WorldWideScience

Sample records for superconducting sc technology

  1. Superconducting Technology Assessment

    Science.gov (United States)

    2005-08-01

    of Nb/Al- Nx /NbTiN junctions for SIS mixer applications,” IEEE Trans. Appl. Superconduct., vol. 11, pp. 76–79, Mar. 2001. [48] M. Gurvitch, W. A...Another connector developed by IBM for commercial applications using a dendritic interposer technology. A “beam-on-pad” approach developed by Siemens

  2. Superconductivity at 3.1 K in the orthorhombic ternary silicide ScRuSi

    Science.gov (United States)

    Ruan, Bin-Bin; Wang, Xiao-Chuan; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-02-01

    We report the synthesis, crystal structure, superconductivity and physical property characterizations of the ternary equiatomic compound ScRuSi. Polycrystalline samples of ScRuSi were prepared by an arc-melting method. The as-prepared samples were identified as the orthorhombic Co2P-type o-ScRuSi by powder x-ray diffraction analysis. Electrical resistivity measurements show o-ScRuSi to be a metal which superconducts below a T c of 3.1 K; the upper critical field μ 0 H c2(0) is estimated to be 0.87 T. The magnetization and specific heat measurements confirm the bulk type-II superconductivity in o-ScRuSi, with a specific heat jump within the BCS weak coupling limit. o-ScRuSi is the first Co2P-type superconductor to contain scandium. After annealing at 1273 K for a week, o-ScRuSi transforms into hexagonal Fe2P-type h-ScRuSi, which is a Pauli-paramagnetic metal with no superconductivity observed above 1.8 K.

  3. Advanced fusion technologies developed for JT-60 superconducting tokamak

    Science.gov (United States)

    Sakasai, A.; Ishida, S.; Matsukawa, M.; Akino, N.; Ando, T.; Arai, T.; Ezato, K.; Hamada, K.; Ichige, H.; Isono, T.; Kaminaga, A.; Kato, T.; Kawano, K.; Kikuchi, M.; Kizu, K.; Koizumi, N.; Kudo, Y.; Kurita, G.; Masaki, K.; Matsui, K.; Miura, Y. M.; Miya, N.; Miyo, Y.; Morioka, A.; Nakajima, H.; Nunoya, Y.; Oikawa, A.; Okuno, K.; Sakurai, S.; Sasajima, T.; Satoh, K.; Shimizu, K.; Takeji, S.; Takenaga, K.; Tamai, H.; Taniguchi, M.; Tobita, K.; Tsuchiya, K.; Urata, K.; Yagyu, J.

    2004-02-01

    Modification of JT-60 as a full superconducting tokamak (JT-60SC) is planned. The objectives of the JT-60SC programme are to establish scientific and technological bases for steady-state operation of high performance plasmas and utilization of reduced-activation materials in an economically and environmentally attractive DEMO reactor. Advanced fusion technologies relevant to the DEMO reactor have been developed for the superconducting magnet technology and plasma facing components of the JT-60SC design. To achieve a high current density in a superconducting strand, Nb3Al strands with a high copper ratio of 4 have been newly developed for the toroidal field coils (TFCs) of JT-60SC. The R&D to demonstrate the applicability of the Nb3Al conductor to TFCs by a react-and-wind technique has been carried out using a full-size Nb3Al conductor. A full-size NbTi conductor with low ac loss using Ni-coated strands has been successfully developed. A forced cooling divertor component with high heat transfer using screw tubes has been developed for the first time. The heat removal performance of the carbon fibre composite target was successfully demonstrated on an electron beam irradiation stand.

  4. The Future of Superconducting Technology for Particle Accelerators

    CERN Document Server

    Yamamoto, Akira

    2015-01-01

    Introduction: - Colliders constructed and operated - Future High Energy Colliders under Study - Superconducting Phases and Applications - Possible Choices among SC Materials Superconducting Magnets and the Future - Advances in SC Magnets for Accelerators - Nb3Sn for realizing Higher Field - NbTi to Nb3Sn for realizing High Field (> 10 T) - HL-LHC as a critical milestone for the Future of Acc. Magnet Technology - Nb3Sn Superconducting Magnets (> 11 T)and MgB2 SC Links for HL-LHC - HL-LHC, 11T Dipole Magnet - Nb3Sn Quadrupole (MQXF) at IR - Future Circular Collider Study - Conductor development (1998-2008) - Nb3Sn conductor program - 16 T Dipole Options and R&D sharing - Design Study and Develoment for SppC in China - High-Field Superconductor and Magnets - HTS Block Coil R&D for 20 T - Canted Cosine Theta (CCT) Coil suitable with Brittle HTS Conductor - A topic at KEK: S-KEKB IRQs just integrated w/ BELLE-II ! Superconducting RF and the Future - Superconducting Phases and Applications - Poss...

  5. 超导ECR离子源DECRIS-SC2%Project of the Superconducting ECR Ion Source DECRIS-SC2

    Institute of Scientific and Technical Information of China (English)

    V.V.Bekhterev; V.V.Seleznev; A.Shishov; G.P.Tsvineva; N.YU.Yazvitsky; B.I.Yakovlev; S.L.Bogomolov; V.I.Datskov; V.M.Drobin; S.N.Dmitriev; A.A.Efremov; V.N.Loginov; A.N.Lebedev; H.Malinowski

    2007-01-01

    A new compact version of the"liquid He-free"superconducting Electron Cyclotron Resonance Ion Source,to be used as an injector for the U-400M cyclotron,is presently under construction at the FLNR in collaboration with LHE(JINR).The axial magnetic field of the source is created by the superconducting magnet,and the NdFeB hexapole is used for the radial plasma confinement.The microwave frequency of 14GHz will be used for ECR plasma heating.The DECRIS-SC2 superconducting magnet is designed for the induction of a magnetic field on the axis of the source of up to 1.4T (extraction side) and 1.9T (injection side) at nominal current of 75A.Cooling of the coils is carried out by GM cryocooler with cooling power of 1W at the temperature 4.5K.The basic design features of the superconducting magnet and of the ion source are presented.The main parts of the source are in production.The first beam test of the source is expected in the beginning of 2007.

  6. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa3

    Science.gov (United States)

    Parvin, F.; Hossain, M. A.; Ali, M. S.; Islam, A. K. M. A.

    2015-01-01

    The rare occurrence of type-I superconductivity in binary system ScGa3 has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ~13 eV and thus ScGa3 can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa3 are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0-1000 K and 0-40 GPa, respectively. The calculated electron-phonon coupling constant λ=0.52 yields Tc=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg-Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  7. Mechanical, electronic, optical, thermodynamic properties and superconductivity of ScGa{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Parvin, F. [Department of Physics, Rajshahi University, Rajshahi (Bangladesh); Hossain, M.A. [Department of Physics, Mawlana Bhashani Science and Technology University, Santosh, Tangail 1902 (Bangladesh); Ali, M.S. [Department of Physics, Rajshahi University, Rajshahi (Bangladesh); Islam, A.K.M.A., E-mail: azi46@ru.ac.bd [International Islamic University Chittagong, 154/A College Road, Chittagong 4203 (Bangladesh)

    2015-01-15

    The rare occurrence of type-I superconductivity in binary system ScGa{sub 3} has experimentally been shown recently. In the present paper we study the electronic, optical, thermodynamic properties and some aspects of superconductivity of this compound using first-principles calculations. The mechanical properties like elastic constants, bulk modulus, shear modulus, Pugh's ductility index, Young's modulus, Poisson's ratio, elastic anisotropy factor, Peierls stress are calculated for the first time. The material is anisotropic and brittle. Electronic band structure, density of states, Fermi surfaces and bonding nature have also been studied. The optical functions are estimated and discussed for the first time. The high reflectivity is found in the ultraviolet regions up to ∼13 eV and thus ScGa{sub 3} can serve as a possible shielding material for ultraviolet radiation. Thermal effects on some macroscopic properties of ScGa{sub 3} are predicted using the quasi-harmonic Debye model and phonon approximation in the temperature and hydrostatic pressure in the ranges of 0–1000 K and 0–40 GPa, respectively. The calculated electron–phonon coupling constant λ=0.52 yields T{sub c}=2.6 K, which is in very good agreement with the experimentally observed value. The value of the coupling constant and the Ginzburg–Landau parameter (κ=0.09) indicate that the compound is a weak-coupled type-I rare binary BCS superconductor.

  8. Superconducting Radio Frequency Technology: An Overview

    Energy Technology Data Exchange (ETDEWEB)

    Peter Kneisel

    2003-06-01

    Superconducting RF cavities are becoming more often the choice for larger scale particle accelerator projects such as linear colliders, energy recovery linacs, free electron lasers or storage rings. Among the many advantages compared to normal conducting copper structures, the superconducting devices dissipate less rf power, permit higher accelerating gradients in CW operation and provide better quality particle beams. In most cases these accelerating cavities are fabricated from high purity bulk niobium, which has superior superconducting properties such as critical temperature and critical magnetic field when compared to other superconducting materials. Research during the last decade has shown, that the metallurgical properties--purity, grain structure, mechanical properties and oxidation behavior--have significant influence on the performance of these accelerating devices. This contribution attempts to give a short overview of the superconducting RF technology with emphasis on the importance of the material properties of the high purity niobium.

  9. Future of IT, PT and superconductivity technology

    Science.gov (United States)

    Tanaka, Shoji

    2003-10-01

    Recently the Information Technology is developing very rapidly and the total traffic on the Internet is increasing dramatically. The numerous equipments connected to the Internet must be operated at very high-speed and the electricity consumed in the Internet is also increasing. Superconductivity devices of very high-speed and very low power consumption must be introduced. These superconducting devices will play very important roles in the future information society. Coated conductors will be used to generate extremely high magnetic fields of beyond 20 T at low temperatures. At the liquid nitrogen temperature they can find many applications in a wide range of Power Technology and other industries, since we have already large critical current and brilliant magnetic field dependences in some prototypes of coated conductors. It is becoming certain that the market for the superconductivity technology will be opened between the years of 2005 and 2010.

  10. Two-gap superconductivity in R2Fe3Si5 (R=Lu, Sc and Sc5Ir4Si10

    Directory of Open Access Journals (Sweden)

    Tsuyoshi Tamegai, Yasuyuki Nakajima, Tsuyoshi Nakagawa, Guoji Li and Hisatomo Harima

    2008-01-01

    Full Text Available R2Fe3Si5 (R= Sc, Y, Lu contains nonmagnetic iron and has a relatively high superconducting transition temperature Tc among iron-containing superconductors. An anomalous temperature dependence of specific heat C(T has been reported for polycrystalline samples down to 1 K. We have grown R2Fe3Si5 single crystals, confirmed the anomalous C(T dependence, and found a second drop in specific heat below 1 K. In Lu2Fe3Si5, we can reproduce C(T below Tc, assuming two distinct energy gaps 2Δ 1/kBTc = 4.4 and 2Δ 2/kBTc = 1.1, with nearly equal weights, indicating that Lu2Fe3Si5 is a two-gap superconductor similar to MgB2. Hall coefficient measurements and band structure calculation also support the multiband contributions to the normal-state properties. The specific heat in the Sc2Fe3Si5 single crystals also shows the two-gap feature. R5Ir4Si10 (R = Sc, rare earth is also a superconductor where competition between superconductivity and the charge-density wave is known for rare earths but not for Sc. We have performed detailed specific heat measurements on Sc5Ir4Si10 single crystals and found that C(T deviates slightly from the behavior expected for weak-coupling superconductors. C(T for these superconductors can also be reproduced well by assuming two superconducting gaps.

  11. Accelerator Technology: Magnets, Normal and Superconducting

    CERN Document Server

    Bottura, L

    2013-01-01

    This document is part of Subvolume C 'Accelerators and Colliders' of Volume 21 'Elementary Particles' of Landolt-Börnstein - Group I 'Elementary Particles, Nuclei and Atoms'. It contains the the Section '8.1 Magnets, Normal and Superconducting' of the Chapter '8 Accelerator Technology' with the content: 8.1 Magnets, Normal and Superconducting 8.1.1 Introduction 8.1.2 Normal Conducting Magnets 8.1.2.1 Magnetic Design 8.1.2.2 Coils 8.1.2.3 Yoke 8.1.2.4 Costs 8.1.2.5 Undulators, Wigglers, Permanent Magnets 8.1.2.6 Solenoids 8.1.3 Superconducting Magnets 8.1.3.1 Superconducting Materials 8.1.3.2 Superconducting Cables 8.1.3.3 Stability and Margins, Quench and Protection 8.1.3.4 Magnetization, Coupling and AC Loss 8.1.3.5 Magnetic Design of Superconducting Accelerator Magnets 8.1.3.6 Current Leads 8.1.3.7 Mechanics, Insulation, Cooling and Manufacturing Aspects

  12. Theory and technology for superconducting cavities

    CERN Document Server

    Lengeler, Herbert

    1993-01-01

    The course will address Physicist and Engineers who are newcomers in the field of accelerators and accelerating cavities. The elements of RF-Superconductivity will be presented with special relevance to accelerating cavities. The present ststus of achievable accelerating fields and RF losses will be given and their link to the special technologies for cavity fabrication and surface treatments will be stressed. Cavity auxiliaries like main couplers, higher order mode couplers and frequency tuners will be described.

  13. Superconductivity

    Science.gov (United States)

    1989-07-01

    SUPERCONDUCTIVITY HIGH-POWER APPLICATIONS Electric power generation/transmission Energy storage Acoustic projectors Weapon launchers Catapult Ship propulsion • • • Stabilized...temperature superconductive shields could be substantially enhanced by use of high-Tc materials. 27 28 NRAC SUPERCONDUCTIVITY SHIP PROPULSION APPLICATIONS...motor shown in the photograph. As a next step in the evolution of electric-drive ship propulsion technology, DTRC has proposed to scale up the design

  14. Industrialization of Superconducting RF Accelerator Technology

    Science.gov (United States)

    Peiniger, Michael; Pekeler, Michael; Vogel, Hanspeter

    2012-01-01

    Superconducting RF (SRF) accelerator technology has basically existed for 50 years. It took about 20 years to conduct basic R&D and prototyping at universities and international institutes before the first superconducting accelerators were built, with industry supplying complete accelerator cavities. In parallel, the design of large scale accelerators using SRF was done worldwide. In order to build those accelerators, industry has been involved for 30 years in building the required cavities and/or accelerator modules in time and budget. To enable industry to supply these high tech components, technology transfer was made from the laboratories in the following three regions: the Americas, Asia and Europe. As will be shown, the manufacture of the SRF cavities is normally accomplished in industry whereas the cavity testing and module assembly are not performed in industry in most cases, yet. The story of industrialization is so far a story of customized projects. Therefore a real SRF accelerator product is not yet available in this market. License agreements and technology transfer between leading SRF laboratories and industry is a powerful tool for enabling industry to manufacture SRF components or turnkey superconducting accelerator modules for other laboratories and users with few or no capabilities in SRF technology. Despite all this, the SRF accelerator market today is still a small market. The manufacture and preparation of the components require a range of specialized knowledge, as well as complex and expensive manufacturing installations like for high precision machining, electron beam welding, chemical surface preparation and class ISO4 clean room assembly. Today, the involved industry in the US and Europe comprises medium-sized companies. In Japan, some big enterprises are involved. So far, roughly 2500 SRF cavities have been built by or ordered from industry worldwide. Another substantial step might come from the International Linear Collider (ILC) project

  15. The preliminary tests of the superconducting electron cyclotron resonance ion source DECRIS-SC2.

    Science.gov (United States)

    Efremov, A; Bekhterev, V; Bogomolov, S; Drobin, V; Loginov, V; Lebedev, A; Yazvitsky, N; Yakovlev, B

    2012-02-01

    A new compact version of the "liquid He-free" superconducting ECR ion source, to be used as an injector of highly charged heavy ions for the MC-400 cyclotron, is designed and built at the Flerov Laboratory of Nuclear Reactions in collaboration with the Laboratory of High Energy Physics of JINR. The axial magnetic field of the source is created by the superconducting magnet and the NdFeB hexapole is used for the radial plasma confinement. The microwave frequency of 14 GHz is used for ECR plasma heating. During the first tests, the source shows a good enough performance for the production of medium charge state ions. In this paper, we will present the design parameters and the preliminary results with gaseous ions.

  16. 1D to 3D dimensional crossover in the superconducting transition of the quasi-one-dimensional carbide superconductor Sc3CoC4.

    Science.gov (United States)

    He, Mingquan; Wong, Chi Ho; Shi, Dian; Tse, Pok Lam; Scheidt, Ernst-Wilhelm; Eickerling, Georg; Scherer, Wolfgang; Sheng, Ping; Lortz, Rolf

    2015-02-25

    The transition metal carbide superconductor Sc(3)CoC(4) may represent a new benchmark system of quasi-one-dimensional (quasi-1D) superconducting behavior. We investigate the superconducting transition of a high-quality single crystalline sample by electrical transport experiments. Our data show that the superconductor goes through a complex dimensional crossover below the onset T(c) of 4.5 K. First, a quasi-1D fluctuating superconducting state with finite resistance forms in the [CoC(4)](∞) ribbons which are embedded in a Sc matrix in this material. At lower temperature, the transversal Josephson or proximity coupling of neighboring ribbons establishes a 3D bulk superconducting state. This dimensional crossover is very similar to Tl(2)Mo(6)Se(6), which for a long time has been regarded as the most appropriate model system of a quasi-1D superconductor. Sc(3)CoC(4) appears to be even more in the 1D limit than Tl(2)Mo(6)Se(6).

  17. CLIQ. A new quench protection technology for superconducting magnets

    CERN Document Server

    Ravaioli, Emmanuele; ten Kate, H H J

    CLIQ, the Coupling-Loss Induced Quench system, is a new method for protecting superconducting magnets after a sudden transition to the normal state. It offers significant advantages over the conventional technology due to its effective mechanism for heating the superconductor relying on coupling loss and its robust electrical design, which makes it more reliable and less interfering with the coil winding process. The analysis of the electro-magnetic and thermal transients during and after a CLIQ discharge allows identifying the system parameters that affect the system performance and defining guidelines for implementing this technology on coils of various characteristics. Most existing superconducting magnets can be protected by CLIQ as convincingly shown by test results performed on magnets of different sizes, superconductor types, geometries, cables and strand parameters. Experimental results are successfully reproduced by means of a novel technique for modeling non-linear dynamic effects in superconducting...

  18. Design And Tests Of A Superconducting Magnet With A Cryocooler For The Ion Source Decris-sc

    CERN Document Server

    Datskov, V I; Bekhterev, V V; Bogomolov, S L; Bondarenko, P G; Dmitriev, S N; Drobin, V M; Efremov, A A; Iakovlev, B I; Leporis, M; Malinowski, H; Nikiforov, S A; Paschenko, S V; Seleznev, V V; Shishov, Yu A; Tsvineva, G P; Yazvitsky, N Yu

    2004-01-01

    A superconducting magnet system (SMS) for the multicharged ion source DECRIS-SC was designed and manufactured at the Joint Institute for Nuclear Research. Successful tests of the SMS were conducted in late 2003 - early 2004. The peculiarities of this system are stipulated by using of a cryocooler 1 W in power for the cryostabilization of the magnet, and also by a special configuration of the magnetic field demanded for the source of ions. Four coils ensure induction of a magnetic field on the axes of the source of up to 3T (the mirror ratio of ~6) which considerably extends possibilities of the ion source from the point of view of producing intense highly charged ion beams. The problem of compensating large forces of interaction between the coils and surrounding iron yoke in this magnet has been successfully solved, and a reliable suspension of the magnet in a cryostat realized. For compounding of the windings working in vacuum at indirect cryostabilization prepreg is used. There has been applied a new techno...

  19. Experts call for increasing support to superconducting technology studies

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ The Chinese government should launch a major research project on superconducting technology, as it is of significant importance for ensuring national energy security, raising energy efficiency and reducing emissions, urged experts at a workshop held at the CAS Institute of Electronic Engineering on 6 and 7 March in Beijing.

  20. Development of superconducting acceleration cavity technology for free electron lasers

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong Min; Lee, Byung Cheol; Kim, Sun Kook; Jeong, Young Uk; Cho, Sung Oh

    2000-10-01

    As a result of the cooperative research between the KAERI and Peking University, the key technologies of superconducting acceleration cavity and photoelectron gun have been developed for the application to high power free electron lasers. A 1.5-GHz, 1-cell superconducting RF cavity has been designed and fabricated by using pure Nb sheets. The unloaded Q values of the fabricated superconducting cavity has been measured to be 2x10{sup 9} at 2.5K, and 8x10{sup 9} at 1.8K. The maximum acceleration gradient achieved was 12 MeV/m at 2.5K, and 20MV/m at 1.8 K. A cryostat for the 1-cell superconducting cavity has been designed. As a source of electron beam, a DC photocathode electron gun has been designed and fabricated, which is composed of a photocathode evaporation chamber and a 100-keV acceleration chamber. The efficiency of the Cs2Te photocathode is 3% nominally at room temperature, 10% at 290 deg C. The superconducting photoelectron gun system developed has been estimated to be a good source of high-brightness electron beam for high-power free electron lasers.

  1. Superconductivity

    CERN Document Server

    Poole, Charles P; Farach, Horacio A

    1995-01-01

    Superconductivity covers the nature of the phenomenon of superconductivity. The book discusses the fundamental principles of superconductivity; the essential features of the superconducting state-the phenomena of zero resistance and perfect diamagnetism; and the properties of the various classes of superconductors, including the organics, the buckministerfullerenes, and the precursors to the cuprates. The text also describes superconductivity from the viewpoint of thermodynamics and provides expressions for the free energy; the Ginzburg-Landau and BCS theories; and the structures of the high

  2. Application of FPGA technology for control of superconducting TESLA cavities in free electron laser

    Science.gov (United States)

    Pozniak, Krzysztof T.

