; Tsynaeva, Ekaterina A.
2017-10-01
Efficiency of supersonic pipe for temperature stratification with finned subsonic surface of heat transfer is the major of this paper. Thermal and hydraulic analyses of this pipe were conducted to asses effects from installation of longitudinal rectangular and parabolic fins as well as studs of cylindrical, rectangular and parabolic profiles. The analysis was performed based on refined empirical equations of similarity, dedicated to heat transfer of high-speed gas flow with plain wall, and Kármán equation with Nikuradze constants. Results revealed cylindrical studs (with height-to-diameter ratio of 5:1) to be 1.5 times more efficient than rectangular fins of the same height. At the same time rectangular fins (with height-to-thickness ratio of 5:1) were tend to enhance heat transfer rate up to 2.67 times compared to bare walls from subsonic side of the pipe. Longitudinal parabolic fins have minuscule effect on combined efficiency of considered pipe since extra head losses void any gain of heat transfer. Obtained results provide perspective of increasing efficiency of supersonic tube for temperature stratification. This significantly broadens device applicability in thermostatting systems for equipment, cooling systems for energy converting machinery, turbine blades and aerotechnics.
Determination of aerodynamic sensitivity coefficients in the transonic and supersonic regimes
Elbanna, Hesham M.; Carlson, Leland A.
1989-01-01
The quasi-analytical approach is developed to compute airfoil aerodynamic sensitivity coefficients in the transonic and supersonic flight regimes. Initial investigation verifies the feasibility of this approach as applied to the transonic small perturbation residual expression. Results are compared to those obtained by the direct (finite difference) approach and both methods are evaluated to determine their computational accuracies and efficiencies. The quasi-analytical approach is shown to be superior and worth further investigation.
Boháček, K.; Kozlová, M.; Nejdl, J.; Chaulagain, U.; Horný, V.; Krůs, M.; Ta Phuoc, K.
2018-03-01
The generation of stable electron beams produced by the laser wakefield acceleration mechanism with a few-terawatt laser system (600 mJ, 50 fs) in a supersonic synthetic air jet is reported and the requirements necessary to build such a stable electron source are experimentally investigated in conditions near the bubble regime threshold. The resulting electron beams have stable energies of (17.4 ± 1.1) MeV and an energy spread of (13.5 ± 1.5) MeV (FWHM), which has been achieved by optimizing the properties of the supersonic gas jet target for the given laser system. Due to the availability of few-terawatt laser systems in many laboratories around the world these stable electron beams open possibilities for applications of this type of particle source.
Kolmogorov-like spectra in decaying three-dimensional supersonic flows
International Nuclear Information System (INIS)
Porter, D.H.; Pouquet, A.; Woodward, P.R.
1994-01-01
A numerical simulation of decaying supersonic turbulence using the piecewise parabolic method (PPM) algorithm on a computational mesh of 512 3 zones indicates that, once the solenoidal part of the velocity field, representing vortical motions, is fully developed and has reached a self-similar regime, a velocity spectrum compatible with that predicted by the classical theory of Kolmogorov develops. It is followed by a domain with a shallower spectrum. A convergence study is presented to support these assertions. The formation, structure, and evolution of slip surfaces and vortex tubes are presented in terms of perspective volume renderings of fields in physical space
Supersonic N-Crowdions in a Two-Dimensional Morse Crystal
Dmitriev, S. V.; Korznikova, E. A.; Chetverikov, A. P.
2018-03-01
An interstitial atom placed in a close-packed atomic row of a crystal is called crowdion. Such defects are highly mobile; they can move along the row, transferring mass and energy. We generalize the concept of a classical supersonic crowdion to an N-crowdion in which not one but N atoms move simultaneously with a high velocity. Using molecular dynamics simulations for a close-packed two-dimensional Morse crystal, we show that N-crowdions transfer mass much more efficiently, because they are capable of covering large distances while having a lower total energy than that of a classical 1-crowdion.
Supersonic flows past an obstacle in Yukawa liquids
Charan, Harish; Ganesh, Rajaraman
2018-04-01
Shock formation, when a supersonic flow passes a stationary obstacle, is ubiquitous in nature. Considering particles mediating via a Yukawa-type interaction as a prototype for a strongly coupled complex plasma, characterized by coupling strength (Γ, ratio of the average potential to kinetic energy per particle) and screening parameter (κ, ratio of the mean inter-particle distance to the shielding length), we address the fundamental problem of supersonic fluid flow U0, past a stationary obstacle immersed in this strongly coupled system. We here report the results on the bow shocks formed in Yukawa liquids when the liquid flows at speeds larger than the speed of sound in the system. Depending on the values of Mach number MC L=U/0 CL , where CL is the longitudinal speed of sound in the system, the bow shocks are found to be either traveling or localized. We find that for the transonic flows (0.8 ≲ MC L≲ 1.2), the bow shocks travel in the upstream direction opposite to the incoming fluid. The phase velocity of the traveling bow shocks is found to be a non-monotonous function of κ, varying as ∝1 /k1.11 at a fixed value of Γ, and is found to be independent of Γ at a fixed value of κ. It is observed that for the flow values with MC L>1.5 , the shock waves do not travel in the upstream direction but instead form a stationary arc like structure around the obstacle. For the fluid flows with 1 ≲ MC L≲ 2.6 , secondary bow shocks are seen to emerge behind the stationary obstacle which travel in the downstream direction, and the phase velocity of these secondary bow shocks is found to be equal to that of the primary bow shocks.
Transition due to streamwise streaks in a supersonic flat plate boundary layer
Paredes, Pedro; Choudhari, Meelan M.; Li, Fei
2016-12-01
Transition induced by stationary streaks undergoing transient growth in a supersonic flat plate boundary layer flow is studied using numerical computations. While the possibility of strong transient growth of small-amplitude stationary perturbations in supersonic boundary layer flows has been demonstrated in previous works, its relation to laminar-turbulent transition cannot be established within the framework of linear disturbances. Therefore, this paper investigates the nonlinear evolution of initially linear optimal disturbances that evolve into finite amplitude streaks in the downstream region, and then studies the modal instability of those streaks as a likely cause for the onset of bypass transition. The nonmodal evolution of linearly optimal stationary perturbations in a supersonic, Mach 3 flat plate boundary layer is computed via the nonlinear plane-marching parabolized stability equations (PSE) for stationary perturbations, or equivalently, the perturbation form of parabolized Navier-Stokes equations. To assess the effect of the nonlinear finite-amplitude streaks on transition, the linear form of plane-marching PSE is used to investigate the instability of the boundary layer flow modified by the spanwise periodic streaks. The onset of transition is estimated using an N -factor criterion based on modal amplification of the secondary instabilities of the streaks. In the absence of transient growth disturbances, first mode instabilities in a Mach 3, zero pressure gradient boundary layer reach N =10 at Rex≈107 . However, secondary instability modes of the stationary streaks undergoing transient growth are able to achieve the same N -factor at Rex<2 ×106 when the initial streak amplitude is sufficiently large. In contrast to the streak instabilities in incompressible flows, subharmonic instability modes with twice the fundamental spanwise wavelength of the streaks are found to have higher amplification ratios than the streak instabilities at fundamental
Hu, Y J; Fu, H B; Bernstein, E R
2006-03-02
The peroxyacetyl radical (PA, CH3C(O)OO) is generated by flash pyrolysis of peroxyacetyl nitrate (PAN, CH3C(O)OONO2) in a supersonic jet. The 0(0)(0) A2A' CH3CO mass channel. Rotational envelope simulation results find that the rotational temperature for PA in its ground electronic and vibrational state is ca. 55 K. At ca. 330 degrees C, the thermal decomposition of PAN by flash pyrolysis in a heated nozzle with supersonic expansion is mainly by formation of PA and NO2. The maximum yield of PA is obtained at this temperature. At higher temperatures (300-550 degrees C), an intense signal in the CH2CO+ mass channel is observed, generated by the decomposition of PA.
Liu, Fuhai; Sun, Dongbai; Zhu, Rong; Li, Yilin
2018-05-01
Coherent jet technology was been widely used in the electric arc furnace steelmaking process to protect the kinetic energy of supersonic oxygen jets and achieve a better mixing effect. For this technology, the total temperature distribution of the shrouding jet has a great impact on the velocity of the main oxygen jet. In this article, a supersonic shrouding nozzle using a preheating shrouding jet is proposed to increase the shrouding jet velocity. Both numerical simulation and experimental studies were carried out to analyze its effect on the axial velocity, total temperature and turbulence kinetic energy profiles of the main oxygen jet. Based on these results, it was found that a significant amount of kinetic energy was removed from the main oxygen jet when it passed though the shock wave using a high-temperature shrouding jet, which made the average axial velocity of the coherent jet lower than for a conventional jet in the potential core region. However, the supersonic shrouding nozzle and preheating technology employed for this nozzle design significantly improved the shrouding gas velocity, forming a low-density gas zone at the exit of the main oxygen jet and prolonging the velocity potential core length.
DEFF Research Database (Denmark)
Munk, Lone
The aim of this research is to improve understanding of platform-based product development by studying platform performance in relation to internal effects in companies. Platform-based product development makes it possible to deliver product variety and at the same time reduce the needed resources...... engaging in platform-based product development. Similarly platform assessment criteria lack empirical verification regarding relevance and sufficiency. The thesis focuses on • the process of identifying and estimating internal effects, • verification of performance of product platforms, (i...... experienced representatives from the different life systems phase systems of the platform products. The effects are estimated and modeled within different scenarios, taking into account financial and real option aspects. The model illustrates and supports estimation and quantification of internal platform...
Connolly, Joe; Carlson, Jan-Renee; Kopasakis, George; Woolwine, Kyle
2015-01-01
This paper covers the development of an integrated nonlinear dynamic model for a variable cycle turbofan engine, supersonic inlet, and convergent-divergent nozzle that can be integrated with an aeroelastic vehicle model to create an overall Aero-Propulso-Servo-Elastic (APSE) modeling tool. The primary focus of this study is to provide a means to capture relevant thrust dynamics of a full supersonic propulsion system by using relatively simple quasi-one dimensional computational fluid dynamics (CFD) methods that will allow for accurate control algorithm development and capture the key aspects of the thrust to feed into an APSE model. Previously, propulsion system component models have been developed and are used for this study of the fully integrated propulsion system. An overview of the methodology is presented for the modeling of each propulsion component, with a focus on its associated coupling for the overall model. To conduct APSE studies the described dynamic propulsion system model is integrated into a high fidelity CFD model of the full vehicle capable of conducting aero-elastic studies. Dynamic thrust analysis for the quasi-one dimensional dynamic propulsion system model is presented along with an initial three dimensional flow field model of the engine integrated into a supersonic commercial transport.
Low-Boom and Low-Drag Optimization of the Twin Engine Version of Silent Supersonic Business Jet
Sato, Koma; Kumano, Takayasu; Yonezawa, Masahito; Yamashita, Hiroshi; Jeong, Shinkyu; Obayashi, Shigeru
Multi-Objective Optimization has been applied to a design problem of the twin engine concept for Silent Supersonic Business Jet (SSBJ). This problem aims to find main wing, body, tail wing and engine nacelle configurations, which can minimize both sonic boom and drag in a supersonic cruising flight. The multi-objective genetic algorithm (MOGA) coupled with the Kriging model has been used to globally and effectively search for optimal design candidates in the multi-objective problem. The drag and the sonic boom have been evaluated by the computational fluid dynamics (CFD) simulation and the waveform parameter method. As a result, the present optimization has successfully obtained low-boom and low-drag design candidates, which are better than the baseline design by more than 40% regarding each performance. Moreover, the structure of design space has been visualized by the self-organizing map (SOM).
Reconstruction theorem for a quantum stochastic process
International Nuclear Information System (INIS)
Belavkin, V.P.
1985-01-01
This paper gives a physically interpretable--in real time--definition of a QSP as families of representations of the observable algebra 'B' in a common (large) system by indicating a universal method of constructing such a system from casual correlation operators described by the axioms formulated in the paper. The authors encompass in a unified manner both nonrelativistic and relativistic covariant QSPs describing open quantum systems and fields in a causally ordered region accessible to observation. The principle of nondestruction by successive measurements of a QSP of a given quantum subsystem is also taken into account
Filippi, Antonello; Giardini, Anna; Marcantoni, Enrico; Paladini, Alessandra; Piccirillo, Susanna; Renzi, Gabriele; Rondino, Flaminia; Roselli, Graziella; Satta, Mauro; Speranza, Maurizio
2007-04-14
The R2PI-TOF spectra of supersonically expanded rare gas/chiral arene heteroclusters have been rationalized in terms of the distortion of the pi-electron density reflecting the different dipole and quadrupole momenta induced in the rare gas atoms by interaction with the opposite pi-faces of the chiral arene itself.
CFD modeling of particle behavior in supersonic flows with strong swirls for gas separation
DEFF Research Database (Denmark)
Yang, Yan; Wen, Chuang
2017-01-01
flow from the dry gas outlet. The separation efficiency reached over 80%, when the droplet diameter was more than 1.5 μm. The optimum length of the cyclonic separation section was approximate 16–20 times of the nozzle throat diameter to obtain higher collection efficiency for the supersonic separator...
IS MAGNETIC RECONNECTION THE CAUSE OF SUPERSONIC UPFLOWS IN GRANULAR CELLS?
Energy Technology Data Exchange (ETDEWEB)
Borrero, J. M.; Schmidt, W. [Kiepenheuer-Institut fuer Sonnenphysik, Schoeneckstr. 6, D-79110, Freiburg (Germany); Martinez Pillet, V.; Quintero Noda, C.; Bonet, J. A. [Instituto de Astrofisica de Canarias, Avd. Via Lactea s/n, E-38200 La Laguna (Spain); Del Toro Iniesta, J. C.; Bellot Rubio, L. R., E-mail: borrero@kis.uni-freiburg.de, E-mail: wolfgang@kis.uni-freiburg.de, E-mail: vmp@ll.iac.es, E-mail: cqn@ll.iac.es, E-mail: jab@ll.iac.es, E-mail: jti@iaa.es, E-mail: lbellot@iaa.es [Instituto de Astrofisica de Andalucia (CSIC), Apdo. de Correos 3004, E-18080 Granada (Spain)
2013-05-01
In a previous work, we reported on the discovery of supersonic magnetic upflows on granular cells in data from the SUNRISE/IMaX instrument. In the present work, we investigate the physical origin of these events employing data from the same instrument but with higher spectral sampling. By means of the inversion of Stokes profiles we are able to recover the physical parameters (temperature, magnetic field, line-of-sight velocity, etc.) present in the solar photosphere at the time of these events. The inversion is performed in a Monte-Carlo-like fashion, that is, repeating it many times with different initializations and retaining only the best result. We find that many of the events are characterized by a reversal in the polarity of the magnetic field along the vertical direction in the photosphere, accompanied by an enhancement in the temperature and by supersonic line-of-sight velocities. In about half of the studied events, large blueshifted and redshifted line-of-sight velocities coexist above/below each other. These features can be explained in terms of magnetic reconnection, where the energy stored in the magnetic field is released in the form of kinetic and thermal energy when magnetic field lines of opposite polarities coalesce. However, the agreement with magnetic reconnection is not perfect and, therefore, other possible physical mechanisms might also play a role.
The Platformization of the Web: Making Web Data Platform Ready
Helmond, A.
2015-01-01
In this article, I inquire into Facebook’s development as a platform by situating it within the transformation of social network sites into social media platforms. I explore this shift with a historical perspective on, what I refer to as, platformization, or the rise of the platform as the dominant
Kopasakis, George; Connolly, Joseph W.; Seiel, Jonathan
2016-01-01
A summary of the propulsion system modeling under NASA's High Speed Project (HSP) AeroPropulsoServoElasticity (APSE) task is provided with a focus on the propulsion system for the low-boom supersonic configuration developed by Lockheed Martin and referred to as the N+2 configuration. This summary includes details on the effort to date to develop computational models for the various propulsion system components. The objective of this paper is to summarize the model development effort in this task, while providing more detail in the modeling areas that have not been previously published. The purpose of the propulsion system modeling and the overall APSE effort is to develop an integrated dynamic vehicle model to conduct appropriate unsteady analysis of supersonic vehicle performance. This integrated APSE system model concept includes the propulsion system model, and the vehicle structural aerodynamics model. The development to date of such a preliminary integrated model will also be summarized in this report
Supersonic propagation of ionization waves in an underdense, laser-produced plasma
International Nuclear Information System (INIS)
Constantin, C.; Back, C.A.; Fournier, K.B.; Gregori, G.; Landen, O.L.; Glenzer, S.H.; Dewald, E.L.; Miller, M.C.
2005-01-01
A laser-driven supersonic ionization wave propagating through a millimeter-scale plasma of subcritical density up to 2-3 keV electron temperatures was observed. Propagation velocities initially ten times the sound speed were measured by means of time-resolved x-ray imaging diagnostics. The measured ionization wave trajectory is modeled analytically and by a two-dimensional radiation-hydrodynamics code. The comparison to the modeling suggests that nonlocal heat transport effects may contribute to the attenuation of the heat-wave propagation
Flight assessment of a large supersonic drone aircraft for research use
Eckstrom, C. V.; Peele, E. L.
1974-01-01
An assessment is made of the capabilities of the BQM-34E supersonic drone aircraft as a test bed research vehicle. This assessment is made based on a flight conducted for the purpose of obtaining flight test measurements of wing loads at various maneuver flight conditions. Flight plan preparation, flight simulation, and conduct of the flight test are discussed along with a presentation of the test data obtained and an evaluation of how closely the flight test followed the test plan.
Qu, Aifang; Xiang, Wei
2018-05-01
In this paper, we study the stability of the three-dimensional jet created by a supersonic flow past a concave cornered wedge with the lower pressure at the downstream. The gas beyond the jet boundary is assumed to be static. It can be formulated as a nonlinear hyperbolic free boundary problem in a cornered domain with two characteristic free boundaries of different types: one is the rarefaction wave, while the other one is the contact discontinuity, which can be either a vortex sheet or an entropy wave. A more delicate argument is developed to establish the existence and stability of the square jet structure under the perturbation of the supersonic incoming flow and the pressure at the downstream. The methods and techniques developed here are also helpful for other problems involving similar difficulties.
Numerical Simulation of Reactive Flows in Overexpanded Supersonic Nozzle with Film Cooling
Directory of Open Access Journals (Sweden)
Mohamed Sellam
2015-01-01
Full Text Available Reignition phenomena occurring in a supersonic nozzle flow may present a crucial safety issue for rocket propulsion systems. These phenomena concern mainly rocket engines which use H2 gas (GH2 in the film cooling device, particularly when the nozzle operates under over expanded flow conditions at sea level or at low altitudes. Consequently, the induced wall thermal loads can lead to the nozzle geometry alteration, which in turn, leads to the appearance of strong side loads that may be detrimental to the rocket engine structural integrity. It is therefore necessary to understand both aerodynamic and chemical mechanisms that are at the origin of these processes. This paper is a numerical contribution which reports results from CFD analysis carried out for supersonic reactive flows in a planar nozzle cooled with GH2 film. Like the experimental observations, CFD simulations showed their ability to highlight these phenomena for the same nozzle flow conditions. Induced thermal load are also analyzed in terms of cooling efficiency and the results already give an idea on their magnitude. It was also shown that slightly increasing the film injection pressure can avoid the reignition phenomena by moving the separation shock towards the nozzle exit section.
Computational Investigation of Swirling Supersonic Jets Generated Through a Nozzle-Twisted Lance
Li, Mingming; Li, Qiang; Zou, Zongshu; An, Xizhong
2017-02-01
The dynamic characteristics of supersonic swirling jets generated through a nozzle-twisted lance are numerically studied. The essential features of the swirling jets are identified by defining a deviation angle. The effects of nozzle twist angle (NTA) on swirling flow intensity, coalescence characteristics, and dynamic parameter distributions of the jets are discussed. The rotational flow characteristics are revealed. The results show that the jets from the nozzle-twisted lance are imparted to a circumferential rotating movement around the lance axis, and such swirling flow is enhanced by increasing NTA. The enhanced swirling flow causes weaker coalescence of the jets, faster attenuations of the axial velocity, and higher heat transfer rate between the jets and surroundings. The supersonic core length, however, is found to be less sensitive to the swirling flow intensity. The radial spreading of the jets, changing non-monotonically with NTA, arrives at its maximum at 5 deg of NTA. Furthermore, the swirling flow induces a considerable tangential velocity component, and as a result, a holistic and effective horizontal swirling flow field develops. The y-vorticity distribution range and the corresponding magnitude turn larger with increasing NTA, which promote the vortex motion of the local fluid element and thus intensify the local mixing.
A multivariate quadrature based moment method for LES based modeling of supersonic combustion
Donde, Pratik; Koo, Heeseok; Raman, Venkat
2012-07-01
The transported probability density function (PDF) approach is a powerful technique for large eddy simulation (LES) based modeling of scramjet combustors. In this approach, a high-dimensional transport equation for the joint composition-enthalpy PDF needs to be solved. Quadrature based approaches provide deterministic Eulerian methods for solving the joint-PDF transport equation. In this work, it is first demonstrated that the numerical errors associated with LES require special care in the development of PDF solution algorithms. The direct quadrature method of moments (DQMOM) is one quadrature-based approach developed for supersonic combustion modeling. This approach is shown to generate inconsistent evolution of the scalar moments. Further, gradient-based source terms that appear in the DQMOM transport equations are severely underpredicted in LES leading to artificial mixing of fuel and oxidizer. To overcome these numerical issues, a semi-discrete quadrature method of moments (SeQMOM) is formulated. The performance of the new technique is compared with the DQMOM approach in canonical flow configurations as well as a three-dimensional supersonic cavity stabilized flame configuration. The SeQMOM approach is shown to predict subfilter statistics accurately compared to the DQMOM approach.
National Research Council Canada - National Science Library
Klunker, E
1952-01-01
The effect of a finite trailing-edge thickness on the pressure drag of rectangular and delta wings with truncated diamond-shaped airfoil sections with a given thickness ratio is studied for supersonic...
National Research Council Canada - National Science Library
Bobashev, S. V; Mende, N. P; Sakharov, V. A; Van Wie, D. M
2003-01-01
.... Generally, the separation leads to harmful consequences such as an increase of the body drag, a decrease of the wing lift, unsteady loads, and at high supersonic velocities causes emergence of narrow...
International Nuclear Information System (INIS)
Koperski, J; Fry, E S
2006-01-01
The supersonic free-jet expansion technique has been used in different fields of research in physics, physical chemistry and chemistry to study vibrational and rotational molecular structures in ground and excited electronic energy states as well as in cold chemistry to study chemical reactions in a unique environment. The supersonic beam technique, as a widely used method in laser spectroscopy of molecules, exploits a source of monokinetic, rotationally and vibrationally cold molecules, that are very weakly bound in their ground electronic states (van der Waals molecules). In experiments at Jagiellonian University the supersonic free-jet beam serves as a source of ground-state van der Waals objects in studies of neutral-neutral interactions between group 12 metal (M = Zn, Cd, Hg) and noble gas (NG) atoms. Recently, the method has been applied as a source of entangled 199 Hg atom pairs in order to test Bell's inequality in an experiment at Texas A and M University
International Nuclear Information System (INIS)
Nakhale, S.G.
2004-11-01
The experimental setup for generating supersonic pulsed free-jet containing atoms and molecules of refractory nature has been built. The technique of laser vaporization in conjunction with supersonic cooling is used to generate these species. The cooled atoms and molecules in supersonic free-jet are probed by laser induced fluorescence spectroscopy. In particular, the technique has been used to perform low-resolution laser induced fluorescence spectroscopy, limited by laser linewidth, on cold Zr atoms and ZrO molecules. The translational temperatures of ∼ 26.5 K and the rotational temperatures of ∼ 81 K have been achieved. It is possible to achieve the Doppler width of few tens of MHz allowing it to perform high-resolution spectroscopy on these atomic and molecular species. Also because of low rotational temperature of molecules the spectral congestion is greatly reduced. In general, this technique can be applied to perform spectroscopy on atoms and molecules of refractory nature. (author)
Christhilf, David M.; Moulin, Boris; Ritz, Erich; Chen, P. C.; Roughen, Kevin M.; Perry, Boyd
2012-01-01
The Semi-Span Supersonic Transport (S4T) is an aeroelastically scaled wind-tunnel model built to test active controls concepts for large flexible supersonic aircraft in the transonic flight regime. It is one of several models constructed in the 1990's as part of the High Speed Research (HSR) Program. Control laws were developed for the S4T by M4 Engineering, Inc. and by Zona Technologies, Inc. under NASA Research Announcement (NRA) contracts. The model was tested in the NASA-Langley Transonic Dynamics Tunnel (TDT) four times from 2007 to 2010. The first two tests were primarily for plant identification. The third entry was used for testing control laws for Ride Quality Enhancement, Gust Load Alleviation, and Flutter Suppression. Whereas the third entry only tested FS subcritically, the fourth test demonstrated closed-loop operation above the open-loop flutter boundary. The results of the third entry are reported elsewhere. This paper reports on flutter suppression results from the fourth wind-tunnel test. Flutter suppression is seen as a way to provide stability margins while flying at transonic flight conditions without penalizing the primary supersonic cruise design condition. An account is given for how Controller Performance Evaluation (CPE) singular value plots were interpreted with regard to progressing open- or closed-loop to higher dynamic pressures during testing.
Directory of Open Access Journals (Sweden)
Maria Cristina ENACHE
2017-04-01
Full Text Available Cross-platform - a concept becoming increasingly used in recent years especially in the development of mobile apps, but this consistently over time and in the development of conventional desktop applications. The notion of cross-platform software (multi-platform or platform-independent refers to a software application that can run on more than one operating system or computing architecture. Thus, a cross-platform application can operate independent of software or hardware platform on which it is execute. As a generic definition presents a wide range of meanings for purposes of this paper we individualize this definition as follows: we will reduce the horizon of meaning and we use functionally following definition: a cross-platform application is a software application that can run on more than one operating system (desktop or mobile identical or in a similar way.