    2006-10-01

    Contemporary fundamental research in physics, biology, chemistry, pharmacology, material technology and other uses frequently methods basing on collision of high energy particles or penetration of matter with ultra-short electromagnetic waves. Kinetic energy of involved particles, considerably greater than GeV, is generated in accelerators of unique construction. The paper presents a digest of working principles of accelerators. There are characterized research methods which use accelerators. A method to stabilize the accelerating EM field in superconducting (SC) resonant cavity was presented. An example was given of usage of TESLA cavities in linear accelerator propelling the FLASH free electron laser (FEL) in DESY, Hamburg. Electronic and photonic control system was debated. The system bases on advanced FPGA circuits and cooperating fast DSP microprocessor chips. Examples of practical solutions were described. Test results of the debated systems in the real-time conditions were given.

  3. Superconducting Magnet Technology for the Upgrade

    Energy Technology Data Exchange (ETDEWEB)

    Todesco, E. [European Organization for Nuclear Research (CERN), Geneva (Switzerland). TE Dept.; Ambrosio, G. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ferracin, P. [European Organization for Nuclear Research (CERN), Geneva (Switzerland). TE Dept.; Rifflet, J. M. [European Organization for Nuclear Research (CERN), Geneva (Switzerland). TE Dept.; Sabbi, G. L. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Segreti, M. [Alternative Energies and Atomic Energy Commission (CEA), Saclay (France); Nakamoto, T. [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); van Weelderen, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland). TE Dept.; Xu, Q. [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan)

    2015-10-01

    In this section we present the magnet technology for the High Luminosity LHC. After a short review of the project targets and constraints, we discuss the main guidelines used to determine the technology, the field/gradients, the operational margins, and the choice of the current density for each type of magnet. Then we discuss the peculiar aspects of each class of magnet, with special emphasis on the triplet.

  4. {sup 27}Al and {sup 45}Sc NMR spectroscopy on ScT{sub 2}Al and Sc(T{sub 0.5}T{sup '}{sub 0.5}){sub 2}Al (T = T{sup '} = Ni, Pd, Pt, Cu, Ag, Au) Heusler phases and superconductivity in Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al

    Energy Technology Data Exchange (ETDEWEB)

    Benndorf, Christopher [Institut fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Institut fuer Physikalische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Niehaus, Oliver; Janka, Oliver [Institut fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany); Eckert, Hellmut [Institut fuer Physikalische Chemie, Westfaelische Wilhelms-Universitaet Muenster (Germany)

    2015-02-15

    The intermetallic Heusler compounds with ScT{sub 2}Al and Sc(T{sub 0.5}T{sup '}{sub 0.5}){sub 2}Al composition with T = T{sup '} = Ni, Pd, Pt, Cu, Ag, Au were synthesized from the elements by arc melting. They crystallize in the cubic MnCu{sub 2}Al type structure, space group Fm anti 3m. The unit cell parameters were determined by powder X-ray diffraction and the structure of Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al was refined on the basis of single-crystal X-ray diffraction. While the majority of the compounds show Pauli-paramagnetism, ScAu{sub 2}Al and the newly synthesized solid solution Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al exhibit superconductivity with transition temperatures of T{sub C} = 4.4 K and T{sub C} = 3.0(1) K, respectively. The superconducting state of Sc(Pd{sub 0.5}Au{sub 0.5}){sub 2}Al was also investigated by electrical resistivity measurements. All the synthesized compounds were furthermore studied by {sup 27}Al and {sup 45}Sc MAS-NMR spectroscopy. The resonance shifts of the synthesized compounds were determined and in Sc(Pd{sub 1-x}Au{sub x}){sub 2}Al a linear relationship between the resonance shifts and the composition was found. Line broadening effects and enhanced quadrupolar interaction strengths observed in the mixed samples can be attributed to the effect of Pd/Au mixing on the 8c Wyckoff site. The NMR spectroscopic data give no clear evidence for or against Sc/Al site disordering. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. Superconductivity

    CERN Document Server

    Thomas, D B

    1974-01-01

    A short general review is presented of the progress made in applied superconductivity as a result of work performed in connection with the high-energy physics program in Europe. The phenomenon of superconductivity and properties of superconductors of Types I and II are outlined. The main body of the paper deals with the development of niobium-titanium superconducting magnets and of radio-frequency superconducting cavities and accelerating structures. Examples of applications in and for high-energy physics experiments are given, including the large superconducting magnet for the Big European Bubble Chamber, prototype synchrotron magnets for the Super Proton Synchrotron, superconducting d.c. beam line magnets, and superconducting RF cavities for use in various laboratories. (0 refs).

  6. On the control parameters of the quasi-one dimensional superconductivity in Sc{sub 3}CoC{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Eickerling, Georg; Hauf, Christoph; Scheidt, Ernst-Wilhelm; Reichardt, Lena; Schneider, Christian; Scherer, Wolfgang [Institut fuer Physik, Universitaet Augsburg, Universitaetstrasse 1, 86179 Augsburg (Germany); Munoz, Alfonso [Departamento de Fisica Fundamental II, Instituto de Materiales y Nanotecnologia, Universidad de La Laguna, Tenerife (Spain); Lopez-Moreno, Sinhue [Escuela Superior Cd. Sahagun, Universidad Autonoma del Estado de Hidalgo, Carretera Cd. Sahagun-Otumba s/n. 43990, Hidalgo (Mexico); Humberto Romero, Aldo [Physics Department, West Virginia University, Morgantown, West Virginia 26506-6315 (United States); Max Planck Institut fuer Mikrostruktur Physik, Weinberg 2, 06120 Halle (Germany); Porcher, Florence; Andre, Gilles [Laboratoire Leon Brillouin, UMR12 CEA-CNRS, Bat 563 CEA Saclay, 91191 Gif sur Yvette Cedex (France); Poettgen, Rainer [Institut fuer Anorganische und Analytische Chemie, Universitaet Muenster, Corrensstrasse 30, 48149 Muenster (Germany)

    2013-09-15

    Within the series of ternary rare-earth transition metal carbides Sc{sub 3}TC{sub 4} (T = Fe, Co, Ni) only the Co congener displays a structural phase transition at 72 K and an onset of bulk superconductivity at 4.5 K. In this paper we present the results of a detailed analysis of the structural, electronic, and vibrational properties of the low-temperature phase of Sc{sub 3}CoC{sub 4} that represents one of the few well-documented examples of a quasi one-dimensional (1D) superconductor. Variable temperature neutron powder diffraction and low temperature X-ray diffraction experiments were performed in order to confirm the subtle structural distortions during the phase transition. The results of periodic electronic structure calculations indicate, that the structural transition can clearly be identified as a Peierls-type distortion and by a comparison with the isostructural carbide Sc{sub 3}FeC{sub 4} we are able to identify the chemical, electronic, and the vibrational control parameters of the transition. Topological analyses of the electron density distribution and of the valence shell charge concentrations at the cobalt atom finally allow us to directly correlate the changes in the electronic structure due to the Peierls transition in reciprocal space with the according subtle changes in the real space properties of Sc{sub 3}CoC{sub 4}. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Superconductive technologies for the Large Hadron collider at CERN

    CERN Document Server

    Rossi, L

    2000-01-01

    The Large Hadron Collider (LHC) project is the largest plant based on superconductivity and cryogenics: 27 km of tunnel filled with superconducting magnets and other equipment that will be kept at 1.9 K. The dipole magnets have to generate a minimum magnetic field of 8.3 T to allow collisions of proton beams at an energy of 14 TeV in the centre of mass. The construction of LHC started in 1997 at CERN in Geneva and required 10 years of research and development on fine- filament NbTi superconducting wires and cables, on magnet technology and on He-II refrigerators. In particular the project needs the production of about 1000 tons of high-homogeneity NbTi with current densities of more than 2000 A mm/sup -2/ at 9 T and 1.9 K, with tight control also of all other cable properties such as magnetization, interstrand resistance and copper resistivity. The paper describes the main dipole magnets and reviews the most significant steps in the research and development, focusing on the issues related to the conductor, to...

  8. ORNL Superconducting Technology Program for Electric Energy Systems

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A. (comp.)

    1993-02-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy's (DOE's) Office of Conservation and Renewable Energy to develop the technology base needed by US industry for commercial development of electric power applications of high-temperature superconductivity. The two major elements of this program are wire development and systems development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from information prepared for the FY 1992 Peer Review of Projects, conducted by DOE's Office of Program Analysis, Office of Energy Research. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer to US industry. Working together, the collaborative teams are making tremendous progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire products.

  9. Magnet Science and Technology for Basic Research at the High Field Laboratory for Superconducting Materials

    Institute of Scientific and Technical Information of China (English)

    渡辺和雄

    2007-01-01

    Since the first practical cryocooled superconducting magnet using a GM-cryocooler and high temperature superconducting current leads has been demonstrated successfully at the High Field Laboratory for Superconducting Materials (HFLSM), various kinds of cryocooled superconducting magnets in fields up to 15 T have been used to provide access for new research areas in fields of magneto-science. Recently, the HFLSM has succeeded in demonstrating a cryocooed 18 T high temperature superconducting magnet and a high field cryocooled 27.5 T hybrid magnet. Cryocooled magnet technology and basic research using high field magnets at the HFLSM are introduced.

  10. Superconductivity

    CERN Document Server

    Ketterson, John B

    2008-01-01

    Conceived as the definitive reference in a classic and important field of modern physics, this extensive and comprehensive handbook systematically reviews the basic physics, theory and recent advances in the field of superconductivity. Leading researchers, including Nobel laureates, describe the state-of-the-art in conventional and unconventional superconductors at a particularly opportune time, as new experimental techniques and field-theoretical methods have emerged. In addition to full-coverage of novel materials and underlying mechanisms, the handbook reflects continued intense research into electron-phone based superconductivity. Considerable attention is devoted to high-Tc superconductivity, novel superconductivity, including triplet pairing in the ruthenates, novel superconductors, such as heavy-Fermion metals and organic materials, and also granular superconductors. What’s more, several contributions address superconductors with impurities and nanostructured superconductors. Important new results on...

  11. Superconducting RF Technology R&D for Future Accelerator Applications

    CERN Document Server

    Reece, Charles E

    2012-01-01

    Superconducting rf technology (SRF) is evolving rapidly as are its applications. While there is active exploitation of what one may term the current state-of-the-practice, there is also rapid progress expanding in several dimensions the accessible and useful parameter space. While state-of-the-art performance sometimes outpaces thorough understanding, the improving scientific understanding from active SRF research is clarifying routes to obtain optimum performance from present materials and opening avenues beyond the standard bulk niobium. The improving technical basis understanding is enabling process engineering to both improve performance confidence and reliability and also unit implementation costs. Increasing confidence in the technology enables the engineering of new creative application designs. We attempt to survey this landscape to highlight the potential for future accelerator applications.

  12. Superconductivity

    CERN Document Server

    Poole, Charles P; Creswick, Richard J; Prozorov, Ruslan

    2014-01-01

    Superconductivity, Third Edition is an encyclopedic treatment of all aspects of the subject, from classic materials to fullerenes. Emphasis is on balanced coverage, with a comprehensive reference list and significant graphics from all areas of the published literature. Widely used theoretical approaches are explained in detail. Topics of special interest include high temperature superconductors, spectroscopy, critical states, transport properties, and tunneling. This book covers the whole field of superconductivity from both the theoretical and the experimental point of view. This third edition features extensive revisions throughout, and new chapters on second critical field and iron based superconductors.

  13. Superconductivity in Italian Secondary Schools: the experimentation carried out by Udine University with Supercomet2 (SC2) materials

    Science.gov (United States)

    Michelini, Marisa; Santi, Lorenzo; Viola, Rossana; Corni, Federico

    2008-05-01

    Through a highly interactive tools on CD, which comprises animation and films of demonstrative experiments, and uses modern pedagogical methods, such as collaborative learning and problem solving, the Supercomet 2 Project (SUPERCOnductivity Multimedia Educational Tool phase 2 of the European Union) aims to introduce superconductivity to European high school curriculums. During the first year of the project the following were produced: a CD-ROM with didactic material, a teacher's guide to clarify characteristics and roles of support material (texts, worksheets and computer presentations) and preview didactic courses. During the second year of the project It was: translated the material into the languages of countries participating in the project, experimented the application in high school classes in various parts of Europe, tested the updating course and the teacher's guide with a group of reference teachers. At the end of the first period of experimentation and dissemination were revised and new material was integrated in order to produce a final version at the end of the project. Further integrated proposals have been included with the revised material. In this paper the main characteristics realized during the project will be described.

  14. Summer Course on the Science and Technology of Superconductivity

    CERN Document Server

    Gregory, W D; Mathews, W N; The science and technology of superconductivity

    1973-01-01

    Since the discovery of superconductivity in 1911 by H. Kamerlingh Onnes, of the order of half a billion dollars has been spent on research directed toward understanding and utiliz­ ing this phenomenon. This investment has gained us fundamental understanding in the form of a microscopic theory of superconduc­ tivity. Moreover, superconductivity has been transformed from a laboratory curiosity to the basis of some of the most sensitive and accurate measuring devices known, a whole host of other elec­ tronic devices, a soon-to-be new international standard for the volt, a prototype generation of superconducting motors and gener­ ators, and magnets producing the highest continuous magnetic fields yet produced by man. The promise of more efficient means of power transmission and mass transportation, a new generation of superconducting motors and generators, and computers and other electronic devices with superconducting circuit elements is all too clear. The realization of controlled thermonuclear fu...

  15. Targeting cytokines: production and characterization of anti-TNF-α scFvs by phage display technology.

    Science.gov (United States)

    Abdolalizadeh, Jalal; Nouri, Mohammad; Zolbanin, Jafar Majidi; Barzegari, Abolfazl; Baradaran, Behzad; Barar, Jaleh; Coukos, George; Omidi, Yadollah

    2013-01-01

    The antibody display technology (ADT) such as phage display (PD) has substantially improved the production of monoclonal antibodies (mAbs) and Ab fragments through bypassing several limitations associated with the traditional approach of hybridoma technology. In the current study, we capitalized on the PD technology to produce high affinity single chain variable fragment (scFv) against tumor necrosis factor-alpha (TNF- α), which is a potent pro-inflammatory cytokine and plays important role in various inflammatory diseases and malignancies. To pursue production of scFv antibody fragments against human TNF- α, we performed five rounds of biopanning using stepwise decreased amount of TNF-α (1 to 0.1 μ g), a semi-synthetic phage antibody library (Tomlinson I + J) and TG1 cells. Antibody clones were isolated and selected through enzyme-linked immunosorbent assay (ELISA) screening. The selected scFv antibody fragments were further characterized by means of ELISA, PCR, restriction fragment length polymorphism (RFLP) and Western blot analyses as well as fluorescence microscopy and flow cytometry. Based upon binding affinity to TNF-α , 15 clones were selected out of 50 positive clones enriched from PD in vitro selection. The selected scFvs displayed high specificity and binding affinity with Kd values at nm range to human TNF-α . The immunofluorescence analysis revealed significant binding of the selected scFv antibody fragments to the Raji B lymphoblasts. The effectiveness of the selected scFv fragments was further validated by flow cytometry analysis in the lipopolysaccharide (LPS) treated mouse fibroblast L929 cells. Based upon these findings, we propose the selected fully human anti-TNF-α scFv antibody fragments as potential immunotherapy agents that may be translated into preclinical/clinical applications.

  16. High performance superconducting radio frequency ingot niobium technology for continuous wave applications

    Energy Technology Data Exchange (ETDEWEB)

    Dhakal, Pashupati, E-mail: dhakal@jlab.org; Ciovati, Gianluigi, E-mail: gciovati@jlab.org; Myneni, Ganapati R., E-mail: rao@jlab.org [Thomas Jefferson National Accelerator Facility, 12000 Jefferson Avenue, Newport News, VA 23606 (United States)

    2015-12-04

    Future continuous wave (CW) accelerators require the superconducting radio frequency cavities with high quality factor and medium accelerating gradients (≤20 MV/m). Ingot niobium cavities with medium purity fulfill the specifications of both accelerating gradient and high quality factor with simple processing techniques and potential reduction in cost. This contribution reviews the current superconducting radiofrequency research and development and outlines the potential benefits of using ingot niobium technology for CW applications.

  17. Superconductivity program for electric systems, Superconductivity Technology Center, Los Alamos National Laboratory, annual progress report for fiscal year 1997

    Energy Technology Data Exchange (ETDEWEB)

    Willis, J.O.; Newnam, B.E. [eds.; Peterson, D.E.

    1999-03-01

    Development of high-temperature superconductors (HTS) has undergone tremendous progress during the past year. Kilometer tape lengths and associated magnets based on BSCCO materials are now commercially available from several industrial partners. Superconducting properties in the exciting YBCO coated conductors continue to be improved over longer lengths. The Superconducting Partnership Initiative (SPI) projects to develop HTS fault current limiters and transmission cables have demonstrated that HTS prototype applications can be produced successfully with properties appropriate for commercial applications. Research and development activities at LANL related to the HTS program for Fiscal Year 1997 are collected in this report. LANL continues to support further development of Bi2223 and Bi2212 tapes in collaboration with American Superconductor Corporation (ASC) and Oxford Superconductivity Technology, Inc. (OSTI), respectively. The tape processing studies involving novel thermal treatments and microstructural characterization have assisted these companies in commercializing these materials. The research on second-generation YBCO-coated conductors produced by pulsed-laser deposition (PLD) over buffer template layers produced by ion beam-assisted deposition (IBAD) continues to lead the world. The applied physics studies of magnetic flux pinning by proton and heavy ion bombardment of BSCCO and YBCO tapes have provided many insights into improving the behavior of these materials in magnetic fields. Sections 4 to 7 of this report contain a list of 29 referred publications and 15 conference abstracts, a list of patent and license activities, and a comprehensive list of collaborative agreements in progress and completed.

  18. Technology and materials for the Superconducting Super Collider (SSC) project

    Energy Technology Data Exchange (ETDEWEB)

    Shintomi, Takakazu; Ishimaru, Hajime; Unno, Yoshinobu; Arai, Yasuo; Watase, Yoshiyuki; Amako, Katsuya; Kondo, Takahiko (National Lab. for High Energy Physics, Tsukuba, Ibaraki (Japan))

    1992-08-01

    The Superconducting Super Collider (SSC) is the accelerator for the research on elementary particle physics, of which the construction was already begun in Texas, USA. Two proton rings comprising about 10,000 superconducting magnets are installed in an underground tunnel with the circumferential length of 87 km, and the proton-proton collision of superhigh energy is realized. This accelerator becomes the largest machine that mankind makes. In this report, among the high-tech and materials used for the SSC, superconducting magnets, super-high vacuum beam pipes, silicon semiconductor detector, the use of VLSI and superhigh density mounting and high speed, large quantity data processing system are taken up, and the outline of those is described. The SSC was planned for the elucidation of Higg's theory. The incidence accelerator group is composed of a linear accelerator and three booster synchrotrons. The particles generated by proton-proton collision are measured, and the discovery of new particles and the study on high energy physical phenomena are carried out. The construction of the accelerator and experimental equipment is carried out by international cooperation. (K.I.).

  19. High Temperature Superconducting Magnetic Energy Storage and Its Power Control Technology

    Institute of Scientific and Technical Information of China (English)

    Xiao-Yuan Chen; Jian-Xun Jin; Kai-Meng Ma; Ju Wen; Ying Xin; Wei-Zhi Gong; An-Lin Ren; Jing-Yin Zhang

    2008-01-01

    High temperature superconducting (HTS) power inductor and its control technology have been studied and analyzed in the paper. Based on the results of simulations and practical experiments, a controlled release scheme has been proposed and verified for developing a practical HTS SMES prototype.

  20. Development of superconducting power devices in Europe

    Science.gov (United States)

    Tixador, Pascal

    2010-11-01

    Europe celebrated last year (2008) the 100-year anniversary of the first liquefaction of helium by H. Kammerling Onnes in Leiden. It led to the discovery of superconductivity in 1911. Europe is still active in the development of superconducting (SC) devices. The discovery of high critical temperature materials in 1986, again in Europe, has opened a lot of opportunities for SC devices by broking the 4 K cryogenic bottleneck. Electric networks experience deep changes due to the emergence of dispersed generation (renewable among other) and to the advances in ICT (Information Communication Technologies). The networks of the future will be “smart grids”. Superconductivity will offer “smart” devices for these grids like FCL (Fault Current Limiter) or VLI (Very Low Inductance) cable and would certainly play an important part. Superconductivity also will participate to the required sustainable development by lowering the losses and enhancing the mass specific powers. Different SC projects in Europe will be presented (Cable, FCL, SMES, Flywheel and Electrical Machine) but the description is not exhaustive. Nexans has commercialized the first two FCLs without public funds in the European grid (UK and Germany). The Amsterdam HTS cable is an exciting challenge in term of losses for long SC cables. European companies (Nexans, Air Liquide, Siemens, Converteam, …) are also very active for projects outside Europe (LIPA, DOE FCL, …).

  1. An experimental superconducting helical undulator

    Energy Technology Data Exchange (ETDEWEB)

    Caspi, S.; Taylor, C. [Lawrence Berkeley Lab., CA (United States)

    1995-12-31

    Improvements in the technology of superconducting magnets for high energy physics and recent advancements in SC materials with the artificial pinning centers (APC){sup 2}, have made a bifilar helical SC device an attractive candidate for a single-pass free electron laser (FEL){sup 3}. Initial studies have suggested that a 6.5 mm inner diameter helical device, with a 27 mm period, can generate a central field of 2-2.5 Tesla. Additional studies have also suggested that with a stored energy of 300 J/m, such a device can be made self-protecting in the event of a quench. However, since the most critical area associated with high current density SC magnets is connected with quenching and training, a short experimental device will have to be built and tested. In this paper we discuss technical issues relevant to the construction of such a device, including a conceptual design, fields, and forces.

  2. Emerging boom in nano magnetic particle incorporated high-Tc superconducting materials and technologies - A South African perspective

    CSIR Research Space (South Africa)

    Srinivasu, VV

    2009-01-01

    Full Text Available With a strategy to establish and embrace the emerging nano particle incorporated superconductivity technology (based on the HTS materials and nano magnetic particles) in South Africa, the author has initiated the following research activity in South...

  3. Superconducting Technology Assessment (NSA, Office of Corporate Assessments)

    Data.gov (United States)

    Networking and Information Technology Research and Development, Executive Office of the President — The government, and particularly NSA, has a continuing need for ever-increasing computational power. The Agency is concerned about projected limitations of...

  4. X-ray photoelectron spectroscopy studies of the electronic structure of superconducting Nb{sub 2}SnC and Nb{sub 2}SC

    Energy Technology Data Exchange (ETDEWEB)

    Romero, M.; Huerta, L.; Akachi, T. [Instituto de Investigaciones en Materiales, Universidad Nacional Autónoma de México, Apartado Postal 70-360, México D.F. 04510 (Mexico); Llamazares, J.L. Sánchez [Instituto Potosino de Investigación Científica y Tecnológica, Camino a la Presa San José 2055, Col. Lomas 4a, San Luis Potosí, S.L.P. 78216 (Mexico); Escamilla, R., E-mail: rauleg@unam.mx [Instituto de Investigaciones en Materiales, Universidad Nacional Autónoma de México, Apartado Postal 70-360, México D.F. 04510 (Mexico)

    2013-12-05

    Highlights: •XPS was used to investigate chemical shift in the Nb{sub 2}SnC and Nb{sub 2}SC compounds. •Valence band of the Nb{sub 2}SnC and Nb{sub 2}SC compounds was studied by XPS. •Positive and negative chemical shift are observed in the Nb{sub 2}SnC and Nb{sub 2}SC. •The charge transfer model can be applicable to the Nb{sub 2}SnC and Nb{sub 2}SC compounds. •The decrease of the N(E{sub F}) of Nb{sub 2}SC respect to Nb{sub 2}SnC explain the decrease of T{sub c}. -- Abstract: X-ray photoelectron spectroscopy (XPS) was used to investigate the binding energies and valence band of the Nb{sub 2}SnC and Nb{sub 2}SC compounds. The Nb 3d{sub 5/2}, Sn 3d{sub 5/2}, S 2p{sub 3/2} and C 1s core levels associated with the chemical states of Nb{sub 2}SnC and Nb{sub 2}SC were identified. The spectra for Nb{sub 2}SnC revealed Nb and Sn oxides on the surface of the sample, mainly Nb{sub 2}O{sub 5} and SnO{sub 2}, while the Nb{sub 2}SC only Nb{sub 2}O{sub 5} oxide. After Ar{sup +} ion etching the intensity of the oxides decreased in both samples. Comparing the Nb 3d, Sn 3d, S 2p and C 1s core levels with metallic Nb, Sn, S and C reference materials, we observed a positive chemical shift for Nb 3d{sub 5/2} and a negative chemical shift for C 1s in both samples. These results suggest that the charge transfer model can be applicable to the Nb{sub 2}SnC and Nb{sub 2}SC compounds. Finally, the decrease in the T{sub c} in the Nb{sub 2}SC compound respect to Nb{sub 2}SnC might be associated to decrease in the density of states N(E{sub F})

  5. Superconducting doped topological materials

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Satoshi, E-mail: sasaki@sanken.osaka-u.ac.jp [Institute of Scientific and Industrial Research, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Mizushima, Takeshi, E-mail: mizushima@mp.es.osaka-u.ac.jp [Department of Materials Engineering Science, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Department of Physics, Okayama University, Okayama 700-8530 (Japan)

    2015-07-15

    Highlights: • Studies on both normal- and SC-state properties of doped topological materials. • Odd-parity pairing systems with the time-reversal-invariance. • Robust superconductivity in the presence of nonmagnetic impurity scattering. • We propose experiments to identify the existence of Majorana fermions in these SCs. - Abstract: Recently, the search for Majorana fermions (MFs) has become one of the most important and exciting issues in condensed matter physics since such an exotic quasiparticle is expected to potentially give rise to unprecedented quantum phenomena whose functional properties will be used to develop future quantum technology. Theoretically, the MFs may reside in various types of topological superconductor materials that is characterized by the topologically protected gapless surface state which are essentially an Andreev bound state. Superconducting doped topological insulators and topological crystalline insulators are promising candidates to harbor the MFs. In this review, we discuss recent progress and understanding on the research of MFs based on time-reversal-invariant superconducting topological materials to deepen our understanding and have a better outlook on both the search for and realization of MFs in these systems. We also discuss some advantages of these bulk systems to realize MFs including remarkable superconducting robustness against nonmagnetic impurities.

  6. ORNL Superconducting Technology Program for Electric Power Systems, Annual Report for FY 1998

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A.; Murphy, A.W.

    1999-04-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by U.S. industry for commercial development of electric power applications of high temperature superconductivity. The two major elements of this program are wire development and applications development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from recent open literature publications, presentations, and information prepared for the FY 1998 Annual Program Review held July 20-22, 1998. Aspects of ORNL's work that were presented at the Applied Superconductivity Conference (September 1998) are included in this report, as well. This ORNL program is highly leveraged by the staff and other resources of U.S. industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to cooperative projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with U.S. industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high temperature superconductor wire and wire-using systems.

  7. Superconducting Magnet Technology for Future High Energy Proton Colliders

    Science.gov (United States)

    Gourlay, Stephen

    2017-01-01

    Interest in high field dipoles has been given a boost by new proposals to build a high-energy proton-proton collider to follow the LHC and programs around the world are taking on the task to answer the need. Studies aiming toward future high-energy proton-proton colliders at the 100 TeV scale are now being organized. The LHC and current cost models are based on technology close to four decades old and point to a broad optimum of operation using dipoles with fields between 5 and 12T when site constraints, either geographical or political, are not a factor. Site geography constraints that limit the ring circumference can drive the required dipole field up to 20T, which is more than a factor of two beyond state-of-the-art. After a brief review of current progress, the talk will describe the challenges facing future development and present a roadmap for moving high field accelerator magnet technology forward. This work was supported by the Director, Office of Science, High Energy Physics, US Department of Energy, under contract No. DE-AC02-05CH11231.

  8. COMMERCIALIZATION DEMONSTRATION OF MID-SIZED SUPERCONDUCTING MAGNETIC ENERGY STORAGE TECHNOLOGY FOR ELECTRIC UTILITYAPPLICATIONS

    Energy Technology Data Exchange (ETDEWEB)

    CHARLES M. WEBER

    2008-06-24

    As an outgrowth of the Technology Reinvestment Program of the 1990’s, an Agreement was formed between BWXT and the DOE to promote the commercialization of Superconducting Magnetic Energy Storage (SMES) technology. Business and marketing studies showed that the performance of electric transmission lines could be improved with this SMES technology by stabilizing the line thereby allowing the reserved stability margin to be used. One main benefit sought was to double the capacity and the amount of energy flow on an existing transmission line by enabling the use of the reserved stability margin, thereby doubling revenue. Also, electrical disturbances, power swings, oscillations, cascading disturbances and brown/black-outs could be mitigated and rendered innocuous; thereby improving power quality and reliability. Additionally, construction of new transmission lines needed for increased capacity could be delayed or perhaps avoided (with significant savings) by enabling the use of the reserved stability margin of the existing lines. Two crucial technical aspects were required; first, a large, powerful, dynamic, economic and reliable superconducting magnet, capable of oscillating power flow was needed; and second, an electrical power interface and control to a transmission line for testing, demonstrating and verifying the benefits and features of the SMES system was needed. A project was formed with the goals of commercializing the technology by demonstrating SMES technology for utility applications and to establish a domestic capability for manufacturing large superconducting magnets for both commercial and defense applications. The magnet had very low AC losses to support the dynamic and oscillating nature of the stabilizing power flow. Moreover, to economically interface to the transmission line, the magnet had the largest operating voltage ever made. The manufacturing of that design was achieved by establishing a factory with newly designed and acquired equipment

  9. Workshop on technology issues of superconducting Maglev transportation systems

    Energy Technology Data Exchange (ETDEWEB)

    Wegrzyn, J.E. (Brookhaven National Lab., Upton, NY (United States)); Shaw, D.T. (New York State Inst. of Superconductivity, Buffalo, NY (United States))

    1991-09-27

    There exists a critical need in the United States to improve its ground transportation system. One suggested system that offers many advantages over the current transportation infrastructure is Maglev. Maglev represents the latest evolution in very high and speed ground transportation, where vehicles are magnetically levitated, guided, and propelled over elevated guideways at speeds of 300 miles per hour. Maglev is not a new concept but is, however, receiving renewed interest. The objective of this workshop was to further promote these interest by bringing together a small group of specialists in Maglev technology to discuss Maglev research needs and to identify key research issues to the development of a successful Maglev system. The workshop was organized into four sessions based on the following technical areas: Materials, Testing, and Shielding; Magnet Design and Cryogenic Systems; Propulsion and Levitation Systems; and, System Control and Integration.

  10. Superconducting technology for overcurrent limiting in a 25 kA current injection system

    Science.gov (United States)

    Heydari, Hossein; Faghihi, Faramarz; Sharifi, Reza; Poursoltanmohammadi, Amir Hossein

    2008-09-01

    Current injection transformer (CIT) systems are within the major group of the standard type test of high current equipment in the electrical industry, so their performance becomes very important. When designing high current systems, there are many factors to be considered from which their overcurrent protection must be ensured. The output of a CIT is wholly dependent on the impedance of the equipment under test (EUT). Therefore current flow beyond the allowable limit can occur. The present state of the art provides an important guide to developing current limiters not only for the grid application but also in industrial equipment. This paper reports the state of the art in the technology available that could be developed into an application of superconductivity for high current equipment (CIT) protection with no test disruption. This will result in a greater market choice and lower costs for equipment protection solutions, reduced costs and improved system reliability. The paper will also push the state of the art by using two distinctive circuits, closed-core and open-core, for overcurrent protection of a 25 kA CIT system, based on a flux-lock-type superconducting fault current limiter (SFCL) and magnetic properties of high temperature superconducting (HTS) elements. An appropriate location of the HTS element will enhance the rate of limitation with the help of the magnetic field generated by the CIT output busbars. The calculation of the HTS parameters for overcurrent limiting is also performed to suit the required current levels of the CIT.

  11. ORNL Superconducting Technology Program for electric power systems. Annual report for FY 1996

    Energy Technology Data Exchange (ETDEWEB)

    Koncinski, W.S. [ed.; Hawsey, R.A. [comp.

    1997-05-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy`s Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by US industry for commercial development of electric power applications of high temperature superconductivity. The two major elements of this program are wire development and applications development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from recent open literature publications, presentations, and information prepared for the FY 1996 Annual Program Review held July 31 and August 1, 1996. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to cooperative projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with US industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high temperature superconductor wire and wire-using systems.

  12. ORNL superconducting technology program for electric power systems. Annual report for FY 1993

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A. [comp.

    1994-04-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy`s Office of Energy Efficiency and Renewable Energy to develop the technology base needed by US industry for commercial development of electric power applications of high-temperature superconductivity. The two major elements of this program are conductor development and applications development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from information prepared for the FY 1993 Annual Program Review held July 28--29, 1993. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to industrial competitiveness projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer to US industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire products.

  13. ORNL Superconducting Technology Program for Electric Power Systems--Annual Report for FY 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, RA

    2002-02-18

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy's Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by US industry for development of electric power applications of high-temperature superconductivity. The two major elements of this program are wire development and applications development. A new part of the wire research effort was the Accelerated Coated Conductor Initiative. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from recent open literature publications, presentations, and information prepared for the FY 2001 Annual Program Review held August 1-3, 2001. Aspects of ORNL's work that were presented at the International Cryogenic Materials Conference/Cryogenic Engineering Conference (July 2001) are included in this report as well. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. Interlaboratory teams are also in place on a number of industry-driven projects. Working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with US industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire-using systems.

  14. ORNL Superconducting Technology Program for electric power systems. Annual report for FY 1995

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A. [comp.; Turner, J.W. [ed.

    1996-05-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the U.S. Department of Energy`s Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by U.S. industry for commercial development of electric power applications of high-temperature superconductivity. The two major elements of this program are wire development and systems development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from information prepared for the FY 1995 Annual Program Review held August 1-2, 1995. This ORNL program is highly leveraged by the staff and other resources of U.S. industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to cooperative projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with U.S. industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire-using systems.

  15. ORNL Superconducting Technology Program for Electric Energy Systems. Annual report for FY 1992

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A. [comp.

    1993-02-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy`s (DOE`s) Office of Conservation and Renewable Energy to develop the technology base needed by US industry for commercial development of electric power applications of high-temperature superconductivity. The two major elements of this program are wire development and systems development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from information prepared for the FY 1992 Peer Review of Projects, conducted by DOE`s Office of Program Analysis, Office of Energy Research. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer to US industry. Working together, the collaborative teams are making tremendous progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire products.

  16. ORNL superconducting technology program for electric power systems. Annual report for FY 1993

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A. [comp.

    1994-04-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy`s Office of Energy Efficiency and Renewable Energy to develop the technology base needed by US industry for commercial development of electric power applications of high-temperature superconductivity. The two major elements of this program are conductor development and applications development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from information prepared for the FY 1993 Annual Program Review held July 28--29, 1993. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to industrial competitiveness projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer to US industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire products.

  17. ORNL Superconducting Technology Program for Electric Power Systems: Annual Report for FY 1999

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A.

    2000-06-13

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by U.S. industry for development of electric power applications of high-temperature superconductivity. The two major elements of this program are wire development and applications development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from recent open literature publications, presentations, and information prepared for the FY 1999 Annual Program Review held July 26-28, 1999. Aspects of ORNL's work that were presented at the International Cryogenic Materials Conference and the Cryogenic Engineering Conference (July 1999) are included in this report, as well. This ORNL program is highly leveraged by the staff and other resources of U.S. industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to cooperative projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with U.S. industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire-using systems.

  18. ORNL Superconducting Technology Program for Electric Power Systems, Annual Report for FY 1999

    Energy Technology Data Exchange (ETDEWEB)

    Hawsey, R.A.; Murphy, A.W

    2000-04-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by U.S. industry for development of electric power applications of high-temperature superconductivity. The two major elements of this program are wire development and applications development. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from recent open literature publications, presentations, and information prepared for the FY 1999 Annual Program Review held July 26--28, 1999. Aspects of ORNL's work that were presented at the International Cryogenic Materials Conference and the Cryogenic Engineering Conference (July 1999) are included in this report, as well. This ORNL program is highly leveraged by the staff and other resources of U.S. industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to cooperative projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with U.S. industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire-using systems.

  19. ORNL Superconducting Technology Program for electric power systems: Annual report for FY 1997

    Energy Technology Data Exchange (ETDEWEB)

    Koncinski, W.S.; O`Hara, L.M. [eds.; Hawsey, R.A.; Murphy, A.W. [comps.

    1998-03-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy`s Office of Energy Efficiency and Renewable Energy to develop the science and technology base needed by US industry for commercial development of electric power applications of high temperature superconductivity. The two major elements of this program are wire development and applications development. This document describes the major research and developments activities for this program together with related accomplishments. The technical progress reported was summarized from recent open literature publications, presentations, and information prepared for the FY 1997 Annual Program Review held July 21--23, 1997. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to cooperative projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with US industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high temperature superconductor wire and wire-using systems.

  20. Status of RF superconductivity at Argonne

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, K.W.

    1989-01-01

    Development of a superconducting (SC) slow-wave structures began at Argonne National Laboratory (ANL) in 1971, and led to the first SC heavy-ion linac (ATLAS - the Argonne Tandem-Linac Accelerating System), which began regularly scheduled operation in 1978. To date, more than 40,000 hours of bean-on target operating time has been accumulated with ATLAS. The Physics Division at ANL has continued to develop SC RF technology for accelerating heavy-ions, with the result that the SC linac has, up to the present, has been in an almost continuous process of upgrade and expansion. It should be noted that this has been accomplished while at the same time maintaining a vigorous operating schedule in support of the nuclear and atomic physics research programs of the division. In 1987, the Engineering Physics Division at ANL began development of SC RF components for the acceleration of high-brightness proton and deuterium beams. This work has included the evaluation of RF properties of high-{Tc} oxide superconductors, both for the above and for other applications. The two divisions collaborated while they worked on several applications of RF SC, and also worked to develop the technology generally. 11 refs., 6 figs.

  1. Biased HiPIMS technology for superconducting rf accelerating cavities coating

    CERN Document Server

    G. Rosaz, G.; Sonato, D.; Calatroni, S.; Ehiasarian, A.; Junginger, T.; Taborelli, M.

    2016-01-01

    In the last few years the interest of the thin film science and technology community on High Impulse Power Magnetron Sputtering (HIPIMS) coatings has steadily increased. HIPIMS literature shows that better thin film morphology, denser and smoother films can be achieved when compared with standard dc Magnetron Sputtering (dcMS) coating technology. Furthermore the capability of HIPIMS to produce a high quantity of ionized species can allow conformal coatings also for complex geometries. CERN already studied the possibility to use such a coating method for SRF accelerating cavities. Results are promising but not better from a RF point of view than dcMS coatings. Thanks to these results the next step is to go towards a biased HiPIMS approach. However the geometry of the cavities leads to complex changes in the coating setup in order to apply a bias voltage. Coating system tweaking and first superconducting properties of biased samples are presented.

  2. First Operation of PIAVE, the Heavy Ion Injector Based on Superconducting RFQ's

    CERN Document Server

    Bisoffi, Giovanni; Battistella, Andrea; Bezzon, Giampietro; Boscagli, Lucia; Calore, Andrea; Canella, Stefania; Carlucci, Davide; Chiurlotto, Francesca; Comunian, Michele; De Lazzari, Mauro; Facco, Alberto; Fagotti, Enrico; Lombardi, Augusto; Modanese, Paolo; Moisio, M Francesca; Pisent, Andrea; Poggi, Marco; Porcellato, Anna M; Stark, Sergey

    2005-01-01

    The Positive Ion Accelerator for low-Velocity Ions (PIAVE), based on superconducting RFQ's (SRFQ's), has been completed in fall 2004 with the first acceleration of beams from the ECR ion source. Superconducting RFQ's were used, for the first time, for beam acceleration on a user-oriented accelerator complex. A general status of the injector performances is given: it includes, besides the SRFQ's, eight superconducting (SC) QWR's and three bunchers; the beam is received from an ECR source on a HV platform and is delivered, through the SC accelerator ALPI, to nuclear physics experimental apparatuses. The paper emphasizes, in particular, the technological challenges related to the operation of the SC cavities, the cryogenics, control, diagnostics and vacuum systems.

  3. 超导无线电能传输技术%Superconducting Wireless Power Transfer Technology

    Institute of Scientific and Technical Information of China (English)

    张国民; 余卉; 刘国乐; 林良真; 肖立业

    2015-01-01

    In recent years,wireless power tranfer technology has become a hot technology. Compared with traditional power tranfer mode,wireless power transfer is more convinient and safer,and it has been applied to many fields. Because the efficiency of wireless power transfer system is dominated by the resistive losses of the coils,and the smaller the resistances of the coils,the higher the trans-fer efficiencyis. With the characteristics of zero DC resistance and low AC loss,supercondcuting materials have significant efficiency advantage for use in wireless power transfer. In this paper,the research status on supercondcuting wireless power transfer technology is introduced,especially our complete and ongoing research works in the Key Lab of Applied Superconductivity on superconducting wireless power transfer,and the potential application prospects of superconducting wireless power transfer technology are also presen-ted.%近年来,无线电能传输技术已成为了热点技术。与传统电能传输方式相比,无线电能传输更为方便、安全,并已被应用于多个领域。由于无线电能传输效率取决于发射与接收线圈本身的电阻,线圈电阻越小,传输效率越高。超导体所具有的直流零电阻、交流低损耗的特性,使得超导材料用于无线电能传输具有显著的效率优势。介绍了超导无线电能传输技术的研究现状,中国科学院应用超导重点实验室关于超导无线电能传输方面已经开展和正在进行的研究工作,指出了超导无线电能传输技术潜在的应用前景。

  4. Hidden Correlations in Indivisible Qudits as a Resource for Quantum Technologies on Examples of Superconducting Circuits

    Science.gov (United States)

    Man'ko, M. A.; Man'ko, V. I.

    2016-03-01

    We show that the density-matrix states of noncomposite qudit systems satisfy entropic and information relations like the subadditivity condition, strong subadditivity condition, and Araki-Lieb inequality, which characterize hidden quantum correlations of observables associated with these indivisible systems. We derive these relations employing a specific map of the entropic inequalities known for density matrices of multiqudit systems to the inequalities for density matrices of single-qudit systems. We present the obtained relations in the form of mathematical inequalities for arbitrary Hermitian N × N-matrices. We consider examples of superconducting qubits and qudits. We discuss the hidden correlations in single- qudit states as a new resource for quantum technologies analogous to the known resource in correlations associated with the entanglement in multiqudit systems.

  5. Cs2Te normal conducting photocathodes in the superconducting rf gun

    CERN Document Server

    Xiang, R; Buettig, H; Janssen, D; Justus, M; Lehnert, U; Michel, P; Murcek, P; Schamlott, A; Schneider, Ch; Schurig, R; Staufenbiel, F; Teichert, J

    2010-01-01

    The superconducting radio frequency photoinjector (SRF gun) is one of the latest applications of superconducting rf technology in the accelerator field. Since superconducting photocathodes with high quantum efficiency are yet unavailable, normal conducting cathode material is the main choice for SRF photoinjectors. However, the compatibility between the photocathode and the cavity is one of the challenges for this concept. Recently, a SRF gun with Cs2Te cathode has been successfully operated in Forschungszentrum Dresden-Rossendorf. In this paper, we will present the physical properties of Cs2Te photocathodes in the SC cavity, such as the quantum efficiency, the lifetime, the rejuvenation, the charge saturation, and the dark current.