Platform Performance and Challenges - using Platforms in Lego Company
DEFF Research Database (Denmark)
Munk, Lone; Mortensen, Niels Henrik
2009-01-01
needs focus on the incentive of using the platform. This problem lacks attention in literature, as well as industry, where assessment criteria do not cover this aspect. Therefore, we recommend including user incentive in platform assessment criteria to these challenges. Concrete solution elements...... ensuring user incentive in platforms is an object for future research...
International Nuclear Information System (INIS)
Wener, M.H.; Mannik, M.; Schwartz, M.M.; Lewis, E.J.
1987-01-01
Sera from 35 patients with biopsy-proven diffuse proliferative (WHO class IV) or membranous (WHO class V) lupus nephritis were analyzed for the presence and size of circulating immune complexes. Elevations of the C1q solid-phase assay (C1qSP) for immune complexes were found in sera from all patients with diffuse proliferative nephritis, with a mean +/- 1 SEM of 166.8 +/- 42.0 micrograms/AHG-equivalents/ml serum, and in 71.4% of the patients with membranous nephritis (83.1 +/- 26.7, p = 0.06). Using the WHO criteria for subclasses of membranous lupus nephritis, we also designated renal biopsies as nonproliferative (WHO classes Va and Vb) or proliferative (WHO classes IV and Vc). Employing the latter groupings, we observed significant differences between C1qSP results of patients with nonproliferative (30.3 +/- 8.8) and proliferative (172.8 +/- 36.8, p less than 0.001) lupus nephritis. These data suggest that the presence of C1q-binding material in serum is pathophysiologically related to proliferative glomerular lesions, and that levels of C1qSP binding reflect renal lesions in SLE patients. Sucrose density gradient ultracentrifugation was performed on each serum, and gradient fractions analyzed for C1qSP-binding and total IgG, using techniques to minimize losses of immune complexes. The predominant peak of C1qSP activity sedimented with the 6.6S monomeric IgG. The 6.6S C1q-binding IgG was increased only in 1 of 10 patients with membranous lupus nephritis without proliferative changes, and was elevated in 16 of 25 patients with proliferative lesions (WHO classes IV and Vc)
Variable geometry for supersonic mixed-compression inlets
Sorensen, N. E.; Latham, E. A.; Smeltzer, D. B.
1974-01-01
Study of two-dimensional and axisymmetric supersonic mixed-compression inlet systems has shown that the geometry of both systems can be varied to provide adequate transonic airflow to satisfy the airflow demand of most jet engines. Collapsing geometry systems for both types of inlet systems provide a generous amount of transonic airflow for any design Mach number inlet system. However, the mechanical practicality of collapsing centerbodies for axisymmetric inlet systems is doubtful. Therefore, translating centerbody axisymmetric inlets with auxiliary airflow systems to augment the transonic airflow capability are an attractive alternative. Estimates show that the capture mass-flow ratio at Mach number 1.0 can be increased approximately 0.20 for a very short axisymmetric inlet system designed for Mach number 2.37. With this increase in mass-flow ratio, even variable-cycle engine transonic airflow demand can be matched without oversizing the inlet at the design Mach number.
DEFF Research Database (Denmark)
Staykova, Kalina Stefanova; Damsgaard, Jan
2016-01-01
This research paper presents an initial attempt to introduce and explain the emergence of new phenomenon, which we refer to as platform constellations. Functioning as highly modular systems, the platform constellations are collections of highly connected platforms which co-exist in parallel and a......’ acquisition and users’ engagement rates as well as unlock new sources of value creation and diversify revenue streams....
International Nuclear Information System (INIS)
Faucher, Olivier
1991-01-01
This research thesis reports experimental studies performed on the generation of a coherent radiation in vacuum ultraviolet (94 nm) by tripling the frequency of an ultraviolet laser focussed within a continuous supersonic free nitrogen jet. After a recall of some general issues related to non-linear optics, the evolution of the non-linear susceptibility and conditions of phase adaptation in supersonic jet have been determined. This allowed a quantitative study of the third harmonic generation for the three following types of conversion: without resonance, with resonance with two photons, and with resonance with three photons. In the first two cases, due to the absence of saturation phenomena, measuring the harmonic signal intensity allows a diagnosis of the non-linear medium internal state to the performed. As far as the third harmonic generation with resonance with three photons is concerned, the use of supersonic free jet properties leads to a perfect understanding of saturation effects by self-absorption which are at the origin of the unusual character of the obtained spectra [fr
Continuous Platform Development
DEFF Research Database (Denmark)
Nielsen, Ole Fiil
low risks and investments but also with relatively fuzzy results. When looking for new platform projects, it is important to make sure that the company and market is ready for the introduction of platforms, and to make sure that people from marketing and sales, product development, and downstream......, but continuous product family evolution challenges this strategy. The concept of continuous platform development is based on the fact that platform development should not be a one-time experience but rather an ongoing process of developing new platforms and updating existing ones, so that product family...
Photoelectron spectroscopy of supersonic molecular beams
International Nuclear Information System (INIS)
Pollard, J.E.; Trevor, D.J.; Lee, Y.T.; Shirley, D.A.
1981-01-01
A high-resolution photoelectron spectrometer which uses molecular beam sampling is described. Photons from a rare-gas resonance lamp or UV laser are crossed with the beam from a differentially pumped supersonic nozzle source. The resulting photoelectrons are collected by an electrostatic analyzer of a unique design consisting of a 90 0 spherical sector preanalyzer, a system of lenses, and a 180 0 hemispherical deflector. A multichannel detection system based on dual microchannel plates with a resistive anode position encoder provides an increase in counting efficiency by a factor of 12 over the equivalent single channel detector. The apparatus has demonstrated an instrumental resolution of better than 10 meV FWHM, limited largely by the photon source linewidth. A quadrupole mass spectrometer is used to characterize the composition of the molecular beam. Extensive differential pumping is provided to protect the critical surfaces of the analyzer and mass spectrometer from contamination. Because of the near elimination of Doppler and rotational broadenings, the practical resolution is the highest yet obtained in molecular PES
Redundant actuator development study. [flight control systems for supersonic transport aircraft
Ryder, D. R.
1973-01-01
Current and past supersonic transport configurations are reviewed to assess redundancy requirements for future airplane control systems. Secondary actuators used in stability augmentation systems will probably be the most critical actuator application and require the highest level of redundancy. Two methods of actuator redundancy mechanization have been recommended for further study. Math models of the recommended systems have been developed for use in future computer simulations. A long range plan has been formulated for actuator hardware development and testing in conjunction with the NASA Flight Simulator for Advanced Aircraft.
Shock Waves Oscillations in the Interaction of Supersonic Flows with the Head of the Aircraft
Bulat, Pavel V.; Volkov, Konstantin N.
2016-01-01
In this article we reviewed the shock wave oscillation that occurs when supersonic flows interact with conic, blunt or flat nose of aircraft, taking into account the aerospike attached to it. The main attention was paid to the problem of numerical modeling of such oscillation, flow regime classification, and cases where aerospike attachment can…
International Nuclear Information System (INIS)
Mateescu, D.
1985-01-01
A method of solution is developed in the present paper for studying the unsteady supersonic flow past a cruciform canard - conical body system, represented in the figure, which executes an oscillatory pitching motion of rotation. The generality of the analysis permits particular solutions such as the case of symmetrical cruciform canards (for l 1 =l 2 =l) used mainly in missile applications, and tail-body configurations (for l 2 =0 pr l 2 →∞ used in aeronautical applications, as well as more general solutions. Attached supersonic flow past the system, associated with small amplitude oscillations of reasonably low frequency with respect to a mean equilibrium position are assumed in this paper. As a result, the steady flow past the canard-body system at an attitude defined by the mean equilibrium position can be separated from the actual flow; general methods of solution for this steady flow have been established. The aim of the present analysis is to develop a method of solution for the unsteady motion resulting from the actual flow after the above separation, which incorporates the effects of the system oscillations. (author)
Particle fuelling for long pulse with standard gas puff and supersonic pulsed gas injection
International Nuclear Information System (INIS)
Bucalossi, J.; Tsitrone, E.; Martin, G.
2003-01-01
In addition to the standard gas puff and to the technically complex pellet injection, a novel intermediate method, based on the injection of a supersonic high density cloud of neutrals, has been recently implemented on the Tore Supra tokamak. Fuelling efficiency, in the 30-50% range are found while it lies in the 10-20% range for the gas puff. It is not sensitive to the plasma density and to the additional heating. According to modelling, the increased efficiency is attributed to the very short injection duration compared to the particle confinement time and to the strong cooling of the plasma edge resulting from the massive injection of matter. A feedback loop on the frequency of the injector has been successfully implemented to control the plasma density. In long pulse experiments (>200s), wall saturation has not been reached. Gas puffing rate was typically around 1 Pa.m 3 s -1 while dynamic wall retention around 0.6 Pa.m 3 s -1 . Co-deposited carbon layer could trap such large amounts of gas. A discharge fuelled by supersonic pulsed gas injections exhibits lower wall retention than a gas puff fuelled discharge. (author)
Erickson, Gary E.; Schreiner, John A.; Rogers, Lawrence W.
1989-01-01
Slender wing vortex flows at subsonic, transonic, and supersonic speeds were investigated in a 6 x 6 ft wind tunnel. Test data obtained include off-body and surface flow visualizations, wing upper surface static pressure distributions, and six-component forces and moments. The results reveal the transition from the low-speed classical vortex regime to the transonic regime, beginning at a freestream Mach number of 0.60, where vortices coexist with shock waves. It is shown that the onset of core breakdown and the progression of core breakdown with the angle of attack were sensitive to the Mach number, and that the shock effects at transonic speeds were reduced by the interaction of the wing and the lead-edge extension (LEX) vortices. The vortex strengths and direct interaction of the wing and LEX cores (cores wrapping around each other) were found to diminish at transonic and supersonic speeds.
2016-12-01
of offspring populations, the Student’s t-distribution is used as the convergence method. Equations 10–12 are the mean , variance , and standard...ARL-CR-0810 ● DEC 2016 US Army Research Laboratory Aerodynamic Optimization of a Supersonic Bending Body Projectile by a Vector...not return it to the originator. ARL-CR-0810 ● DEC 2016 US Army Research Laboratory Aerodynamic Optimization of a
Schlieren study of a sonic jet injected into a supersonic cross flow using high-current pulsed LEDs
Giskes, Ella; Verschoof, Ruben A.; Segerink, Frans B.; Venner, Cornelis H.
2017-01-01
Benefiting from the development of increasingly advanced high speed cameras, flow visualization and analysis nowadays yield detailed data of the flow field in many applications. Notwithstanding this progress, for high speed and supersonic flows it is still not trivial to capture high quality images.
An efficient unstructured WENO method for supersonic reactive flows
Zhao, Wen-Geng; Zheng, Hong-Wei; Liu, Feng-Jun; Shi, Xiao-Tian; Gao, Jun; Hu, Ning; Lv, Meng; Chen, Si-Cong; Zhao, Hong-Da
2018-03-01
An efficient high-order numerical method for supersonic reactive flows is proposed in this article. The reactive source term and convection term are solved separately by splitting scheme. In the reaction step, an adaptive time-step method is presented, which can improve the efficiency greatly. In the convection step, a third-order accurate weighted essentially non-oscillatory (WENO) method is adopted to reconstruct the solution in the unstructured grids. Numerical results show that our new method can capture the correct propagation speed of the detonation wave exactly even in coarse grids, while high order accuracy can be achieved in the smooth region. In addition, the proposed adaptive splitting method can reduce the computational cost greatly compared with the traditional splitting method.
Supersonic molecular beam electric resonance spectroscopy and van der Waals molecules
International Nuclear Information System (INIS)
Luftman, H.S.
1982-09-01
A supersonic molecular beam electric resonance (MBER) spectrometer was built to study the radiofrequency spectra of weakly bound gas phase van der Waals molecules. The instrument and its operating characteristics are described in detail. Sample mass spectra of Ar-ClF gas mixtures are also presented as an illustration of the synthesis of van der Waals molecules. The Stark focusing process for linear polar molecules is discussed and computer-simulated using both second order perturbation and variational methods. Experimental refocusing spectra of OCS and ClF are studied and compared with these trajectory calculations. Though quantitative fitting is poor, there are strong qualitative indicators that the central part of a supersonic beam consists of molecules with a significantly greater population in the lowest energy rotational states than generally assumed. Flop in as opposed to flop out resonance signals for OCS are also numerically predicted and observed. The theoretical properties of the MBER spectrum for linear molecules are elaborated upon with special emphasis on line shape considerations. MBER spectra of OCS and ClF under a variety of conditions are presented and discussed in context to these predictions. There is some uncertainty expressed both in our own modeling and in the manner complex MBER spectra have been analyzed in the past. Finally, an electrostatic potential model is used to quantitatively describe the class of van der Waals molecules Ar-MX, where MX is an alkali halide. Energetics and equilibrium geometries are calculated. The validity of using an electrostatic model to predict van der Waals bond properties is critically discussed
Practical Calculation of Second-order Supersonic Flow past Nonlifting Bodies of Revolution
Van Dyke, Milton D
1952-01-01
Calculation of second-order supersonic flow past bodies of revolution at zero angle of attack is described in detail, and reduced to routine computation. Use of an approximate tangency condition is shown to increase the accuracy for bodies with corners. Tables of basic functions and standard computing forms are presented. The procedure is summarized so that one can apply it without necessarily understanding the details of the theory. A sample calculation is given, and several examples are compared with solutions calculated by the method of characteristics.
Batterton, P. G.; Arpasi, D. J.; Baumbick, R. J.
1974-01-01
A digitally implemented integrated inlet-engine control system was designed and tested on a mixed-compression, axisymmetric, Mach 2.5, supersonic inlet with 45 percent internal supersonic area contraction and a TF30-P-3 augmented turbofan engine. The control matched engine airflow to available inlet airflow. By monitoring inlet terminal shock position and over-board bypass door command, the control adjusted engine speed so that in steady state, the shock would be at the desired location and the overboard bypass doors would be closed. During engine-induced transients, such as augmentor light-off and cutoff, the inlet operating point was momentarily changed to a more supercritical point to minimize unstarts. The digital control also provided automatic inlet restart. A variable inlet throat bleed control, based on throat Mach number, provided additional inlet stability margin.
International Nuclear Information System (INIS)
Inogamov, Nail A; Khokhlov, Viktor A; Zhakhovsky, Vasily V; Khishchenko, Konstantin V; Demaske, Brian J; Oleynik, Ivan I
2014-01-01
Ultrafast processes, including nonmonotonic expansion of material into vacuum, supersonic melting and generation of super-elastic shock wave, in a surface layer of metal irradiated by an ultrashort laser pulse are discussed. In addition to the well-established two-temperature (2T) evolution of heated layer a new effect of electron pressure gradient on early stage of material expansion is studied. It is shown that the expanding material experiences an unexpected jump in flow velocity in a place where stress exceeds the effective tensile strength provided by used EoS of material. Another 2T effect is that supersonic propagation of homogeneous melting front results in distortion of spatial profile of ion temperature, which later imprints on ion pressure profile transforming in a super-elastic shock wave with time.
Asokan, N; Dmitrienko, Alexandra
2013-01-01
Recently, mobile security has garnered considerable interest in both the research community and industry due to the popularity of smartphones. The current smartphone platforms are open systems that allow application development, also for malicious parties. To protect the mobile device, its user, and other mobile ecosystem stakeholders such as network operators, application execution is controlled by a platform security architecture. This book explores how such mobile platform security architectures work. We present a generic model for mobile platform security architectures: the model illustrat
Supersonic micro-jets and their application to few-cycle laser-driven electron acceleration
International Nuclear Information System (INIS)
Schmid, Karl
2009-01-01
This thesis covers the few-cycle laser-driven acceleration of electrons in a laser-generated plasma. The laser system employed in this work is a new development based on optical parametric chirped pulse amplification and is the only multi-TW few-cycle laser in the world. In the experiment, the laser beam is focused onto a supersonic helium gas jet which leads to the formation of a plasma channel. The laser pulse, having an intensity of 10 19 W/cm 2 propagates through the plasma with an electron density of 2 x 10 19 cm -3 and forms via a highly nonlinear interaction a strongly anharmonic plasma wave. The amplitude of the wave is so large that the wave breaks, thereby injecting electrons from the background plasma into the accelerating phase. The energy transfer from the laser pulse to the plasma is so strong that the maximum propagation distance is limited to the 100 m range. Therefore, gas jets specifically tuned to these requirements have to be employed. The properties of microscopic supersonic gas jets are thoroughly analyzed in this work. Based on numeric flow simulation, this study encompasses several extensive parameter studies that illuminate all relevant features of supersonic flows in microscopic gas nozzles. This allowed the optimized design of de Laval nozzles with exit diameters ranging from 150 μm to 3 mm. The employment of these nozzles in the experiment greatly improved the electron beam quality. After these optimizations, the laser-driven electron accelerator now yields monoenergetic electron pulses with energies up to 50 MeV and charges between one and ten pC. The electron beam has a typical divergence of 5 mrad and comprises an energy spectrum that is virtually free from low energetic background. The electron pulse duration could not yet be determined experimentally but simulations point towards values in the range of 1 fs. The acceleration gradient is estimated from simulation and experiment to be approximately 0.5 TV/m. The electron accelerator
Supersonic micro-jets and their application to few-cycle laser-driven electron acceleration
Energy Technology Data Exchange (ETDEWEB)
Schmid, Karl
2009-07-23
This thesis covers the few-cycle laser-driven acceleration of electrons in a laser-generated plasma. The laser system employed in this work is a new development based on optical parametric chirped pulse amplification and is the only multi-TW few-cycle laser in the world. In the experiment, the laser beam is focused onto a supersonic helium gas jet which leads to the formation of a plasma channel. The laser pulse, having an intensity of 10{sup 19} W/cm{sup 2} propagates through the plasma with an electron density of 2 x 10{sup 19} cm{sup -3} and forms via a highly nonlinear interaction a strongly anharmonic plasma wave. The amplitude of the wave is so large that the wave breaks, thereby injecting electrons from the background plasma into the accelerating phase. The energy transfer from the laser pulse to the plasma is so strong that the maximum propagation distance is limited to the 100 m range. Therefore, gas jets specifically tuned to these requirements have to be employed. The properties of microscopic supersonic gas jets are thoroughly analyzed in this work. Based on numeric flow simulation, this study encompasses several extensive parameter studies that illuminate all relevant features of supersonic flows in microscopic gas nozzles. This allowed the optimized design of de Laval nozzles with exit diameters ranging from 150 {mu}m to 3 mm. The employment of these nozzles in the experiment greatly improved the electron beam quality. After these optimizations, the laser-driven electron accelerator now yields monoenergetic electron pulses with energies up to 50 MeV and charges between one and ten pC. The electron beam has a typical divergence of 5 mrad and comprises an energy spectrum that is virtually free from low energetic background. The electron pulse duration could not yet be determined experimentally but simulations point towards values in the range of 1 fs. The acceleration gradient is estimated from simulation and experiment to be approximately 0.5 TV/m. The
Abbas, L.K.; Rui, X.; Marzocca, P.; Abdalla, M.; De Breuker, R.
2011-01-01
In this paper, the effect of the system parameters on the flutter of a curved skin panel forced by a supersonic/hypersonic unsteady flow is numerically investigated. The aeroelastic model investigated includes the third-order piston theory aerodynamics for modeling the flow-induced forces and the
Aerodynamic Interaction between Delta Wing and Hemisphere-Cylinder in Supersonic Flow
Nishino, Atsuhiro; Ishikawa, Takahumi; Nakamura, Yoshiaki
As future space vehicles, Reusable Launch Vehicle (RLV) needs to be developed, where there are two kinds of RLV: Single Stage To Orbit (SSTO) and Two Stage To Orbit (TSTO). In the latter case, the shock/shock interaction and shock/boundary layer interaction play a key role. In the present study, we focus on the supersonic flow field with aerodynamic interaction between a delta wing and a hemisphere-cylinder, which imitate a TSTO, where the clearance, h, between the delta wing and hemisphere-cylinder is a key parameter. As a result, complicated flow patterns were made clear, including separation bubbles.
Computations of the Magnus effect for slender bodies in supersonic flow
Sturek, W. B.; Schiff, L. B.
1980-01-01
A recently reported Parabolized Navier-Stokes code has been employed to compute the supersonic flow field about spinning cone, ogive-cylinder, and boattailed bodies of revolution at moderate incidence. The computations were performed for flow conditions where extensive measurements for wall pressure, boundary layer velocity profiles and Magnus force had been obtained. Comparisons between the computational results and experiment indicate excellent agreement for angles of attack up to six degrees. The comparisons for Magnus effects show that the code accurately predicts the effects of body shape and Mach number for the selected models for Mach numbers in the range of 2-4.
Supersonic flow with shock waves. Monte-Carlo calculations for low density plasma. I
International Nuclear Information System (INIS)
Almenara, E.; Hidalgo, M.; Saviron, J. M.
1980-01-01
This Report gives preliminary information about a Monte Carlo procedure to simulate supersonic flow past a body of a low density plasma in the transition regime. A computer program has been written for a UNIVAC 1108 machine to account for a plasma composed by neutral molecules and positive and negative ions. Different and rather general body geometries can be analyzed. Special attention is played to tho detached shock waves growth In front of the body. (Author) 30 refs
Platform-based production development
DEFF Research Database (Denmark)
Bossen, Jacob; Brunoe, Thomas Ditlev; Nielsen, Kjeld
2015-01-01
Platforms as a means for applying modular thinking in product development is relatively well studied, but platforms in the production system has until now not been given much attention. With the emerging concept of platform-based co-development the importance of production platforms is though...
Omnidirectional holonomic platforms
International Nuclear Information System (INIS)
Pin, F.G.; Killough, S.M.
1994-01-01
This paper presents the concepts for a new family of wheeled platforms which feature full omnidirectionality with simultaneous and independently controlled rotational and translational motion capabilities. The authors first present the orthogonal-wheels concept and the two major wheel assemblies on which these platforms are based. They then describe how a combination of these assemblies with appropriate control can be used to generate an omnidirectional capability for mobile robot platforms. The design and control of two prototype platforms are then presented and their respective characteristics with respect to rotational and translational motion control are discussed
Platform decommissioning costs
International Nuclear Information System (INIS)
Rodger, David
1998-01-01
There are over 6500 platforms worldwide contributing to the offshore oil and gas production industry. In the North Sea there are around 500 platforms in place. There are many factors to be considered in planning for platform decommissioning and the evaluation of options for removal and disposal. The environmental impact, technical feasibility, safety and cost factors all have to be considered. This presentation considers what information is available about the overall decommissioning costs for the North Sea and the costs of different removal and disposal options for individual platforms. 2 figs., 1 tab
Interaction of a supersonic plasma jet with a coaxial dipole magnetic field
International Nuclear Information System (INIS)
Landes, K.
1975-01-01
A low pressure plasma jet of considerable conductivity can be influenced by a magnetic field. On the other hand the influencing magnetic field is changed by currents induced in the plasma jet. New astrophysical examples of suchlike interaction have been found in the investigation of the moon, where the partially not currentfree solar wind is influenced by locally confined magnetic fields. In the experiment reported, the interaction of a supersonic plasma jet with a coaxial, dipole-shaped magnetic field is investigated. A current is superimposed to the plasma jet. (Auth.)
A steady-state supersonic downflow in the transition region above a sunspot umbra
Straus, Thomas; Fleck, Bernhard; Andretta, Vincenzo
2015-10-01
We investigate a small-scale (~1.5 Mm along the slit), supersonic downflow of about 90 km s-1 in the transition region above the lightbridged sunspot umbra in AR 11836. The observations were obtained with the Interface Region Spectrograph (IRIS) on 2013 September 2 from 16:40 to 17:59 UT. The downflow shows up as redshifted "satellite" lines of the Si iv and O iv transition region lines and is remarkably steady over the observing period of nearly 80 min. The downflow is not visible in the chromospheric lines, which only show an intensity enhancement at the location of the downflow. The density inferred from the line ratio of the redshifted satellites of the O iv lines (Ne = 1010.6 ± 0.25 cm-3) is only a factor 2 smaller than the one inferred from the main components (Ne = 1010.95 ± 0.20 cm-3). Consequently, this implies a substantial mass flux (~5 × 10-7 g cm-2 s-1), which would evacuate the overlying corona on timescales close to 10 s. We interpret these findings as evidence of a stationary termination shock of a supersonic siphon flow in a cool loop that is rooted in the central umbra of the spot. The movie is available in electronic form at http://www.aanda.org
Brondz, Ilia; Fialkov, Alexander B; Amirav, Aviv
2009-01-30
Malaria is one of the most widespread and deadly diseases on the planet. Every year, about 500 million new cases are diagnosed, and the annual death toll is about 3 million. Primaquine has strong antiparasitic effects against gametocytes and can therefore prevent the spread of the parasite from treated patients to mosquitoes. It is also used in radical cures and prevents relapse. Consequently, primaquine is an often-used drug. In this study the separation of unprocessed primaquine from the contaminant quinocide based on gas chromatography-mass spectrometry with supersonic molecular beam (SMB) is presented and 7.5 mg primaquine diphosphate tablets were analyzed. We present a novel method for fast determination of quinocide which is an isomer of primaquine as the main contaminant in unprocessed primaquine and in its medical form as tablets by gas chromatography-mass spectrometry with SMB (also named supersonic GC-MS). Supersonic GC-MS provides enhanced molecular ion without any ion source related peak tailing plus extended range of compounds amenable for GC-MS analysis. In addition, major isomer mass spectral effects were revealed in the mass spectra of primaquine and quinocide which facilitated the unambiguous identification of quinocide in primaquine tablets. Fast GC-MS analysis is demonstrated with less then 2 min elution time of the drug and its main contaminants.
DEFF Research Database (Denmark)
Sköld, Martin; Karlsson, Christer
2012-01-01
. To shed light on this unexplored and growing managerial concern, the purpose of this explorative study is to identify operational challenges to management when product platforms are replaced. Design/methodology/approach – The study uses a longitudinal field-study approach. Two companies, Gamma and Omega...... replacement was chosen in each company. Findings – The study shows that platform replacements primarily challenge managers' existing knowledge about platform architectures. A distinction can be made between “width” and “height” in platform replacements, and it is crucial that managers observe this in order...... to challenge their existing knowledge about platform architectures. Issues on technologies, architectures, components and processes as well as on segments, applications and functions are identified. Practical implications – Practical implications are summarized and discussed in relation to a framework...