  6. Performance analysis of a model-sized superconducting DC transmission system based VSC-HVDC transmission technologies using RTDS

    Science.gov (United States)

    Dinh, Minh-Chau; Ju, Chang-Hyeon; Kim, Sung-Kyu; Kim, Jin-Geun; Park, Minwon; Yu, In-Keun

    2012-08-01

    The combination of a high temperature superconducting DC power cable and a voltage source converter based HVDC (VSC-HVDC) creates a new option for transmitting power with multiple collection and distribution points for long distance and bulk power transmissions. It offers some greater advantages compared with HVAC or conventional HVDC transmission systems, and it is well suited for the grid integration of renewable energy sources in existing distribution or transmission systems. For this reason, a superconducting DC transmission system based HVDC transmission technologies is planned to be set up in the Jeju power system, Korea. Before applying this system to a real power system on Jeju Island, system analysis should be performed through a real time test. In this paper, a model-sized superconducting VSC-HVDC system, which consists of a small model-sized VSC-HVDC connected to a 2 m YBCO HTS DC model cable, is implemented. The authors have performed the real-time simulation method that incorporates the model-sized superconducting VSC-HVDC system into the simulated Jeju power system using Real Time Digital Simulator (RTDS). The performance analysis of the superconducting VSC-HVDC systems has been verified by the proposed test platform and the results were discussed in detail.

  7. A magnetic levitation rotating plate model based on high-Tc superconducting technology

    Science.gov (United States)

    Zheng, Jun; Li, Jipeng; Sun, Ruixue; Qian, Nan; Deng, Zigang

    2017-09-01

    With the wide requirements of the training aids and display models of science, technology and even industrial products for the public like schools, museums and pleasure grounds, a simple-structure and long-term stable-levitation technology is needed for these exhibitions. Opportunely, high temperature superconducting (HTS) technology using bulk superconductors indeed has prominent advantages on magnetic levitation and suspension for its self-stable characteristic in an applied magnetic field without any external power or control. This paper explores the feasibility of designing a rotatable magnetic levitation (maglev) plate model with HTS bulks placed beneath a permanent magnet (PM) plate. The model is featured with HTS bulks together with their essential cryogenic equipment above and PMs below, therefore it eliminates the unclear visual effects by spray due to the low temperature coolant such as liquid nitrogen (LN2) and additional levitation weight of the cryogenic equipment. Besides that, a matched LN2 automation filling system is adopted to help achieving a long-term working state of the rotatable maglev plate. The key low-temperature working condition for HTS bulks is maintained by repeatedly opening a solenoid valve and automatically filling LN2 under the monitoring of a temperature sensor inside the cryostat. With the support of the cryogenic devices, the HTS maglev system can meet all requirements of the levitating display model for exhibitions, and may enlighten the research work on HTS maglev applications.

  8. Superconducting Hadron Linacs

    CERN Document Server

    Ostroumov, Peter

    2013-01-01

    This article discusses the main building blocks of a superconducting (SC) linac, the choice of SC resonators, their frequencies, accelerating gradients and apertures, focusing structures, practical aspects of cryomodule design, and concepts to minimize the heat load into the cryogenic system. It starts with an overview of design concepts for all types of hadron linacs differentiated by duty cycle (pulsed or continuous wave) or by the type of ion species (protons, H-, and ions) being accelerated. Design concepts are detailed for SC linacs in application to both light ion (proton, deuteron) and heavy ion linacs. The physics design of SC linacs, including transverse and longitudinal lattice designs, matching between different accelerating–focusing lattices, and transition from NC to SC sections, is detailed. Design of high-intensity SC linacs for light ions, methods for the reduction of beam losses, preventing beam halo formation, and the effect of HOMs and errors on beam quality are discussed. Examples are ta...

  9. SSTAC/ARTS review of the draft Integrated Technology Plan (ITP). Volume 8: Aerothermodynamics Automation and Robotics (A/R) systems sensors, high-temperature superconductivity

    Science.gov (United States)

    1991-01-01

    Viewgraphs of briefings presented at the SSTAC/ARTS review of the draft Integrated Technology Plan (ITP) on aerothermodynamics, automation and robotics systems, sensors, and high-temperature superconductivity are included. Topics covered include: aerothermodynamics; aerobraking; aeroassist flight experiment; entry technology for probes and penetrators; automation and robotics; artificial intelligence; NASA telerobotics program; planetary rover program; science sensor technology; direct detector; submillimeter sensors; laser sensors; passive microwave sensing; active microwave sensing; sensor electronics; sensor optics; coolers and cryogenics; and high temperature superconductivity.

  10. 28 May 2010 - Japanese Ambassador H. Ueda visiting the LHC superconducting magnet test hall with CERN Technology Deputy Department Head L. Rossi.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    CERN-HI-1005088 02 Japanese Ambassador H. Ueda (right) visiting the LHC superconducting magnet test hall with Technology Deputy Department Head L. Rossi(left). H. Ueda is accompanied by KEK and ATLAS Collaboration T. Kondo (centre).

  11. Beating liquid helium: the technologies of cryogen-free superconducting magnets

    Science.gov (United States)

    Burgoyne, John

    2015-03-01

    Cryogen-free superconducting magnets have been available now for almost 15 years, but have only become standard commercial products in more recent years. In this review we will consider the pros and cons of ``dry'' design including superconducting wire development and selection, thermal budgeting, and the alternative methods for achieving magnet cooling.

  12. Prospects for the medium- and long-term development of China`s electric power industry and analysis of the potential market for superconductivity technology

    Energy Technology Data Exchange (ETDEWEB)

    Li, Z. [Bob Lawrence and Associates, Inc., Alexandria, VA (United States)

    1998-05-01

    First of all, overall economic growth objectives in China are concisely and succinctly specified in this report. Secondly, this report presents a forecast of energy supply and demand for China`s economic growth for 2000--2050. In comparison with the capability of energy construction in China in the future, a gap between supply and demand is one of the important factors hindering the sustainable development of Chain`s economy. The electric power industry is one of China`s most important industries. To adopt energy efficiency through high technology and utilizing energy adequately is an important technological policy for the development of China`s electric power industry in the future. After briefly describing the achievements of China`s electric power industry, this report defines the target areas and policies for the development of hydroelectricity and nuclear electricity in the 2000s in China, presents the strategic position of China`s electric power industry as well as objectives and relevant plans of development for 2000--2050. This report finds that with the discovery of superconducting electricity, the discovery of new high-temperature superconducting (HTS) materials, and progress in materials techniques, the 21st century will be an era of superconductivity. Applications of superconductivity in the energy field, such as superconducting storage, superconducting transmission, superconducting transformers, superconducting motors, its application in Magneto-Hydro-Dynamics (MHD), as well as in nuclear fusion, has unique advantages. Its market prospects are quite promising. 12 figs.

  13. Oak Ridge National Laboratory (ORNL) Superconducting Technology Program for electric power systems. Annual report for FY 1994

    Energy Technology Data Exchange (ETDEWEB)

    Koncinski, W.S. [ed.; Hawsey, R.A. [comp.

    1994-12-01

    The Oak Ridge National Laboratory (ORNL) Superconducting Technology Program is conducted as part of a national effort by the US Department of Energy`s Office of Energy Efficiency and Renewable Energy to develop the technology base needed by US industry for commercial development of electric power applications of high-temperature superconductivity. The three major elements of this program are conductor development, applications development, and the Superconductivity Partnership Initiative. This document describes the major research and development activities for this program together with related accomplishments. The technical progress reported was summarized from information prepared for the FY 1994 Annual Program Review held July 19--20, 2994. This ORNL program is highly leveraged by the staff and other resources of US industry and universities. In fact, nearly three-fourths of the ORNL effort is devoted to industrial competitiveness projects with private companies. Interlaboratory teams are also in place on a number of industry-driven projects. Patent disclosures, working group meetings, staff exchanges, and joint publications and presentations ensure that there is technology transfer with US industry. Working together, the collaborative teams are making rapid progress in solving the scientific and technical issues necessary for the commercialization of long lengths of practical high-temperature superconductor wire and wire products.

  14. Superconductivity in Medicine

    Science.gov (United States)

    Alonso, Jose R.; Antaya, Timothy A.

    2012-01-01

    Superconductivity is playing an increasingly important role in advanced medical technologies. Compact superconducting cyclotrons are emerging as powerful tools for external beam therapy with protons and carbon ions, and offer advantages of cost and size reduction in isotope production as well. Superconducting magnets in isocentric gantries reduce their size and weight to practical proportions. In diagnostic imaging, superconducting magnets have been crucial for the successful clinical implementation of magnetic resonance imaging. This article introduces each of those areas and describes the role which superconductivity is playing in them.

  15. Preparation and characterization of Sc doped MgB2 wires

    DEFF Research Database (Denmark)

    Grivel, Jean-Claude; Burdusel, M.

    2016-01-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu–Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations...

  16. Scénarios de transition énergétique en ville. Acteurs, régulations, technologies (dir. Gilles Debizet)

    OpenAIRE

    Ferrieux, Cécile

    2016-01-01

    L’ouvrage « Scénarios de transition énergétique en ville. Acteurs, régulations, technologies » (dir. Gilles Debizet) cherche à comprendre comment s’opère concrètement la transition énergétique dans les villes, c'est-à-dire le passage d’un usage systématique des énergies carbonisées à l’usage plus fréquent, mais pas exclusif, des énergies renouvelables. Au-delà des grands mots d’ordre sur la baisse de la consommation des énergies fossiles et le développement de solutions à grande échelle, Gill...

  17. Search strategy for relevant parasitic elements and reduction of their influence on the operation of SC FIR filters realized in CMOS technology

    Science.gov (United States)

    Dlugosz, Rafal

    2005-06-01

    Parasitic capacities pose a serious problem in switched capacitor finite impulse response (SC FIR) filters realized as VLSI systems in CMOS submicron technologies. The influence of these parasitic elements is especially visible in the stopband of the filter frequency response. To design mixed digital-analog SC FIR filters is a difficult task. Filters of this class have to be designed using full-custom method. SC FIR filters of high orders N are very complex systems with thousands of transistors, capacitors, which, in turn, make the basis for many active elements, switches, delay elements, memories and other circuitry. One of the most important stages during the design process is post-layout HSPICE verification. However, the simulation of separated blocks does not suffice to have enough knowledge of the operation of the whole system. Optimization requires netlist simulations of the entire system, with presence of typically between 5000-30000 of parasitic capacities, where only about hundred of them are critical ones. Analysis which aims at finding these elements, in practice, is not possible because of the complexity of the entire system. The heuristic method of searching for relevant parasitic elements presented in this paper is based on the assumption that all parasitic elements create a set. The main task is to divide this set into subareas. In order to do this particular groups of nets in the layout must be labeled using unique names. Then particular groups of parasitic elements are filtered out from the netlist. Each filtering stage generates two netlists with separate areas of parasitic elements. After the analysis of the simulation results has been done there remains to make the decision concerning subsequent filtering operations. The iteration method is very quick, convenient, efficient and does not require deep knowledge of the simulated system. Many stages of this method can be easy implemented with CAD tools. In realized projects, after no more than 15

  18. Nanoscience and Engineering in Superconductivity

    CERN Document Server

    Moshchalkov, Victor; Lang, Wolfgang

    2010-01-01

    For emerging energy saving technologies, superconducting materials with superior performance are needed. Such materials can be developed by manipulating the 'elementary building blocks' through nanostructuring. For superconductivity the 'elementary blocks' are Cooper pair and fluxon (vortex). This book presents new ways how to modify superconductivity and vortex matter through nanostructuring and the use of nanoscale magnetic templates. The basic nano-effects, vortex and vortex-antivortex patterns, vortex dynamics, Josephson phenomena, critical currents, and interplay between superconductivity

  19. Global and local superconductivity in boron-doped granular diamond.

    Science.gov (United States)

    Zhang, Gufei; Turner, Stuart; Ekimov, Evgeny A; Vanacken, Johan; Timmermans, Matias; Samuely, Tomás; Sidorov, Vladimir A; Stishov, Sergei M; Lu, Yinggang; Deloof, Bart; Goderis, Bart; Van Tendeloo, Gustaaf; Van de Vondel, Joris; Moshchalkov, Victor V

    2014-04-02

    Strong granularity-correlated and intragrain modulations of the superconducting order parameter are demonstrated in heavily boron-doped diamond situated not yet in the vicinity of the metal-insulator transition. These modulations at the superconducting state (SC) and at the global normal state (NS) above the resistive superconducting transition, reveal that local Cooper pairing sets in prior to the global phase coherence.

  20. Applied superconductivity

    CERN Document Server

    Newhouse, Vernon L

    1975-01-01

    Applied Superconductivity, Volume II, is part of a two-volume series on applied superconductivity. The first volume dealt with electronic applications and radiation detection, and contains a chapter on liquid helium refrigeration. The present volume discusses magnets, electromechanical applications, accelerators, and microwave and rf devices. The book opens with a chapter on high-field superconducting magnets, covering applications and magnet design. Subsequent chapters discuss superconductive machinery such as superconductive bearings and motors; rf superconducting devices; and future prospec

  1. DC superconducting fault current limiter

    Science.gov (United States)

    Tixador, P.; Villard, C.; Cointe, Y.

    2006-03-01

    There is a lack of satisfying solutions for fault currents using conventional technologies, especially in DC networks, where a superconducting fault current limiter could play a very important part. DC networks bring a lot of advantages when compared to traditional AC ones, in particular within the context of the liberalization of the electric market. Under normal operation in a DC network, the losses in the superconducting element are nearly zero and only a small, i.e. a low cost, refrigeration system is then required. The absence of zero crossing of a DC fault current favourably accelerates the normal zone propagation. The very high current slope at the time of the short circuit in a DC grid is another favourable parameter. The material used for the experiments is YBCO deposited on Al2O3 as well as YBCO coated conductors. The DC limitation experiments are compared to AC ones at different frequencies (50-2000 Hz). Careful attention is paid to the quench homogenization, which is one of the key issues for an SC FCL. The University of Geneva has proposed constrictions. We have investigated an operating temperature higher than 77 K. As for YBCO bulk, an operation closer to the critical temperature brings a highly improved homogeneity in the electric field development. The material can then absorb large energies without degradation. We present tests at various temperatures. These promising results are to be confirmed over long lengths.

  2. Relaxation of polarized nuclei in superconducting rhodium

    DEFF Research Database (Denmark)

    Knuuttila, T.A.; Tuoriniemi, J.T.; Lefmann, K.

    2000-01-01

    Nuclear spin lattice relaxation rates were measured in normal and superconducting (sc) rhodium with nuclear polarizations up to p = 0.55. This was sufficient to influence the sc state of Rh, whose T, and B-c, are exceptionally low. Because B-c

  3. Activities on RF superconductivity at DESY

    Energy Technology Data Exchange (ETDEWEB)

    Matheisen, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); TESLA Collaboration

    1996-01-01

    At DESY the HERA electron storage ring is supplied with normal and superconducting cavities. The superconducting system transfers up to 1 MW klystron power to the beam. Experiences are reported on luminosity and machine study runs. Since 1993 one major activity in the field of RF superconducting cavities is the installation of the TESLA Test Facility. Set-up of hardware and first tests of s.c. resonators are presented. (R.P.). 11 refs.

  4. A high-temperature superconducting delta-sigma modulator based on a multilayer technology with bicrystal Josephson junctions

    Energy Technology Data Exchange (ETDEWEB)

    Ruck, B.; Chong, Y.; Dittmann, R.; Engelhardt, A.; Sodtke, E.; Siegel, M. [Institut fur Schicht- und Ionentechnik (ISI), Forschungszentrum Julich GmbH, 52425 Juelich (Germany)

    1999-11-01

    We have designed, fabricated and successfully tested a first-order delta-sigma modulator using a high-temperature superconducting multilayer technology with bicrystal Josephson junctions. The circuit has been fabricated on a SrTiO{sub 3} bicrystal substrate. The YBa{sub 2}Cu{sub 3}O{sub 7}/SrTiO{sub 3}/YBa{sub 2}Cu{sub 3}O{sub 7} trilayer was fabricated by laser deposition. The bottom layer served as a superconducting ground plane. The Josephson junctions were formed at the bicrystal line in the upper layer. The integrator resistance has been made from a Pd/Au thin film. The circuit consists of a dc-SFQ converter, a Josephson transmission line, a comparator, an L/R integrator and an output stage. The correct operation of the modulatorhas been tested using dc measurements. The linearity of the modulator was studied by measuring the harmonic distortions of a 19.5 kHz sine wave input signal. From the recorded spectrum, a minimum resolution of at least 5 bits can be estimated. This accuracy was limited by the noise of the preamplifier. The correct operation of the current feedback loop was demonstrated by cutting the feedback inductance. (author)

  5. A high-temperature superconducting delta-sigma modulator based on a multilayer technology with bicrystal Josephson junctions

    Science.gov (United States)

    Ruck, B.; Chong, Y.; Dittmann, R.; Engelhardt, A.; Sodtke, E.; Siegel, M.

    1999-11-01

    We have designed, fabricated and successfully tested a first-order delta-sigma modulator using a high-temperature superconducting multilayer technology with bicrystal Josephson junctions. The circuit has been fabricated on a SrTiO3 bicrystal substrate. The YBa2Cu3O7/SrTiO3/YBa2Cu3O7 trilayer was fabricated by laser deposition. The bottom layer served as a superconducting groundplane. The Josephson junctions were formed at the bicrystal line in the upper layer. The integrator resistance has been made from a Pd/Au thin film. The circuit consists of a dc-SFQ converter, a Josephson transmission line, a comparator, an L/R integrator and an output stage. The correct operation of the modulator has been tested using dc measurements. The linearity of the modulator was studied by measuring the harmonic distortions of a 19.5 kHz sine wave input signal. From the recorded spectrum, a minimum resolution of at least 5 bits can be estimated. This accuracy was limited by the noise of the preamplifier. The correct operation of the current feedback loop was demonstrated by cutting the feedback inductance.

  6. Fiber Bragg Grating Sensor as Valuable Technological Platform for New Generation of Superconducting Magnets

    CERN Document Server

    Chiuchiolo, A; Cusano, A; Bajko, M; Perez, J C; Bajas, H; Viret, P; Giordano, M; Breglio, G

    2014-01-01

    New generation of superconducting magnets for high energy applications designed, manufactured and tested at the European Organization for Nuclear Research (CERN) require the implementation of reliable sensors able to monitor the mechanical stresses affecting the winding from fabrication to operation in magnetic field of 13 T. This work deals with the embedding of Fiber Bragg Grating sensors in a short model Nb3Sn dipole magnet in order to monitor the strain developed in the coil during the cool down to 1.9 K, the powering up to 15.8 kA and the warm up, offering perspectives for the replacement of standard strain gauges.

  7. Preliminary investigation of force-reduced superconducting magnet configurations for advanced technology applications

    Energy Technology Data Exchange (ETDEWEB)

    Bouillard, J.X.

    1992-12-01

    The feasibility of new high-field low specific weight superconducting magnet designs using force-free fields is being explored analytically and numerically. This report attempts to assess the technical viability of force-free field concepts to produce high-field, low specific weight and large bore volume magnets, which could promote the use of high temperature superconductors. Several force-free/force-reduced magnet configurations are first reviewed, then discussed and assessed. Force-free magnetic fields, fields for which the current flows parallel to the field, have well-known mathematical solutions extending upon infinite domains. These solutions, however, are no longer force-free everywhere for finite geometries. In this preliminary study, force-free solutions such as the Lundquist solutions truncated to a size where the internal field of the coil matches an externally cylindrical magnetic field (also called a Lundquist coil) are numerically modeled and explored. Significant force-reduction for such coils was calculated, which may have some importance for the design of lighter toroidal magnets used in thermonuclear fusion power generation, superconducting magnetic energy storage (SMES), and mobile MHD power generation and propulsion.

  8. Application of superconducting technologies as chemical/biological agent electronic eyes

    Science.gov (United States)

    Savoy, Steven M.; Eames, Sara J.; Jurbergs, David C.; Zhao, Jianai; McDevitt, John T.; Sobel, Annette L.

    1997-01-01

    High temperature superconductors provide enhanced sensitivity capabilities as chemical/biological agent detectors. State-of-the-art advances in ruggedizing superconducting platforms make them much more robust for field applications. In addition, microminiaturization and advances in refrigeration have enabled the systems engineering of portable, durable, survivable, low power requirement devices. This presentation describes a prototype system employing YBCO (yttrium barium copper oxide) superconducting quantum interference devices (SQUIDS) with specific biolayer detection dye coatings. These devices may be deployed as specific stand-off detectors, or potentially reconfigured as point sensors. A library of pattern recognition algorithms provides the reference template for the system. The human-system interface will provide a 'yes/no' agent confirmation for the environment being queried, and associated confidence value. This prototype detection system has great potential for deployment in support of hostage rescue/rapid response teams, DMAT, and urban search and rescue. The preparation and characterization of a new generation of optical sensors fabricated from high-temperature superconductor (HTSC) thin films is reported herein. These new hybrid devices are fashioned using HTSC thin films which are coated with organic dye overlayers. These systems are shown to respond selectively to those wavelengths which are absorbed strongly by the molecular dye. Methods for fabricating the superconductor element and depositing the dye layer are discussed. Moreover, resistivity versus temperature measurements before and after dye deposition are utilized to characterize these hybrid structures. The unique optical response properties of these hybrid sensors are also detailed.

  9. Contributions To The 9th Workshop On Rf Superconductivity, Accelerator Technology For The 21st Century (rf Superconductivity Activities At Lal Accelerating Field Measurement In 3 Ghz Pulsed Cavities Design And Test Of A 1.3 Ghz Travelling Wave Window

    CERN Document Server

    Le Duff, J; Thomas, C

    2000-01-01

    Contributions To The 9th Workshop On Rf Superconductivity, Accelerator Technology For The 21st Century (rf Superconductivity Activities At Lal Accelerating Field Measurement In 3 Ghz Pulsed Cavities Design And Test Of A 1.3 Ghz Travelling Wave Window

  10. BSCCO超导带材的工艺要点与应用%Technology Essentials and Application of BSCCO Superconducting Tape

    Institute of Scientific and Technical Information of China (English)

    王醒东

    2014-01-01

    高温超导材料的发现,推进了超导技术的实用化。作为典型的高温超导材料,铋系(BSCCO)超导带材目前已在超导电缆、超导限流器和超导储能等领域实现商用。粉末套管法是制备BSCCO超导带材最常用的方法,主要工艺步骤包括装粉、拉拔、轧制和热处理等。本文介绍了粉末套管法的工艺,重点介绍了各工艺步骤中的关键点,阐述了超导带材在超导限流器和超导储能系统中的应用,提出了BSCCO超导带材未来的发展方向。%The discovery of high temperature superconducting(HTS) materials promotes the practical application of superconducting technology. As typical HTS materials, Bi-superconducting tapes(BSCCO) have achieved the commercialization and been applied in superconducting cables, superconducting fault current limiter(SFCL) and superconducting magnetic energy storage(SMES). Powder in tube(PIT) is the most commonly method, which includes some important processing steps such as powder-filling, drawing, rolling and heat treatment. PIT is introduced in this paper, especially the key point in each process step. The application of superconducting tapes in SFCL and SMES is expounded. Finally, the future development direction of BSCCO superconductor tape is indicated.

  11. Superconducting Magnets for Particle Accelerators

    CERN Document Server

    Rossi, L

    2012-01-01

    Superconductivity has been the most influential technology in the field of accelerators in the last 30 years. Since the commissioning of the Tevatron, which demonstrated the use and operability of superconductivity on a large scale, superconducting magnets and rf cavities have been at the heart of all new large accelerators. Superconducting magnets have been the invariable choice for large colliders, as well as cyclotrons and large synchrotrons. In spite of the long history of success, superconductivity remains a difficult technology, requires adequate R&D and suitable preparation, and has a relatively high cost. Hence, it is not surprising that the development has also been marked by a few setbacks. This article is a review of the main superconducting accelerator magnet projects; it highlights the main characteristics and main achievements, and gives a perspective on the development of superconducting magnets for the future generation of very high energy colliders.

  12. Academic Training - Pulsed SC Magnets

    CERN Multimedia

    Françoise Benz

    2006-01-01

    2005-2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 2, 3, June 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, bldg 500 Pulsed SC Magnets by M. Wilson Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mech...

  13. Reprint of “Performance analysis of a model-sized superconducting DC transmission system based VSC-HVDC transmission technologies using RTDS”

    Science.gov (United States)

    Dinh, Minh-Chau; Ju, Chang-Hyeon; Kim, Sung-Kyu; Kim, Jin-Geun; Park, Minwon; Yu, In-Keun

    2013-01-01

    The combination of a high temperature superconducting DC power cable and a voltage source converter based HVDC (VSC-HVDC) creates a new option for transmitting power with multiple collection and distribution points for long distance and bulk power transmissions. It offers some greater advantages compared with HVAC or conventional HVDC transmission systems, and it is well suited for the grid integration of renewable energy sources in existing distribution or transmission systems. For this reason, a superconducting DC transmission system based HVDC transmission technologies is planned to be set up in the Jeju power system, Korea. Before applying this system to a real power system on Jeju Island, system analysis should be performed through a real time test. In this paper, a model-sized superconducting VSC-HVDC system, which consists of a small model-sized VSC-HVDC connected to a 2 m YBCO HTS DC model cable, is implemented. The authors have performed the real-time simulation method that incorporates the model-sized superconducting VSC-HVDC system into the simulated Jeju power system using Real Time Digital Simulator (RTDS). The performance analysis of the superconducting VSC-HVDC systems has been verified by the proposed test platform and the results were discussed in detail.

  14. Tourism marketing: A study of the use of information and communication technology in travel agencies and tourism of Balneário Camboriú (SC, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz Carlos da Silva Flores

    2012-12-01

    Full Text Available The information and communication technologies (ICT have significant effects on the market in an increasingly competitive landscape. In the services sector, because of its intangibility, the quality of communication with all stakeholders connected directly to the organizations make all the difference to your business success. The agency in tourism sector has been adapting to new ICT tools. This study aimed to investigate, from a descriptive quantitative approach, the level of use of ICT for some travel agencies and tourism city of Balneário Camboriú (SC, Brazil in its relationship with customers, suppliers and partners, as well as in marketing their products and services and their promotional strategies. As methodological procedures adopted the literature and field research, which consisted of the application of questionnaires to travel agents and tourism sites. The results showed that tools like email still has the same level of use that the fixed and mobile telephony and social networking featured prominently only in the relationship with customers. It is believed that a qualitative research with consumers can contribute to a better understanding of the use of ICT tools by travel agents and tourism.

  15. Initial studies of Bremsstrahlung energy deposition in small-bore superconducting undulator structures in linac environments

    Energy Technology Data Exchange (ETDEWEB)

    Cremer, T.; Tatchyn, R. [Stanford Univ., CA (United States)

    1995-12-31

    One of the more promising technologies for developing minimal-length insertion devices for linac-driven, single-pass Free Electron Lasers (FELs) operating in the x-ray range is based on the use of superconducting (SC) materials. In recent FEL simulations, for example, a bifilar helical SC device with a 2 cm period and 1.8 T field was found to require a 30 m saturation length for operation at 1.5{Angstrom} on a 15 GeV linac, more than 40% shorter than an alternative hybrid/permanent magnet (hybrid/PM) undulator. AT the same time, however, SC technology is known to present characteristic difficulties for insertion device design, both in engineering detail and in operation. Perhaps the most critical problem, as observed, e.g., by Madey and co-workers in their initial FEL experiments, was the frequent quenching induced by scattered electrons upstream of their (bifilar) device. Postulating that this quenching was precipitated by directly-scattered or bremsstrahlung-induced particle energy deposited into the SC material or into material contiguous with it, the importance of numerical and experimental characterizations of this phenomenon for linac-based, user-facility SC undulator design becomes evident. In this paper we discuss selected prior experimental results and report on initial EGS4 code studies of scattered and bremsstrahlung induced particle energy deposition into SC structures with geometries comparable to a small-bore bifilar helical undulator.

  16. The Properties of Normal Conducting Cathodes in FZD Superconducting Gun

    CERN Document Server

    Xiang, R; Buettig, H; Janssen, D; Justus, M; Lehnert, U; Michel, P; Murcek, P; Schamlott, A; Schneider, Ch; Schurig, R; Staufenbiel, F; Teichert, J

    2009-01-01

    The superconducting radio frequency photoinjector (SRF photoinjector) is one of the latest applications of SC technology in the accelerator field. Since superconducting cathodes with high QE are not available up to now, normal conducting cathode material is the main choice for the SRF photoinjectors. However, the compatibility between the cathode and the cavity is one of the challenges for this concept. The SRF gun with Cs2Te cathode has been successfully operated under the collaboration of BESSY, DESY, FZD, and MBI. In this paper, some experience gained in the gun commissioning will be concluded. The results of the properties of Cs2Te photocathode in the cavity will be presented, such as the Q.E., the life time, the dark current and the thermal emittance.

  17. Computation of Normal Conducting and Superconducting Linear Accelerator (LINAC) Availabilities

    Energy Technology Data Exchange (ETDEWEB)

    Haire, M.J.

    2000-07-11

    A brief study was conducted to roughly estimate the availability of a superconducting (SC) linear accelerator (LINAC) as compared to a normal conducting (NC) one. Potentially, SC radio frequency cavities have substantial reserve capability, which allows them to compensate for failed cavities, thus increasing the availability of the overall LINAC. In the initial SC design, there is a klystron and associated equipment (e.g., power supply) for every cavity of an SC LINAC. On the other hand, a single klystron may service eight cavities in the NC LINAC. This study modeled that portion of the Spallation Neutron Source LINAC (between 200 and 1,000 MeV) that is initially proposed for conversion from NC to SC technology. Equipment common to both designs was not evaluated. Tabular fault-tree calculations and computer-event-driven simulation (EDS) computer computations were performed. The estimated gain in availability when using the SC option ranges from 3 to 13% under certain equipment and conditions and spatial separation requirements. The availability of an NC LINAC is estimated to be 83%. Tabular fault-tree calculations and computer EDS modeling gave the same 83% answer to within one-tenth of a percent for the NC case. Tabular fault-tree calculations of the availability of the SC LINAC (where a klystron and associated equipment drive a single cavity) give 97%, whereas EDS computer calculations give 96%, a disagreement of only 1%. This result may be somewhat fortuitous because of limitations of tabular fault-tree calculations. For example, tabular fault-tree calculations can not handle spatial effects (separation distance between failures), equipment network configurations, and some failure combinations. EDS computer modeling of various equipment configurations were examined. When there is a klystron and associated equipment for every cavity and adjacent cavity, failure can be tolerated and the SC availability was estimated to be 96%. SC availability decreased as

  18. Advances in Fiber Optic Sensors Technology Development for temperature and strain measurements in Superconducting magnets and devices

    CERN Document Server

    Chiuchiolo, A.; Bajko, M.; Bottura, L.; Consales, M.; Cusano, A.; Giordano, M.; Perez, J. C.

    2016-01-01

    The luminosity upgrade of the Large Hadron Collider (HL-LHC) requires the development of a new generation of superconducting magnets based on Nb3Sn technology. In order to monitor the magnet thermo-mechanical behaviour during its service life, from the coil fabrication to the magnet operation, reliable sensing systems need to be implemented. In the framework of the FP7 European project EUCARD, Nb3Sn racetrack coils are developed as test beds for the fabrication validation, the cable characterization and the instrumentation development. Fiber optic sensors (FOS) based on Fiber Bragg Grating (FBG) technology have been embedded in the coils of the Short Model Coil (SMC) magnet. The FBG sensitivity to both temperature and strain required the development of a solution able to separate the mechanical and temperature effects. This work presents the feasibility study of the implementation of embedded FBG sensors for the temperature and strain monitoring of the 11 T type conductor. We aim to monitor and register these...

  19. SC Power leads and cables - Nominal Current Test Performance of 2 kA-Class High-Tc Superconducting Cable Conductors and Its Implications for Cooling Systems for Utility Cables

    DEFF Research Database (Denmark)

    Willen, D. W. A; Daumling, M.; Rasmussen, C. N.

    2000-01-01

    at high currents. The critical currents of these conductors are in the range of 1-3 kA, and ac losses smaller than 1 W/m are measured at 2 kArms. AC currents with peak values exceeding the dc critical currents are applied. Increased losses, in excess of the expected magnitization losses are observed when...... individual layers in the cables saturate. The loss-contributions from other components of the cable system are discussed,and the implications for the cooling apparatus for superconducting utility cables are determined....

  20. 9 July 2012 - Academy of Sciences Malaysia (ASM), Chairman, Mathematical and Physical Sciences Discipline Group M. Yahaya FASc and his delegation visiting the LHC superconducting magnet test hall with Technology Department G. De Rijk.

    CERN Document Server

    Maximilien Brice

    2012-01-01

    9 July 2012 - Academy of Sciences Malaysia (ASM), Chairman, Mathematical and Physical Sciences Discipline Group M. Yahaya FASc and his delegation visiting the LHC superconducting magnet test hall with Technology Department G. De Rijk.

  1. 10th December 2010 - German Delegation from the Novartis Foundation for Sustainable Development visiting the LHC superconducting magnet test hall with Technology Department S. Russenschuck and accompanied by Adviser for Life Sciences M. Dosanjh.

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    10th December 2010 - German Delegation from the Novartis Foundation for Sustainable Development visiting the LHC superconducting magnet test hall with Technology Department S. Russenschuck and accompanied by Adviser for Life Sciences M. Dosanjh.

  2. Superconducting transistor

    Science.gov (United States)

    Gray, Kenneth E.

    1979-01-01

    A superconducting transistor is formed by disposing three thin films of superconducting material in a planar parallel arrangement and insulating the films from each other by layers of insulating oxides to form two tunnel junctions. One junction is biased above twice the superconducting energy gap and the other is biased at less than twice the superconducting energy gap. Injection of quasiparticles into the center film by one junction provides a current gain in the second junction.

  3. S-C Mylonites

    NARCIS (Netherlands)

    Lister, G.S.; Snoke, A.W.

    1984-01-01

    Two types of foliations are commonly developed in mylonites and mylonitic rocks: (a) S-surfaces related to the accumulation of finite strain and (b) C-surfaces related to displacement discontinuities or zones of relatively high shear strain. There are two types of S-C mylonites. Type I S-C mylonites

  4. Superconductivity and superconductive electronics

    Science.gov (United States)

    Beasley, M. R.

    1990-12-01

    The Stanford Center for Research on Superconductivity and Superconductive Electronics is currently focused on developing techniques for producing increasingly improved films and multilayers of the high-temperature superconductors, studying their physical properties and using these films and multilayers in device physics studies. In general the thin film synthesis work leads the way. Once a given film or multilayer structure can be made reasonably routinely, the emphasis shifts to studying the physical properties and device physics of these structures and on to the next level of film quality or multilayer complexity. The most advanced thin films synthesis work in the past year has involved developing techniques to deposit a-axis and c-axis YBCO/PBCO superlattices and related structures. The in-situ feature is desirable because no solid state reactions with accompanying changes in volume, morphology, etc., that degrade the quality of the film involved.

  5. Superconductivity and ferromagnetism in nanomaterial NbSe2

    Science.gov (United States)

    Gill, Raminder

    2017-07-01

    Finding of superconductivity (SC) in ultra thin layer of Niobium diselenide (NbSe2) caught the attention of each condensed matter physicist in the era of nanotechnology. The coexistence of SC and magnetism have been a topic of interesting research in solid-state physics since the discovery of superconductivity. Ferromagnetism induced in any compound could destroy superconductivity by disturbing the cooper pairing of electrons of the atoms. The interplay between ferromagnetism (FM) and SC in nanomaterial NBSe2 impressed to study and to know the exact mechanism behind this coexistence which can lead to a very interesting research: superconductivity at room temperature. In this paper, I have theoretically studied the coexistence of SC and FM in NbSe2 and how this material could be useful in finding many high Tc nanomaterials.

  6. Superconducting wind turbine generators

    DEFF Research Database (Denmark)

    Abrahamsen, Asger Bech; Mijatovic, Nenad; Seiler, Eugen

    2010-01-01

    , the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10...... offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However...... MW generator and it is concluded that the present production capacity of coated conductors must be increased by a factor of 36 by 2020, resulting in a ten times lower price of the tape in order to reach a realistic price level for the superconducting drive train....

  7. Three-flavor color superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Malekzadeh, H.

    2007-12-15

    I investigate some of the inert phases in three-flavor, spin-zero color-superconducting quark matter: the CFL phase (the analogue of the B phase in superfluid {sup 3}He), the A and A{sup *} phases, and the 2SC and sSC phases. I compute the pressure of these phases with and without the neutrality condition. Without the neutrality condition, after the CFL phase the sSC phase is the dominant phase. However, including the neutrality condition, the CFL phase is again the energetically favored phase except for a small region of intermediate densities where the 2SC/A{sup *} phase is favored. It is shown that the 2SC phase is identical to the A{sup *} phase up to a color rotation. In addition, I calculate the self-energies and the spectral densities of longitudinal and transverse gluons at zero temperature in color-superconducting quark matter in the CFL phase. I find a collective excitation, a plasmon, at energies smaller than two times the gap parameter and momenta smaller than about eight times the gap. The dispersion relation of this mode exhibits a minimum at some nonzero value of momentum, indicating a van Hove singularity. (orig.)

  8. Korea's developmental program for superconductivity

    Science.gov (United States)

    Hong, Gye-Won; Won, Dong-Yeon; Kuk, Il-Hyun; Park, Jong-Chul

    1995-01-01

    Superconductivity research in Korea was firstly carried out in the late 70's by a research group in Seoul National University (SNU), who fabricated a small scale superconducting magnetic energy storage system under the financial support from Korea Electric Power Company (KEPCO). But a few researchers were involved in superconductivity research until the oxide high Tc superconductor was discovered by Bednorz and Mueller. After the discovery of YBaCuO superconductor operating above the boiling point of liquid nitrogen (77 K)(exp 2), Korean Ministry of Science and Technology (MOST) sponsored a special fund for the high Tc superconductivity research to universities and national research institutes by recognizing its importance. Scientists engaged in this project organized 'High Temperature Superconductivity Research Association (HITSRA)' for effective conducting of research. Its major functions are to coordinate research activities on high Tc superconductivity and organize the workshop for active exchange of information. During last seven years the major superconductivity research has been carried out through the coordination of HITSRA. The major parts of the Korea's superconductivity research program were related to high temperature superconductor and only a few groups were carrying out research on conventional superconductor technology, and Korea Atomic Energy Research Institute (KAERI) and Korea Electrotechnology Research Institute (KERI) have led this research. In this talk, the current status and future plans of superconductivity research in Korea will be reviewed based on the results presented in interim meeting of HITSRA, April 1-2, 1994. Taejeon, as well as the research activity of KAERI.

  9. Final Scientific/Technical Report On AWARD NO. DE-SC0015635 “Organization of the 17th Advanced Accelerator Concepts (AAC16) Workshop by the IEEE” The IEEE Council on Superconductivity David F. Sutter (PI) Institute of Electrical & Electronics Engineers, Inc. 445 Hoes Lane Piscataway, NJ, 088544141, US. Period of time covered by the report: 5/1/2016 – 7/30/2017

    Energy Technology Data Exchange (ETDEWEB)

    Sutter, David F. [Inst. of Electrical and Electronics Engineers Inc., Piscataway, NJ (United States)

    2017-07-15

    The 2016 Workshop on Advanced Accelerator Concepts (AAC) was held at the Gaylord Hotel and Conference Center, National Harbor, Maryland, from July 31 through August 5, 2016. This workshop was the seventeenth in a biennial series that began at Los Alamos National Laboratory in 1982 with a workshop on laser acceleration of particles (see AIP Conf. Proc. 91). AAC16 was organized under the sponsorship of the IEEE Council on Superconductivity with financial support from the U. S. Department of Energy Office of High Energy Physics and the National Science Foundation. The scope of the AAC Workshop has grown since 1982 to encompass a broad range of topics related to advancing accelerator science and technology beyond its current scientific and technical limits and is now an internationally acknowledged forum for interdisciplinary discussions on advanced accelerator and beam physics/technology concepts covering the widest possible range of applications. The Workshop continued the trend of growing worldwide participation, attracting world wide participation. The Workshop had a total of 256 attendees comprising (including the U.S.) representatives from 11 countries representing 65 different institutions. Each day’s schedule began with plenary sessions covering broad, cross disciplinary interests or general tutorial topics as selected by the Program Committee, followed by a break out into more narrowly focused working groups. The Workshop was organized into eight Working Groups each with a published statement of topical focus, scope of discussion and goals. A summary of the Working Group activities and conclusions is included in the American Institute of Physics’ (AIP) Conference Proceedings now available as an on line open source document. It has been a long tradition of the AAC workshops to encourage strong student participation. This is accomplished in part by subsidizing student attendance, done for this work shop by using funds from the DOE and National Science

  10. Mid-infrared Laser-Induced Fluorescence with Nanosecond Time Resolution Using a Superconducting Nanowire Single-Photon Detector: New Technology for Molecular Science.

    Science.gov (United States)

    Chen, Li; Schwarzer, Dirk; Verma, Varun B; Stevens, Martin J; Marsili, Francesco; Mirin, Richard P; Nam, Sae Woo; Wodtke, Alec M

    2017-06-20

    In contrast to UV photomultiplier tubes that are widely used in physical chemistry, mid-infrared detectors are notorious for poor sensitivity and slow time response. This helps explain why, despite the importance of infrared spectroscopy in molecular science, mid-infrared fluorescence is not more widely used. In recent years, several new technologies have been developed that open new experimental possibilities for research in the mid-infrared. In this Account, we present one of the more promising technologies, superconducting nanowire single photon detectors (SNSPDs) by sharing our experience with its use in a typical experiment carried out by physical chemists (laser-induced fluorescence) and comparing the SNSPD to a detector commonly used by physical chemists (InSb at LN Temperature). SNSPDs are fabricated from a thin film of superconducting metal, patterned into a meandering nanowire. The nanowire is cooled below its superconducting temperature, Tc, and held in a constant current circuit below the critical current necessary to destroy superconductivity, Ic. Upon absorption of a photon, the resulting heat is sufficient to destroy superconductivity across the entire width of the nanowire, an event that can be detected as a voltage pulse. In contrast to semiconductor-based detectors, which have a long wavelength cutoff determined by the band gap, the SNSPD exhibits single-photon sensitivity across the entire mid-IR spectrum. As these devices have not been used extensively outside the field of light detection technology research, one important goal of this Account is to provide practical details for the implementation of these devices in a physical chemistry laboratory. We provide extensive Supporting Information describing what is needed. This includes information on a liquid nitrogen cooled monochromator, the optical collection system including mid-infrared fibers, as well as a closed-cycle cryogenic cooler that reaches 0.3 K. We demonstrate the advantages of

  11. Japan. Superconductivity for Smart Grids

    Energy Technology Data Exchange (ETDEWEB)

    Hayakawa, K.