International Nuclear Information System (INIS)
Anna, Voloshenko; Rimma, Shelkov; Lev, Ovadia; Jenny, Gun
2011-01-01
The determination of 14 N-nitrosamines by a supersonic molecular beam electron ionization mass spectrometer equipped with triple quadruple analyzer, GC/SMB/EI/QQQ/MS is presented. The supersonic molecular beam electron ionization ion source allows the elucidation of the molecular ion of 13 out of the 14 examined nitrosamines (except for diphenylnitrosamine which was degraded before the analysis). It was possible to use the molecular ions of all the nitrosamines as the parent ions for multiple reactions monitoring mode, which in turn allows significant increase of specificity and lowering of the method limit of detection of the higher molecular weight nitrosamines. The instrumental LOD for different N-nitrosamines was 1-5 pg injection -1 . The proposed method was exemplified by analysis of N-nitrosamines and N-nitrosatables in rubber teats according to the British Standard BS EN 12868:1999.
Supersonic Molecular Beam Optical Stark Spectroscopy of MnH.
Gengler, Jamie; Ma, Tongmei; Harrison, Jeremy; Steimle, Timothy
2006-03-01
The large moment of inertia, large magnetic moment, and possible large permanent electric dipole moment of manganese monohydride, MnH, makes it a prime candidate for ultra-cold molecule production via Stark deceleration and magnetic trapping. Here we report the first molecular beam production of MnH and the analysis of the Stark effect in the (0,0) A^7 π -- X^ 7σ^+ band. The sample was prepared by laser ablation of solid Mn in an H2 supersonic expansion. The low rotational temperature (MnH and the analysis of T.D. Varberg, J.A. Gray, R.W. Field, and A.J. Merer, J. Mol. Spec. 156, 296-318 (1992). I.E. Gordon, D.R.T. Appadoo, A. Shayesteh, K.A. Walker, and P.F. Bernath, J. Mol. Spec., 229, 145-149 (2005).
CARS Temperature Measurements in a Combustion-Heated Supersonic Jet
Tedder, S. A.; Danehy, P. M.; Magnotti, G.; Cutler, A. D.
2009-01-01
Measurements were made in a combustion-heated supersonic axi-symmetric free jet from a nozzle with a diameter of 6.35 cm using dual-pump Coherent Anti-Stokes Raman Spectroscopy (CARS). The resulting mean and standard deviation temperature maps are presented. The temperature results show that the gas temperature on the centerline remains constant for approximately 5 nozzle diameters. As the heated gas mixes with the ambient air further downstream the mean temperature decreases. The standard deviation map shows evidence of the increase of turbulence in the shear layer as the jet proceeds downstream and mixes with the ambient air. The challenges of collecting data in a harsh environment are discussed along with influences to the data. The yield of the data collected is presented and possible improvements to the yield is presented are discussed.
Cai, Yan-Hua; Ma, Dong-Mei; Peng, Ru-Fang; Chu, Shi-Jin
2008-01-01
The treatment of calcium chloride with sodium carbonate under solvent-free conditions with a supersonic airflow and at a low heating temperature leads to the synthesis of ultra-fine calcium carbonate. The reaction not only involves mild conditions, a simple operation, and high yields but also gives a high conversion rate.
DEFF Research Database (Denmark)
Pedersen, Rasmus
for customisation of products. In many companies these changes in the business environment have created a controversy between the need for a wide variety of products offered to the marketplace and a desire to reduce variation within the company in order to increase efficiency. Many companies use the concept...... other. These groups can be varied and combined to form different product variants without increasing the internal variety in the company. Based on the Theory of Domains, the concept of encapsulation in the organ domain is introduced, and organs are formulated as platform elements. Included......This PhD thesis has the title Product Platform Modelling. The thesis is about product platforms and visual product platform modelling. Product platforms have gained an increasing attention in industry and academia in the past decade. The reasons are many, yet the increasing globalisation...
Storti, Mario A.; Nigro, Norberto M.; Paz, Rodrigo R.; Dalcín, Lisandro D.
2009-03-01
In this paper some results on the convergence of the Gauss-Seidel iteration when solving fluid/structure interaction problems with strong coupling via fixed point iteration are presented. The flow-induced vibration of a flat plate aligned with the flow direction at supersonic Mach number is studied. The precision of different predictor schemes and the influence of the partitioned strong coupling on stability is discussed.
2016-09-14
residence time for chemical reac- tions to occur within the cavity [2]. These types of combustors have previously been demonstrated as a suitable...release distributions when imaging com- bustion chemiluminescence. POD was first applied to turbulent flows by Lumley and coworkers [30] but to date...and quantitatively different. This relationship has been previously observed in subsonic and supersonic combustion with V-gutter, blunt-body combustion
Parameters of the plasma of a dc pulsating discharge in a supersonic air flow
Energy Technology Data Exchange (ETDEWEB)
Shibkov, V. M., E-mail: shibkov@phys.msu.ru; Shibkova, L. V.; Logunov, A. A. [Moscow State University, Faculty of Physics (Russian Federation)
2017-03-15
A dc discharge in a cold (T = 200 K) supersonic air flow at a static pressure of 200–400 Torr was studied experimentally. The excited unsteady pulsating discharge has the form of a thin plasma channel with a diameter of ≤1 mm, stretched downstream the flow. Depending on the discharge current, the pulsation frequency varies from 800 to 1600 Hz and the electron temperature varies from 8000 to 15000 K.
1980-01-01
Advances in airframe structure and materials technology for supersonic cruise aircraft are reported with emphasis on titanium and composite structures. The operation of the Concorde is examined as a baseline for projections into the future. A market survey of U.S. passenger attitudes and preferences, the impact of advanced air transport technology and the integration of systems for the advanced SST and for a smaller research/business jet vehicle are also discussed.
Introducing Platform Interactions Model for Studying Multi-Sided Platforms
DEFF Research Database (Denmark)
Staykova, Kalina; Damsgaard, Jan
2018-01-01
Multi-Sided Platforms (MSPs) function as socio-technical entities that facilitate direct interactions between various affiliated to them constituencies through developing and managing IT architecture. In this paper, we aim to explain the nature of the platform interactions as key characteristic o...
A study of direct-current surface discharge plasma for a Mach 3 supersonic flow control
Shin, Jichul
A direct-current, non-equilibrium surface glow discharge plasma in the presence of a Mach 2.85 flow is studied experimentally for flow control applications. The discharge is generated with pin-like electrodes flush mounted on a ceramic plate with sustaining currents from 25 mA to 300 mA. In the presence of a supersonic flow, two distinct discharge modes - diffuse and constricted - are observed depending on the flow and discharge operating conditions. In cathode upstream location, both diffuse and constricted discharges are observed while in cathode downstream location, the discharge mostly exhibits either constricted mode or bistable mixed mode. The effect of the discharge on the flow ("plasma actuation'') is characterized by the appearance of a weak shock wave in the vicinity of the discharge. The shock is observed at low powers (˜10 W) for the diffuse discharge mode but is absent for the higher power (˜100 W) constricted mode. High speed laser schlieren imaging suggests that the diffuse mode plasma actuation is rapid as it occurs on a time scale that is less than 100 microsec. Rotational (gas) and vibrational temperatures within the discharge are estimated by emission spectral line fits of N 2 and N+2 rovibronic bands near 365-395 nm. The electronic temperatures are estimated by using the Boltzmann plot method for Fe(I) atomic lines. Rotational temperatures are found to be high (˜1500 K) in the absence of a flow but drop sharply (˜500 K) in the presence of a supersonic flow for both the diffuse and constricted discharge modes. The vibrational and electronic temperatures are measured to be about 3000 K and 1.25 eV (14500 K), respectively, and these temperatures are the same with and without flow. The gas (rotational) temperature spatial profiles above the cathode surface are found to be similar for the diffuse and constricted modes indicating that dilatational effects due to gas heating are similar. However, complete absence of flow actuation for the
High Response Dew Point Measurement System for a Supersonic Wind Tunnel
Blumenthal, Philip Z.
1996-01-01
A new high response on-line measurement system has been developed to continuously display and record the air stream dew point in the NASA Lewis 10 x 10 supersonic wind tunnel. Previous instruments suffered from such problems as very slow response, erratic readings, and high susceptibility to contamination. The system operates over the entire pressure level range of the 10 x 10 SWT, from less than 2 psia to 45 psia, without the need for a vacuum pump to provide sample flow. The system speeds up tunnel testing, provides large savings in tunnel power costs and provides the dew point input for the data-reduction subroutines which calculate test section conditions.
The Generation, Radiation and Prediction of Supersonic Jet Noise. Volume 1
1978-10-01
supersonic Jet noise, the U. S. Air Force and the U. S. Department of Transportation Jointly Initiated a series of research contracts directed toward this need...ofMeasurdUAiDigPNOLE Specta an PreictiosDBaedLo 9ih0eqec LiEDICTIEquation Solutos eimTmeaueJt TP 80.Mthd1 *7 60 .........em131 1 (a 6300 I dB 100 90j 80...C3 - -21 Vjm 2Ao/a, a 2 de C4 - 21 Z- Ao, C5 - - 2IH 2VIMM6, and C6 - iVAob/. The form of j, for r >r m may be found by substituting Equation (3-107
Numerical simulation of steady supersonic flow over spinning bodies of revolution
Sturek, W. B.; Schiff, L. B.
1982-01-01
A recently reported parabolized Navier-Stokes code has been employed to compute the supersonic flowfield about a spinning cone and spinning and nonspinning ogive cylinder and boattailed bodies of revolution at moderate incidence. The computations were performed for flow conditions where extensive measurements for wall pressure, boundary-layer velocity profiles, and Magnus force had been obtained. Comparisons between the computational results and experiment indicate excellent agreement for angles of attack up to 6 deg. At angles greater than 6 deg discrepancies are noted which are tentatively attributed to turbulence modeling errors. The comparisons for Magnus effects show that the code accurately predicts the effects of body shape for the selected models.
The Experimental Measurement of Aerodynamic Heating About Complex Shapes at Supersonic Mach Numbers
Neumann, Richard D.; Freeman, Delma C.
2011-01-01
In 2008 a wind tunnel test program was implemented to update the experimental data available for predicting protuberance heating at supersonic Mach numbers. For this test the Langley Unitary Wind Tunnel was also used. The significant differences for this current test were the advances in the state-of-the-art in model design, fabrication techniques, instrumentation and data acquisition capabilities. This current paper provides a focused discussion of the results of an in depth analysis of unique measurements of recovery temperature obtained during the test.
Multi-objective design optimization of the transverse gaseous jet in supersonic flows
Huang, Wei; Yang, Jun; Yan, Li
2014-01-01
The mixing process between the injectant and the supersonic crossflow is one of the important issues for the design of the scramjet engine, and the efficiency mixing has a great impact on the improvement of the combustion efficiency. A hovering vortex is formed between the separation region and the barrel shock wave, and this may be induced by the large negative density gradient. The separation region provides a good mixing area for the injectant and the subsonic boundary layer. In the current study, the transverse injection flow field with a freestream Mach number of 3.5 has been optimized by the non-dominated sorting genetic algorithm (NSGA II) coupled with the Kriging surrogate model; and the variance analysis method and the extreme difference analysis method have been employed to evaluate the values of the objective functions. The obtained results show that the jet-to-crossflow pressure ratio is the most important design variable for the transverse injection flow field, and the injectant molecular weight and the slot width should be considered for the mixing process between the injectant and the supersonic crossflow. There exists an optimal penetration height for the mixing efficiency, and its value is about 14.3 mm in the range considered in the current study. The larger penetration height provides a larger total pressure loss, and there must be a tradeoff between these two objection functions. In addition, this study demonstrates that the multi-objective design optimization method with the data mining technique can be used efficiently to explore the relationship between the design variables and the objective functions.
Coupled Analysis of an Inlet and Fan for a Quiet Supersonic Jet
Chima, Rodrick V.; Conners, Timothy R.; Wayman, Thomas R.
2010-01-01
A computational analysis of a Gulfstream isentropic external compression supersonic inlet coupled to a Rolls-Royce fan has been completed. The inlet was designed for a small, low sonic boom supersonic vehicle with a design cruise condition of M = 1.6 at 45,000 ft. The inlet design included an annular bypass duct that routed flow subsonically around an engine-mounted gearbox and diverted flow with high shock losses away from the fan tip. Two Reynolds-averaged Navier-Stokes codes were used for the analysis: an axisymmetric code called AVCS for the inlet and a three dimensional (3-D) code called SWIFT for the fan. The codes were coupled at a mixing plane boundary using a separate code for data exchange. The codes were used to determine the performance of the inlet/fan system at the design point and to predict the performance and operability of the system over the flight profile. At the design point the core inlet had a recovery of 96 percent, and the fan operated near its peak efficiency and pressure ratio. A large hub radial distortion generated in the inlet was not eliminated by the fan and could pose a challenge for subsequent booster stages. The system operated stably at all points along the flight profile. Reduced stall margin was seen at low altitude and Mach number where flow separated on the interior lips of the cowl and bypass ducts. The coupled analysis gave consistent solutions at all points on the flight profile that would be difficult or impossible to predict by analysis of isolated components.
Coupled Analysis of an Inlet and Fan for a Quiet Supersonic Aircraft
Chima, Rodrick V.; Conners, Timothy R.; Wayman, Thomas R.
2009-01-01
A computational analysis of a Gulfstream isentropic external compression supersonic inlet coupled to a Rolls-Royce fan was completed. The inlet was designed for a small, low sonic boom supersonic vehicle with a design cruise condition of M = 1.6 at 45,000 feet. The inlet design included an annular bypass duct that routed flow subsonically around an engine-mounted gearbox and diverted flow with high shock losses away from the fan tip. Two Reynolds-averaged Navier-Stokes codes were used for the analysis: an axisymmetric code called AVCS for the inlet and a 3-D code called SWIFT for the fan. The codes were coupled at a mixing plane boundary using a separate code for data exchange. The codes were used to determine the performance of the inlet/fan system at the design point and to predict the performance and operability of the system over the flight profile. At the design point the core inlet had a recovery of 96 percent, and the fan operated near its peak efficiency and pressure ratio. A large hub radial distortion generated in the inlet was not eliminated by the fan and could pose a challenge for subsequent booster stages. The system operated stably at all points along the flight profile. Reduced stall margin was seen at low altitude and Mach number where flow separated on the interior lips of the cowl and bypass ducts. The coupled analysis gave consistent solutions at all points on the flight profile that would be difficult or impossible to predict by analysis of isolated components.
International Nuclear Information System (INIS)
Hasheminejad, Seyyed M; Nezami, M; Aryaee Panah, M E
2012-01-01
Brief reviews on suppressing panel flutter vibrations by various active control strategies as well as utilization tunable electrorheological fluids (ERFs) for vibration control of structural systems are presented. Active suppression of the supersonic flutter motion of a simply supported sandwich panel with a tunable ERF interlayer, and coupled to an elastic foundation, is subsequently investigated. The structural formulation is based on the classical beam theory along with the Winkler–Pasternak foundation model, the ER fluid core is modeled as a first-order Kelvin–Voigt material, and the quasi-steady first-order supersonic piston theory is employed to describe the aerodynamic loading. Hamilton’s principle is used to derive a set of fully coupled dynamic equations of motion. The generalized Fourier expansions in conjunction with the Galerkin method are then employed to formulate the governing equations in the state space domain. The critical dynamic pressures at which unstable panel oscillations (coalescence of eigenvalues) occur are obtained via the p-method for selected applied electric field strengths (E = 0,2,4 kV mm −1 ). The classical Runge–Kutta time integration algorithm is subsequently used to calculate the open-loop aeroelastic response of the system in various basic loading configurations (i.e. uniformly distributed blast, gust, sonic boom, and step loads), with or without an interacting soft/stiff elastic foundation. Finally, a sliding mode control synthesis (SMC) involving the first six natural modes of the structural system is set up to actively suppress the closed-loop system response in supersonic flight conditions and under the imposed excitations. Simulation results demonstrate performance, effectiveness, and insensitivity with respect to the spillover of the proposed SMC-based control system. Limiting cases are considered and good agreements with the data available in the literature as well as with the computations made by using the
Supersonic plasma flow between high latitude conjugate ionospheres
International Nuclear Information System (INIS)
Roesler, G.
1975-01-01
The polar wind problem has been investigated for closed field lines in situations where one of the two conjugate ionospheric regions is fully illuminated by the sun and the other darkness (solstices at high latitudes). A supersonic flow between hemispheres is possible; the magnetospheric part of this flow must be symmetric with respect to the equator. The daytime fluxes are proportional to the neutral hydrogen density. Fluxes of the order of 10 8 cm -2 sec -1 are only possible with density considerably higher than given by CIRA models. For stationary solutions higher flow speeds are needed on the dark side than provided from the illuminated side. It is concluded that shock waves with upward velocities of about 5 km/sec would form above the dark ionosphere. This implies a reduction by a factor of 3 to 5 of the plasma influx into the dark hemisphere, whereby F-layer densities of only up to 2 x 10 4 cm -3 can be maintained. (orig.) [de
Production and characterization of supersonic carbon cluster beams
International Nuclear Information System (INIS)
Rohlfing, E.A.; Cox, D.M.; Kaldor, A.
1984-01-01
Laser vaporization of a substrate within the throat of a pulsed nozzle is used to generate a supersonic beam of carbon clusters. The neutral cluster beam is probed downstream by UV laser photoionization with time-of-flight mass analysis of the resulting photoions. Using graphite as the substrate, carbon clusters C/sub n/ for n = 1--190 have been produced having a distinctly bimodal cluster size distribution: (i) Both even and odd clusters for C/sub n/, 1 + /sub n/ signals are interpreted on the basis of cluster formation and stability arguments. Ionizing laser power dependences taken at several different photon energies are used to roughly bracket the carbon cluster ionization potentials, and, at high laser intensity, to observe the onset of multiphoton fragmentation. By treating the graphite rod with KOH, a greatly altered carbon cluster distribution with mixed carbon/potassium clusters of formula K 2 C/sub 2n/ is produced
Supersonic Love waves in strong piezoelectrics of symmetry mm2
International Nuclear Information System (INIS)
Darinskii, A. N.; Weihnacht, M.
2001-01-01
A study has been made of the Love wave propagation on piezoelectric substrates of symmetry mm2. It has been shown that under certain conditions the velocity of the Love wave exceeds that of shear horizontal (SH) bulk waves in the substrate. This occurs when the slowness curve of SH bulk waves in the substrate either has a concavity or is convex with nearly zero curvature. For such 'supersonic' Love waves to appear, it is also required that the substrate as well as the layer be specially oriented and that their material constants fulfill a number of inequalities. Numerical computations have been carried out for a number of structures. The results of numerical computations have been compared with approximate analytical estimations. [copyright] 2001 American Institute of Physics
Supersonic Combustion in Air-Breathing Propulsion Systems for Hypersonic Flight
Urzay, Javier
2018-01-01
Great efforts have been dedicated during the last decades to the research and development of hypersonic aircrafts that can fly at several times the speed of sound. These aerospace vehicles have revolutionary applications in national security as advanced hypersonic weapons, in space exploration as reusable stages for access to low Earth orbit, and in commercial aviation as fast long-range methods for air transportation of passengers around the globe. This review addresses the topic of supersonic combustion, which represents the central physical process that enables scramjet hypersonic propulsion systems to accelerate aircrafts to ultra-high speeds. The description focuses on recent experimental flights and ground-based research programs and highlights associated fundamental flow physics, subgrid-scale model development, and full-system numerical simulations.
Titze, Katharina; Zollitsch, Tilo; Heiz, Ulrich; Boesl, Ulrich
2014-09-15
An experiment on chiral molecules that combines circular dichroism (CD) spectroscopy, mass-selective detection by laser mass spectrometry (MS), and cooling of molecules by using a supersonic beam is presented. The combination of the former two techniques (CD-laser-MS) is a new method to investigate chiral molecules and is now used by several research groups. Cooling in a supersonic beam supplies a substantial increase in spectroscopic resolution, a feature that has not yet been used in CD spectroscopy. In the experiments reported herein, a large variation in the electronic CD of carbonyl 3-methylcyclopentanone was observed depending on the excited vibrational modes in the n → π* transition. This finding should be of interest for the detection of chiral molecules and for the theoretical understanding of the CD of vibronic bands. It is expected that this effect will show up in other chiral carbonyls because the n → π* transition is typical for the carbonyl group. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Wang, Kon-Sheng Charles
1994-01-01
The design and development of an airborne flight-test experiment to study nonreacting gas jets injected transversely into transonic and supersonic crossflows is presented. Free-stream/crossflow Mach numbers range from 0.8 to 2.0. Planar laser-induced fluorescence (PLIF) of an iodine-seeded nitrogen jet is used to visualize the jet flow. Time-dependent images are obtained with a high-speed intensified video camera synchronized to the laser pulse rate. The entire experimental assembly is configured compactly inside a unique flight-test-fixture (FTF) mounted under the fuselage of the F-104G research aircraft, which serves as a 'flying wind tunnel' at NASA Dryden Flight Research Center. The aircraft is flown at predetermined speeds and altitudes to permit a perfectly expanded (or slightly underexpanded) gas jet to form just outside the FTF at each free-stream Mach number. Recorded gas jet images are then digitized to allow analysis of jet trajectory, spreading, and mixing characteristics. Comparisons will be made with analytical and numerical predictions. This study shows the viability of applying highly sophisticated groundbased flow diagnostic techniques to flight-test vehicle platforms that can achieve a wide range of thermo/fluid dynamic conditions. Realistic flow environments, high enthalpies, unconstrained flowfields, and moderate operating costs are also realized, in contrast to traditional wind-tunnel testing.
Influence of probe geometry on pitot-probe displacement in supersonic turbulent flow
Allen, J. M.
1975-01-01
An experiment was conducted to determine the varying effects of six different probe-tip and support-shaft configurations on pitot tube displacement. The study was stimulated by discrepancies between supersonic wind-tunnel tests conducted by Wilson and Young (1949) and Allen (1972). Wilson (1973) had concluded that these discrepancies were caused by differences in probe geometry. It is shown that in fact, no major differences in profiles of streamwise velocity over streamwise velocity at boundary-layer edge vs normal coordinate over boundary-layer total thickness result from geometry. The true cause of the discrepancies, however, remains to be discovered.
Pitot-probe displacement in a supersonic turbulent boundary layer
Allen, J. M.
1972-01-01
Eight circular pitot probes ranging in size from 2 to 70 percent of the boundary-layer thickness were tested to provide experimental probe displacement results in a two-dimensional turbulent boundary layer at a nominal free-stream Mach number of 2 and unit Reynolds number of 8 million per meter. The displacement obtained in the study was larger than that reported by previous investigators in either an incompressible turbulent boundary layer or a supersonic laminar boundary layer. The large probes indicated distorted Mach number profiles, probably due to separation. When the probes were small enough to cause no appreciable distortion, the displacement was constant over most of the boundary layer. The displacement in the near-wall region decreased to negative displacement in some cases. This near-wall region was found to extend to about one probe diameter from the test surface.
Flow Visualization in Supersonic Turbulent Boundary Layers.
Smith, Michael Wayne
This thesis is a collection of novel flow visualizations of two different flat-plate, zero pressure gradient, supersonic, turbulent boundary layers (M = 2.8, Re _theta ~ 82,000, and M = 2.5, Re_ theta ~ 25,000, respectively). The physics of supersonic shear flows has recently drawn increasing attention with the renewed interest in flight at super and hypersonic speeds. This work was driven by the belief that the study of organized, Reynolds -stress producing turbulence structures will lead to improved techniques for the modelling and control of high-speed boundary layers. Although flow-visualization is often thought of as a tool for providing qualitative information about complex flow fields, in this thesis an emphasis is placed on deriving quantitative results from image data whenever possible. Three visualization techniques were applied--'selective cut-off' schlieren, droplet seeding, and Rayleigh scattering. Two experiments employed 'selective cut-off' schlieren. In the first, high-speed movies (40,000 fps) were made of strong density gradient fronts leaning downstream at between 30^circ and 60^ circ and travelling at about 0.9U _infty. In the second experiment, the same fronts were detected with hot-wires and imaged in real time, thus allowing the examination of the density gradient fronts and their associated single-point mass -flux signals. Two experiments employed droplet seeding. In both experiments, the boundary layer was seeded by injecting a stream of acetone through a single point in the wall. The acetone is atomized by the high shear at the wall into a 'fog' of tiny (~3.5mu m) droplets. In the first droplet experiment, the fog was illuminated with copper-vapor laser sheets of various orientations. The copper vapor laser pulses 'froze' the fog motion, revealing a variety of organized turbulence structures, some with characteristic downstream inclinations, others with large-scale roll-up on the scale of delta. In the second droplet experiment, high
2012-01-01
This paper focuses on some of the more challenging design processes and characterization tests of the Semi-Span Super-Sonic Transport (S4T)-Active Controls Testbed (ACT). The model was successfully tested in four entries in the National Aeronautics and Space Administration Langley Transonic Dynamics Tunnel to satisfy the goals and objectives of the Fundamental Aeronautics Program Supersonic Project Aero-Propulso-Servo-Elastic effort. Due to the complexity of the S4T-ACT, only a small sample of the technical challenges for designing and characterizing the model will be presented. Specifically, the challenges encountered in designing the model include scaling the Technology Concept Airplane to model scale, designing the model fuselage, aileron actuator, and engine pylons. Characterization tests included full model ground vibration tests, wing stiffness measurements, geometry measurements, proof load testing, and measurement of fuselage static and dynamic properties.
Energy Technology Data Exchange (ETDEWEB)
2018-01-23
Deploying an ADMS or looking to optimize its value? NREL offers a low-cost, low-risk evaluation platform for assessing ADMS performance. The National Renewable Energy Laboratory (NREL) has developed a vendor-neutral advanced distribution management system (ADMS) evaluation platform and is expanding its capabilities. The platform uses actual grid-scale hardware, large-scale distribution system models, and advanced visualization to simulate realworld conditions for the most accurate ADMS evaluation and experimentation.
Photoelectron spectroscopy of supersonic molecular beams
International Nuclear Information System (INIS)
Pollard, J.E.