    2012-11-15

    Currently, many smart grid projects are running or planned worldwide. These aim at controlling the electricity supply more efficiently and more stably in a new power network system. In Japan, especially superconductivity technology development projects are carried out to contribute to the future smart grid. Japanese cable makers such as Sumitomo Electric and Furukawa Electric are leading in the production of high-temperature superconducting (HTS) power cables. The world's largest electric current and highest voltage superconductivity proving tests have been started this year. Big cities such as Tokyo will be expected to introduce the HTS power cables to reduce transport losses and to meet the increased electricity demand in the near future. Superconducting devices, HTS power cables, Superconducting Magnetic Energy Storage (SMES) and flywheels are the focus of new developments in cooperations between companies, universities and research institutes, funded by the Japanese research and development funding organization New Energy and Industrial Technology Development Organization (NEDO)

  12. Stress management as an enabling technology for high-field superconducting dipole magnets

    Science.gov (United States)

    Holik, Eddie Frank, III

    This dissertation examines stress management and other construction techniques as means to meet future accelerator requirement demands by planning, fabricating, and analyzing a high-field, Nb3Sn dipole. In order to enable future fundamental research and discovery in high energy accelerator physics, bending magnets must access the highest fields possible. Stress management is a novel, propitious path to attain higher fields and preserve the maximum current capacity of advanced superconductors by managing the Lorentz stress so that strain induced current degradation is mitigated. Stress management is accomplished through several innovative design features. A block-coil geometry enables an Inconel pier and beam matrix to be incorporated in the windings for Lorentz Stress support and reduced AC loss. A laminar spring between windings and mica paper surrounding each winding inhibit any stress transferral through the support structure and has been simulated with ALGORRTM. Wood's metal filled, stainless steel bladders apply isostatic, surface-conforming preload to the pier and beam support structure. Sufficient preload along with mica paper sheer release reduces magnet training by inhibiting stick-slip motion. The effectiveness of stress management is tested with high-precision capacitive stress transducers and strain gauges. In addition to stress management, there are several technologies developed to assist in the successful construction of a high-field dipole. Quench protection has been designed and simulated along with full 3D magnetic simulation with OPERARTM. Rutherford cable was constructed, and cable thermal expansion data was analysed after heat treatment. Pre-impregnation analysis techniques were developed due to elemental tin leakage in varying quantities during heat treatment from each coil. Robust splicing techniques were developed with measured resistivites consistent with nO joints. Stress management has not been incorporated by any other high field dipole

  13. Superconducting electronics

    NARCIS (Netherlands)

    Rogalla, Horst

    1994-01-01

    During the last decades superconducting electronics has been the most prominent area of research for small scale applications of superconductivity. It has experienced quite a stormy development, from individual low frequency devices to devices with high integration density and pico second switching

  14. Accelerator Science and Technology in Canada -- From the Microtron to TRIUMF, Superconducting Cyclotrons and the Canadian Light Source

    Science.gov (United States)

    Craddock, M. K.; Laxdal, R. E.

    As elsewhere, accelerators in Canada have evolved from modest beginnings to major facilities such as TRIUMF (currently with the highest-power driver for rare isotope beam production) and the third generation Canadian Light Source. Highlights along the way include construction of the first microtron, the first racetrack microtron and the first superconducting cyclotron (to which list might have been added the first pulse stretcher ring, had it been funded sooner). This article will summarize the history of accelerators in Canada, documenting both the successes and the near-misses. Besides the research accelerators, a thriving commercial sector has developed, manufacturing small cyclotrons and linacs, beam line components and superconducting rf cavities.

  15. Accelerator Science and Technology in Canada — From the Microtron to TRIUMF, Superconducting Cyclotrons and the Canadian Light Source

    Science.gov (United States)

    Craddock, M. K.; Laxdal, R. E.

    As elsewhere, accelerators in Canada have evolved from modest beginnings to major facilities such as TRIUMF (currently with the highest-power driver for rare isotope beam production) and the third generation Canadian Light Source. Highlights along the way include construction of the first microtron, the first racetrack microtron and the first superconducting cyclotron (to which list might have been added the first pulse stretcher ring, had it been funded sooner). This article will summarize the history of accelerators in Canada, documenting both the successes and the near-misses. Besides the research accelerators, a thriving commercial sector has developed, manufacturing small cyclotrons and linacs, beam line components and superconducting rf cavities.

  16. Measurement of (43)Sc and (44)Sc production cross-section with an 18MeV medical PET cyclotron.

    Science.gov (United States)

    Carzaniga, Tommaso Stefano; Auger, Martin; Braccini, Saverio; Bunka, Maruta; Ereditato, Antonio; Nesteruk, Konrad Pawel; Scampoli, Paola; Türler, Andreas; van der Meulen, Nicholas

    2017-11-01

    (43)Sc and (44)Sc are positron emitter radionuclides that, in conjunction with the β(-) emitter (47)Sc, represent one of the most promising possibilities for theranostics in nuclear medicine. Their availability in suitable quantity and quality for medical applications is an open issue and their production with medical cyclotrons represents a scientific and technological challenge. For this purpose, an accurate knowledge of the production cross sections is mandatory. In this paper, we report on the cross section measurement of the reactions (43)Ca(p,n)(43)Sc, (44)Ca(p,2n) (43)Sc, (46)Ti(p,α)(43)Sc, and (44)Ca(p,n)(44)Sc at the Bern University Hospital cyclotron. A study of the production yield and purity performed by using commercially available enriched target materials is also presented. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Current Sharing Technology in Transmission Conductors of Cold Dielectric High Temperature Superconducting Cables Using Second-generation HTS Wires

    Institute of Scientific and Technical Information of China (English)

    ZHU Jiahui; BAO Xuzheng; QIU Ming

    2012-01-01

    The cold dielectric high temperature superconducting (CD HTS) cable has multilayer conductors. The non-uniform AC current distribution in these multilayer conductors will increase the AC loss and decrease the current transmission efficiency. So it is important to understand the current sharing among layers in order to fully exploit the performance of the HTS cable.

  18. DARPA Antibody Technology Program. Standardized Test Bed for Antibody Characterization: Characterization of an MS2 ScFv Antibody Produced by Illumina

    Science.gov (United States)

    2016-08-01

    air bubbles from the samples. Mineral oil (Sigma-Aldrich) was applied to the top of each sample to prevent sample evaporation. The plate was placed...quantitative melting temperature (Tm) for each of the Illumina MS2 scFv proteins. The Tm should predict the results of subsequent ELISA and surface plasmon...in 1× PBS and divided into five tubes. One aliquot was kept on ice for the duration of the experiment and was marked time 0. The remaining four

  19. SC tuning fork

    CERN Multimedia

    The tuning fork used to modulate the radiofrequency system of the synchro cyclotron (SC) from 1957 to 1973. This piece is an unused spare part. The SC was the 1st accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990. In the SC the magnetic field did not change with time, and the particles were accelerated in successive pulses by a radiofrequency voltage of some 20kV which varied in frequency as they spiraled outwards towards the extraction radius. The frequency varied from 30MHz to about 17Mz in each pulse. The tuning fork vibrated at 55MHz in vacuum in an enclosure which formed a variable capacitor in the tuning circuit of the RF system, allowing the RF to vary over the appropriate range to accelerate protons from the centre of the macine up to 600Mev at extraction radius. In operation the tips of the tuning fork blade had an amplitude of movement of over 1 cm. The SC accelerator underwent extensive improvements from 1973 to 1975, including the installation of a...

  20. SC2 dee

    CERN Multimedia

    1974-01-01

    Checking the positioning of the dee before its introduction into the vacuum chamber of SC2. The dee is mounted on a large cover plate which also carries the dee liner and the pump manifold. The dummy dee is fixed to the pole faces within the vacuum chamber.

  1. A superconducting magnet upgrade of the ATF2 final focus

    CERN Document Server

    Parker, B; Escallier, J; He, P; Jain, P; Marone, A; Wanderer, P; Wu, KC; Hauviller, C; Marin, E; Tomas, R; Zimmermann, F; Bolzon, B; Jeremie, A; Kimura, N; Kubo, K; Kume, T; Kuroda, S; Okugi, T; Tauchi, T; Terunuma, N; Tomaru, T; Tsuchiya, K; Urakawa, J; Yamamoto, A; Bambade, P; Coe, P; Urner, D; Seryi, A; Spencer, C; White, G

    2010-01-01

    The ATF2 facility at KEK is a proving ground for linear collider technology with a well instrumented extracted beam line and Final Focus (FF). The primary ATF2 goal is to demonstrate the extreme beam demagnification and spot stability needed for a linear collider FF [1]. But the ATF2 FF uses water cooled magnets and the ILC baseline has a superconducting (SC) FF [2]. We plan to upgrade ATF2 and replace some of the warm FF magnets with SC FF magnets. The ATF2 SC magnets, like the ILC FF, will made via direct wind construction [3]. ATF2 coil winding is in progress at BNL and warm magnetic measurements indicate we have achieved good field quality. Studies indicate that having ATF2 FF magnets with larger aperture and better field quality should allow reducing the ATF2 FF beta function for study of focusing regimes relevant to CLIC [4]. The ATF2 magnet cryostat will have laser view ports for directly monitoring cold mass movement. We plan to make stability measurements at BNL and KEK to relate ATF2 FF magnet perfo...

  2. A Superconducting Magnet Upgrade of the ATF2 Final Focus

    Energy Technology Data Exchange (ETDEWEB)

    Parker B.; Anerella M.; Escallier J.; He P.; Jain A.; Marone A.; Wanderer P.; Wu K.C.; Hauviller C.; Marin E.; Tomas R.; Zimmermann F.; Bolzon B.; Jeremie A.; Kimura N.; Kubo K.; Kume T.; Kuroda S.; Okugi T.; Tauchi T.; Terunuma N.; Tomaru T.; Tsuchiya K.; Urakawa J.; Yamamoto A.; Bambabe P.; Coe P.; Urner D.; Seryi A.; Spencer C.; White G.

    2010-05-23

    The ATF2 facility at KEK is a proving ground for linear collider technology with a well instrumented extracted beam line and Final Focus (FF). The primary ATF2 goal is to demonstrate the extreme beam demagnification and spot stability needed for a linear collider FF. But the ATF2 FF uses water cooled magnets and the ILC baseline has a superconducting (SC) FF. We plan to upgrade ATF2 and replace some of the warm FF magnets with SC FF magnets. The ATF2 SC magnets, like the ILC FF, will made via direct wind construction. ATF2 coil winding is in progress at BNL and warm magnetic measurements indicate we have achieved good field quality. Studies indicate that having ATF2 FF magnets with larger aperture and better field quality should allow reducing the ATF2 FF beta function for study of focusing regimes relevant to CLIC. The ATF2 magnet cryostat will have laser view ports for directly monitoring cold mass movement. We plan to make stability measurements at BNL and KEK to relate ATF2 FF magnet performance to that of a full length ILC QD0 R and D FF prototype under construction at BNL.

  3. A Superconducting Magnet Upgrade of the ATF2 Final Focus

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Brett; /Brookhaven; Anerella, Michael; /Brookhaven; Escallier, John; /Brookhaven; He, Ping; /Brookhaven; Jain, Animesh; /Brookhaven; Marone, Andrew; /Brookhaven; Wanderer, Peter; /Brookhaven; Wu, Kuo-Chen; /Brookhaven; Bambade, Philip; /Orsay, LAL; Bolzon, Benoit; /Annecy, LAPP; Jeremie, Andrea; /Annecy, LAPP; Coe, Paul; /Oxford U.; Urner, David /Oxford U.; Hauviller, Claude; /CERN; Marin, Eduardo; /CERN; Tomas, Rogelio; /CERN; Zimmermann, Frank; /CERN; Kimura, Nobuhiro; /KEK, Tsukuba; Kubo, Kiyoshi; /KEK, Tsukuba; Kume, Tatsuya /KEK, Tsukuba; Kuroda, Shigeru; /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /KEK, Tsukuba /SLAC /SLAC /SLAC

    2012-07-05

    The ATF2 facility at KEK is a proving ground for linear collider technology with a well instrumented extracted beam line and Final Focus (FF). The primary ATF2 goal is to demonstrate the extreme beam demagnification and spot stability needed for a linear collider FF. But the ATF2 FF uses water cooled magnets and the ILC baseline has a superconducting (SC) FF. We plan to upgrade ATF2 and replace some of the warm FF magnets with SC FF magnets. The ATF2 SC magnets, like the ILC FF, will made via direct wind construction. ATF2 coil winding is in progress at BNL and warm magnetic measurements indicate we have achieved good field quality. Studies indicate that having ATF2 FF magnets with larger aperture and better field quality should allow reducing the ATF2 FF beta function for study of focusing regimes relevant to CLIC. The ATF2 magnet cryostat will have laser view ports for directly monitoring cold mass movement. We plan to make stability measurements at BNL and KEK to relate ATF2 FF magnet performance to that of a full length ILC QD0 R&D FF prototype under construction at BNL.

  4. Charge ordering phenomena and superconductivity in underdoped cuprates

    Energy Technology Data Exchange (ETDEWEB)

    Tassini, Leonardo [Bayerische Akademie der Wissenschaften, Muenchen (Germany). Lehrstuhl E23 fuer Technische Physik

    2008-01-16

    In this thesis electronic properties of two prototypical copper-oxygen superconductors were studied with Raman scattering. The underdoped regime including the onset point of superconductivity p{sub sc1} was investigated. Evidence of quasi one-dimensional (1D) dynamical stripes was found. The 1D structures have a universal preferential orientation along the diagonals of the CuO{sub 2} planes below p{sub sc1}. At p{sub sc1}, lattice and electron dynamics change discontinuously. The results show that charge ordering drives the transition at p{sub sc1} and that the maximal transition temperature to superconductivity at optimal doping T{sub c}{sup MAX} depends on the type of ordering at p{sub sc1}. (orig.)

  5. Intercalated Nanocomposites Based on High-Temperature Superconducting Ceramics and Their Properties

    Directory of Open Access Journals (Sweden)

    Sevan Davtyan

    2009-12-01

    Full Text Available High temperature superconducting (SC nanocomposites based on SC ceramics and various polymeric binders were prepared. Regardless of the size of the ceramics’ grains, the increase of their amount leads to an increase of resistance to rupture and modulus and a decrease in limiting deformation, whereas an increase in the average ceramic grain size worsens resistance properties. The SC, thermo-chemical, mechanical and dynamic-mechanical properties of the samples were investigated. Superconducting properties of the polymer ceramic nanocomposites are explained by intercalation of macromolecule fragments into the interstitial layer of the ceramics’ grains. This phenomenon leads to a change in the morphological structure of the superconducting nanocomposites.

  6. 17th International Conference on RF Superconductivity

    CERN Document Server

    2015-01-01

    RF superconductivity is the key technology of accelerators for particle physics, nuclear physics and light sources. SRF 2015 covered the latest advances in the science, technology, and applications of superconducting RF. There was also an industrial exhibit during the conference with the key vendors in the community available to discuss their capabilities and products.

  7. 17th International Conference on RF Superconductivity

    CERN Document Server

    Laxdal, Robert E.; Schaa, Volker R.W.

    2015-01-01

    RF superconductivity is the key technology of accelerators for particle physics, nuclear physics and light sources. SRF 2015 covered the latest advances in the science, technology, and applications of superconducting RF. There was also an industrial exhibit during the conference with the key vendors in the community available to discuss their capabilities and products.

  8. Operational Merits of Maritime Superconductivity

    Science.gov (United States)

    Ross, R.; Bosklopper, J. J.; van der Meij, K. H.

    The perspective of superconductivity to transfer currents without loss is very appealing in high power applications. In the maritime sector many machines and systems exist in the roughly 1-100 MW range and the losses are well over 50%, which calls for dramatic efficiency improvements. This paper reports on three studies that aimed at the perspectives of superconductivity in the maritime sector. It is important to realize that the introduction of superconductivity comprises two technology transitions namely firstly electrification i.e. the transition from mechanical drives to electric drives and secondly the transition from normal to superconductive electrical machinery. It is concluded that superconductivity does reduce losses, but its impact on the total energy chain is of little significance compared to the investments and the risk of introducing a very promising but as yet not proven technology in the harsh maritime environment. The main reason of the little impact is that the largest losses are imposed on the system by the fossil fueled generators as prime movers that generate the electricity through mechanical torque. Unless electric power is supplied by an efficient and reliable technology that does not involve mechanical torque with the present losses both normal as well as superconductive electrification of the propulsion will hardly improve energy efficiency or may even reduce it. One exception may be the application of degaussing coils. Still appealing merits of superconductivity do exist, but they are rather related to the behavior of superconductive machines and strong magnetic fields and consequently reduction in volume and mass of machinery or (sometimes radically) better performance. The merits are rather convenience, design flexibility as well as novel applications and capabilities which together yield more adequate systems. These may yield lower operational costs in the long run, but at present the added value of superconductivity rather seems more

  9. Preparation and characterization of Sc doped MgB2 wires

    Science.gov (United States)

    Grivel, J.-C.; Burdusel, M.

    2016-09-01

    The in-situ technique was used to manufacture scandium (Sc) doped MgB2 wires in a composite Cu-Nb sheath. After reaction at 700 °C, at most 1 at.% Mg was replaced by Sc in the MgB2 phase, without significant influence on its superconducting transition temperature. For higher Sc concentrations in the nominal composition, the formation of Sc-rich impurity phases was evidenced by SEM/EDS observations. The critical current density and accommodation field of the wires are weakly dependant on the Sc content. It is believed that these effects are related more to modifications of the thermal behaviour of the precursor powders revealed by DTA measurements than to actual doping. The best performance was obtained in a wire with Mg:Sc = 0.995_0.005 atomic ratio.

  10. Ripple Field AC Losses in 10-MW Wind Turbine Generators With a MgB2 Superconducting Field Winding

    DEFF Research Database (Denmark)

    Liu, Dong; Polinder, Henk; Magnusson, Niklas

    2016-01-01

    Superconducting (SC) synchronous generators are proposed as a promising candidate for 10-20-MW direct-drive wind turbines because they can have low weights and small sizes. A common way of designing an SC machine is to use SC wires with high current-carrying capability in the dc field winding...

  11. Application of Phase Lock Loop in Superconducting RF Technology%锁相环在超导射频技术中的应用

    Institute of Scientific and Technical Information of China (English)

    常玮; 何源; 李春龙; 高郑; 朱正龙; 薛纵横; 宋玉; 张锐

    2014-01-01

    利用压控振荡器锁相环路(VCO-PLL)锁定超导射频谐振腔体的本征频率,使腔体稳定谐振。在原理验证阶段,利用NI-Labview对实验原理做了仿真。得到的仿真结果显示,环路增益选取的不同会直接影响整个系统的锁定状态。在实验测试阶段,根据原理和仿真结果搭建了相应的实验平台,从而得到环路锁定的测试结果。最后在低温超导态测试阶段,用经过验证的实验平台对IMP-HWR010超导腔体进行了频率锁定测试,并得到了腔体频率随氦压变化的实际测量结果,df/dp约为0.73 Hz/Pa。%The main issue of this paper is to introduce the application of phase lock loop (PLL) in supercon-ducting RF technology. The voltage-controlled oscillator phase lock loop (VCO-PLL) can be used for locking the eigen frequency of the superconducting cavity. It can keep superconducting cavity resonant stably. In this paper, the principle of the cavity locking by the VCO-PLL is verified by a simulation, which is done by using NI-Labview software. The simulation result shows that the different gain of the PLL system can impact the locking situation of the whole system. In the test stage, the locking test plant is set up and passed validation. Finally, at the low temperature test stage, the frequency of the IMP-HWR010 superconducting cavity is locked by the test plant. The frequency change with helium pressure of the cavity is about 0.73 Hz/Pa.

  12. Induced spectral gap and pairing correlations from superconducting proximity effect

    Science.gov (United States)

    Chiu, Ching-Kai; Cole, William S.; Das Sarma, S.

    2016-09-01

    We theoretically consider superconducting proximity effect, using the Bogoliubov-de Gennes (BdG) theory, in heterostructure sandwich-type geometries involving a normal s -wave superconductor and a nonsuperconducting material with the proximity effect being driven by Cooper pairs tunneling from the superconducting slab to the nonsuperconducting slab. Applications of the superconducting proximity effect may rely on an induced spectral gap or induced pairing correlations without any spectral gap. We clarify that in a nonsuperconducting material the induced spectral gap and pairing correlations are independent physical quantities arising from the proximity effect. This is a crucial issue in proposals to create topological superconductivity through the proximity effect. Heterostructures of three-dimensional topological insulator (TI) slabs on conventional s -wave superconductor (SC) substrates provide a platform, with proximity-induced topological superconductivity expected to be observed on the "naked" top surface of a thin TI slab. We theoretically study the induced superconducting gap on this naked surface. In addition, we compare against the induced spectral gap in heterostructures of SC with a normal metal or a semiconductor with strong spin-orbit coupling and a Zeeman splitting potential (another promising platform for topological superconductivity). We find that for any model for the non-SC metal (including metallic TI) the induced spectral gap on the naked surface decays as L-3 as the thickness (L ) of the non-SC slab is increased in contrast to the slower 1 /L decay of the pairing correlations. Our distinction between proximity-induced spectral gap (with its faster spatial decay) and pairing correlation (with its slower spatial decay) has important implications for the currently active search for topological superconductivity and Majorana fermions in various superconducting heterostructures.

  13. Industrial and scientific technology research and development project in fiscal 1997 commissioned by the New Energy and Industrial Technology Development Organization. Research and development of superconducting materials and transistors (report on overall investigation of superconductive devices); 1997 nendo sangyo kagaku gijutsu kenkyu kaihatsu jigyo Shin energy Sangyo Gijutsu Sogo Kaihatsu Kiko itaku. Chodendo zairyo chodendo soshi no kenkyu kaihatsu (chodendo soshika gijutsu kaihatsu seika hokokusho)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    This paper describes development of superconducting new function transistors. Fiscal 1997 as the final year of the project advanced improvement in such transistor-using processes as formation and micro-processing of superconducting thin films to show enhancement in characteristics of high-temperature superconducting transistors and possibility of their application utilizing their high speed motions. Furthermore, fundamental technologies were studied with an aim on junction transistors to be applied as circuits. For field effect transistors, evaluation was performed on critical current distribution of step-type particle boundary junction to make it possible to evaluate characteristics of hundreds of transistors. At the same time, a magnetic flux quantum parametron gate with three-layer structure was fabricated to identify its operation. In superconducting-base transistors, strong reflection was recognized on temperature dependence of permittivity of an Nb-doped strontium titanate substrate used for collectors, by which barrier height was reduced. In the junction transistor and circuit technology, isotropic ramp-edge junctions were fabricated, and so was a frequency divider circuit with single magnetic flux quantum mode operation for evaluating high-speed response characteristics. High time resolution current was observed successfully by using a high-temperature superconducting sampler system. 148 refs., 127 figs., 4 tabs.

  14. Nonequilibrium superconducting detectors

    Science.gov (United States)

    Cristiano, R.; Ejrnaes, M.; Esposito, E.; Lisitskyi, M. P.; Nappi, C.; Pagano, S.; Perez de Lara, D.

    2006-03-01

    Nonequilibrium superconducting detectors exploit the early stages of the energy down cascade which occur after the absorption of radiation. They operate on a short temporal scale ranging from few microseconds down to tens of picoseconds. In such a way they provide fast counting capability, high time discrimination and also, for some devices, energy sensitivity. Nonequilibrium superconducting detectors are developed for their use both in basic science and in practical applications for detection of single photons or single ionized macromolecules. In this paper we consider two devices: distributed readout imaging detectors (DROIDs) based on superconducting tunnel junctions (STJs), which are typically used for high-speed energy spectroscopy applications, and hot-electron superconductive detectors (HESDs), which are typically used as fast counters and time discriminators. Implementation of the DROID geometry to use a single superconductor is discussed. Progress in the fabrication technology of NbN nanostructured HESDs is presented. The two detectors share the high sensitivity that makes them able to efficiently detect even single photons down to infrared energy.

  15. Nonequilibrium superconducting detectors

    Energy Technology Data Exchange (ETDEWEB)

    Cristiano, R [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Ejrnaes, M [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); INFN Sezione di Napoli, 80126 Naples (Italy); Esposito, E [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Lisitskyi, M P [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Nappi, C [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Pagano, S [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy); Dipartimento di Fisica, Universita di Salerno, 84081 Baronissi (Saudi Arabia) (Italy); Perez de Lara, D [CNR-Istituto di Cibernetica E. Caianiello, 80078 Pozzuoli (Namibia) (Italy)

    2006-03-15

    Nonequilibrium superconducting detectors exploit the early stages of the energy down cascade which occur after the absorption of radiation. They operate on a short temporal scale ranging from few microseconds down to tens of picoseconds. In such a way they provide fast counting capability, high time discrimination and also, for some devices, energy sensitivity. Nonequilibrium superconducting detectors are developed for their use both in basic science and in practical applications for detection of single photons or single ionized macromolecules. In this paper we consider two devices: distributed readout imaging detectors (DROIDs) based on superconducting tunnel junctions (STJs), which are typically used for high-speed energy spectroscopy applications, and hot-electron superconductive detectors (HESDs), which are typically used as fast counters and time discriminators. Implementation of the DROID geometry to use a single superconductor is discussed. Progress in the fabrication technology of NbN nanostructured HESDs is presented. The two detectors share the high sensitivity that makes them able to efficiently detect even single photons down to infrared energy.

  16. Disbursement of $65 million to the State of Texas for construction of a Regional Medical Technology Center at the former Superconducting Super Collider Site, Waxahachie, Texas

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    As part of a settlement agreement between the US DOE and the State of Texas, DOE proposes to transfer $65 million of federal funds to the Texas National Research Laboratory Commission (TNLRC) for construction of the Regional Medical Technology Center (RMTC) to be located in Ellis County, Texas. The RMTC would be a state-of-the-art medical facility for proton cancer therapy, operated by the State of Texas in conjunction with the University of Texas Southwestern Medical Center. The RMTC would use the linear accelerator assets of the recently terminated DOE Superconducting Super Collider Project to accelerate protons to high energies for the treatment of cancer patients. The current design provides for treatment areas, examination rooms, support laboratories, diagnostic imaging equipment, and office space as well as the accelerators (linac and synchrotron) and beam steering and shaping components. The potential environmental consequences of the proposed action are expected to be minor.

  17. Superconducting Microelectronics.

    Science.gov (United States)

    Henry, Richard W.

    1984-01-01

    Discusses superconducting microelectronics based on the Josephson effect and its advantages over conventional integrated circuits in speed and sensitivity. Considers present uses in standards laboratories (voltage) and in measuring weak magnetic fields. Also considers future applications in superfast computer circuitry using Superconducting…

  18. Development of superconductor application technology - Fabrication of superconducting plate using tape casting and development of directional growth

    Energy Technology Data Exchange (ETDEWEB)

    Noh, Kwang Soo; Yoon, Dae Sung; Lee, Joon Sung; Jun, Byung Hyuk; Woo, Sung Soo; Hong, Seung Bum; Kim, Eun Ah; Song, Han Wook [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)

    1996-05-01

    This study concerns the establishment of the fabrication techniques of the high temperature superconductor tape using tape coating, the heat treatment and directional growth techniques in order to fabricate high temperature superconductor bulks having high current density. This study is important in the development of bulk high temperature superconductors and in the applications in bulk forms. Development of Tape Casting Technique : Fabrication of the high temperature superconductor tape using different processing condition. Fabrication of Y- and Bi- High Temperature Superconductor Tapes : Based on the optimum processing condition, the superconductor tapes were fabricated. Development of Directional Growth Techniques : The tapes were heat-treated at proper condition and directionally growth using different directional growth condition. The superconducting properties were tested on the directionally grown samples. 21 figs. (author)

  19. 2 March 2012 - US Google Management Team Executive Chairman E. Schmidt visiting the LHC superconducting magnet test hall with Director for Accelerators and Technology S. Myers and Head of Technology Department F. Bordry; signing the guest book with CERN Director-General R. Heuer.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    2 March 2012 - US Google Management Team Executive Chairman E. Schmidt visiting the LHC superconducting magnet test hall with Director for Accelerators and Technology S. Myers and Head of Technology Department F. Bordry; signing the guest book with CERN Director-General R. Heuer.

  20. 20th May 2010 - Malaysian Minister for Science, Technology and Innovation H. F: B. H. Yusof signing the guest book with Coordinator for External Relations F. Pauss and CMS Collaboration Deputy Spokesperson A. De Roeck; visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry; throughout accompanied by CERN Advisers J. Ellis and E. Tsesmelis.

    CERN Document Server

    Maximilien brice

    2010-01-01

    20th May 2010 - Malaysian Minister for Science, Technology and Innovation H. F: B. H. Yusof signing the guest book with Coordinator for External Relations F. Pauss and CMS Collaboration Deputy Spokesperson A. De Roeck; visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry; throughout accompanied by CERN Advisers J. Ellis and E. Tsesmelis.

  1. Comparing superconducting and permanent magnets for magnetic refrigeration

    DEFF Research Database (Denmark)

    Bjørk, Rasmus; Nielsen, Kaspar Kirstein; Bahl, C. R. H.

    2016-01-01

    We compare the cost of a high temperature superconducting (SC) tape-based solenoidwith a permanent magnet (PM) Halbach cylinder for magnetic refrigeration.Assuming a five liter active magnetic regenerator volume, the price of each type ofmagnet is determined as a function of aspect ratio of the r......We compare the cost of a high temperature superconducting (SC) tape-based solenoidwith a permanent magnet (PM) Halbach cylinder for magnetic refrigeration.Assuming a five liter active magnetic regenerator volume, the price of each type ofmagnet is determined as a function of aspect ratio...

  2. Time ripe for superconductivity?

    Directory of Open Access Journals (Sweden)

    George Marsh

    2002-04-01

    But there is a crucial deadline and failure to meet it could send superconductivity back to the commercial shadows (at least outside the medical and scientific niches where it is a key enabler in analytical instruments, magnetic resonance imaging, and particle accelerators for another 30 years. Later this decade, the vintage infrastructure of dense copper conductors that supports power distribution in developed countries, in particular in the US, will become due for renewal. (Recent power problems in California were largely those of distribution infrastructure. At the same time, boosting capacity to serve the needs of increasingly affluent populations will pose a challenge. Superconductivity could provide the answer — if the technology matures in time and cost targets are met.

  3. Color superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Wilczek, F. [Institute for Advanced Study, Princeton, NJ (United States)

    1997-09-22

    The asymptotic freedom of QCD suggests that at high density - where one forms a Fermi surface at very high momenta - weak coupling methods apply. These methods suggest that chiral symmetry is restored and that an instability toward color triplet condensation (color superconductivity) sets in. Here I attempt, using variational methods, to estimate these effects more precisely. Highlights include demonstration of a negative pressure in the uniform density chiral broken phase for any non-zero condensation, which we take as evidence for the philosophy of the MIT bag model; and demonstration that the color gap is substantial - several tens of MeV - even at modest densities. Since the superconductivity is in a pseudoscalar channel, parity is spontaneously broken.

  4. SUPERCONDUCTING PHOTOCATHODES.

    Energy Technology Data Exchange (ETDEWEB)

    SMEDLEY, J.; RAO, T.; WARREN, J.; SEKUTOWICZ, LANGNER, J.; STRZYZEWSKI, P.; LEFFERS, R.; LIPSKI, A.

    2005-10-09

    We present the results of our investigation of lead and niobium as suitable photocathode materials for superconducting RF injectors. Quantum efficiencies (QE) have been measured for a range of incident photon energies and a variety of cathode preparation methods, including various lead plating techniques on a niobium substrate. The effects of operating at ambient and cryogenic temperatures and different vacuum levels on the cathode QE have also been studied.

  5. Superconducting accelerating structures for very low velocity ion beams

    Directory of Open Access Journals (Sweden)

    J. Xu

    2008-03-01

    Full Text Available This paper presents designs for four types of very-low-velocity superconducting (SC accelerating cavity capable of providing several MV of accelerating potential per cavity, and suitable for particle velocities in the range 0.006Superconducting TEM-class cavities have been widely applied to cw acceleration of ion beams. SC linacs can be formed as an array of independently phased cavities, enabling a variable velocity profile to maximize the output energy for each of a number of different ion species. Several laboratories in the U.S. and Europe are planning exotic beam facilities based on SC linacs. The cavity designs presented here are intended for the front end of such linacs, particularly for the postacceleration of rare isotopes of low charge state. Several types of SC cavities have been developed recently to cover particle velocities above 0.06c. Superconducting four-gap quarter-wave resonators for velocities 0.008<β=v/c<0.05 were developed about two decades ago and have been successfully operated at the ATLAS SC linac at Argonne National Laboratory. Since that time, progress in simulation tools, cavity fabrication, and processing have increased SC cavity gradients by a factor of 3–4. This paper applies these tools to optimize the design of a four-gap quarter-wave resonator for exotic beam facilities and other low-velocity applications.

  6. Precise Thermometry for Next Generation LHC Superconducting Magnet Prototypes

    CERN Document Server

    Datskov, V; Bottura, L; Perez, J C; Borgnolutti, F; Jenninger, B; Ryan, P

    2013-01-01

    The next generation of LHC superconducting magnets is very challenging and must operate in harsh conditions: high radiation doses in a range between 10 and 50 MGy, high voltage environment of 1 to 5 kV during the quench, dynamic high magnetic field up to 12 T, dynamic temperature range 1.8 K to 300 K in 0.6 sec. For magnet performance and long term reliability it is important to study dynamic thermal effects, such as the heat flux through the magnet structure, or measuring hot spot in conductors during a magnet quench with high sampling rates above 200 Hz. Available on the market cryogenic temperature sensors comparison is given. An analytical model for special electrically insulating thermal anchor (Kapton pad) with high voltage insulation is described. A set of instrumentation is proposed for fast monitoring of thermal processes during normal operation, quenches and failure situations. This paper presents the technology applicable for mounting temperature sensors on high voltage superconducting (SC) cables....

  7. Design and comparative analysis of 10 MW class superconducting wind power generators according to different types of superconducting wires

    Energy Technology Data Exchange (ETDEWEB)

    Sung, Hae-Jin, E-mail: haejin90@changwon.ac.kr [Changwon National University, 55306 Sarim-dong, Changwon 641-773 (Korea, Republic of); Kim, Gyeong-Hun; Kim, Kwangmin; Park, Minwon [Changwon National University, 55306 Sarim-dong, Changwon 641-773 (Korea, Republic of); Yu, In-Keun, E-mail: yuik@changwon.ac.kr [Changwon National University, 55306 Sarim-dong, Changwon 641-773 (Korea, Republic of); Kim, Jong-Yul [Korea Electrotechnology Research Institute, Changwon 641-120 (Korea, Republic of)

    2013-11-15

    Highlights: •10 MW SC wind power generators are designed using different types of SC wires. •SCSGs using YBCO and Bi-2223 wires are optimized by the modified Taguchi method. •The results demonstrate a proper type of SC wire for the optimal design of SCSG. -- Abstract: Wind turbine concepts can be classified into the geared type and the gearless type. The gearless type wind turbine is more attractive due to advantages of simplified drive train and increased energy yield, and higher reliability because the gearbox is omitted. In addition, this type resolves the weight issue of the wind turbine with the light weight of gearbox. However, because of the low speed operation, this type has disadvantage such as the large diameter and heavy weight of generator. Super-Conducting (SC) wind power generator can reduce the weight and volume of a wind power system. Properties of superconducting wire are very different from each company. This paper considers the design and comparative analysis of 10 MW class SC wind power generators according to different types of SC wires. Super-Conducting Synchronous Generators (SCSGs) using YBCO and Bi-2223 wires are optimized by an optimal method. The magnetic characteristics of the SCSGs are investigated using the finite elements method program. The optimized specifications of the SCSGs are discussed in detail, and the optimization processes can be used effectively to develop large scale wind power generation systems.

  8. Cryostat for Testing HIE-Isolde Superconducting RF Cavities

    CERN Document Server

    Capatina, O; Cuccuru, G; Pasini, M; Renaglia, T; Therasse, M; Vullierme, B

    2011-01-01

    The High Intensity and Energy ISOLDE (HIE-ISOLDE) project is a major upgrade of the existing ISOLDE and REX-ISOLDE facilities at CERN [1], with the objective of increasing the energy and intensity of the delivered radioactive ion beams (RIB). This project aims to fill the request for a more energetic post-accelerated beam by means of a new superconducting (SC) linac based on Quarter Wave Resonators (QWR). A research and development (R&D) programme looking at all the different aspects of the SC linac started in 2008 and continued throughout 2010. The R&D effort has particularly focused on the development of the high β cavities (β = 10.3%) for which the Nb sputtered on Cu substrate technology has been adopted. Two prototype cavities were manufactured and are undergoing RF cold tests. The pre-series cavity manufacturing is under way using 3D forged Cu billets. A single vacuum cryostat was designed and built to test these cavities at liquid helium temperatures. This paper details the main design concep...

  9. Report on the achievements in fiscal 1999. Research and development on a basic technology to apply superconductivity (Development on an ultra high speed signal processing technology with low electric power consumption); 1999 nendo chodendo oyo kiban gijutsu kenkyu kaihatsu seika hokokusho. Teishohi denryoku chokosoku shingo shori gijutsu kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-05-01

    The development of a technology to design superconductive circuits has worked on (1) a circuit design technology and (2) fabrication of a small scale demonstration circuit. In Item (1), analog evaluation provided SN characteristics of 11 bits or more by using a primary Sigma-Delta ({sigma}-{delta}) modulator as the element circuit for an AD converter. In addition, a proposal was made on a decimation filter using a secondary {sigma}-{delta} module and a counter, which use a magnetic quantum multiplication element as feedback. In Item (2), fabricating conditions for an NBCO film were established with high Tc reproducibility. In addition to having established a design method for a superconductive filter, a technology was developed to deposit superconductive oxide conductors on both sides of an MgO substrate having a thickness of 0.5 mm. This development provided a prospect of realizing a filter for large electric power of 10 GHz and 10W class. In developing a technology for measuring superconductive circuit characteristics, discussions were given on a measurement and evaluation technology. To explain, with regard to the technology to demonstrate high speed actions, a high-speed action demonstration and measurement system was started up, which can be cooled down to 5K, and has small critical current variation due to magnetic flux trap. Output of SFQ signals up to 4 GHz was successfully detected. (NEDO)

  10. HYDRAULICS, ANDERSON COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  11. Hydraulics, ABBEVILLE COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  12. Hydraulics, OCONEE COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  13. HYDRAULICS, LAURENS COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  14. Hydraulics, GREENVILLE COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  15. Hydraulics, DARLINGTON COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  16. Hydraulics, FLORENCE COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  17. HYDRAULICS, FAIRFIELD COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  18. HYDROLOGY, Newberry COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  19. HYDROLOGY, Chester COUNTY, SC

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  20. Superconducting Fault Current Limiter optimized design

    Science.gov (United States)

    Tixador, Pascal; Badel, Arnaud

    2015-11-01

    The SuperConducting Fault Current Limiter (SCFCL) appears as one of the most promising SC applications for the electrical grids. Despite its advantages and many successful field experiences the market of SCFCL has difficulties to take off even if the first orders for permanent operation in grids are taken. The analytical design of resistive SCFCL will be discussed with the objective to reduce the quantity of SC conductor (length and section) to be more cost-effective. For that the SC conductor must have a high resistivity in normal state. It can be achieved by using high resistivity alloy for shunt, such as Hastelloy®. One of the most severe constraint is that the SCFCL should operate safely for any faults, especially those with low prospective short-circuit currents. This constraint requires to properly design the thickness of the SC tape in order to limit the hot spot temperature. An operation at 65 K appears as very interesting since it decreases the SC cost at least by a factor 2 with a simple LN2 cryogenics. Taking into account the cost reduction in a near future, the SC conductor cost could be rather low, half a dollar per kV A.

  1. Superconducting Fault Current Limiter optimized design

    Energy Technology Data Exchange (ETDEWEB)

    Tixador, Pascal, E-mail: Pascal.Tixador@grenoble-inp.fr [Univ. Grenoble Alpes, G2Elab – Institut Néel, F-38000 Grenoble (France); CNRS, G2Elab – Institut Néel, F-38000 Grenoble (France); Badel, Arnaud [CNRS, G2Elab – Institut Néel, F-38000 Grenoble (France)

    2015-11-15

    Highlights: • A low cost design of YBCO Fault Current Limiter. • A high resistance conductor for reduced length. • An asymmetrical YBCO conductor (injection and AC losses). • A thickness suitable for non destructive hot spots. - Abstract: The SuperConducting Fault Current Limiter (SCFCL) appears as one of the most promising SC applications for the electrical grids. Despite its advantages and many successful field experiences the market of SCFCL has difficulties to take off even if the first orders for permanent operation in grids are taken. The analytical design of resistive SCFCL will be discussed with the objective to reduce the quantity of SC conductor (length and section) to be more cost-effective. For that the SC conductor must have a high resistivity in normal state. It can be achieved by using high resistivity alloy for shunt, such as Hastelloy®. One of the most severe constraint is that the SCFCL should operate safely for any faults, especially those with low prospective short-circuit currents. This constraint requires to properly design the thickness of the SC tape in order to limit the hot spot temperature. An operation at 65 K appears as very interesting since it decreases the SC cost at least by a factor 2 with a simple LN2 cryogenics. Taking into account the cost reduction in a near future, the SC conductor cost could be rather low, half a dollar per kV A.

  2. Design and simulation of 3½-cell superconducting gun cavity and beam dynamics studies of the SASE-FEL System at the Institute of Accelerator Technologies at Ankara University

    Science.gov (United States)

    Yildiz, H. Duran; Cakir, R.; Porsuk, D.

    2015-06-01

    Design and simulation of a superconducting gun cavity with 3½ cells have been studied in order to give the first push to the electron beam for the linear accelerating system at The Institute of Accelerator Technologies at Ankara University. Electrons are accelerated through the gun cavity with the help of the Radiofrequency power suppliers from cryogenic systems. Accelerating gradient should be as high as possible to accelerate electron beam inside the cavity. In this study, electron beam reaches to 9.17 MeV energy at the end of the gun cavity with the accelerating gradient; Ec=19.21 MV/m. 1.3 GHz gun cavity consists of three TESLA-like shaped cells while the special designed gun-cell includes a cathode plug. Optimized important beam parameters inside the gun cavity, average beam current 3 mA, transverse emittance 2.5 mm mrad, repetition rate 30 MHz and other parameters are obtained for the SASE-FEL System. The Superfish/Poisson program is used to design each cell of the superconducting cavity. Superconducting gun cavity and Radiofrequency properties are studied by utilizing 2D Superfish/Poisson, 3D Computer Simulation Technology Microwave Studio, and 3D Computer Simulation Technology Particle Studio. Superfish/Poisson is also used to optimize the geometry of the cavity cells to get the highest accelerating gradient. The behavior of the particles along the beamline is included in this study. ASTRA Code is used to track the particles.

  3. 100 years of superconductivity

    CERN Multimedia

    Globe Info

    2011-01-01

    Public lecture by Philippe Lebrun, who works at CERN on applications of superconductivity and cryogenics for particle accelerators. He was head of CERN’s Accelerator Technology Department during the LHC construction period. Centre culturel Jean Monnet, route de Gex Tuesday 11 October from 8.30 p.m. to 10.00 p.m. » Suitable for all – Admission free - Lecture in French » Number of places limited For further information: +33 (0)4 50 42 29 37

  4. TOPICAL REVIEW: Superconducting bearings

    Science.gov (United States)

    Hull, John R.

    2000-02-01

    The physics and technology of superconducting bearings is reviewed. Particular attention is given to the use of high-temperature superconductors (HTSs) in rotating bearings. The basic phenomenology of levitational forces is presented, followed by a brief discussion of the theoretical models that can be used for conceptual understanding and calculations. The merits of various HTS bearing designs are presented, and the behaviour of HTS bearings in typical situations is discussed. The article concludes with a brief survey of various proposed applications for HTS bearings.

  5. Conventional and unconventional superconductivity

    Science.gov (United States)

    Fernandes, R. M.

    2012-02-01

    Superconductivity has been one of the most fruitful areas of research in condensed matter physics, bringing together researchers with distinct interests in a collaborative effort to understand from its microscopic basis to its potential for unprecedented technological applications. The concepts, techniques, and methods developed along its centennial history have gone beyond the realm of condensed matter physics and influenced the development of other fascinating areas, such as particle physics and atomic physics. These notes, based on a set of lectures given at the 2011 Advanced Summer School of Cinvestav, aim to motivate the young undergraduate student in getting involved in the exciting world of conventional and unconventional superconductors.

  6. Monitor of SC beam profiles

    CERN Multimedia

    1977-01-01

    A high-resolution secondary emission grid for the measurement of SC beam profiles. Modern techniques of metal-ceramic bonding, developed for micro-electronics, have been used in its construction. (See Annual Report 1977 p. 105 Fig. 12.)

  7. First coil for the SC

    CERN Multimedia

    CERN PhotoLab

    1955-01-01

    The coils for the SC magnet were stored in the large hangar of the Cointrin Airport (to make sure that they would be available before snow and ice would block the roads and canals from Belgium, where they were built).