1982-05-01
A new technique for performing high resolution molecular photoelectron spectroscopy is described, beginning with its conceptual development, through the construction of a prototypal apparatus, to the initial applications on a particularly favorable molecular system. The distinguishing features of this technique are: (1) the introduction of the sample in the form of a collimated supersonic molecular beam; and (2) the use of an electrostatic deflection energy analyzer which is carefully optimized in terms of sensitivity and resolution. This combination makes it possible to obtain photoelectron spectra at a new level of detail for many small molecules. Three experiments are described which rely on the capability to perform rotationally-resolved photoelectron spectroscopy on the hydrogen molecule and its isotopes. The first is a measurement of the ionic vibrational and rotational spectroscopic constants and the vibrationally-selected photoionization cross sections. The second is a determination of the photoelectron asymmetry parameter, β, for selected rotational transitions. The third is an investigation of the rotational relaxation in a free jet expansion, using photoelectron spectroscopy as a probe of the rotational state population distributions. In the closing chapter an assessment is made of the successes and limitations of the technique, and an indication is given of areas for further improvement in future spectrometers
Effects of variable specific heat on energy transfer in a high-temperature supersonic channel flow
Chen, Xiaoping; Li, Xiaopeng; Dou, Hua-Shu; Zhu, Zuchao
2018-05-01
An energy transfer mechanism in high-temperature supersonic turbulent flow for variable specific heat (VSH) condition through turbulent kinetic energy (TKE), mean kinetic energy (MKE), turbulent internal energy (TIE) and mean internal energy (MIE) is proposed. The similarities of energy budgets between VSH and constant specific heat (CSH) conditions are investigated by introducing a vibrational energy excited degree and considering the effects of fluctuating specific heat. Direct numerical simulation (DNS) of temporally evolving high-temperature supersonic turbulent channel flow is conducted at Mach number 3.0 and Reynolds number 4800 combined with a constant dimensional wall temperature 1192.60 K for VSH and CSH conditions to validate the proposed energy transfer mechanism. The differences between the terms in the two kinetic energy budgets for VSH and CSH conditions are small; however, the magnitude of molecular diffusion term for VSH condition is significantly smaller than that for CSH condition. The non-negligible energy transfer is obtained after neglecting several small terms of diffusion, dissipation and compressibility related. The non-negligible energy transfer involving TIE includes three processes, in which energy can be gained from TKE and MIE and lost to MIE. The same non-negligible energy transfer through TKE, MKE and MIE is observed for both the conditions.
DEFF Research Database (Denmark)
Blok, Anders; Courmont, Antoine; Hoyng, Rolien
2017-01-01
This section offers a series of joint reflections on (open) data platform from a variety of cases, from cycling, traffic and mapping to activism, environment and data brokering. Data platforms play a key role in contemporary urban governance. Linked to open data initiatives, such platforms are of...
Accounting for Laminar Run & Trip Drag in Supersonic Cruise Performance Testing
Goodsell, Aga M.; Kennelly, Robert A.
1999-01-01
An improved laminar run and trip drag correction methodology for supersonic cruise performance testing was derived. This method required more careful analysis of the flow visualization images which revealed delayed transition particularly on the inboard upper surface, even for the largest trip disks. In addition, a new code was developed to estimate the laminar run correction. Once the data were corrected for laminar run, the correct approach to the analysis of the trip drag became evident. Although the data originally appeared confusing, the corrected data are consistent with previous results. Furthermore, the modified approach, which was described in this presentation, extends prior historical work by taking into account the delayed transition caused by the blunt leading edges.
Doppler-shifted fluorescence imaging of velocity fields in supersonic reacting flows
Allen, M. G.; Davis, S. J.; Kessler, W. J.; Sonnenfroh, D. M.
1992-01-01
The application of Doppler-shifted fluorescence imaging of velocity fields in supersonic reacting flows is analyzed. Focussing on fluorescence of the OH molecule in typical H2-air Scramjet flows, the effects of uncharacterized variations in temperature, pressure, and collisional partner composition across the measurement plane are examined. Detailed measurements of the (1,0) band OH lineshape variations in H2-air combustions are used, along with single-pulse and time-averaged measurements of an excimer-pumped dye laser, to predict the performance of a model velocimeter with typical Scramjet flow properties. The analysis demonstrates the need for modification and control of the laser bandshape in order to permit accurate velocity measurements in the presence of multivariant flow properties.
Mobile Platforms and Development Environments
Helal, Sumi; Li, Wengdong
2012-01-01
Mobile platform development has lately become a technological war zone with extremely dynamic and fluid movement, especially in the smart phone and tablet market space. This Synthesis lecture is a guide to the latest developments of the key mobile platforms that are shaping the mobile platform industry. The book covers the three currently dominant native platforms -- iOS, Android and Windows Phone -- along with the device-agnostic HTML5 mobile web platform. The lecture also covers location-based services (LBS) which can be considered as a platform in its own right. The lecture utilizes a sampl
Poliak, Marina; Fialkov, Alexander B; Amirav, Aviv
2008-11-07
Pulsed flow modulation (PFM) two-dimensional comprehensive gas chromatography (GC x GC) was combined with quadrupole-based mass spectrometry (MS) via a supersonic molecular beam (SMB) interface using a triple-quadrupole system as the base platform, which enabled tandem mass spectrometry (MS-MS). PFM is a simple GC x GC modulator that does not consume cryogenic gases while providing tunable second GC x GC column injection time for enabling the use of quadrupole-based mass spectrometry regardless its limited scanning speed. The 20-ml/min second column flow rate involved with PFM is handled, splitless, by the SMB interface without affecting the sensitivity. The combinations of PFM GC x GC-MS with SMB and PFM GC x GC-MS-MS with SMB were explored with the analysis of diazinon and permethrin in coriander. PFM GC x GC-MS with SMB is characterized by enhanced molecular ion and tailing-free fast ion source response time. It enables universal pesticide analysis with full scan and data analysis with reconstructed single ion monitoring on the enhanced molecular ion and another prominent high mass fragment ion. The elimination of the third fragment ion used in standard three ions method results in significantly reduced matrix interference. GC x GC-MS with SMB improves the GC separation, and thereby our ability for sample identification using libraries. GC-MS-MS with SMB provides better reduction (elimination) of matrix interference than GC x GC-MS. However, it is a target method, which is not always applicable. GC x GC-MS-MS does not seem to further reduce matrix interferences over GC-MS-MS and unlike GC x GC-MS, it is incompatible with library identification, but it is beneficial to have both GC x GC and MS-MS capabilities in the same system.
Particle acceleration via reconnection processes in the supersonic solar wind
International Nuclear Information System (INIS)
Zank, G. P.; Le Roux, J. A.; Webb, G. M.; Dosch, A.; Khabarova, O.
2014-01-01
An emerging paradigm for the dissipation of magnetic turbulence in the supersonic solar wind is via localized small-scale reconnection processes, essentially between quasi-2D interacting magnetic islands. Charged particles trapped in merging magnetic islands can be accelerated by the electric field generated by magnetic island merging and the contraction of magnetic islands. We derive a gyrophase-averaged transport equation for particles experiencing pitch-angle scattering and energization in a super-Alfvénic flowing plasma experiencing multiple small-scale reconnection events. A simpler advection-diffusion transport equation for a nearly isotropic particle distribution is derived. The dominant charged particle energization processes are (1) the electric field induced by quasi-2D magnetic island merging and (2) magnetic island contraction. The magnetic island topology ensures that charged particles are trapped in regions where they experience repeated interactions with the induced electric field or contracting magnetic islands. Steady-state solutions of the isotropic transport equation with only the induced electric field and a fixed source yield a power-law spectrum for the accelerated particles with index α = –(3 + M A )/2, where M A is the Alfvén Mach number. Considering only magnetic island contraction yields power-law-like solutions with index –3(1 + τ c /(8τ diff )), where τ c /τ diff is the ratio of timescales between magnetic island contraction and charged particle diffusion. The general solution is a power-law-like solution with an index that depends on the Alfvén Mach number and the timescale ratio τ diff /τ c . Observed power-law distributions of energetic particles observed in the quiet supersonic solar wind at 1 AU may be a consequence of particle acceleration associated with dissipative small-scale reconnection processes in a turbulent plasma, including the widely reported c –5 (c particle speed) spectra observed by Fisk and Gloeckler
DEFF Research Database (Denmark)
Lahrmann, Harry; Agerholm, Niels; Juhl, Jens
2012-01-01
This paper presents the project entitled “ITS Platform North Denmark” which is used as a test platform for Intelligent Transportation System (ITS) solutions. The platform consists of a newly developed GNSS/GPRS On Board Unit (OBU) to be installed in 500 cars, a backend server and a specially...
Platform development supportedby gaming
DEFF Research Database (Denmark)
Mikkola, Juliana Hsuan; Hansen, Poul H. Kyvsgård
2007-01-01
The challenge of implementing industrial platforms in practice can be described as a configuration problem caused by high number of variables, which often have contradictory influences on the total performance of the firm. Consequently, the specific platform decisions become extremely complex......, possibly increasing the strategic risks for the firm. This paper reports preliminary findings on platform management process at LEGO, a Danish toy company. Specifically, we report the process of applying games combined with simulations and workshops in the platform development. We also propose a framework...
Molecular description of steady supersonic free jets
Montero, S.
2017-09-01
A detailed analysis of the non-local thermal equilibrium (n-LTE) problem in the paraxial zone of silence of supersonic free jets is reported. The study is based on a hybrid approach that combines Navier-Stokes equations with a kinetic equation derived from the generalized Boltzmann (Waldmann-Snider) equation. The resulting system is solved for those flow quantities not easily amenable to experimental measure (translational temperature, flow velocity, and entropy) in terms of the quantities that can be measured accurately (distance, number density, population of rotational states, and their gradients). The reported solutions are essentially exact and are formulated in terms of macroscopic quantities, as well as in terms of elementary collision processes. Emphasis is made on the influence of dissipative effects onto the flow (viscous and diabatic) and of the breakdown of thermal equilibrium onto the evolution of entropy and translational temperature. The influence of inelastic collisions onto these effects is analysed in depth. The reported equations are aimed at optimizing the experimental knowledge of the n-LTE problem and its quantitative interpretation in terms of state-to-state rates for inelastic collisions.
International Nuclear Information System (INIS)
Barre, S.; Bonnet, J.P.
2015-01-01
Highlights: • We performed a careful experiment on a highly compressible mixing layer. • We validated the most recent DNS with the present results. • We discuss some aspects of the thermodynamics of the turbulent flow. • We performed a comparison between a computed and a measured turbulent kinetic energy budget. - Abstract: A compressible supersonic mixing layer at convective Mach number (Mc) equal to 1 has been studied experimentally in a dual stream supersonic/subsonic wind-tunnel. Laser Doppler Velocimetry (L.D.V.) measurements were performed making possible a full estimation of the mean and turbulent 3D velocity fields in the mixing layer. The Reynolds stress tensor was described. In particular, some anisotropy coefficients were obtained. It appears that the structure of the Reynolds tensor is almost not affected by compressibility at least up to Mc = 1. The turbulent kinetic energy budget was also experimentally estimated. Reynolds analogies assumptions were used to obtain density/velocity correlations in order to build the turbulent kinetic energy budget from LDV measurements. Results have been compared to other experimental and numerical results. Compressibility effects on the turbulent kinetic energy budget have been detected and commented. A study about thermodynamics flow properties was also performed using most recent DNS results experimentally validated by the present data. A non-dimensional number is then introduced in order to quantify the real effect of pressure fluctuations on the thermodynamics quantities fluctuations
International Nuclear Information System (INIS)
Nezami, M; Gholami, B
2016-01-01
The active flutter control of supersonic sandwich panels with regular honeycomb interlayers under impact load excitation is studied using piezoelectric patches. A non-dominated sorting-based multi-objective evolutionary algorithm, called non-dominated sorting genetic algorithm II (NSGA-II) is suggested to find the optimal locations for different numbers of piezoelectric actuator/sensor pairs. Quasi-steady first order supersonic piston theory is employed to define aerodynamic loading and the p-method is applied to find the flutter bounds. Hamilton’s principle in conjunction with the generalized Fourier expansions and Galerkin method are used to develop the dynamical model of the structural systems in the state-space domain. The classical Runge–Kutta time integration algorithm is then used to calculate the open-loop aeroelastic response of the system. The maximum flutter velocity and minimum voltage applied to actuators are calculated according to the optimal locations of piezoelectric patches obtained using the NSGA-II and then the proportional feedback is used to actively suppress the closed loop system response. Finally the control effects, using the two different controllers, are compared. (paper)
Erickson, Gary E.
2013-01-01
A video-based photogrammetric model deformation system was established as a dedicated optical measurement technique at supersonic speeds in the NASA Langley Research Center Unitary Plan Wind Tunnel. This system was used to measure the wing twist due to aerodynamic loads of two supersonic commercial transport airplane models with identical outer mold lines but different aeroelastic properties. One model featured wings with deflectable leading- and trailing-edge flaps and internal channels to accommodate static pressure tube instrumentation. The wings of the second model were of single-piece construction without flaps or internal channels. The testing was performed at Mach numbers from 1.6 to 2.7, unit Reynolds numbers of 1.0 million to 5.0 million, and angles of attack from -4 degrees to +10 degrees. The video model deformation system quantified the wing aeroelastic response to changes in the Mach number, Reynolds number concurrent with dynamic pressure, and angle of attack and effectively captured the differences in the wing twist characteristics between the two test articles.
Study of Interaction between Supersonic Flow and Rods Surrounded by Porous Cavity
Institute of Scientific and Technical Information of China (English)
Minoru YAGA; Kenji YAMAMOTO; Piotr DOERFFER; Kenyu OYAKAWA
2006-01-01
In this paper,some preliminary calculations and the experiments were performed to figure out the flow field,in which some rods were normally inserted into the main flow surrounded by a porous cavity.As a result,it is found that the starting shock wave severely interacts with the rods,the bow shock wave,its reflections,and the porous wall,which are numerically well predicted at some conditions.Moreover,inserting the rods makes the pressure on the upper wall in the porous region increase when the main flow in the porous region is completely supersonic.The calculations also suggest that three rods cause the widest suction area.
Nelson, D. P.
1980-01-01
Wind tunnel tests were conducted to evaluate the aerodynamic performance of a coannular exhaust nozzle for a proposed variable stream control supersonic propulsion system. Tests were conducted with two simulated configurations differing primarily in the fan duct flowpaths: a short flap mechanism for fan stream control with an isentropic contoured flow splitter, and an iris fan nozzle with a conical flow splitter. Both designs feature a translating primary plug and an auxiliary inlet ejector. Tests were conducted at takeoff and simulated cruise conditions. Data were acquired at Mach numbers of 0, 0.36, 0.9, and 2.0 for a wide range of nozzle operating conditions. At simulated supersonic cruise, both configurations demonstrated good performance, comparable to levels assumed in earlier advanced supersonic propulsion studies. However, at subsonic cruise, both configurations exhibited performance that was 6 to 7.5 percent less than the study assumptions. At take off conditions, the iris configuration performance approached the assumed levels, while the short flap design was 4 to 6 percent less.
Connolly, Joseph W.; Kopasakis, George; Lemon, Kimberly A.
2010-01-01
A turbofan simulation has been developed for use in aero-propulso-servo-elastic coupling studies, on supersonic vehicles. A one-dimensional lumped volume approach is used whereby each component (fan, high-pressure compressor, combustor, etc.) is represented as a single volume using characteristic performance maps and conservation equations for continuity, momentum and energy. The simulation is developed in the MATLAB/SIMULINK (The MathWorks, Inc.) environment in order to facilitate controls development, and ease of integration with a future aero-servo-elastic vehicle model being developed at NASA Langley. The complete simulation demonstrated steady state results that closely match a proposed engine suitable for a supersonic business jet at the cruise condition. Preliminary investigation of the transient simulation revealed expected trends for fuel flow disturbances as well as upstream pressure disturbances. A framework for system identification enables development of linear models for controller design. Utilizing this framework, a transfer function modeling an upstream pressure disturbance s impacts on the engine speed is developed as an illustrative case of the system identification. This work will eventually enable an overall vehicle aero-propulso-servo-elastic model
Platform Expansion Design as Strategic Choice
DEFF Research Database (Denmark)
Staykova, Kalina S.; Damsgaard, Jan
2016-01-01
In this paper, we address how the strategic choice of platform expansion design impacts the subse-quent platform strategy. We identify two distinct approaches to platform expansion – platform bun-dling and platform constellations, which currently co-exist. The purpose of this paper is to outline...
A Typology of Multi-sided Platforms
DEFF Research Database (Denmark)
Staykova, Kalina Stefanova; Damsgaard, Jan
2015-01-01
In this paper we address how the composition of a platform impacts the platform’s business model. By platform’s business model we mean platform features, platform architecture and platform governance. To this end, we construct the Platform Business Model Framework. We apply the framework to three...
Hart, Roger C.; Herring, Gregory C.; Balla, Robert J.
2007-01-01
Nonintrusive, off-body flow barometry in Mach-2 airflow has been demonstrated in a large-scale supersonic wind tunnel using seedless laser-induced thermal acoustics (LITA). The static pressure of the gas flow is determined with a novel differential absorption measurement of the ultrasonic sound produced by the LITA pump process. Simultaneously, stream-wise velocity and static gas temperature of the same spatially-resolved sample volume were measured with this nonresonant time-averaged LITA technique. Mach number, temperature and pressure have 0.2%, 0.4%, and 4% rms agreement, respectively, in comparison with known free-stream conditions.
Adaptive Aft Signature Shaping of a Low-Boom Supersonic Aircraft Using Off-Body Pressures
Ordaz, Irian; Li, Wu
2012-01-01
The design and optimization of a low-boom supersonic aircraft using the state-of-the- art o -body aerodynamics and sonic boom analysis has long been a challenging problem. The focus of this paper is to demonstrate an e ective geometry parameterization scheme and a numerical optimization approach for the aft shaping of a low-boom supersonic aircraft using o -body pressure calculations. A gradient-based numerical optimization algorithm that models the objective and constraints as response surface equations is used to drive the aft ground signature toward a ramp shape. The design objective is the minimization of the variation between the ground signature and the target signature subject to several geometric and signature constraints. The target signature is computed by using a least-squares regression of the aft portion of the ground signature. The parameterization and the deformation of the geometry is performed with a NASA in- house shaping tool. The optimization algorithm uses the shaping tool to drive the geometric deformation of a horizontal tail with a parameterization scheme that consists of seven camber design variables and an additional design variable that describes the spanwise location of the midspan section. The demonstration cases show that numerical optimization using the state-of-the-art o -body aerodynamic calculations is not only feasible and repeatable but also allows the exploration of complex design spaces for which a knowledge-based design method becomes less effective.
A new wall function boundary condition including heat release effect for supersonic combustion flows
International Nuclear Information System (INIS)
Gao, Zhen-Xun; Jiang, Chong-Wen; Lee, Chun-Hian
2016-01-01
Highlights: • A new wall function including heat release effect is theoretically derived. • The new wall function is a unified form holding for flows with/without combustion. • The new wall function shows good results for a supersonic combustion case. - Abstract: A new wall function boundary condition considering combustion heat release effect (denoted as CWFBC) is proposed, for efficient predictions of skin friction and heat transfer in supersonic combustion flows. Based on a standard flow model including boundary-layer combustion, the Shvab–Zeldovich coupling parameters are introduced to derive a new velocity law-of-the-wall including the influence of combustion. For the temperature law-of-the-wall, it is proposed to use the enthalpy–velocity relation, instead of the Crocco–Busemann equation, to eliminate explicit influence of chemical reactions. The obtained velocity and temperature law-of-the-walls constitute the CWFBC, which is a unified form simultaneously holding for single-species, multi-species mixing and multi-species reactive flows. The subsequent numerical simulations using this CWFBC on an experimental case indicate that the CWFBC could accurately reflect the influences on the skin friction and heat transfer by the chemical reactions and heat release, and show large improvements compared to previous WFBC. Moreover, the CWFBC can give accurate skin friction and heat flux for a coarse mesh with y"+ up to 200 for the experimental case, except for slightly larger discrepancy of the wall heat flux around ignition position.
Linearised dynamics and non-modal instability analysis of an impinging under-expanded supersonic jet
Karami, Shahram; Stegeman, Paul C.; Theofilis, Vassilis; Schmid, Peter J.; Soria, Julio
2018-04-01
Non-modal instability analysis of the shear layer near the nozzle of a supersonic under-expanded impinging jet is studied. The shear layer instability is considered to be one of the main components of the feedback loop in supersonic jets. The feedback loop is observed in instantaneous visualisations of the density field where it is noted that acoustic waves scattered by the nozzle lip internalise as shear layer instabilities. A modal analysis describes the asymptotic limit of the instability disturbances and fails to capture short-time responses. Therefore, a non-modal analysis which allows the quantitative description of the short-time amplification or decay of a disturbance is performed by means of a local far-field pressure pulse. An impulse response analysis is performed which allows a wide range of frequencies to be excited. The temporal and spatial growths of the disturbances in the shear layer near the nozzle are studied by decomposing the response using dynamic mode decomposition and Hilbert transform analysis. The short-time response shows that disturbances with non-dimensionalised temporal frequencies in the range of 1 to 4 have positive growth rates in the shear layer. The Hilbert transform analysis shows that high non-dimensionalised temporal frequencies (>4) are dampened immediately, whereas low non-dimensionalised temporal frequencies (analysis show that spatial frequencies between 1 and 3 have positive spatial growth rates. Finally, the envelope of the streamwise velocity disturbances reveals the presence of a convective instability.
Effects of streamwise vortex breakdown on supersonic combustion.
Hiejima, Toshihiko
2016-04-01
This paper presents a numerical simulation study of the combustion structure of streamwise vortex breakdown at Mach number 2.48. Hydrogen fuel is injected into a combustor at sonic speed from the rear of a hypermixer strut that can generate streamwise vortices. The results show that the burning behavior is enhanced at the points of the shock waves that are incident on the vortex and therefore the vortex breakdown in the subsonic region occurs due to combustion. The breakdown domain in the mainstream is found to form a flame-holding region suited to combustion and to lead to a stable combustion field with detached flames. In this way, streamwise vortex breakdown has an essential role in combustion enhancement and the formation of flames that hold under supersonic inflow conditions. Finally, the combustion property defined here is shown to coincide with the produced-water mass flow. This property shows that the amount of combustion is saturated at equivalence ratios over 0.4, although there is a slight increase beyond 1.
Experimental observations of a complex, supersonic nozzle concept
Magstadt, Andrew; Berry, Matthew; Glauser, Mark; Ruscher, Christopher; Gogineni, Sivaram; Kiel, Barry; Skytop Turbulence Labs, Syracuse University Team; Spectral Energies, LLC. Team; Air Force Research Laboratory Team
2015-11-01
A complex nozzle concept, which fuses multiple canonical flows together, has been experimentally investigated via pressure, schlieren and PIV in the anechoic chamber at Syracuse University. Motivated by future engine designs of high-performance aircraft, the rectangular, supersonic jet under investigation has a single plane of symmetry, an additional shear layer (referred to as a wall jet) and an aft deck representative of airframe integration. Operating near a Reynolds number of 3 ×106 , the nozzle architecture creates an intricate flow field comprised of high turbulence levels, shocks, shear & boundary layers, and powerful corner vortices. Current data suggest that the wall jet, which is an order of magnitude less energetic than the core, has significant control authority over the acoustic power through some non-linear process. As sound is a direct product of turbulence, experimental and analytical efforts further explore this interesting phenomenon associated with the turbulent flow. The authors acknowledge the funding source, a SBIR Phase II project with Spectral Energies, LLC. and AFRL turbine engine branch under the direction of Dr. Barry Kiel.
Robust optimization of supersonic ORC nozzle guide vanes
Bufi, Elio A.; Cinnella, Paola
2017-03-01
An efficient Robust Optimization (RO) strategy is developed for the design of 2D supersonic Organic Rankine Cycle turbine expanders. The dense gas effects are not-negligible for this application and they are taken into account describing the thermodynamics by means of the Peng-Robinson-Stryjek-Vera equation of state. The design methodology combines an Uncertainty Quantification (UQ) loop based on a Bayesian kriging model of the system response to the uncertain parameters, used to approximate statistics (mean and variance) of the uncertain system output, a CFD solver, and a multi-objective non-dominated sorting algorithm (NSGA), also based on a Kriging surrogate of the multi-objective fitness function, along with an adaptive infill strategy for surrogate enrichment at each generation of the NSGA. The objective functions are the average and variance of the isentropic efficiency. The blade shape is parametrized by means of a Free Form Deformation (FFD) approach. The robust optimal blades are compared to the baseline design (based on the Method of Characteristics) and to a blade obtained by means of a deterministic CFD-based optimization.
2009-04-01
GAMING PLATFORM (DGP) Lockheed Martin Corporation...YYYY) APR 09 2. REPORT TYPE Final 3. DATES COVERED (From - To) Jul 07 – Mar 09 4. TITLE AND SUBTITLE DYNAMIC GAMING PLATFORM (DGP) 5a...CMU Carnegie Mellon University DGP Dynamic Gaming Platform GA Genetic Algorithm IARPA Intelligence Advanced Research Projects Activity LM ATL Lockheed Martin Advanced Technology Laboratories PAINT ProActive INTelligence
Energy Technology Data Exchange (ETDEWEB)
Shimada, T.; Tamura, N.; Sekino, N.; Tsujimura, N. (Nissan Motor Co. Ltd., Tokyo (Japan))
1992-06-25
By applying computational fluid dynamics (CFD) to a flow in the supersonic air intake of rocket, appropriateness of computational result was confirmed from a comparison with the wind tunnel test result. In order for the air intake type rocket to heighten the combustion efficiency of fuel and air, it is important to possibly minimize the total pressure loss of air which has been taken in and maintain the air flow rate. A numerical analysis was made through modeling the sectional shape of wind tunnel test body and analyzing the two-dimensional flow by Reynolds-averaged Navier-Stokes equations. The computational result of analysis coincided well with the pressure measurement result in wind tunnel test. Having elucidated the main factors of total pressure loss in a two-dimensionally curved flow passage, the CFD computation gave a possibility that the total pressure loss is considerably low against that passage if improved in shape. If simultaneously used with a characteristic curve method, the CFD computation made it possible to optimize the pressure recovery characteristics in the axially symmetric air intake. The CFD can be expected to be an effective method of designing the basic shape of supersonic air intake. 9 refs., 14 figs.
Nieuwenhuis, Lambertus Johannes Maria; van Halteren, Aart
1999-01-01
This paper presents the results of the EURESCOM Project 715. In February 1999, a large team of researchers from six European public network operators completed a two year period of cooperative experiments on a TINA-based environment, called the EURESCOM Services Platform (ESP). This platform
Numerical simulation of supersonic over/under expanded jets using adaptive grid
International Nuclear Information System (INIS)
Talebi, S.; Shirani, E.
2001-05-01
Numerical simulation of supersonic under and over expanded jet was simulated. In order to achieve the solution efficiently and with high resolution, adaptive grid is used. The axisymmetric compressible, time dependent Navier-Stokes equations in body fitted curvilinear coordinate were solved numerically. The equations were discretized by using control volume, and the Van Leer flux splitting approach. The equations were solved implicitly. The obtained computer code was used to simulate four different cases of moderate and strong under and over expanded jet flows. The results show that with the adaptation of the grid, the various features of this complicated flow can be observed. It was shown that the adaptation method is very efficient and has the ability to make fine grids near the high gradient regions. (author)
Morgenstern, John; Buonanno, Michael; Yao, Jixian; Murugappan, Mugam; Paliath, Umesh; Cheung, Lawrence; Malcevic, Ivan; Ramakrishnan, Kishore; Pastouchenko, Nikolai; Wood, Trevor;
2015-01-01
Lockheed Martin Aeronautics Company (LM), working in conjunction with General Electric Global Research (GE GR) and Stanford University, executed a 19 month program responsive to the NASA sponsored "N+2 Supersonic Validation: Advanced Concept Studies for Supersonic Commercial Transports Entering Service in the 2018-2020 Period" contract. The key technical objective of this effort was to validate integrated airframe and propulsion technologies and design methodologies necessary to realize a supersonic vehicle capable of meeting the N+2 environmental and performance goals. The N+2 program is aligned with NASA's Supersonic Project and is focused on providing system level solutions capable of overcoming the efficiency, environmental, and performance barriers to practical supersonic flight. The N+2 environmental and performance goals are outlined in the technical paper, AIAA-2014-2138 (Ref. 1) along with the validated N+2 Phase 2 results. Our Phase 2 efforts built upon our Phase 1 studies (Ref. 2) and successfully demonstrated the ability to design and test realistic configurations capable of shaped sonic booms over the width of the sonic boom carpet. Developing a shaped boom configuration capable of meeting the N+2 shaped boom targets is a key goal for the N+2 program. During the LM Phase 1 effort, LM successfully designed and tested a shaped boom trijet configuration (1021) capable of achieving 85 PLdB under track (forward and aft shock) and up to 28 deg off-track at Mach 1.6. In Phase 2 we developed a refined configuration (1044-2) that extended the under 85 PLdB sonic boom level over the entire carpet of 52 deg off-track at a cruise Mach number of 1.7. Further, the loudness level of the configuration throughout operational conditions calculates to an average of 79 PLdB. These calculations rely on propagation employing Burger's (sBOOM) rounding methodology, and there are indications that the configuration average loudness would actually be 75 PLdB. We also added
Towards a Disruptive Digital Platform Model
DEFF Research Database (Denmark)
Kazan, Erol
that digital platforms leverage on three strategic design elements (i.e., business, architecture, and technology design) to create supportive conditions for facilitating disruption. To shed light on disruptive digital platforms, I opted for payment platforms as my empirical context and unit of analysis......Digital platforms are layered modular information technology architectures that support disruption. Digital platforms are particularly disruptive, as they facilitate the quick release of digital innovations that may replace established innovations. Yet, despite their support for disruption, we have...... not fully understood how such digital platforms can be strategically designed and configured to facilitate disruption. To that end, this thesis endeavors to unravel disruptive digital platforms from the supply perspective that are grounded on strategic digital platform design elements. I suggest...
Groundwater Assessment Platform
Podgorski, Joel; Berg, Michael
2018-01-01
The Groundwater Assessment Platform is a free, interactive online GIS platform for the mapping, sharing and statistical modeling of groundwater quality data. The modeling allows users to take advantage of publicly available global datasets of various environmental parameters to produce prediction maps of their contaminant of interest.
Preparing for a Product Platform
DEFF Research Database (Denmark)
Fiil-Nielsen, Ole; Munk, Lone; Mortensen, Niels Henrik
2005-01-01
on commonalities and similarities in the product family, and variance should be based on customer demands. To relate these terms and to improve the basis on which decisions are made, we need a way of visualizing the hierarchy of the product family as well as the commonality and variance. This visualization method...... of the platform or ensuring that the platform can meet future demands will be very useful in the preparation process of a platform synthesis as well as in the updating or reengineering of an existing product development platform.......Experience in the industry as well as recent related scientific publications show the benefits of product development platforms. Companies use platforms to develop not a single but multiple products (i.e. a product family) simultaneously. When these product development projects are coordinated...
Overexpanded viscous supersonic jet interacting with a unilateral barrier
Dobrynin, B. M.; Maslennikov, V. G.; Sakharov, V. A.; Serova, E. V.
1986-07-01
The interaction of a two-dimensional supersonic jet with a unilateral barrier parallel to the flow symmetry plane was studied to account for effects due to gas viscosity and backgound-gas ejection from the region into which the jet expands. In the present experiments, the incident shock wave was reflected at the end of a shock tube equipped with a nozzle. The jet emerged into a pressure chamber 6 cu m in volume and the environmental pressure ratio of the flow in the quasi-stationary phase remained constant. The light source was an OGM-20 laser operating in the giant-pulse mode. Due to background-gas ejection, the gas density in the vicinity of the barrier is much less than on the unconfined side of the jet. The resulting flow is characterized by two distinct environmental pressure ratios: the flow is underexpanded near the barrier, while on the other side it is overexpanded.
Supersonic jets of hydrogen and helium for laser wakefield acceleration
Svensson, K.; Wojda, F.; Senje, L.; Burza, M.; Aurand, B.; Genoud, G.; Persson, A.; Wahlström, C.-G.; Lundh, O.
2016-01-01
The properties of laser wakefield accelerated electrons in supersonic gas flows of hydrogen and helium are investigated. At identical backing pressure, we find that electron beams emerging from helium show large variations in their spectral and spatial distributions, whereas electron beams accelerated in hydrogen plasmas show a higher degree of reproducibility. In an experimental investigation of the relation between neutral gas density and backing pressure, it is found that the resulting number density for helium is ∼30% higher than for hydrogen at the same backing pressure. The observed differences in electron beam properties between the two gases can thus be explained by differences in plasma electron density. This interpretation is verified by repeating the laser wakefield acceleration experiment using similar plasma electron densities for the two gases, which then yielded electron beams with similar properties.
Multi-chord fiber-coupled interferometry of supersonic plasma jets (invited)
International Nuclear Information System (INIS)
Merritt, Elizabeth C.; Lynn, Alan G.; Gilmore, Mark A.; Thoma, Carsten; Loverich, John; Hsu, Scott C.
2012-01-01
A multi-chord fiber-coupled interferometer is being used to make time-resolved density measurements of supersonic argon plasma jets on the Plasma Liner Experiment. The long coherence length of the laser (>10 m) allows signal and reference path lengths to be mismatched by many meters without signal degradation, making for a greatly simplified optical layout. Measured interferometry phase shifts are consistent with a partially ionized plasma in which both positive and negative phase shift values are observed depending on the ionization fraction. In this case, both free electrons and bound electrons in ions and neutral atoms contribute to the index of refraction. This paper illustrates how the interferometry data, aided by numerical modeling, are used to derive total jet density, jet propagation velocity (∼15–50 km/s), jet length (∼20–100 cm), and 3D expansion.
Error analysis of supersonic air-to-air ejector schlieren pictures
Directory of Open Access Journals (Sweden)
Kolář J.
2013-04-01
Full Text Available The scope of this article is focused on general analysis of errors and uncertainties possibly arising from CFD-to-schlieren pictures matching. Analysis is based on classic analytical equations. These are firstly evaluated with the presumption of constant density gradient along the ray course. In other words, the deflection of light-ray caused by density gradient is negligible in compare to the cross size of constant gradient area. It is the aim of this work to determine, whether this presumption is applicable in case of supersonic air-to-air ejector. The colour and black and white schlieren pictures are carried out and compared to CFD results. Simulations had covered various eddy viscosities. Computed pressure gradients are transformed into deflection angles and further to ray displacement. Resulting computed light- ray deflection is matched to experimental results
Supersonic jets of hydrogen and helium for laser wakefield acceleration
Directory of Open Access Journals (Sweden)
K. Svensson
2016-05-01
Full Text Available The properties of laser wakefield accelerated electrons in supersonic gas flows of hydrogen and helium are investigated. At identical backing pressure, we find that electron beams emerging from helium show large variations in their spectral and spatial distributions, whereas electron beams accelerated in hydrogen plasmas show a higher degree of reproducibility. In an experimental investigation of the relation between neutral gas density and backing pressure, it is found that the resulting number density for helium is ∼30% higher than for hydrogen at the same backing pressure. The observed differences in electron beam properties between the two gases can thus be explained by differences in plasma electron density. This interpretation is verified by repeating the laser wakefield acceleration experiment using similar plasma electron densities for the two gases, which then yielded electron beams with similar properties.
Sakata, I. F.; Davis, G. W.
1975-01-01
The materials and advanced producibility methods that offer potential structural mass savings in the design of the primary structure for a supersonic cruise aircraft are identified and reported. A summary of the materials and fabrication techniques selected for this analytical effort is presented. Both metallic and composite material systems were selected for application to a near-term start-of-design technology aircraft. Selective reinforcement of the basic metallic structure was considered as the appropriate level of composite application for the near-term design.
Research on the penetration characteristic of supersonic molecule beam on the HL-1M tokamak
International Nuclear Information System (INIS)
Dong Jiafu; Luo Junling; Tang Nianyi; Li Wei; Zhong Yunze; Liu Yi; Fu Binzhong; Yao Lianghua; Feng Baibing; Qin Yunwen
2002-01-01
In the HL-1M plasma experiments, two refueling ways, the pellet injection and the gas puffing, are usually used. In recent years, a new refueling method, the supersonic molecular beam (SMB) injection, has been developed. In this paper, the penetration characteristics of SMB has been analyzed and researched. The SMB experiments were analyzed with H α emissivity measurement. The H α emissivity distribution in the plasma was calculated from multi-channel chord emission singles by means of the asymmetry Abel inversion method
The Logic of Digital Platform Disruption
DEFF Research Database (Denmark)
Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.
Digital platforms are disruptive IT artifacts, because they facilitate the quick release of innovative platform derivatives from third parties (e.g., apps). This study endeavours to unravel the disruptive potential, caused by distinct designs and configurations of digital platforms on market...... environments. We postulate that the disruptive potential of digital platforms is determined by the degree of alignment among the business, technology and platform profiles. Furthermore, we argue that the design and configuration of the aforementioned three elements dictates the extent to which open innovation...... is permitted. To shed light on the disruptive potential of digital platforms, we opted for payment platforms as our unit of analysis. Through interviews with experts and payment providers, we seek to gain an in-depth appreciation of how contemporary digital payment platforms are designed and configured...
Beijerinck, H.C.W.; van Gerwen, R.J.F.; Kerstel, E.R.T.; Martens, J.F.M.; van Vliembergen, E.J.W.; Smits, M.R.T.; Kaashoek, G.H.
1985-01-01
The process of beam formation in a supersonic expansion into a high pressure (10-2 -1 Torr) expansion chamber, a so-called Campargue-type beam source, has been investigated, using the theoretical frame work of an ideal undisturbed expansion as a reference. Absolute values of the centre-line
Flexible, ionic liquid-based micro-supercapacitor produced by supersonic cluster beam deposition
International Nuclear Information System (INIS)
Bettini, L.G.; Piseri, P.; De Giorgio, F.; Arbizzani, C.; Milani, P.; Soavi, F.
2015-01-01
Highlights: • We exploited Supersonic Cluster Beam Deposition for the fabrication of a flexible, planar micro-supercapacitor featuring nanostructured carbon electrodes deposited on a plastic Mylar substrate and N-trimethyl-N-propyl-ammonium bis(trifluoromethanesulfonyl) imide (N 1113 TFSI) ionic liquid electrolyte. • The micro-supercapacitor operates at 3 V above RT up to 80 °C with a capacitance density approaching 10 F cm −3 and delivering maximum specific energy and power densities of 10 mWh cm −3 and 8-10 W cm −3 . • The micro-supercapacitor features long cycling stability over 2x10 4 cycle on flat and bent configuration. -- Graphical abstract: Display Omitted -- Abstract: Power generation and storage in electronics require flexible, thin micro-electrochemical energy storage/conversion systems. Micro-supercapacitors (μSCs) with double-layer capacitance carbon electrodes are attracting much attention for their capability of delivering short power pulses with high stability over repeated charge/discharge cycling. Supersonic Cluster Beam Deposition (SCBD) is an effective strategy for the development of nanostructured, binder-free porous carbon electrodes on temperature sensitive substrates including polymers. We exploited SCBD for the development of a flexible, planar μSC featuring nanostructured carbon (ns-C) electrodes deposited on a plastic Mylar substrate and N-trimethyl-N-propyl-ammonium bis(trifluoromethanesulfonyl) imide (N 1113 TFSI) ionic liquid electrolyte. The electrochemical performance at different temperatures of the μSC which operates at 3 V above RT up to 80 °C with a capacitance density approaching 10 F cm −3 and delivering maximum specific energy and power densities of 10 mWh cm −3 and 8-10 W cm −3 with long cycling stability over 2 × 10 4 cycles is here reported and discussed
Transactional Network Platform: Applications
Energy Technology Data Exchange (ETDEWEB)
Katipamula, Srinivas; Lutes, Robert G.; Ngo, Hung; Underhill, Ronald M.
2013-10-31
In FY13, Pacific Northwest National Laboratory (PNNL) with funding from the Department of Energy’s (DOE’s) Building Technologies Office (BTO) designed, prototyped and tested a transactional network platform to support energy, operational and financial transactions between any networked entities (equipment, organizations, buildings, grid, etc.). Initially, in FY13, the concept demonstrated transactions between packaged rooftop air conditioners and heat pump units (RTUs) and the electric grid using applications or "agents" that reside on the platform, on the equipment, on a local building controller or in the Cloud. The transactional network project is a multi-lab effort with Oakridge National Laboratory (ORNL) and Lawrence Berkeley National Laboratory (LBNL) also contributing to the effort. PNNL coordinated the project and also was responsible for the development of the transactional network (TN) platform and three different applications associated with RTUs. This document describes two applications or "agents" in details, and also summarizes the platform. The TN platform details are described in another companion document.
Vertical Relationships within Platform Marketplaces
Directory of Open Access Journals (Sweden)
Mark J. Tremblay
2016-07-01
Full Text Available In two-sided markets a platform allows consumers and sellers to interact by creating sub-markets within the platform marketplace. For example, Amazon has sub-markets for all of the different product categories available on its site, and smartphones have sub-markets for different types of applications (gaming apps, weather apps, map apps, ridesharing apps, etc.. The network benefits between consumers and sellers depend on the mode of competition within the sub-markets: more competition between sellers lowers product prices, increases the surplus consumers receive from a sub-market, and makes platform membership more desirable for consumers. However, more competition also lowers profits for a seller which makes platform membership less desirable for a seller and reduces seller entry and the number of sub-markets available on the platform marketplace. This dynamic between seller competition within a sub-market and agents’ network benefits leads to platform pricing strategies, participation decisions by consumers and sellers, and welfare results that depend on the mode of competition. Thus, the sub-market structure is important when investigating platform marketplaces.
McNab, A.
2017-10-01
This paper describes GridPP’s Vacuum Platform for managing virtual machines (VMs), which has been used to run production workloads for WLCG and other HEP experiments. The platform provides a uniform interface between VMs and the sites they run at, whether the site is organised as an Infrastructure-as-a-Service cloud system such as OpenStack, or an Infrastructure-as-a-Client system such as Vac. The paper describes our experience in using this platform, in developing and operating VM lifecycle managers Vac and Vcycle, and in interacting with VMs provided by LHCb, ATLAS, ALICE, CMS, and the GridPP DIRAC service to run production workloads.
International Nuclear Information System (INIS)
Memon, A.D.
1994-01-01
There is a remarkable tectonic resemblance between the indian Platform (Pakistan) and the Moesian Platform (Romania). As viewed in global tectonic perspective Moeslan and Indian Plates have played important role in Alpine Himalayan Orogeny; Moesian and Indian Platforms are extension of these respective plates. Characteristics features of both the platforms are block faulting which has effected not only the general tectonic framework but has also played important role in oil accumulation. Main producing rocks in the Moesian platform are Jurassic sandstones and cretaceous limestones while in the indian platform cretaceous sandstones are important reservoirs. The average geothermal gradient in the indian platform is 2.45 C/100m with the higher gradients in the central gas producing region. Geothermal gradients in the Moesian platform have an average value of 3 C/100m with higher gradients in the northern in the northern part. Some of the producing structures in both the platforms are remarkably similar, traps associated with normal faults are very important. Extensive exploration carried in the Moesian Platform makes it very important oil producing region of Romania. After the discovery of oil lower Sindh, serious exploration is being carried in the Indian platform. The paper deals with the similarities between these two important platforms. In the light of the studies of the Moesian platform, strategies or exploration of oil and gas in the Indian Platform are suggested. (author)
Utilizing platforms in industrialized construction
DEFF Research Database (Denmark)
Bonev, Martin; Wörösch, Michael; Hvam, Lars
2015-01-01
platform strategies, this researchhighlights key aspects of adapting platform-based developed theory to industrialised construction.Building projects use different layers of product, process and logistics platforms to form the right cost– value ratio for the target market application, while modelling...
Stratospheric Platforms for Monitoring Purposes
International Nuclear Information System (INIS)
Konigorski, D.; Gratzel, U.; Obersteiner, M.; Schneidereit, M.
2010-01-01
Stratospheric platforms are emerging systems based on challenging technology. Goal is to create a platform, payload, and mission design which is able to complement satellite services on a local scale. Applications are close to traditional satellite business in telecommunication, navigation, science, and earth observation and include for example mobile telecommunications, navigation augmentation, atmospheric research, or border control. Stratospheric platforms could potentially support monitoring activities related to safeguards, e.g. by imagery of surfaces, operational conditions of nuclear facilities, and search for undeclared nuclear activities. Stratospheric platforms are intended to be flown in an altitude band between 16 and 30 km, above 16-20 km to take advantage of usually lower winds facilitating station keeping, below 30 km to limit the challenges to achieve a reasonable payload at acceptable platform sizes. Stratospheric platforms could substitute satellites which are expensive and lack upgrade capabilities for new equipment. Furthermore they have practically an unlimited time over an area of interest. It is intended to keep the platforms operational and maintenance free on a 24/7 basis with an average deployment time of 3 years. Geostationary satellites lack resolution. Potential customers like Armed Forces, National Agencies and commercial customers have indicated interest in the use of stratospheric platforms. Governmental entities are looking for cheaper alternatives to communications and surveillance satellites and stratospheric platforms could offer the following potential advantages: Lower operational cost than satellite or UAV (Unmanned Aerial Vehicles) constellation (fleet required); Faster deployment than satellite constellation; Repositioning capability and ability to loiter as required; Persistent long-term real-time services over a fairly large regional spot; Surge capability: Able to extend capability (either monitoring or communications
Supersonics/Airport Noise Plan: An Evolutionary Roadmap
Bridges, James
2011-01-01
This presentation discusses the Plan for the Airport Noise Tech Challenge Area of the Supersonics Project. It is given in the context of strategic planning exercises being done in other Projects to show the strategic aspects of the Airport Noise plan rather than detailed task lists. The essence of this strategic view is the decomposition of the research plan by Concept and by Tools. Tools (computational, experimental) is the description of the plan that resources (such as researchers) most readily identify with, while Concepts (here noise reduction technologies or aircraft configurations) is the aspects that project management and outside reviewers most appreciate as deliverables and milestones. By carefully cross-linking these so that Concepts are addressed sequentially (roughly one after another) by researchers developing/applying their Tools simultaneously (in parallel with one another), the researchers can deliver milestones at a reasonable pace while doing the longer-term development that most Tools in the aeroacoustics science require. An example of this simultaneous application of tools was given for the Concept of High Aspect Ratio Nozzles. The presentation concluded with a few ideas on how this strategic view could be applied to the Subsonic Fixed Wing Project's Quiet Aircraft Tech Challenge Area as it works through its current roadmapping exercise.
Adoption of Mobile Payment Platforms
DEFF Research Database (Denmark)
Staykova, Kalina Stefanova; Damsgaard, Jan
2016-01-01
Numerous mobile payment solutions, which rely on new disruptive technologies, have been launched on the payment market in recent years. But despite the growing number of mobile payment apps, very few solutions have turned to be successful as the majority of them fail to gain a critical mass...... of users. In this paper, we investigate successful platform adoption strategies by using the Reach and Range Framework for Multi-Sided Platforms as a strategic tool to which mobile payment providers can adhere in order to tackle some of the main challenges they face throughout the evolution...... of their platforms. The analysis indicates that successful mobile payment solutions tend to be launched as one-sided platforms and then gradually be expanded into being two-sided. Our study showcases that the success of mobile payment platforms lies with the ability of the platform to balance the reach (number...
The Dynamics of Digital Platform Innovation
DEFF Research Database (Denmark)
Eaton, Ben
2016-01-01
Curated platforms provide an architectural basis for third parties to develop platform complements and for platform owners to control their implementation as a form of open innovation. The refusal to implement complements as innovations can cause tension between platform owners and developers. Th...
Cross-platform learning: on the nature of children's learning from multiple media platforms.
Fisch, Shalom M
2013-01-01
It is increasingly common for an educational media project to span several media platforms (e.g., TV, Web, hands-on materials), assuming that the benefits of learning from multiple media extend beyond those gained from one medium alone. Yet research typically has investigated learning from a single medium in isolation. This paper reviews several recent studies to explore cross-platform learning (i.e., learning from combined use of multiple media platforms) and how such learning compares to learning from one medium. The paper discusses unique benefits of cross-platform learning, a theoretical mechanism to explain how these benefits might arise, and questions for future research in this emerging field. Copyright © 2013 Wiley Periodicals, Inc., A Wiley Company.
Liu, Yu; Liu, Jingfei; Fite, Brett Z.; Foiret, Josquin; Ilovitsh, Asaf; Leach, J. Kent; Dumont, Erik; Caskey, Charles F.; Ferrara, Katherine W.
2017-05-01
Non-invasive, quantitative methods to assess the properties of biological tissues are needed for many therapeutic and tissue engineering applications. Magnetic resonance elastography (MRE) has historically relied on external vibration to generate periodic shear waves. In order to focally assess a biomaterial or to monitor the response to ablative therapy, the interrogation of a specific region of interest by a focused beam is desirable and transient MRE (t-MRE) techniques have previously been developed to accomplish this goal. Also, strategies employing a series of discrete ultrasound pulses directed to increasing depths along a single line-of-sight have been designed to generate a quasi-planar shear wave. Such ‘supersonic’ excitations have been applied for ultrasound elasticity measurements. The resulting shear wave is higher in amplitude than that generated from a single excitation and the properties of the media are simply visualized and quantified due to the quasi-planar wave geometry and the opportunity to generate the wave at the site of interest. Here for the first time, we extend the application of supersonic methods by developing a protocol for supersonic transient magnetic resonance elastography (sst-MRE) using an MR-guided focused ultrasound system capable of therapeutic ablation. We apply the new protocol to quantify tissue elasticity in vitro using biologically-relevant inclusions and tissue-mimicking phantoms, compare the results with elasticity maps acquired with ultrasound shear wave elasticity imaging (US-SWEI), and validate both methods with mechanical testing. We found that a modified time-of-flight (TOF) method efficiently quantified shear modulus from sst-MRE data, and both the TOF and local inversion methods result in similar maps based on US-SWEI. With a three-pulse excitation, the proposed sst-MRE protocol was capable of visualizing quasi-planar shear waves propagating away from the excitation location and detecting differences in shear
Numerical Experiments of Counterflowiing Jet Effects on Supersonic Slender-Body Configurations
Venkatachari, Balaji Shankar; Mullane, Michael; Cheng, Gary C.; Chang, Chau-Lyan
2015-01-01
Previous studies have demonstrated that the use of counterflowing jets can greatly reduce the drag and heat loads on blunt-body geometries, especially when the long penetration mode jet condition can be established. Previously, the authors had done some preliminary numerical studies to determine the ability to establish long penetration mode jets on a typical Mach 1.6 slender configuration, and study its impact on the boom signature. The results indicated that a jet with a longer penetration length was required to achieve any impact on the boom signature of a typical Mach 1.6 slender configuration. This paper focuses on an in-depth parametric study, done using the space-time conservation element solution element Navier-Stokes flow solver, for investigating the effect of various counterflowing jet conditions/configurations on two supersonic slender-body models (cone-cylinder and quartic body of revolution). The study is aimed at gaining a better understanding of the relationship between the shock penetration length and reduction of drag and boom signature for these two supersonic slender-body configurations. Different jet flow rates, Mach numbers, nozzle jet exit diameters and jet-to-base diameter ratios were examined. The results show the characteristics of a short-to-long-to-short penetration-mode pattern with the increase of jet mass flow rates, observed across various counterflowing jet nozzle configurations. Though the optimal shock penetration length for potential boom-signature mitigation is tied to the long penetration mode, it often results in a very unsteady flow and leads to large oscillations of surface pressure and drag. Furthermore, depending on the geometry of the slender body, longer jet penetration did not always result in maximum drag reduction. For the quartic geometry, the maximum drag reduction corresponds well to the longest shock penetration length, while this was not the case for the cone-cylinder-as the geometry was already optimized for
Laosunthara, Ampan; Akatsuka, Hiroshi
2016-09-01
In previous study, we experimentally examined physical properties of supersonic flow of weakly ionized expanding arc-jet plasma through an open magnetic field line (Bmax 0.16T). We found supersonic velocity of helium plasma up to Mach 3 and the space potential drop at the end of the magnets. To understand the plasma in numerical point of view, the flows of ion and neutral are treated by particle-based Direct Simulation Monte Carlo (DSMC) method, electron is treated as a fluid. The previous numerical study, we assumed 2 conditions. Ion and electron temperatures were the same (LTE condition). Ion and electron velocities were the same (current-free condition). We found that ion velocity decreased by collision with residual gas molecules (background pressure). We also found that space potential changing with background pressure. In other words, it was indicated that electric field exists and the current-free assumption is not proper. In this study, we add electron continuity and electron momentum equations to obtain electron velocity and space potential. We find that space potential changing with background pressure slightly. It is indicated that electron is essential to space potential formation than ion.
The European Photovoltaic Technology Platform
International Nuclear Information System (INIS)
Nowak, S.; Aulich, H.; Bal, J.L.; Dimmler, B.; Garnier, A.; Jongerden, G.; Luther, J.; Luque, A.; Milner, A.; Nelson, D.; Pataki, I.; Pearsall, N.; Perezagua, E.; Pietruszko, S.; Rehak, J.; Schellekens, E.; Shanker, A.; Silvestrini, G.; Sinke, W.; Willemsen, H.
2006-05-01
The European Photovoltaic Technology Platform is one of the European Technology Platforms, a new instrument proposed by the European Commission. European Technology Platforms (ETPs) are a mechanism to bring together all interested stakeholders to develop a long-term vision to address a specific challenge, create a coherent, dynamic strategy to achieve that vision and steer the implementation of an action plan to deliver agreed programmes of activities and optimise the benefits for all parties. The European Photovoltaic Technology Platform has recently been established to define, support and accompany the implementation of a coherent and comprehensive strategic plan for photovoltaics. The platform will mobilise all stakeholders sharing a long-term European vision for PV, helping to ensure that Europe maintains and improves its industrial position. The platform will realise a European Strategic Research Agenda for PV for the next decade(s). Guided by a Steering Committee of 20 high level decision-makers representing all relevant European PV Stakeholders, the European PV Technology Platform comprises 4 Working Groups dealing with the subjects policy and instruments; market deployment; science, technology and applications as well as developing countries and is supported by a secretariat
Directory of Open Access Journals (Sweden)
Eisner Salamanca
2017-01-01
Full Text Available The benefits and feasibility of platform switching have been discussed in several studies, reporting lesser crestal bone loss in platform-switched implants than in platform-matched implants. Objective. The aim of the present study was to observe the changes in vertical and horizontal marginal bone levels in platform-switched and platform-matched dental implants. Materials and Methods. 51 patients received 60 dental implants in the present study over a 1-year period. Measurement was performed between the implant shoulder and the most apical and horizontal marginal defect by periapical radiographs to examine the changes of peri-implant alveolar bone before and 12 months after prosthodontic restoration delivery. Results. These marginal bone measurements showed a bone gain of 0.23±0.58 mm in the vertical gap and 0.22±0.53 mm in the horizontal gap of platform matching, while in platform switching a bone gain of 0.93±1 mm (P<0.05 in the vertical gap and 0.50±0.56 mm in the horizontal gap was found. The average vertical gap reduction from the baseline until 12 months was 0.92±1.11 mm in platform switching and 0.29±0.85 mm in platform matching (P<0.05. Conclusions. Within the limitations of the present study, platform switching seemed to be more effective for a better peri-implant alveolar bone vertical and horizontal gap reduction at 1 year.
The Educational Platform: Constructing Conceptual Frameworks.
Peca, Kathy; Isham, Mark
2001-01-01
The education faculty at Eastern New Mexico University used educational platforms as a means of developing the unit's conceptual framework. Faculty members developed personal platforms, then synthesized them into one curricular area platform. The resultant unit educational platform became the basis for the unit's conceptual framework, which…
Insulation systems for liquid methane fuel tanks for supersonic cruise aircraft
Brady, H. F.; Delduca, D.
1972-01-01
Two insulation systems for tanks containing liquid methane in supersonic cruise-type aircraft were designed and tested after an extensive materials investigation. One system is an external insulation and the other is an internal wet-type insulation system. Tank volume was maximized by making the tank shape approach a rectangular parallelopiped. One tank was designed to use the external insulation and the other tank to use the internal insulation. Performance of the external insulation system was evaluated on a full-scale tank under the temperature environment of -320 F to 700 F and ambient pressures of ground-level atmospheric to 1 psia. Problems with installing the internal insulation on the test tank prevented full-scale evaluation of performance; however, small-scale testing verified thermal conductivity, temperature capability, and installed density.
CFD modeling of condensation process of water vapor in supersonic flows
DEFF Research Database (Denmark)
Yang, Yan; Walther, Jens Honore; Yan, Yuying
2017-01-01
The condensation phenomenon of vapor plays an important role in various industries, such as the steam flow in turbines and refrigeration system. A mathematical model is developed to predict the spontaneous condensing phenomenon in the supersonic flows using the nucleation and droplet growth...... theories. The numerical approach is validated with the experimental data, which shows a good agreement between them. The condensation characteristics of water vapor in the Laval nozzle are described in detail. The results show that the condensation process is a rapid variation of the vapor-liquid phase...... change both in the space and in time. The spontaneous condensation of water vapor will not appear immediately when the steam reaches the saturation state. Instead, it occurs further downstream the nozzle throat, where the steam is in the state of supersaturation....
Energy Technology Data Exchange (ETDEWEB)
Merritt, Elizabeth C., E-mail: emerritt@lanl.gov; Adams, Colin S. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); University of New Mexico, Albuquerque, New Mexico 87131 (United States); Moser, Auna L.; Hsu, Scott C., E-mail: scotthsu@lanl.gov; Dunn, John P.; Miguel Holgado, A. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Gilmore, Mark A. [University of New Mexico, Albuquerque, New Mexico 87131 (United States)
2014-05-15
We report spatially resolved measurements of the oblique merging of two supersonic laboratory plasma jets. The jets are formed and launched by pulsed-power-driven railguns using injected argon, and have electron density ∼10{sup 14} cm{sup −3}, electron temperature ≈1.4 eV, ionization fraction near unity, and velocity ≈40 km/s just prior to merging. The jet merging produces a few-cm-thick stagnation layer, as observed in both fast-framing camera images and multi-chord interferometer data, consistent with collisional shock formation [E. C. Merritt et al., Phys. Rev. Lett. 111, 085003 (2013)].
Busa, K. M.; McDaniel J. C.; Diskin, G. S.; DePiro, M. J.; Capriotti, D. P.; Gaffney, R. L.
2012-01-01
Detailed knowledge of the internal structure of high-enthalpy flows can provide valuable insight to the performance of scramjet combustors. Tunable Diode Laser Absorption Spectroscopy (TDLAS) is often employed to measure temperature and species concentration. However, TDLAS is a path-integrated line-of-sight (LOS) measurement, and thus does not produce spatially resolved distributions. Tunable Diode Laser Absorption Tomography (TDLAT) is a non-intrusive measurement technique for determining two-dimensional spatially resolved distributions of temperature and species concentration in high enthalpy flows. TDLAT combines TDLAS with tomographic image reconstruction. More than 2500 separate line-of-sight TDLAS measurements are analyzed in order to produce highly resolved temperature and species concentration distributions. Measurements have been collected at the University of Virginia's Supersonic Combustion Facility (UVaSCF) as well as at the NASA Langley Direct-Connect Supersonic Combustion Test Facility (DCSCTF). Due to the UVaSCF s unique electrical heating and ability for vitiate addition, measurements collected at the UVaSCF are presented as a calibration of the technique. Measurements collected at the DCSCTF required significant modifications to system hardware and software designs due to its larger measurement area and shorter test duration. Tomographic temperature and water vapor concentration distributions are presented from experimentation on the UVaSCF operating at a high temperature non-reacting case for water vitiation level of 12%. Initial LOS measurements from the NASA Langley DCSCTF operating at an equivalence ratio of 0.5 are also presented. Results show the capability of TDLAT to adapt to several experimental setups and test parameters.
Lifescience Database Archive (English)
Full Text Available savirus (isolate Bat/AUS/1996) GN=L PE=3 SV=2 Length = 2...HS N+ IT + K Sbjct: 81 RTEPINIYGPPEIKNTIENILKIGYHSINFKITVHEINSK 120 >sp|Q9QSP0|L_ABLVB Large structural protein OS=Australian bat lys
National Community Solar Platform
Energy Technology Data Exchange (ETDEWEB)
Rupert, Bart [Clean Energy Collective, Louisville, CO (United States)
2016-06-30
This project was created to provide a National Community Solar Platform (NCSP) portal known as Community Solar Hub, that is available to any entity or individual who wants to develop community solar. This has been done by providing a comprehensive portal to make CEC’s solutions, and other proven community solar solutions, externally available for everyone to access – making the process easy through proven platforms to protect subscribers, developers and utilities. The successful completion of this project provides these tools via a web platform and integration APIs, a wide spectrum of community solar projects included in the platform, multiple groups of customers (utilities, EPCs, and advocates) using the platform to develop community solar, and open access to anyone interested in community solar. CEC’s Incubator project includes web-based informational resources, integrated systems for project information and billing systems, and engagement with customers and users by community solar experts. The combined effort externalizes much of Clean Energy Collective’s industry-leading expertise, allowing third parties to develop community solar without duplicating expensive start-up efforts. The availability of this platform creates community solar projects that are cheaper to build and cheaper to participate in, furthering the goals of DOE’s SunShot Initiative. Final SF 425 Final SF 428 Final DOE F 2050.11 Final Report Narrative
Wiswall, John D.
For many aerospace applications, mixing enhancement between co-flowing streams has been identified as a critical and enabling technology. Due to short fuel residence times in scramjet combustors, combustion is limited by the molecular mixing of hydrogen (fuel) and air. Determining the mixedness of fuel and air in these complex supersonic flowfields is critical to the advancement of novel injection schemes currently being developed at UTA in collaboration with NASA Langley and intended to be used on a future two-stage to orbit (~Mach 16) hypersonic air-breathing vehicle for space access. Expanding on previous work, an instrument has been designed, fabricated, and tested in order to measure mean concentrations of injected helium (a passive scalar used instead of hazardous hydrogen) and to quantitatively characterize the nature of the high-frequency concentration fluctuations encountered in the compressible, turbulent, and high-speed (up to Mach 3.5) complex flows associated with the new supersonic injection schemes. This important high-frequency data is not yet attainable when employing other techniques such as Laser Induced Fluorescence, Filtered Rayleigh Scattering or mass spectroscopy in the same complex supersonic flows. The probe operates by exploiting the difference between the thermodynamic properties of two species through independent massflow measurements and calibration. The probe samples isokinetically from the flowfield's area of interest and the helium concentration may be uniquely determined by hot-film anemometry and internally measured stagnation conditions. The final design has a diameter of 0.25" and is only 2.22" long. The overall accuracy of the probe is 3% in molar fraction of helium. The frequency response of mean concentration measurements is estimated at 103 Hz, while high-frequency hot-film measurements were conducted at 60 kHz. Additionally, the work presents an analysis of the probe's internal mixing effects and the effects of the spatial
Hoffman, S.; Varholic, M. C.
1983-01-01
NASA-SCAR (AST) program was initiated in 1972 at the direct request of the Executive Office of the White House and Congress following termination of the U.S. SST program. The purpose of SCR was to conduct a focused research and technology program on those technology programs which contributed to the SST termination and, also, to provide an expanded data base for future civil and military supersonic transport aircraft. Funding for the Supersonic Cruise Research (SCR) Program was initiated in fiscal year 1973 and terminated in fiscal year 1981. The program was implemented through contracts and grants with industry, universities, and by in-house investigations at the NASA/OAST centers. The studies included system studies and five disciplines: propulsion, stratospheric emissions impact, materials and structures, aerodynamic performance, and stability and control. The NASA/Lewis Variable-Cycle Engine (VCE) Component Program was initiated in 1976 to augment the SCR program in the area of propulsion. After about 2 years, the title was changed to VCE Technology program. The total number of contractors and grantees on record at the AST office in 1982 was 101 for SCR and 4 for VCE. This paper presents a compilation of all the contracts and grants as well as the funding summaries for both programs.
Directory of Open Access Journals (Sweden)
Uzu-Kuei Hsu
2009-01-01
Full Text Available This research adopts a shock tube 16 meters long and with a 9 cm bore to create a supersonic, high-temperature, and high-pressure flowfield to observe the gasification and ignition of HTPB solid fuel under different environments. Also, full-scale 3D numerical simulation is executed to enhance the comprehension of this complex phenomenon. The CFD (Computational Fluid Dynamics code is based on the control volume method and the pre-conditioning method for solving the Navier-Stokes equations to simulate the compressible and incompressible coupling problem. In the tests, a HTPB slab is placed in the windowed-test section. Various test conditions generate different supersonic Mach numbers and environmental temperatures. In addition, the incident angles of the HTPB slab were changed relative to the incoming shock wave. Results show that as the Mach number around the slab section exceeded 1.25, the flowfield temperature achieved 1100 K, which is higher than the HTPB gasification temperature (930 K ~ 1090 K. Then, gasification occurred and a short-period ignition could be observed. In particular, when the slab angle was 7∘, the phenomenon became more visible. This is due to the flow field temperature increase when the slab angle was at 7∘.
Trottmann, M; Rübenthaler, J; Marcon, J; Stief, C G; Reiser, M F; Clevert, D A
2016-01-01
To investigate the difference of standard values of Supersonic shear imaging (SSI) and Acoustic Radiation Force Impulse (ARFI) technique in the evaluation of testicular tissue stiffness in vivo. 58 healthy male testes were examined using B-mode sonography and ARFI and SSI. B-mode sonography was performed in order to scan the testis for pathologies followed by performance of real-time elastography in three predefined areas (upper pole, central portion and lower pole) using the SuperSonic® Aixplorer ultrasound device (SuperSonic Imagine, Aix-en-Provence, France). Afterwards a second assessment of the same testicular regions by elastography followed using the ARFI technique of the Siemens Acuson 2000™ ultrasound device (Siemens Health Care, Germany). Values of shear wave velocity were described in m/s. Parameters of elastography techniques were compared using paired sample t-test. The values of SSI were all significantly higher in all measured areas compared to ARFI (p < 0.001 to p = 0.015). Quantitatively there was a higher mean SSI wave velocity value of 1,1 compared to 0.8 m/s measured by ARFI. SSI values are significantly higher than ARFI values when measuring the stiffness of testicular tissue and should only be compared with caution.
Flexible experimental FPGA based platform
DEFF Research Database (Denmark)
Andersen, Karsten Holm; Nymand, Morten
2016-01-01
This paper presents an experimental flexible Field Programmable Gate Array (FPGA) based platform for testing and verifying digital controlled dc-dc converters. The platform supports different types of control strategies, dc-dc converter topologies and switching frequencies. The controller platform...... interface supporting configuration and reading of setup parameters, controller status and the acquisition memory in a simple way. The FPGA based platform, provides an easy way within education or research to use different digital control strategies and different converter topologies controlled by an FPGA...
International Nuclear Information System (INIS)
Shuvalov, V.A.
1986-01-01
The character of flow over a body, structure of the perturbed zone, and flow resistance in a supersonic flow of rarefied partially ionized gas are determined by the intrinsic magnetic field and surface potential of the body. There have been practically no experimental studies of the effect of intrinsic magnetic field on flow of a rarefied plasma. Studies of the effect of surface potential have been limited to the case R/λd 10 2 (where R is the characteristic dimension of the body and λd is the Debye radius). At the same time R/λd > 10 2 , the regime of flow over a large body, is of the greatest practical interest. The present study will consider the effect of potential and intrinsic magnetic field on resistance of a large (R/λd > 10 2 ) axisymmetric body (disk, sphere) in a supersonic flow of rarefield partially ionized gas
Lagen, Nicholas T.; Seiner, John M.
1990-01-01
The development of water cooled supersonic probes used to study high temperature jet plumes is addressed. These probes are: total pressure, static pressure, and total temperature. The motivation for these experiments is the determination of high temperature supersonic jet mean flow properties. A 3.54 inch exit diameter water cooled nozzle was used in the tests. It is designed for exit Mach 2 at 2000 F exit total temperature. Tests were conducted using water cooled probes capable of operating in Mach 2 flow, up to 2000 F total temperature. Of the two designs tested, an annular cooling method was chosen as superior. Data at the jet exit planes, and along the jet centerline, were obtained for total temperatures of 900 F, 1500 F, and 2000 F, for each of the probes. The data obtained from the total and static pressure probes are consistent with prior low temperature results. However, the data obtained from the total temperature probe was affected by the water coolant. The total temperature probe was tested up to 2000 F with, and without, the cooling system turned on to better understand the heat transfer process at the thermocouple bead. The rate of heat transfer across the thermocouple bead was greater when the coolant was turned on than when the coolant was turned off. This accounted for the lower temperature measurement by the cooled probe. The velocity and Mach number at the exit plane and centerline locations were determined from the Rayleigh-Pitot tube formula.
International Nuclear Information System (INIS)
Dastugue, Laurent
2013-01-01
Exact self-similar solutions of gas dynamics equations with nonlinear heat conduction for semi-infinite slabs of perfect gases are used for studying the stability of flows in inertial confinement fusion. Both the similarity solutions and their linear perturbations are computed with a multi domain Chebyshev pseudo-spectral method, allowing us to account for, without any other approximation, compressibility and unsteadiness. Following previous results (Clarisse et al., 2008; Lombard, 2008) representative of the early ablation of a target by a nonuniform laser flux (electronic conduction, subsonic heat front downstream of a quasi-perfect shock front), we explore here other configurations. For this early ablation phase, but for a nonuniform incident X-radiation (radiative conduction), we study a compressible and a weakly compressible flow. In both cases, we recover the behaviours obtained for compressible flows with electronic heat conduction with a maximal instability for a zero wavenumber. Besides, the spectral method is extended to compute similarity solutions taking into account the supersonic heat wave ahead of the shock front. Based on an analysis of the reduced equations singularities (infinitely stiff front), this method allows us to describe the supersonic heat wave regime proper to the initial irradiation of the target and to recover the ablative solutions which were obtained under a negligible fore-running heat wave approximation. (author) [fr
Fradenburgh, Evan A; Gorton, Gerald C; Beke, Andrew
1954-01-01
An experimental investigation of a series of four convergent-divergent exhaust nozzles was conducted in the Lewis 8-by-6 foot supersonic wind tunnel at Mach numbers of 0.1, 0.6, 1.6, and 2.0 over a range of nozzle pressure ratios. The thrust characteristics of these nozzles were determined by a pressure-integration technique. From a thrust standpoint, a nozzle designed to give uniform parallel flow at the exit had no advantage over the simple geometric design with conical convergent and divergent sections. The rapid-divergent nozzles might be competitive with the more gradual-divergent nozzles since the relatively short length of these nozzles would be advantageous from a weight standpoint and might result in smaller thrust losses due to friction. The thrusts, with friction losses neglected, were predicted satisfactorily by one-dimensional theory for the nozzles with relatively gradual divergence. The thrusts of the rapid-divergent designs were several percentages below the theoretical values at the design pressure ratio or above, while at low pressure ratios there was a considerable effect of free-stream Mach number, with thrusts considerably above theoretical values at subsonic speeds and somewhat above theoretical values at supersonic speeds. This Mach numb effect appeared to be related to the variation of the model base pressure with free-stream Mach number.
Sun, Ming-bo; Zhong, Zhan; Liang, Jian-han; Wang, Hong-bo
2016-10-01
Supersonic combustion with cavity-strut injection of supercritical kerosene in a model scramjet engine was experimentally investigated in Mach 2.92 facility with the stagnation temperatures of approximately 1430 K. Static pressure distribution in the axial direction was determined using pressure transducers installed along the centerline of the model combustor top walls. High speed imaging camera was used to capture flame luminosity and combustion region distribution. Multi-cavities were used to and stabilize the combustion in the supersonic combustor. Intrusive injection by thin struts was used to enhance the fuel-air mixing. Supercritical kerosene at temperatures of approximately 780 K and various pressures was prepared using a heat exchanger driven by the hot gas from a pre-burner and injected at equivalence ratios of approximately 1.0. In the experiments, combustor performances with different strut injection schemes were investigated and compared to direct wall injection scheme based on the measured static pressure distributions, the specific thrust increments and the images obtained by high-speed imaging camera. The experimental results showed that the injection by thin struts could obtain an enhanced mixing in the field but could not acquire a steady flame when mixing field cannot well match cavity separation region. There is no significant difference on performance between different schemes since the unsteady intermittent and oscillating flame leads to no actual combustion efficiency improvement.
Energy Technology Data Exchange (ETDEWEB)
Dyominov, I.G.; Zadorozhny, A.M. [Novosibirsk State Univ. (Russian Federation); Elansky, N.F. [Russian Academy of Sciences, Moscow (Russian Federation). Inst. of Atmospheric Physics
1997-12-31
The impact of supersonic aviation on atmospheric ozone and sulfate aerosol is examined with the help of a two-dimensional dynamical/radiative/chemical model of ozonosphere including aerosol physics. For SO{sub 2} emissions from aircraft as gas, gas/particles (90%/10%) mix, and particles of 0.01 {mu}m radius the sulphate aerosol surface density at maximum of changes increases against its background value by {approx}50%, {approx}75%, and {approx}200%, respectively. This effect of SO{sub 2} emissions with insignificant NO{sub x} injection leads to a significant decrease of total ozone by 2015 in the entire atmosphere. For NO{sub x} emissions which are anticipated in future (EI(NO{sub x}) = 15) any kind of SO{sub 2} emission results in significant weakening of supersonic aviation impact on ozone layer in the Northern Hemisphere. (author) 14 refs.
Energy Technology Data Exchange (ETDEWEB)
Dyominov, I G; Zadorozhny, A M [Novosibirsk State Univ. (Russian Federation); Elansky, N F [Russian Academy of Sciences, Moscow (Russian Federation). Inst. of Atmospheric Physics
1998-12-31
The impact of supersonic aviation on atmospheric ozone and sulfate aerosol is examined with the help of a two-dimensional dynamical/radiative/chemical model of ozonosphere including aerosol physics. For SO{sub 2} emissions from aircraft as gas, gas/particles (90%/10%) mix, and particles of 0.01 {mu}m radius the sulphate aerosol surface density at maximum of changes increases against its background value by {approx}50%, {approx}75%, and {approx}200%, respectively. This effect of SO{sub 2} emissions with insignificant NO{sub x} injection leads to a significant decrease of total ozone by 2015 in the entire atmosphere. For NO{sub x} emissions which are anticipated in future (EI(NO{sub x}) = 15) any kind of SO{sub 2} emission results in significant weakening of supersonic aviation impact on ozone layer in the Northern Hemisphere. (author) 14 refs.
Performance characterization of Ni60-WC coating on steel processed with supersonic laser deposition
Directory of Open Access Journals (Sweden)
Fang Luo
2015-03-01
Full Text Available Ni60-WC particles are used to improve the wear resistance of hard-facing steel due to their high hardness. An emerging technology that combines laser with cold spraying to deposit the hard-facing coatings is known as supersonic laser deposition. In this study, Ni60-WC is deposited on low-carbon steel using SLD. The microstructure and performance of the coatings are investigated through SEM, optical microscopy, EDS, XRD, microhardness and pin-on-disc wear tests. The experimental results of the coating processed with the optimal parameters are compared to those of the coating deposited using laser cladding.
Investigating the Structures of Turbulence in a Multi-Stream, Rectangular, Supersonic Jet
Magstadt, Andrew S.
Supersonic flight has become a standard for military aircraft, and is being seriously reconsidered for commercial applications. Engine technologies, enabling increased mission capabilities and vehicle performance, have evolved nozzles into complex geometries with intricate flow features. These engineering solutions have advanced at a faster rate than the understanding of the flow physics, however. The full consequences of the flow are thus not known, and using predictive tools becomes exceedingly difficult. Additionally, the increasing velocities associated with supersonic flight exacerbate the preexisting jet noise problem, which has troubled the engineering community for nearly 65 years. Even in the simplest flows, the full consequences of turbulence, e.g. noise production, are not fully understood. For composite flows, the fluid mechanics and acoustic properties have been studied even less sufficiently. Before considering the aeroacoustic problem, the development, structure, and evolution of the turbulent flow-field must be considered. This has prompted an investigation into the compressible flow of a complex nozzle. Experimental evidence is sought to explain the stochastic processes of the turbulent flow issuing from a complex geometry. Before considering the more complicated configuration, an experimental campaign of an axisymmetric jet is conducted. The results from this study are presented, and guide research of the primary flow under investigation. The design of a nozzle representative of future engine technologies is then discussed. Characteristics of this multi-stream rectangular supersonic nozzle are studied via time-resolved schlieren imaging, stereo PIV measurements, dynamic pressure transducers, and far-field acoustics. Experiments are carried out in the anechoic chamber at Syracuse University, and focus primarily on the flow-field. An extensive data set is generated, which reveals a detailed view of a very complex flow. Shear, shock waves, unequal
Product Platform Screening at LEGO
DEFF Research Database (Denmark)
Mortensen, Niels Henrik; Steen Jensen, Thomas; Nielsen, Ole Fiil
2012-01-01
Product platforms offer great benefits to companies developing new products in highly competitive markets. Literature describes how a single platform can be designed from a technical point of view, but rarely mentions how the process begins. How do companies identify possible platform candidates...... after a few changes had been applied to the initial process layout. This case study shows how companies must focus on a limited selection of simultaneous projects in order to keep focus. Primary stakeholders must be involved from the very beginning, and short presentations of the platform concepts...
International Nuclear Information System (INIS)
Gudmestad, O.T.; Sparby, B.K.; Stead, B.L.
1993-01-01
There is an increasing need to reduce costs of offshore production facilities in order to make development of offshore fields profitable. For small fields with short production time there is in particular a need to investigate ways to reduce costs. The idea of platform reuse is for such fields particularly attractive. This paper will review reusable platform concepts and will discuss their range of application. Particular emphasis will be placed on technical limitations. Traditional concepts as jackups and floating production facilities will be discussed by major attention will be given to newly developed ideas for reuse of steel jackets and concrete structures. It will be shown how the operator for several fields can obtain considerable savings by applying such reusable platform concepts
Disentangling Competition Among Platform Driven Strategic Groups
DEFF Research Database (Denmark)
Kazan, Erol; Tan, Chee-Wee; Lim, Eric
2015-01-01
In platform-driven markets, competitive advantage is derived from superior platform design and configurations. For this reason, platform owners strive to create unique and inimitable platform configurals to maintain and extend their competitiveness within network economies. To disentangle firm...... competition within platform-driven markets, we opted for the UK mobile payment market as our empirical setting. By embracing the theoretical lens of strategic groups and digital platforms, this study supplements prior research by deriving a taxonomy of platform-driven strategic groups that is grounded...
Numerical Simulation of Hydrogen Air Supersonic Coaxial Jet
Dharavath, Malsur; Manna, Pulinbehari; Chakraborty, Debasis
2017-10-01
In the present study, the turbulent structure of coaxial supersonic H2-air jet is explored numerically by solving three dimensional RANS equations along with two equation k-ɛ turbulence model. Grid independence of the solution is demonstrated by estimating the error distribution using Grid Convergence Index. Distributions of flow parameters in different planes are analyzed to explain the mixing and combustion characteristics of high speed coaxial jets. The flow field is seen mostly diffusive in nature and hydrogen diffusion is confined to core region of the jet. Both single step laminar finite rate chemistry and turbulent reacting calculation employing EDM combustion model are performed to find the effect of turbulence-chemistry interaction in the flow field. Laminar reaction predicts higher H2 mol fraction compared to turbulent reaction because of lower reaction rate caused by turbulence chemistry interaction. Profiles of major species and temperature match well with experimental data at different axial locations; although, the computed profiles show a narrower shape in the far field region. These results demonstrate that standard two equation class turbulence model with single step kinetics based turbulence chemistry interaction can describe H2-air reaction adequately in high speed flows.
Sakata, I. F.; Davis, G. W.
1975-01-01
The design of an economically viable supersonic cruise aircraft requires the lowest attainable structural-mass fraction commensurate with the selected near-term structural material technology. To achieve this goal of minimum structural-mass fraction, various combinations of promising wing and fuselage primary structure were analyzed for the load-temperature environment applicable to the arrow wing configuration. This analysis was conducted in accordance with the design criteria specified and included extensive use of computer-aided analytical methods to screen the candidate concepts and select the most promising concepts for the in-depth structural analysis.
Platform development: implications for portfolio management
DEFF Research Database (Denmark)
Hsuan, Juliana; Hansen, Poul H. Kyvsgård
2007-01-01
" The challenge of implementing industrial platforms in practice can be described as a configuration problem caused by a considerable number of variables, which often have contradictory influences on the total performance of the firm. Consequently, the specific platform decisions become extremely...... complex, possibly increasing the strategic risks for the firm. This paper reports preliminary findings on platform management process at LEGO, a Danish toy company. Specifically, we report the process of applying games combined with simulations and workshops in the platform development. We also propose...... a framework, based on the portfolio management thinking to evaluate the degree of modularity embedded in a given platform and to which extent it is aligned with other platforms."...
Stratifying the Develoment of Product Platforms
DEFF Research Database (Denmark)
Sköld, Martin; Karlsson, Christer
2013-01-01
companies develop platforms for different aims, purposes, and product scopes. Following on from this, the requirements for platform development resources, the ways of organizing platform development, and the implications for management styles have not been explored and are presumably varying. To start...... influencing the project length, requirements for platform development resources, principles for organizing, and implications for management styles....
The COMET Sleep Research Platform.
Nichols, Deborah A; DeSalvo, Steven; Miller, Richard A; Jónsson, Darrell; Griffin, Kara S; Hyde, Pamela R; Walsh, James K; Kushida, Clete A
2014-01-01
The Comparative Outcomes Management with Electronic Data Technology (COMET) platform is extensible and designed for facilitating multicenter electronic clinical research. Our research goals were the following: (1) to conduct a comparative effectiveness trial (CET) for two obstructive sleep apnea treatments-positive airway pressure versus oral appliance therapy; and (2) to establish a new electronic network infrastructure that would support this study and other clinical research studies. The COMET platform was created to satisfy the needs of CET with a focus on creating a platform that provides comprehensive toolsets, multisite collaboration, and end-to-end data management. The platform also provides medical researchers the ability to visualize and interpret data using business intelligence (BI) tools. COMET is a research platform that is scalable and extensible, and which, in a future version, can accommodate big data sets and enable efficient and effective research across multiple studies and medical specialties. The COMET platform components were designed for an eventual move to a cloud computing infrastructure that enhances sustainability, overall cost effectiveness, and return on investment.
Design and test of a 10kW ORC supersonic turbine generator
Seume, J. R.; Peters, M.; Kunte, H.
2017-03-01
Manufactures are searching for possibilities to increase the efficiency of combustion engines by using the remaining energy of the exhaust gas. One possibility to recover some of this thermal energy is an organic Rankine cycle (ORC). For such an ORC running with ethanol, the aerothermodynamic design and test of a supersonic axial, single stage impulse turbine generator unit is described. The blade design as well as the regulation by variable partial admission is shown. Additionally the mechanical design of the directly coupled turbine generator unit including the aerodynamic sealing and the test facility is presented. Finally the results of CFD-based computations are compared to the experimental measurements. The comparison shows a remarkably good agreement between the numerical computations and the test data.
Production of amorphous nanoparticles by supersonic spray-drying with a microfluidic nebulator
Amstad, Esther; Gopinadhan, Manesh; Holtze, Christian; Osuji, Chinedum O.; Brenner, Michael P.; Spaepen, Frans; Weitz, David A.
2015-08-01
Amorphous nanoparticles (a-NPs) have physicochemical properties distinctly different from those of the corresponding bulk crystals; for example, their solubility is much higher. However, many materials have a high propensity to crystallize and are difficult to formulate in an amorphous structure without stabilizers. We fabricated a microfluidic nebulator that can produce amorphous NPs from a wide range of materials, even including pure table salt (NaCl). By using supersonic air flow, the nebulator produces drops that are so small that they dry before crystal nuclei can form. The small size of the resulting spray-dried a-NPs limits the probability of crystal nucleation in any given particle during storage. The kinetic stability of the a-NPs—on the order of months—is advantageous for hydrophobic drug molecules.
Identification of platform levels
DEFF Research Database (Denmark)
Mortensen, Niels Henrik
2005-01-01
reduction, ability to launch a wider product portfolio without increasing resources and reduction of complexity within the whole company. To support the multiple product development process, platform based product development has in many companies such as Philips, VW, Ford etc. proven to be a very effective...... product development in one step and therefore the objective of this paper is to identify levels of platform based product development. The structure of this paper is as follows. First the applied terminology for platforms will be briefly explained and then characteristics between single and multi product...... development will be examined. Based on the identification of the above characteristics five platform levels are described. The research presented in this paper is a result of MSc, Ph.D projects at the Technical University of Denmark and consultancy projects within the organisation of Institute of Product...
Space-marching gridless computation of steady supersonic/hypersonic flow
International Nuclear Information System (INIS)
Hui, W.H.; Hu, J.J.
2004-01-01
Most CFD work use Eulerian coordinates, which require generating a grid prior to flow filed computation. Despite three decades of research, grid generation is still a bottleneck of CFD, as it is time-consuming, tedious and requires specialized training. It will be shown in this paper that using the Unified Coordinates introduced by Hui et. al., there is no need for grid generation prior to flow computation; the grid is automatically generated while computing the flow. This greatly saves computing time. For steady supersonic/hypersonic flow, the Euler equations of gas dynamics are of hyperbolic type and a space-marching gridless computation along the streamlines - coordinate lines in the unified coordinates - is shown to be a complete success in that: (a) it is most robust, (b) it resolves both slip lines (also called contact lines) and shocks sharply, (c) its computing time is more than three orders of magnitude smaller than Eulerian computation and, (d) it by-passes the tedious and time-consuming grid generation stage which is needed in Eulerian computation. Three examples are given to justify these claims. (author)
LPWA using supersonic gas jet with tailored density profile
Kononenko, O.; Bohlen, S.; Dale, J.; D'Arcy, R.; Dinter, M.; Erbe, J. H.; Indorf, G.; di Lucchio, L.; Goldberg, L.; Gruse, J. N.; Karstensen, S.; Libov, V.; Ludwig, K.; Martinez de La Ossa, A.; Marutzky, F.; Niroula, A.; Osterhoff, J.; Quast, M.; Schaper, L.; Schwinkendorf, J.-P.; Streeter, M.; Tauscher, G.; Weichert, S.; Palmer, C.; Horbatiuk, Taras
2016-10-01
Laser driven plasma wakefield accelerators have been explored as a potential compact, reproducible source of relativistic electron bunches, utilising an electric field of many GV/m. Control over injection of electrons into the wakefield is of crucial importance in producing stable, mono-energetic electron bunches. Density tailoring of the target, to control the acceleration process, can also be used to improve the quality of the bunch. By using gas jets to provide tailored targets it is possible to provide good access for plasma diagnostics while also producing sharp density gradients for density down-ramp injection. OpenFOAM hydrodynamic simulations were used to investigate the possibility of producing tailored density targets in a supersonic gas jet. Particle-in-cell simulations of the resulting density profiles modelled the effect of the tailored density on the properties of the accelerated electron bunch. Here, we present the simulation results together with preliminary experimental measurements of electron and x-ray properties from LPWA experiments using gas jet targets and a 25 TW, 25 fs Ti:Sa laser system at DESY.
Turbine engine airfoil and platform assembly
Campbell, Christian X [Oviedo, FL; James, Allister W [Chuluota, FL; Morrison, Jay A [Oviedo, FL
2012-07-31
A turbine airfoil (22A) is formed by a first process using a first material. A platform (30A) is formed by a second process using a second material that may be different from the first material. The platform (30A) is assembled around a shank (23A) of the airfoil. One or more pins (36A) extend from the platform into holes (28) in the shank (23A). The platform may be formed in two portions (32A, 34A) and placed around the shank, enclosing it. The two platform portions may be bonded to each other. Alternately, the platform (30B) may be cast around the shank (23B) using a metal alloy with better castability than that of the blade and shank, which may be specialized for thermal tolerance. The pins (36A-36D) or holes for them do not extend to an outer surface (31) of the platform, avoiding stress concentrations.
The Innovative Capabilities Of Digital Payment Platforms
DEFF Research Database (Denmark)
Kazan, Erol
2015-01-01
This study presents a model for studying the innovative capabilities of digital payment platforms in regards to open innovation integration and commercialization. We perceive digital platforms as layered modular IT artifacts, where platform governance and the configuration of platform layers impact...... the support for open innovation. The proposed model has been employed in a comparative case study between two digital payment platforms: Apple Pay and Google Wallet. The findings suggest that digital payment platforms make use of boundary resources to be highly integrative or integratable, which supports...... the intended conjoint commercialization efforts. Furthermore, the architectural design of digital platforms impacts the access to commercialization, resulting to an exclusion or inclusion strategy in accessing value opportunities. Our findings contribute to the open innovation and digital platform literature...
PR-PR: cross-platform laboratory automation system.
Linshiz, Gregory; Stawski, Nina; Goyal, Garima; Bi, Changhao; Poust, Sean; Sharma, Monica; Mutalik, Vivek; Keasling, Jay D; Hillson, Nathan J
2014-08-15
To enable protocol standardization, sharing, and efficient implementation across laboratory automation platforms, we have further developed the PR-PR open-source high-level biology-friendly robot programming language as a cross-platform laboratory automation system. Beyond liquid-handling robotics, PR-PR now supports microfluidic and microscopy platforms, as well as protocol translation into human languages, such as English. While the same set of basic PR-PR commands and features are available for each supported platform, the underlying optimization and translation modules vary from platform to platform. Here, we describe these further developments to PR-PR, and demonstrate the experimental implementation and validation of PR-PR protocols for combinatorial modified Golden Gate DNA assembly across liquid-handling robotic, microfluidic, and manual platforms. To further test PR-PR cross-platform performance, we then implement and assess PR-PR protocols for Kunkel DNA mutagenesis and hierarchical Gibson DNA assembly for microfluidic and manual platforms.
Performance Measurement of Complex Event Platforms
Directory of Open Access Journals (Sweden)
Eva Zámečníková
2016-12-01
Full Text Available The aim of this paper is to find and compare existing solutions of complex event processing platforms (CEP. CEP platforms generally serve for processing and/or predicting of high frequency data. We intend to use CEP platform for processing of complex time series and integrate a solution for newly proposed method of decision making. The decision making process will be described by formal grammar. As there are lots of CEP solutions we will take the following characteristics under consideration - the processing in real time, possibility of processing of high volume data from multiple sources, platform independence, platform allowing integration with user solution and open license. At first we will talk about existing CEP tools and their specific way of use in praxis. Then we will mention the design of method for formalization of business rules used for decision making. Afterwards, we focus on two platforms which seem to be the best fit for integration of our solution and we will list the main pros and cons of each approach. Next part is devoted to benchmark platforms for CEP. Final part is devoted to experimental measurements of platform with integrated method for decision support.
Supplement 1: Advanced nuclear turbojet powerplant characteristics summary for supersonic aircraft
International Nuclear Information System (INIS)
Larson, John W.
1959-01-01
The powerplant characteristics previously described in PWAC-275 were based on the use of low compressor pressure ratio nuclear turbojet engines equipped with interburners but without afterburners. The performance of an afterburning version of the same engine is presented in Section B of this supplement. The engine selection for the previous report and for Section B of this supplement was based on best engine performance at Mach No. 3 on nuclear heat alone. For this reason a low compression turbojet engine was selected. However, it is desirable that the nuclear data in report PWAC-275 be useful for both subsonic and supersonic missions. Therefore, the engine performance has been computed for a nuclear conversion of the Pratt & Whitney Aircraft J-58 turbojet engine which has a higher compressor pressure ratio. The performance of this engine is outlined in Section C of this supplement.
Energy Technology Data Exchange (ETDEWEB)
Varnier, J.; Gely, D. [Office National d' Etudes et de Recherches Aerospatiales (ONERA), Dept. DSNA, 92 - Chatillon (France); Foulon, H. [CEAT, 86 - Poitiers (France)
2001-07-01
In the context of the spatial launchers, the prediction of noise radiated by highly supersonic hot jets is generally made from empirical methods. More recently, simulation methods based on computational fluid dynamics have been developed. In the two cases, in order to specify the parameters of the computer codes, it is necessary to know the actual aerodynamic and acoustic data of the flow. In the MARTEL facilities of CNES, ONERA has carried out tests with a 1200 m/s hot jet, free or impinging on a large plate. Acoustic near field and aerodynamic configuration of the free jet and of the wall jet have been characterized by measurements. Particularly, the supersonic core length and the location of the sound power peak on the jet axis have been determined. Other measurements, made with anemometers and wind cocks in the vicinity of the jet and of the plate, have allowed to characterize the drive of the ambient air by the jet. (authors)
Arnaud-Vanneau, A.; Vrielynck, B.
2009-04-01
Carbonate platform sediments are of biogenic origin. More commonly the bioclasts are fragments of shells and skeletons. The bioclastic composition of a limestone may reflect the nature of biota inhabiting the area and a carbonate platform can be estimated as a living factory, which reflects the prevailing ecological factors. The rate of carbonate production is highest in the tropics, in oligotrophic environments, and in the photic zone. The rate of carbonate production varies greatly with temperature and nutrient input. Three types of biotic carbonate platform can be distinguished. The highest carbonate production is linked to oligotrophic carbonate platform characterized by the presence of assemblages with hermatypic corals. This type of platform is developed in shallow marine environment, nutrient poor water and warm tropical sea. A less efficient production of carbonate platform is related to mesotrophic environments in cooler and/or deeper water and associated to nutrient flux with, sometime, detrital input. The biota includes red algae, solitary coral and branching ahermatypic corals, common bryozoans, crinoids and echinoids. The less productive carbonate platform is the eutrophic muddy platform where the mud is due to the intense bacterial activity, probably related to strong nutrient flux. All changes of type of carbonate platform can be related to climatic and oceanic changes. Three platform crises occurred during lower Cretaceous time. They are followed by important turnover of microfauna (large benthic foraminifers) and microflora (marine algae). They start with the demise of the previous oligotrophic platform, they continue with oceanic perturbations, expression of which was the widespread deposition of organic-rich sediments, well expressed during Late Aptian/Albian and Cenomanian Turonian boundary and the replacement of previous oligotrophic platforms by mesotrophic to eutrophic platforms. The first crisis occurred during Valanginian and Hauterivian
Helicopter flight simulation motion platform requirements
Schroeder, Jeffery Allyn
Flight simulators attempt to reproduce in-flight pilot-vehicle behavior on the ground. This reproduction is challenging for helicopter simulators, as the pilot is often inextricably dependent on external cues for pilot-vehicle stabilization. One important simulator cue is platform motion; however, its required fidelity is unknown. To determine the required motion fidelity, several unique experiments were performed. A large displacement motion platform was used that allowed pilots to fly tasks with matched motion and visual cues. Then, the platform motion was modified to give cues varying from full motion to no motion. Several key results were found. First, lateral and vertical translational platform cues had significant effects on fidelity. Their presence improved performance and reduced pilot workload. Second, yaw and roll rotational platform cues were not as important as the translational platform cues. In particular, the yaw rotational motion platform cue did not appear at all useful in improving performance or reducing workload. Third, when the lateral translational platform cue was combined with visual yaw rotational cues, pilots believed the platform was rotating when it was not. Thus, simulator systems can be made more efficient by proper combination of platform and visual cues. Fourth, motion fidelity specifications were revised that now provide simulator users with a better prediction of motion fidelity based upon the frequency responses of their motion control laws. Fifth, vertical platform motion affected pilot estimates of steady-state altitude during altitude repositionings. This refutes the view that pilots estimate altitude and altitude rate in simulation solely from visual cues. Finally, the combined results led to a general method for configuring helicopter motion systems and for developing simulator tasks that more likely represent actual flight. The overall results can serve as a guide to future simulator designers and to today's operators.
A new Lagrangian method for real gases at supersonic speed
Loh, C. Y.; Liou, Meng-Sing
1992-01-01
With the renewed interest in high speed flights, the real gas effect is of theoretical as well as practical importance. In the past decade, upwind splittings or Godunov-type Riemann solutions have received tremendous attention and as a result significant progress has been made both in the ideal and non-ideal gas. In this paper, we propose a new approach that is formulated using the Lagrangian description, for the calculation of supersonic/hypersonic real gas inviscid flows. This new formulation avoids the grid generation step which is automatically obtained as the solution procedure marches in the 'time-like' direction. As a result, no remapping is required and the accuracy is faithfully maintained in the Lagrangian level. In this paper, we give numerical results for a variety of real gas problems consisting of essential elements in high speed flows, such as shock waves, expansion waves, slip surfaces and their interactions. Finally, calculations for flows in a generic inlet and nozzle are presented.
Prediction of Mass Flow Rate in Supersonic Natural Gas Processing
Directory of Open Access Journals (Sweden)
Wen Chuang
2015-11-01
Full Text Available The mass flow rate of natural gas through the supersonic separator was numerically calculated by various cubic equations of state. The numerical results show that the compressibility factor and specific heat ratio for ideal gas law diverge remarkably from real gas models at a high inlet pressure. Simultaneously, the deviation of mass flow calculated by the ideal and real gas models reaches over 10 %. The difference increases with the lower of the inlet temperature regardless of the inlet pressure. A higher back pressure results in an earlier location of the shock wave. The pressure ratio of 0.72 is the first threshold to get the separator work normally. The second threshold is 0.95, in which case the whole flow is subsonic and cannot reach the choked state. The shock position moves upstream with the real gas model compared to the ideal gas law in the cyclonic separation section.
Coherent structures in a supersonic complex nozzle
Magstadt, Andrew; Berry, Matthew; Glauser, Mark
2016-11-01
The jet flow from a complex supersonic nozzle is studied through experimental measurements. The nozzle's geometry is motivated by future engine designs for high-performance civilian and military aircraft. This rectangular jet has a single plane of symmetry, an additional shear layer (referred to as a wall jet), and an aft deck representative of airframe integration. The core flow operates at a Mach number of Mj , c = 1 . 6 , and the wall jet is choked (Mj , w = 1 . 0). This high Reynolds number jet flow is comprised of intense turbulence levels, an intricate shock structure, shear and boundary layers, and powerful corner vortices. In the present study, stereo PIV measurements are simultaneously sampled with high-speed pressure measurements, which are embedded in the aft deck, and far-field acoustics in the anechoic chamber at Syracuse University. Time-resolved schlieren measurements have indicated the existence of strong flow events at high frequencies, at a Strouhal number of St = 3 . 4 . These appear to result from von Kàrmàn vortex shedding within the nozzle and pervade the entire flow and acoustic domain. Proper orthogonal decomposition is applied on the current data to identify coherent structures in the jet and study the influence of this vortex street. AFOSR Turbulence and Transition Program (Grant No. FA9550-15-1-0435) with program managers Dr. I. Leyva and Dr. R. Ponnappan.
Boro, H.; Bertotti, G.V.; Hardebol, N.J.
2012-01-01
Isolated carbonate platforms are highly heterogeneous bodies and are typically composed of laterally juxtaposed first order domains with different sedimentological composition and organization, i.e. a well-stratified platform interior, a massive margin and a slope with steeply dipping and poorly
LES of Supersonic Turbulent Channel Flow at Mach Numbers 1.5 and 3
Raghunath, Sriram; Brereton, Giles
2009-11-01
LES of compressible, turbulent, body-force driven, isothermal-wall channel flows at Reτ of 190 and 395 at moderate supersonic speeds (Mach 1.5 and 3) are presented. Simulations are fully resolved in the wall-normal direction without the need for wall-layer models. SGS models for incompressible flows, with appropriate extensions for compressibility, are tested a priori/ with DNS results and used in LES. Convergence of the simulations is found to be sensitive to the initial conditions and to the choice of model (wall-normal damping) in the laminar sublayer. The Nicoud--Ducros wall adapting SGS model, coupled with a standard SGS heat flux model, is found to yield results in good agreement with DNS.
Tambe, S.S.; Schrijer, F.F.J.; van Oudheusden, B.W.
2017-01-01
The physical relation between the geometry and the flow topology of the wake of a micro ramp is investigated by means of a parametric study. Various micro ramp geometries are placed in a supersonic turbulent boundary layer at a free-stream Mach number of 2. The flow field is measured with schlieren
Telu, Kelly H; Yan, Xinjian; Wallace, William E; Stein, Stephen E; Simón-Manso, Yamil
2016-03-15
The metabolite profiling of a NIST plasma Standard Reference Material (SRM 1950) on different liquid chromatography/mass spectrometry (LC/MS) platforms showed significant differences. Although these findings suggest caution when interpreting metabolomics results, the degree of overlap of both profiles allowed us to use tandem mass spectral libraries of recurrent spectra to evaluate to what extent these results are transferable across platforms and to develop cross-platform chemical signatures. Non-targeted global metabolite profiles of SRM 1950 were obtained on different LC/MS platforms using reversed-phase chromatography and different chromatographic scales (conventional HPLC, UHPLC and nanoLC). The data processing and the metabolite differential analysis were carried out using publically available (XCMS), proprietary (Mass Profiler Professional) and in-house software (NIST pipeline). Repeatability and intermediate precision showed that the non-targeted SRM 1950 profiling was highly reproducible when working on the same platform (relative standard deviation (RSD) HPLC, UHPLC and nanoLC) on the same platform. A substantial degree of overlap (common molecular features) was also found. A procedure to generate consistent chemical signatures using tandem mass spectral libraries of recurrent spectra is proposed. Different platforms rendered significantly different metabolite profiles, but the results were highly reproducible when working within one platform. Tandem mass spectral libraries of recurrent spectra are proposed to evaluate the degree of transferability of chemical signatures generated on different platforms. Chemical signatures based on our procedure are most likely cross-platform transferable. Published in 2016. This article is a U.S. Government work and is in the public domain in the USA.
Flowfield Behavior of Supersonic Impinging Jets
Iyer, K. G.; Alvi, F. S.
1998-11-01
A detailed study is being conducted which examines the behavior of normally impinging, supersonic jets, issuing from axisymmetric a Mach 1.5 C-D and a sonic nozzle. Our goal is to understand the physics of this flowfield (commonly observed in STOVL aircraft) and its influence on the acoustic and aerodynamic loading on the ground plane and the airframe. The airframe is simulated by a circular disc ('lift' plate) with an annular hole from which the jet is issued. Tests are carried out for a wide range of pressure ratios and the ground plane distance is varied from 1.5 to 60 nozzle diameters. Flowfield measurements include Particle Image Velocimetry (PIV) and schlieren/shadowgraph visualization. Surface measurements on the ground and lift plates include mean and unsteady surface pressure distributions and the surface streamline visualization. Near-field acoustic measurements using a microphone are also obtained. For certain cases, the PIV measurements -- first of their kind, to our knowledge -- clearly show the presence of large-scale coherent turbulent structures which, upon jet impingement, propagate into the resulting wall jet. These structures are believed to generate very high unsteady pressure loads on the ground plane thus leading to ground erosion. They are also suspected to be the source of acoustic waves which lead to a feedback loop causing violent oscillations of the primary jet and can result in increased acoustic loading and subsequent damage to the aircraft. As a result of this detailed study over a wide parametric space, we hope to gain a much better understanding of the physical mechanisms governing this complex flow.
Pierson, B.; Menier, D.; Ting, K. K.; Chalabi, A.
2012-04-01
Satellite images of present-day reefs and carbonate platforms of the Celebes Sea, east of Sabah, Malaysia, exhibit large-scale features indicative of the recent evolution of the platforms. These include: (1) multiple, sub-parallel reef rims at the windward margin, suggestive of back-stepping of the platform margin; (2) contraction of the platform, possibly as a result of recent sea level fluctuations; (3) colonization of the internal lagoons by polygonal reef structures and (4) fragmentation of the platforms and creation of deep channels separating platforms that used to be part of a single entity. These features are analogue to what has been observed on seismic attribute maps of Miocene carbonate platforms of Sarawak. An analysis of several growth stages of a large Miocene platform, referred to as the Megaplatform, shows that the platform evolves in function of syn-depositional tectonic movements and sea level fluctuations that result in back-stepping of the margin, illustrated by multiple reef rims, contraction of the platform, the development of polygonal structures currently interpreted as karstic in origin and fragmentation of the megaplatform in 3 sub-entities separated by deep channels that precedes the final demise of the whole platform. Comparing similar features on present-day to platforms and Miocene platforms leads to a better understanding of the growth history of Miocene platforms and to a refined predictability of reservoir and non-reservoir facies distribution.
Directory of Open Access Journals (Sweden)
Kracik Jan
2017-01-01
Full Text Available This work aims at investigating the primary nozzle position in a proposed supersonic air ejector device. The ejector is primarily made up of a supersonic primary nozzle, which is located in the axis of the ejector, a suction chamber or secondary stream inlet, a mixing chamber and a diffuser. The ejector design allows to translate the primary nozzle in the axis direction and fix it in a chosen distance from the beginning of the mixing chamber and hence influence the secondary mass flow rate. In a limit case, it is possible to set the nozzle to such a position where no secondary flow occurs. If we ignore the case where no secondary flow occurs, five different nozzle distances have been investigated in this paper. Some cases seem to be alike and there are no significant dissimilarities between them. Courses of relative back-pressure ratio are carried out against the entrainment ratio and transition between on-design and off-design regimes is determined. Measurements of the mixed flow based on the standard ISO 5167 are performed by means of orifice plate method. In addition, a comparison between experiments and simulations performed by Ansys Fluent software is presented in order to indicate further improvements to the numerical model.
Towards a Framework of Digital Platform Disruption
DEFF Research Database (Denmark)
Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.
2014-01-01
Digital platforms are disruptive information technology (IT) artifacts that erode conventional business logic associated with traditional market structures. This paper presents a framework for examining the disruptive potential of digital platforms whereby we postulate that the strategic interplay...... digital platforms purposely decouple platform layers, to foster open innovation and accelerate market disruption. This paper therefore represents a first concrete step aimed at unravelling the disruptive potential of digital platforms....... of governance regimes and platform layers is deterministic of whether disruptive derivatives are permitted to flourish. This framework has been employed in a comparative case study between centralized (i.e., PayPal) and decentralized (i.e., Coinkite) digital payment platforms to illustrate its applicability...
Product Platform Development in Industrial Networks
DEFF Research Database (Denmark)
Karlsson, Christer; Skold, Martin
2011-01-01
The article examines the strategic issues involved in the deployment of product platform development in an industrial network. The move entails identifying the types and characteristics of generically different product platform strategies and clarifying strategic motives and differences. Number o...... of platforms and product brands serve as the key dimensions when distinguishing the different strategies. Each strategy has its own challenges and raises various issues to deal with.......The article examines the strategic issues involved in the deployment of product platform development in an industrial network. The move entails identifying the types and characteristics of generically different product platform strategies and clarifying strategic motives and differences. Number...
The universal modular platform
International Nuclear Information System (INIS)
North, R.B.
1995-01-01
A new and patented design for offshore wellhead platforms has been developed to meet a 'fast track' requirement for increased offshore production, from field locations not yet identified. The new design uses modular construction to allow for radical changes in the water depth of the final location and assembly line efficiency in fabrication. By utilizing high strength steels and structural support from the well conductors the new design accommodates all planned production requirements on a support structure significantly lighter and less expensive than the conventional design it replaces. Twenty two platforms based on the new design were ready for installation within 18 months of the project start. Installation of the new platforms began in 1992 for drilling support and 1993 for production support. The new design has become the Company standard for all future production platforms. Large saving and construction costs have been realized through its light weight, flexibility in both positioning and water depth, and its modular construction
International Nuclear Information System (INIS)
Zhang, Z.J.; Zhu, Y.J.; Bao, J.; Lin, X.R.; Zheng, H.Z.
2011-01-01
Highlights: → The α-nickel hydroxides doped with several elements were prepared by supersonic co-precipitation method. → Cyclic voltammetry and electrochemical impedance spectroscopy show sample C has the best electrochemical performance. → The charge/discharge tests show that the 0.5 C discharge capacity (346 mAh/g) of sample C is even larger than that (337 mAh/g) at 0.1 C rate, while the discharge capacity at 0.5 C rate is much lower than that at 0.1 C rate for samples A and B. - Abstract: The multi-element doped α-nickel hydroxides have been prepared by supersonic co-precipitation method. Three kinds of samples A, B, C were prepared by chemically coprecipitating Ni, Al, Co, Y, Zn. It was found that sample C produced better performance than the others. The cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS) measurements indicated that sample C has better electrochemical performance, such as better reaction reversibility, higher proton diffusion coefficient and lower charge-transfer resistance, than those of samples A and B. The charge-discharge tests showed that the discharge capacity (346 mA h/g) of sample C is even larger at 0.5 C rate than that (337mAh/g) at 0.1 C rate, while the discharge capacity at 0.5 C rate is much lower than that at 0.1 C rate for samples A and B. It indicates that all doped elements can produce the synergic effect and further improve the electrochemical properties of the active materials.
Supersonic Heat Wave Propagation in Laser-Produced Underdense Plasma for Efficient X-Ray Generation
International Nuclear Information System (INIS)
Tanabe, M.; Nishimura, H.; Fujioka, S.; Nagai, K.; Iwamae, A.; Ohnishi, N.; Fournier, K.B.; Girard, F.; Primout, M.; Villette, B.; Tobin, M.; Mima, K.
2008-01-01
We have observed supersonic heat wave propagation in a low-density aerogel target (ρ ∼ 3.2 mg/cc) irradiated at the intensity of 4 x 10 14 W/cm 2 . The heat wave propagation was measured with a time-resolved x-ray imaging diagnostics, and the results were compared with simulations made with the two-dimensional radiation-hydrodynamic code, RAICHO. Propagation velocity of the ionization front gradually decreased as the wave propagates into the target. The reason of decrease is due to increase of laser absorption region as the front propagates and interplay of hydrodynamic motion and reflection of laser propagation. These features are well reported with the simulation
Ground, Cody R.; Gopal, Vijay; Maddalena, Luca
2018-04-01
By introducing large-scale streamwise vortices into a supersonic flow it is possible to enhance the rate of mixing between two fluid streams. However, increased vorticity content alone does not explicitly serve as a predictor of mixing enhancement. Additional factors, particularly the mutual interactions occurring between neighboring vortical structures, affect the underlying fundamental physics that influence the rate at which the fluids mix. As part of a larger systematic study on supersonic streamwise vortex interactions, this work experimentally quantifies the average rate of mixing of helium and air in the presence of two separate modes of vortex interaction, the merging and non-merging of a pair of co-rotating vortices. In these experiments vortex-generating expansion ramps are placed on a strut injector. The freestream Mach number is set at 2.5 and helium is injected as a passive scalar. Average injectant mole fractions at selected flow planes downstream of the injector are measured utilizing the filtered Rayleigh scattering technique. The filtered Rayleigh scattering measurements reveal that, in the domain surveyed, the merging vortex interaction strongly displaces the plume from its initial horizontal orientation while the non-merging vortex interaction more rapidly mixes the helium and air. The results of the current experiments are consistent with associated knowledge derived from previous analyses of the two studied configurations which have included the detailed experimental characterization of entrainment, turbulent kinetic energy, and vorticity of both modes of vortex interaction.
Nonlinear interaction between a pair of oblique modes in a supersonic mixing layer: Long-wave limit
Balsa, Thomas F.; Gartside, James
1995-01-01
The nonlinear interaction between a pair of symmetric, oblique, and spatial instability modes is studied in the long-wave limit using asymptotic methods. The base flow is taken to be a supersonic mixing layer whose Mach number is such that the corresponding vortex sheet is marginally stable according to Miles' criterion. It is shown that the amplitude of the mode obeys a nonlinear integro-differential equation. Numerical solutions of this equation show that, when the obliqueness angle is less than pi/4, the effect of the nonlinearity is to enhance the growth rate of the instability. The solution terminates in a singularity at a finite streamwise location. This result is reminiscent of that obtained in the vicinity of the neutral point by other authors in several different types of flows. On the other hand, when the obliqueness angle is more than pi/4, the streamwise development of the amplitude is characterized by a series of modulations. This arises from the fact that the nonlinear term in the amplitude equation may be either stabilizing or destabilizing, depending on the value of the streamwise coordinate. However, even in this case the amplitude of the disturbance increases, though not as rapidly as in the case for which the angle is less than pi/4. Quite generally then, the nonlinear interaction between two oblique modes in a supersonic mixing layer enhances the growth of the disturbance.
Ryan, Thomas W., III; Schwab, S. T.; Harlowe, W. W.
1992-01-01
The subject of this paper is the design of supersonic combustors which will be required in order to achieve the needed reaction rates in a reasonable sized combustor. A fuel additive approach, which is the focus of this research, is the use of pyrophorics to shorten the ignition delay time and to increase the energy density of the fuel. Pyrophoric organometallic compounds may also provide an ignition source and flame stabilization mechanism within the combustor, thus permitting use of hydrocarbon fuels in supersonic combustion systems. Triethylaluminum (TEA) and trimethylaluminum (TMA) were suggested for this application due to their high energy density and reactivity. The objective here is to provide comparative data for the ignition quality, the energy content, and the reaction rates of several different adducts of both TEA and TMA. The results of the experiments indicate the aluminum alkyls and their more stable derivatives reduce the ignition delay and total reaction time to JP-10 jet fuel. Furthermore, the temperature dependence of ignition delay and total reaction time of the blends of the adducts are significantly lower than in neat JP-10.
Sakata, I. F.; Davis, G. W.
1975-01-01
The analyses performed to provide structural mass estimates for the arrow wing supersonic cruise aircraft are presented. To realize the full potential for structural mass reduction, a spectrum of approaches for the wing and fuselage primary structure design were investigated. The objective was: (1) to assess the relative merits of various structural arrangements, concepts, and materials; (2) to select the structural approach best suited for the Mach 2.7 environment; and (3) to provide construction details and structural mass estimates based on in-depth structural design studies. Production costs, propulsion-airframe integration, and advanced technology assessment are included.
Utilization of an arc-heated jet for production of supersonic seeded beams of atomic nitrogen
International Nuclear Information System (INIS)
Bickes, R.W. Jr.; Newton, K.R.; Herrmann, J.M.; Bernstein, R.B.
1976-01-01
Intense supersonic beams of atomic nitrogen (>10 17 atoms sr -1 sec -1 ) have been produced from the dissociation of N 2 in an Ar arc (at temperatures in excess of 6000 K) using the arc-heated nozzle beam source of Young, Rodgers, and Knuth. Experiments characterizing the N 2 dissociation and the translational energies of the N, N 2 , and Ar components in the beams are described. Evidence is presented for the formation of atomic C as well as C 2 and CH from the pyrolysis of CH 4 and C 2 H 4 in the Ar arc
Normal Impingement of a Supersonic Jet on a Plane - A Basic Study of Shock-Interference Heating
1975-12-01
George Xaler, Pail Zone Dr. H. Lew 28i0 Mr. J. W. Paust A . Mkrtallucci W. Daskin J. D. Cresaswell J. pvttu" J. Cor%.nto C. l!arri, F. GCOrge1. 4...NSWC/WOL/TR 75195 low zE ~ 1 WHITE OAK LABORATORY SNORMAL IMPINGEMENT OF A SUPERSONIC JET ON A PLANE - A BASIC STUDY OF SHOCK-INTERFERENCE HEATING...OF THIS PAGE ("oin DomejaE’ored) __________________ REPORT DOCUMENTATION PAGE READ INSTRUCTIONS4 2. OV ACE.~ CONTRAT O0GRN NUMBER~ a NS. P ER OR M I
DEFF Research Database (Denmark)
Ingvorsen, Kristian Mark; Buchmann, Nicolas A.; Soria, Julio
2012-01-01
-fluid interactions in these high-speed flows special high performance techniques are required. The present work is an investigation into the applicability of magnified digital in-line holography with ultra-high-speed recording for the study of three-dimensional supersonic particle-laden flows. An optical setup...... × 10mm calibration grid and 120 μm particles on a glass plate. In the case with the calibration grid it is found that accurate determination of the depthwise position is possible. However, when applying the same technique to the particle target, significant problems are encountered. © 2012...
New offshore platform in the Mexican Gulf
Energy Technology Data Exchange (ETDEWEB)
Beisel, T.
1982-04-01
After a construction period of only 10 months, the second steel Offshore platform was recently completed in the Mexican Gulf. The pattern for this structure was the Cognac platform. The erection of the new platform, called the 'Cerveza' platform, is described in the article.
Sinking offshore platform. Nedsenkbar fralandsplatform
Energy Technology Data Exchange (ETDEWEB)
Einstabland, T.B.; Olsen, O.
1988-12-19
The invention deals with a sinking offshore platform of the gravitational type designed for being installed on the sea bed on great depths. The platform consists of at least three inclining pillars placed on a foundation unit. The pillars are at the upper end connected to a tower structure by means of a rigid construction. The tower supports the platform deck. The rigid construction comprises a centre-positioned cylinder connected to the foundation. 11 figs.
Understanding Platform-Based Digital Currencies
Ben Fung; Hanna Halaburda
2014-01-01
Given technological advances and the widespread use of the Internet, various digital currencies have emerged. In most cases, Internet platforms such as Facebook and Amazon restrict the functionality of their digital currencies to enhance the business model and maximize their profits. While platform-based digital currencies could increase the efficiency of retail payments, they could also raise some important policy issues if they were to become widely used outside of the platform. Thus, it is...
Evolutionary space platform concept study. Volume 2, part B: Manned space platform concepts
1982-01-01
Logical, cost-effective steps in the evolution of manned space platforms are investigated and assessed. Tasks included the analysis of requirements for a manned space platform, identifying alternative concepts, performing system analysis and definition of the concepts, comparing the concepts and performing programmatic analysis for a reference concept.
Polymer-based platform for microfluidic systems
Benett, William [Livermore, CA; Krulevitch, Peter [Pleasanton, CA; Maghribi, Mariam [Livermore, CA; Hamilton, Julie [Tracy, CA; Rose, Klint [Boston, MA; Wang, Amy W [Oakland, CA
2009-10-13
A method of forming a polymer-based microfluidic system platform using network building blocks selected from a set of interconnectable network building blocks, such as wire, pins, blocks, and interconnects. The selected building blocks are interconnectably assembled and fixedly positioned in precise positions in a mold cavity of a mold frame to construct a three-dimensional model construction of a microfluidic flow path network preferably having meso-scale dimensions. A hardenable liquid, such as poly (dimethylsiloxane) is then introduced into the mold cavity and hardened to form a platform structure as well as to mold the microfluidic flow path network having channels, reservoirs and ports. Pre-fabricated elbows, T's and other joints are used to interconnect various building block elements together. After hardening the liquid the building blocks are removed from the platform structure to make available the channels, cavities and ports within the platform structure. Microdevices may be embedded within the cast polymer-based platform, or bonded to the platform structure subsequent to molding, to create an integrated microfluidic system. In this manner, the new microfluidic platform is versatile and capable of quickly generating prototype systems, and could easily be adapted to a manufacturing setting.
Experimental Performance Evaluation of a Supersonic Turbine for Rocket Engine Applications
Snellgrove, Lauren M.; Griffin, Lisa W.; Sieja, James P.; Huber, Frank W.
2003-01-01
In order to mitigate the risk of rocket propulsion development, efficient, accurate, detailed fluid dynamics analysis and testing of the turbomachinery is necessary. To support this requirement, a task was developed at NASA Marshall Space Flight Center (MSFC) to improve turbine aerodynamic performance through the application of advanced design and analysis tools. These tools were applied to optimize a supersonic turbine design suitable for a reusable launch vehicle (RLV). The hot gas path and blading were redesigned-to obtain an increased efficiency. The goal of the demonstration was to increase the total-to- static efficiency of the turbine by eight points over the baseline design. A sub-scale, cold flow test article modeling the final optimized turbine was designed, manufactured, and tested in air at MSFC s Turbine Airflow Facility. Extensive on- and off- design point performance data, steady-state data, and unsteady blade loading data were collected during testing.
Aerodynamic optimization of supersonic compressor cascade using differential evolution on GPU
Energy Technology Data Exchange (ETDEWEB)
Aissa, Mohamed Hasanine; Verstraete, Tom [Von Karman Institute for Fluid Dynamics (VKI) 1640 Sint-Genesius-Rode (Belgium); Vuik, Cornelis [Delft University of Technology 2628 CD Delft (Netherlands)
2016-06-08
Differential Evolution (DE) is a powerful stochastic optimization method. Compared to gradient-based algorithms, DE is able to avoid local minima but requires at the same time more function evaluations. In turbomachinery applications, function evaluations are performed with time-consuming CFD simulation, which results in a long, non affordable, design cycle. Modern High Performance Computing systems, especially Graphic Processing Units (GPUs), are able to alleviate this inconvenience by accelerating the design evaluation itself. In this work we present a validated CFD Solver running on GPUs, able to accelerate the design evaluation and thus the entire design process. An achieved speedup of 20x to 30x enabled the DE algorithm to run on a high-end computer instead of a costly large cluster. The GPU-enhanced DE was used to optimize the aerodynamics of a supersonic compressor cascade, achieving an aerodynamic loss minimization of 20%.
Louisiana Geographic Information Center — Offshore Minerals Management Platforms for the Gulf of Mexico (GOM). Identifies the location of platforms in GOM. All platforms existing in the database are included.
Josko, Deborah
2014-01-01
The advent of DNA sequencing technologies and the various applications that can be performed will have a dramatic effect on medicine and healthcare in the near future. There are several DNA sequencing platforms available on the market for research and clinical use. Based on the medical laboratory scientist or researcher's needs and taking into consideration laboratory space and budget, one can chose which platform will be beneficial to their institution and their patient population. Although some of the instrument costs seem high, diagnosing a patient quickly and accurately will save hospitals money with fewer hospital stays and targeted treatment based on an individual's genetic make-up. By determining the type of disease an individual has, based on the mutations present or having the ability to prescribe the appropriate antimicrobials based on the knowledge of the organism's resistance patterns, the clinician will be better able to treat and diagnose a patient which ultimately will improve patient outcomes and prognosis.
International Nuclear Information System (INIS)
Inutake, Masaaki; Ando, Akira
2007-01-01
Fast plasma flow is produced by Magneto-Plasma-Dynamic Arcjet (MPDA). The properties of fast flow and shock wave in various magnetic channels are reported by the experiment results. Fast plasma flow by MPDA, shocked flow in the magnetic channel, supersonic plasma flow in the divergence magnetic nozzle, ion acoustic wave in the mirror field, transonic flow and sonic throat in the magnetic Laval nozzle, fast flow in the helical magnetic channel, and future subjects are reported. Formation of the supersonic plasma flow by the divergence magnetic nozzle and effects of background gas, helical-kink instability in the fast plasma jet, and formation of convergence magnetic nozzle near outlet are described. From the phase difference of azimuthal and axial probe array signals, the plasma has twisted structure and it rotates in the same direction of the twist. Section of MPDA, principle of magnetic acceleration of MPDA, HITOP, relation among velocities, temperature, and Mach number of He ion and atom and the discharge current, distribution of magnetic-flux density in the direction of electromagnetic field, measurement of magnetic field near MPDA exit are illustrated. (S.Y.)
Towards a Framework of Digital Platform Competition
DEFF Research Database (Denmark)
Kazan, Erol; Tan, Chee-Wee; Lim, Eric T. K.
2016-01-01
between monopolistic (i.e., Pingit) and federated (i.e., Paym) mobile payment platforms to illustrate its applicability and yield principles on the nature and impact of competition among platform-driven ubiquitous systems. Preliminary findings indicate that monopolistic mobile digital platforms attempt...... to create unique configurals to obtain monopolistic power by tightly coupling platform layers, which are difficult to replicate. Conversely, federated digital platforms compete by dispersing the service layer to harness the collective resources from individual firms. Furthermore, the interaction...
Modified k-l model and its ability to simulate supersonic axisymmetric turbulent flows
International Nuclear Information System (INIS)
Ahmadikia, H.; Shirani, E.
2001-05-01
The k-l turbulence model is a promising two-equation model. In this paper, the k and l model equations were derived from k-kl incompressible and one-equation turbulent models. Then the model was modified for compressible and transitional flows, and was applied to simulate supersonic axisymmetric flows over Hollow cylinder flare an hyperboloid flare bodies. The results were compared with the results obtained for the same flows experimentally as well as k-ε, k-ω and Baldwin-Lomax models. It was shown that the k-l model produces good results compared with experimental data and numerical data obtained when other turbulence models were used. It gives better results than k-ω and k-ε models in some cases. (author)
Characterization of 17-4PH stainless steel powders produced by supersonic gas atomization
Zhao, Xin-Ming; Xu, Jun; Zhu, Xue-Xin; Zhang, Shao-Ming; Zhao, Wen-Dong; Yuan, Guo-Liang
2012-01-01
17-4PH stainless steel powders were prepared using a supersonic nozzle in a close-coupled gas atomization system. The characteristics of powder particles were carried out by means of a laser particle size analyzer, scanning electron microscopy (SEM), and the X-ray diffraction (XRD) technique. The results show that the mass median particle diameter is about 19.15 μm. Three main types of surface microstructures are observed in the powders: well-developed dendrite, cellular, and cellular dendrite structure. The XRD measurements show that, as the particle size decreases, the amount of fcc phase gradually decreases and that of bcc phase increases. The cooling rate is inversely related to the particle size, i.e., it decreases with an increase in particle size.
User manual for NASA Lewis 10 by 10 foot supersonic wind tunnel. Revised
Soeder, Ronald H.
1995-01-01
This manual describes the 10- by 10-Foot Supersonic Wind Tunnel at the NASA Lewis Research Center and provides information for users who wish to conduct experiments in this facility. Tunnel performance operating envelopes of altitude, dynamic pressure, Reynolds number, total pressure, and total temperature as a function of test section Mach number are presented. Operating envelopes are shown for both the aerodynamic (closed) cycle and the propulsion (open) cycle. The tunnel test section Mach number range is 2.0 to 3.5. General support systems, such as air systems, hydraulic system, hydrogen system, fuel system, and Schlieren system, are described. Instrumentation and data processing and acquisition systems are also described. Pretest meeting formats and schedules are outlined. Tunnel user responsibility and personnel safety are also discussed.
Assembly procedure for Shot Loading Platform
International Nuclear Information System (INIS)
Routh, R.D.
1995-01-01
This supporting document describes the assembly procedure for the Shot Loading Platform. The Shot Loading Platform is used by multiple equipment removal projects to load shielding shot in the annular spaces of the equipment storage containers. The platform height is adjustable to accommodate different sizes of storage containers and transport assemblies
Platform decisions supported by gaming
DEFF Research Database (Denmark)
Hansen, Poul H. Kyvsgård; Mikkola, Juliana Hsuan
2007-01-01
Platform is an ambiguous multidisciplinary concept. The philosophy behind it is easy to communicate and makes intuitively sense. However, the ease in communication does overshadow the high complexity when the concept is implemented. The practical industrial platform implementation challenge can...... be described as being a configuration problem with a high number of variables. These variables are different in nature; they have contradictory influence on the total performance, and, their importance change over time. Consequently, the specific platform decisions become highly complex and the consequences...
Digital platforms as enablers for digital transformation
DEFF Research Database (Denmark)
Hossain, Mokter; Lassen, Astrid Heidemann
transformation is crucial. This study aims at exploring how organizations are driven towards transformation in various ways to embrace digital platforms for ideas, technologies, and knowledge. It shows the opportunities and challenges digital platforms bring in organizations. It also highlights underlying......Digital platforms offer new ways for organizations to collaborate with the external environment for ideas, technologies, and knowledge. They provide new possibilities and competence but they also bring new challenges for organizations. Understanding the role of these platforms in digital...... mechanisms and potential outcomes of various digital platforms. The contribution of the submission is valuable for scholars to understand and further explore this area. It provides insight for practitioners to capture value through digital platforms and accelerate the pace of organizations’ digital...
Toba, Kenji
2017-07-01
The Organized Registration for the Assessment of dementia on Nationwide General consortium toward Effective treatment in Japan (ORANGE platform) is a recently established nationwide clinical registry for dementia. This platform consists of multiple registries of patients with dementia stratified by the following clinical stages: preclinical, mild cognitive impairment, early-stage, and advanced-stage dementia. Patients will be examined in a super-longitudinal fashion, and their lifestyle, social background, genetic risk factors, and required care process will be assessed. This project is also notable because the care registry includes information on the successful, comprehensive management of patients with dementia. Therefore, this multicenter prospective cohort study will contribute participants to all clinical trials for Alzheimer's disease as well as improve the understanding of individuals with dementia.
Energy Technology Data Exchange (ETDEWEB)
Nikolic, M.; Samolov, A.; Popovic, S.; Vuskovic, L.; Godunov, A. [Department of Physics, Center for Accelerator Science, Old Dominion University, Norfolk, Virginia 23529 (United States); Cuckov, F. [Department of Electrical and Computer Engineering, Old Dominion University, Norfolk, Virginia 23529 (United States)
2013-03-14
A tomographic numerical method based on the two-dimensional Radon formula for a cylindrical cavity has been employed for obtaining spatial distributions of the argon excited levels. The spectroscopy measurements were taken at different positions and directions to observe populations of excited species in the plasmoid region and the corresponding excitation temperatures. Excited argon states are concentrated near the tube walls, thus, confirming the assumption that the post discharge plasma is dominantly sustained by travelling surface wave. An automated optical measurement system has been developed for reconstruction of local plasma parameters of the plasmoid structure formed in an argon supersonic flowing microwave discharge. The system carries out angle and distance measurements using a rotating, flat mirror, as well as two high precision stepper motors operated by a microcontroller-based system and several sensors for precise feedback control.
Redkar, Tejaswi
2011-01-01
The Windows Azure Platform has rapidly established itself as one of the most sophisticated cloud computing platforms available. With Microsoft working to continually update their product and keep it at the cutting edge, the future looks bright - if you have the skills to harness it. In particular, new features such as remote desktop access, dynamic content caching and secure content delivery using SSL make the latest version of Azure a more powerful solution than ever before. It's widely agreed that cloud computing has produced a paradigm shift in traditional architectural concepts by providin