  8. Comparing superconducting and permanent magnets for magnetic refrigeration

    Directory of Open Access Journals (Sweden)

    R. Bjørk

    2016-05-01

    Full Text Available We compare the cost of a high temperature superconducting (SC tape-based solenoid with a permanent magnet (PM Halbach cylinder for magnetic refrigeration. Assuming a five liter active magnetic regenerator volume, the price of each type of magnet is determined as a function of aspect ratio of the regenerator and desired internal magnetic field. It is shown that to produce a 1 T internal field in the regenerator a permanent magnet of hundreds of kilograms is needed or an area of superconducting tape of tens of square meters. The cost of cooling the SC solenoid is shown to be a small fraction of the cost of the SC tape. Assuming a cost of the SC tape of 6000 $/m2 and a price of the permanent magnet of 100 $/kg, the superconducting solenoid is shown to be a factor of 0.3-3 times more expensive than the permanent magnet, for a desired field from 0.5-1.75 T and the geometrical aspect ratio of the regenerator. This factor decreases for increasing field strength, indicating that the superconducting solenoid could be suitable for high field, large cooling power applications.

  9. High field superconducting magnet: Science, Technology and Applications%高场超导磁体科学技术与应用

    Institute of Scientific and Technical Information of China (English)

    王秋良

    2013-01-01

    科学技术的发展对于磁场强度质量的要求越来越高,极端强磁场条件是人类追求的永远的科学目标,它孕育着许多重大的科学发现和新技术的产生,对人类的科学和技术以及生活产生重大的影响.以磁体为核心与电力电子器件以及相关的软件等结合可以构成各种各样科学仪器和装置,广泛应用在科学研究和工业特种装备中.磁技术对于人类的科学与技术进步起到越来越重要的作用,尤其是极高磁场所带来的诸多优点,使得人类对于物质世界认识不断加深,对于生命的起源以及从事疾病的防治的研究有特别重要的意义.本文介绍磁体基本原理、磁场产生的方法与应用以及相关的发展.%Development of superconducting magnet science and technology requires a magnetic field with high strength and good quality.The pursuit of extremely high magnetic field is an eternal scientific goal forscientists and engineers.It is an exciting cutting-edge technology with full of challenges and has been essential for many significant discoveries in science and technology.Combined with power-electronic devices and related software,a whole magnet system can be built up as the key component of various types of scientific instruments and other equipment,and can be fund widespread applications in scientific research and industry.Magnet technology is currently playing a more and more important role in scientific and technological progress.Ultra-high magnetic fields help to give us much deeper understanding of the world of matter and have special significance for research into the origins of life and disease prevention.In this review article,basic magnet principles,methods of generating magnetic fields,magnetic field applications,and numerical methods for the design of magnet structures are briefly introduced and reviewed.

  10. The road to superconducting spintronics

    Science.gov (United States)

    Eschrig, Matthias

    Energy efficient computing has become a major challenge, with the increasing importance of large data centres across the world, which already today have a power consumption comparable to that of Spain, with steeply increasing trend. Superconducting computing is progressively becoming an alternative for large-scale applications, with the costs for cooling being largely outweighed by the gain in energy efficiency. The combination of superconductivity and spintronics - ``superspintronics'' - has the potential and flexibility to develop into such a green technology. This young field is based on the observation that new phenomena emerge at interfaces between superconducting and other, competing, phases. The past 15 years have seen a series of pivotal predictions and experimental discoveries relating to the interplay between superconductivity and ferromagnetism. The building blocks of superspintronics are equal-spin Cooper pairs, which are generated at the interface between superconducting and a ferromagnetic materials in the presence of non-collinear magnetism. Such novel, spin-polarised Cooper pairs carry spin-supercurrents in ferromagnets and thus contribute to spin-transport and spin-control. Geometric Berry phases appear during the singlet-triplet conversion process in structures with non-coplanar magnetisation, enhancing functionality of devices, and non-locality introduced by superconducting order leads to long-range effects. With the successful generation and control of equal-spin Cooper pairs the hitherto notorious incompatibility of superconductivity and ferromagnetism has been not only overcome, but turned synergistic. I will discuss these developments and their extraordinary potential. I also will present open questions posed by recent experiments and point out implications for theory. This work is supported by the Engineering and Physical Science Research Council (EPSRC Grant No. EP/J010618/1).

  11. Foreword: Focus on Superconductivity in Semiconductors

    Directory of Open Access Journals (Sweden)

    Yoshihiko Takano

    2008-01-01

    Full Text Available Since the discovery of superconductivity in diamond, much attention has been given to the issue of superconductivity in semiconductors. Because diamond has a large band gap of 5.5 eV, it is called a wide-gap semiconductor. Upon heavy boron doping over 3×1020 cm−3, diamond becomes metallic and demonstrates superconductivity at temperatures below 11.4 K. This discovery implies that a semiconductor can become a superconductor upon carrier doping. Recently, superconductivity was also discovered in boron-doped silicon and SiC semiconductors. The number of superconducting semiconductors has increased. In 2008 an Fe-based superconductor was discovered in a research project on carrier doping in a LaCuSeO wide-gap semiconductor. This discovery enhanced research activities in the field of superconductivity, where many scientists place particular importance on superconductivity in semiconductors.This focus issue features a variety of topics on superconductivity in semiconductors selected from the 2nd International Workshop on Superconductivity in Diamond and Related Materials (IWSDRM2008, which was held at the National Institute for Materials Science (NIMS, Tsukuba, Japan in July 2008. The 1st workshop was held in 2005 and was published as a special issue in Science and Technology of Advanced Materials (STAM in 2006 (Takano 2006 Sci. Technol. Adv. Mater. 7 S1.The selection of papers describe many important experimental and theoretical studies on superconductivity in semiconductors. Topics on boron-doped diamond include isotope effects (Ekimov et al and the detailed structure of boron sites, and the relation between superconductivity and disorder induced by boron doping. Regarding other semiconductors, the superconducting properties of silicon and SiC (Kriener et al, Muranaka et al and Yanase et al are discussed, and In2O3 (Makise et al is presented as a new superconducting semiconductor. Iron-based superconductors are presented as a new series of high

  12. Itinerant Ferromagnetism and Superconductivity

    OpenAIRE

    Karchev, Naoum

    2004-01-01

    Superconductivity has again become a challenge following the discovery of unconventional superconductivity. Resistance-free currents have been observed in heavy-fermion materials, organic conductors and copper oxides. The discovery of superconductivity in a single crystal of $UGe_2$, $ZrZn_2$ and $URhGe$ revived the interest in the coexistence of superconductivity and ferromagnetism. The experiments indicate that: i)The superconductivity is confined to the ferromagnetic phase. ii)The ferromag...

  13. 100 years of superconductivity

    CERN Document Server

    Rogalla, Horst

    2011-01-01

    Even a hundred years after its discovery, superconductivity continues to bring us new surprises, from superconducting magnets used in MRI to quantum detectors in electronics. 100 Years of Superconductivity presents a comprehensive collection of topics on nearly all the subdisciplines of superconductivity. Tracing the historical developments in superconductivity, the book includes contributions from many pioneers who are responsible for important steps forward in the field.The text first discusses interesting stories of the discovery and gradual progress of theory and experimentation. Emphasizi

  14. Two types of superconducting domes in unconventional superconductors

    Science.gov (United States)

    Das, Tanmoy; Panagopoulos, Christos

    2016-10-01

    Uncovering the origin of unconventional superconductivity is often plagued by the overwhelming material diversity with varying normal and superconducting (SC) properties. In this article, we deliver a comprehensive study of the SC properties and phase diagrams using multiple tunings (such as disorder, pressure or magnetic field in addition to doping and vice versa) across several families of unconventional superconductors, including the copper-oxides, heavy-fermions, organics and the recently discovered iron-pnictides, iron-chalcogenides, and oxybismuthides. We discover that all these families often possess two types of SC domes, with lower and higher SC transition temperatures T c, both unconventional but with distinct SC and normal states properties. The lower T c dome arises with or without a quantum critical point (QCP), and not always associated with a non-Fermi liquid (NFL) background. On the contrary, the higher-T c dome clearly stems from a NFL or strange metal phase, without an apparent intervening phase transition or a QCP. The two domes appear either fully separated in the phase diagram, or merged into one, or arise independently owing to their respective normal state characteristics. Our findings suggest that a QCP-related mechanism is an unlikely scenario for the NFL phase in these materials, and thereby narrows the possibility towards short-range fluctuations of various degrees of freedom in the momentum and frequency space. We also find that NFL physics may be a generic route to higher-T c superconductivity.

  15. Superconducting accelerating structures for very low velocity ion beams

    Energy Technology Data Exchange (ETDEWEB)

    Xu, J.; Shepard, K.W.; Ostroumov, P.N.; Fuerst, J.D.; Waldschmidt, G.; /Argonne; Gonin, I.V.; /Fermilab

    2008-01-01

    This paper presents designs for four types of very-low-velocity superconducting accelerating cavity capable of providing several MV of accelerating potential per cavity, and suitable for particle velocities in the range 0.006 < v/c < 0.06. Superconducting TEM-class cavities have been widely applied to CW acceleration of ion beams. SC linacs can be formed as an array of independently-phased cavities, enabling a variable velocity profile to maximize the output energy for each of a number of different ion species. Several laboratories in the US and Europe are planning exotic beam facilities based on SC linacs. The cavity designs presented here are intended for the front-end of such linacs, particularly for the post-acceleration of rare isotopes of low charge state. Several types of SC cavities have been developed recently to cover particle velocities above 0.06c. Superconducting four-gap quarter-wave resonators for velocities 0.008 < {beta} = v/c < 0.05 were developed about two decades ago and have been successfully operated at the ATLAS SC linac at Argonne National Laboratory. Since that time, progress in simulation tools, cavity fabrication and processing have increased SC cavity gradients by a factor of 3-4. This paper applies these tools to optimize the design of a four-gap quarter-wave resonator for exotic beam facilities and other low-velocity applications.

  16. High field superconducting magnets

    Science.gov (United States)

    Hait, Thomas P. (Inventor); Shirron, Peter J. (Inventor)

    2011-01-01

    A superconducting magnet includes an insulating layer disposed about the surface of a mandrel; a superconducting wire wound in adjacent turns about the mandrel to form the superconducting magnet, wherein the superconducting wire is in thermal communication with the mandrel, and the superconducting magnet has a field-to-current ratio equal to or greater than 1.1 Tesla per Ampere; a thermally conductive potting material configured to fill interstices between the adjacent turns, wherein the thermally conductive potting material and the superconducting wire provide a path for dissipation of heat; and a voltage limiting device disposed across each end of the superconducting wire, wherein the voltage limiting device is configured to prevent a voltage excursion across the superconducting wire during quench of the superconducting magnet.

  17. 6th July 2010 - United Kingdom Science and Technology Facilities Council W. Whitehorn signing the guest book with Head of International relations F. Pauss, visiting the Computing Centre with Information Technology Department Head Deputy D. Foster, the LHC superconducting magnet test hall with Technology Department P. Strubin,the Centre Control Centre with Operation Group Leader M. Lamont and the CLIC/CTF3 facility with Project Leader J.-P. Delahaye.

    CERN Multimedia

    Teams : M. Brice, JC Gadmer

    2010-01-01

    6th July 2010 - United Kingdom Science and Technology Facilities Council W. Whitehorn signing the guest book with Head of International relations F. Pauss, visiting the Computing Centre with Information Technology Department Head Deputy D. Foster, the LHC superconducting magnet test hall with Technology Department P. Strubin,the Centre Control Centre with Operation Group Leader M. Lamont and the CLIC/CTF3 facility with Project Leader J.-P. Delahaye.

  18. Theory of superconductivity

    CERN Document Server

    Crisan, Mircea

    1989-01-01

    This book discusses the most important aspects of the theory. The phenomenological model is followed by the microscopic theory of superconductivity, in which modern formalism of the many-body theory is used to treat most important problems such as superconducting alloys, coexistence of superconductivity with the magnetic order, and superconductivity in quasi-one-dimensional systems. It concludes with a discussion on models for exotic and high temperature superconductivity. Its main aim is to review, as complete as possible, the theory of superconductivity from classical models and methods up t

  19. The metallofullerene field-induced single-ion magnet HoSc2 N@C80.

    Science.gov (United States)

    Dreiser, Jan; Westerström, Rasmus; Zhang, Yang; Popov, Alexey A; Dunsch, Lothar; Krämer, Karl; Liu, Shi-Xia; Decurtins, Silvio; Greber, Thomas

    2014-10-13

    The low-temperature magnetic properties of the endohedral metallofullerene HoSc2 N@C80 have been studied by superconducting quantum interference device (SQUID) magnetometry. Alternating current (ac) susceptibility measurements reveal that this molecule exhibits slow relaxation of magnetization in a small applied field with timescales in the order of milliseconds. The equilibrium magnetic properties of HoSc2 N@C80 indicate strong magnetic anisotropy. The large differences in magnetization relaxation times between the present compound and the previously investigated DySc2 N@C80 are discussed. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Downsized superconducting magnetic energy storage systems

    Science.gov (United States)

    Palmer, David N.

    Scaled-down superconductive magnetic energy storage systems (DSMES) and superconductive magnetic energy power sources (SMEPS) are proposed for residential, commercial/retail, industrial off-peak and critical services, telephone and other communication systems, computer operations, power back-up/energy storages, power sources for space stations, and in-field military logistics/communication systems. Recent advances in high-Tc superconducting materials technology are analyzed. DSMES/SMEPS concepts are presented, and design, materials, and systems requirements are discussed. Problems ar identified, and possible solutions are offered. Comparisons are made with mechanical and primary and secondary energy storage and conversion systems.

  1. A superconducting magnetic gear

    Science.gov (United States)

    Campbell, A. M.

    2016-05-01

    A comparison is made between a magnetic gear using permanent magnets and superconductors. The objective is to see if there are any fundamental reasons why superconducting magnets should not provide higher power densities than permanent magnets. The gear is based on the variable permeability design of Attilah and Howe (2001 IEEE Trans. Magn. 37 2844-46) in which a ring of permanent magnets surrounding a ring of permeable pole pieces with a different spacing gives an internal field component at the beat frequency. Superconductors can provide much larger fields and forces but will saturate the pole pieces. However the gear mechanism still operates, but in a different way. The magnetisation of the pole pieces is now constant but rotates with angle at the beat frequency. The result is a cylindrical Halbach array which produces an internal field with the same symmetry as in the linear regime, but has an analytic solution. In this paper a typical gear system is analysed with finite elements using FlexPDE. It is shown that the gear can work well into the saturation regime and that the Halbach array gives a good approximation to the results. Replacing the permanent magnets with superconducting tapes can give large increases in torque density, and for something like a wind turbine a combined gear and generator is possible. However there are major practical problems. Perhaps the most fundamental is the large high frequency field which is inevitably present and which will cause AC losses. Also large magnetic fields are required, with all the practical problems of high field superconducting magnets in rotating machines. Nevertheless there are ways of mitigating these difficulties and it seems worthwhile to explore the possibilities of this technology further.

  2. Color-Neutral Superconducting Quark Matter

    CERN Document Server

    Steiner, A W; Prakash, M; Steiner, Andrew W.; Reddy, Sanjay; Prakash, Madappa

    2002-01-01

    We investigate the consequences of enforcing local color neutrality on the color superconducting phases of quark matter by utilizing the Nambu-Jona-Lasinio model supplemented by diquark and the t'Hooft six-fermion interactions. In neutrino free matter at zero temperature, color neutrality guarantees that the number densities of $u, d, {\\rm and} s$ quarks in the Color-Flavor-Locked (CFL) phase will be equal even with physical current quark masses. Electric charge neutrality follows as a consequence and without the presence of electrons. In contrast, electric charge neutrality in the less symmetric 2-flavor superconducting (2SC) phase with $ud$ pairing requires more electrons than the normal quark phase. The free energy density cost of enforcing color and electric charge neutrality in the CFL phase is lower than that in the 2SC phase, which favors the formation of the CFL phase. With increasing temperature and neutrino content, an unlocking transition occurs from the CFL phase to the 2SC phase with the order of...

  3. ZGS roots of superconductivity: People and devices

    Energy Technology Data Exchange (ETDEWEB)

    Pewitt, E.G.

    1994-12-31

    The ZGS community made basic contributions to the applications of superconducting magnets to high energy physics as well as to other technological areas. ZGS personnel pioneered many significant applications until the time the ZGS was shutdown in 1979. After the shutdown, former ZGS personnel developed magnets for new applications in high energy physics, fusion, and industrial uses. The list of superconducting magnet accomplishments of ZGS personnel is impressive.

  4. Rotary condenser for SC2

    CERN Multimedia

    1975-01-01

    During 1975 the SC2 performance was improved among other things by redesigning some of the elements of the ROTCO (Annual Report 1975, p. 55). The photo shows an interior wiew of the housing of the rotary condenser and of the sixteen sets of shaped stator blades.

  5. Overview on superconducting photoinjectors

    CERN Document Server

    Arnold, A

    2011-01-01

    The success of most of the proposed energy recovery linac (ERL) based electron accelerator projects for future storage ring replacements (SRR) and high power IR–free-electron lasers (FELs) largely depends on the development of an appropriate source. For example, to meet the FEL specifications [J.W. Lewellen, Proc. SPIE Int. Soc. Opt. Eng. 5534, 22 (2004)] electron beams with an unprecedented combination of high brightness, low emittance (0.1 µmrad), and high average current (hundreds of mA) are required. An elegant way to create a beam of such quality is to combine the high beam quality of a normal conducting rf photoinjector with the superconducting technology, i.e., to build a superconducting rf photoinjector (SRF gun). SRF gun R&D programs based on different approaches have been launched at a growing number of institutes and companies (AES, Beijing University, BESSY, BNL, DESY, FZD, TJNAF, Niowave, NPS, Wisconsin University). Substantial progress was achieved in recent years and the first long term ...

  6. Overview of Superconducting Photoinjectors

    CERN Document Server

    Arnold, A

    2009-01-01

    The success of most of the proposed ERL based electron accelerator projects for future storage ring replacements (SRR) and high power IR-FELs is contingent upon the development of an appropriate source. Electron beams with an unprecedented combination of high brightness, low emittance (0.1 µm rad) and high average current (hundreds of mA) are required to meet the FEL specification [1]. An elegant way to create such an unique beam is to combine the high beam quality of a normal conducting RF photo injector with the superconducting technology to get a superconducting RF photo injector (SRF gun). SRF gun R&D programs based on different approaches are under investigation at a growing number of institutes and companies (AES, Beijing University, BESSY, BNL, DESY, FZD, JLab, Niowave, NPS, Wisconsin University). Lot of progress could be achieved during the last years and first long term operation was demonstrated at the FZD [2]. In the near future, this effort will lead to SRF guns, which are indispensab...

  7. Simple Superconducting "Permanent" Electromagnet

    Science.gov (United States)

    Israelson, Ulf E.; Strayer, Donald M.

    1992-01-01

    Proposed short tube of high-temperature-superconducting material like YBa2Cu3O7 acts as strong electromagnet that flows as long as magnetic field remains below critical value and temperature of cylinder maintained sufficiently below superconducting-transition temperature. Design exploits maximally anisotropy of high-temperature-superconducting material.

  8. Basic principle of superconductivity

    OpenAIRE

    De Cao, Tian

    2007-01-01

    The basic principle of superconductivity is suggested in this paper. There have been two vital wrong suggestions on the basic principle, one is the relation between superconductivity and the Bose-Einstein condensation (BEC), and another is the relation between superconductivity and pseudogap.

  9. Characterization of superconducting multilayers samples

    CERN Document Server

    Antoine, C Z; Berry, S; Bouat, S; Jacquot, J F; Villegier, J C; Lamura, G; Gurevich, A

    2009-01-01

    Best RF bulk niobium accelerating cavities have nearly reached their ultimate limits at rf equatorial magnetic field H  200 mT close to the thermodynamic critical field Hc. In 2006 Gurevich proposed to use nanoscale layers of superconducting materials with high values of Hc > HcNb for magnetic shielding of bulk niobium to increase the breakdown magnetic field inside SC RF cavities [1]. Depositing good quality layers inside a whole cavity is rather difficult but we have sputtered high quality samples by applying the technique used for the preparation of superconducting electronics circuits and characterized these samples by X-ray reflectivity, dc resistivity (PPMS) and dc magnetization (SQUID). Dc magnetization curves of a 250 nm thick Nb film have been measured, with and without a magnetron sputtered coating of a single or multiple stack of 15 nm MgO and 25 nm NbN layers. The Nb samples with/without the coating clearly exhibit different behaviors. Because SQUID measurements are influenced by edge an...

  10. ETV TEST REPORT OF MOBILE SOURCE EMISSIONS CONTROL DEVICES: LUBRIZOL ENGINE CONTROL SYSTEMS PURIFILTER SC17L

    Science.gov (United States)

    The Environmental Technology Verification report discusses the technology and performance of the Lubrizol Engine Control Systems Purifilter SC17L manufactured by Lubrizol Engine Control Systems. The technology is a precious and base metal, passively regenerated particulate filter...

  11. Enhanced superconductivity of fullerenes

    Energy Technology Data Exchange (ETDEWEB)

    Washington, II, Aaron L.; Teprovich, Joseph A.; Zidan, Ragaiy

    2017-06-20

    Methods for enhancing characteristics of superconductive fullerenes and devices incorporating the fullerenes are disclosed. Enhancements can include increase in the critical transition temperature at a constant magnetic field; the existence of a superconducting hysteresis over a changing magnetic field; a decrease in the stabilizing magnetic field required for the onset of superconductivity; and/or an increase in the stability of superconductivity over a large magnetic field. The enhancements can be brought about by transmitting electromagnetic radiation to the superconductive fullerene such that the electromagnetic radiation impinges on the fullerene with an energy that is greater than the band gap of the fullerene.

  12. Superconducting microfabricated ion traps

    CERN Document Server

    Wang, Shannon X; Labaziewicz, Jaroslaw; Dauler, Eric; Berggren, Karl; Chuang, Isaac L

    2010-01-01

    We fabricate superconducting ion traps with niobium and niobium nitride and trap single 88Sr ions at cryogenic temperatures. The superconducting transition is verified and characterized by measuring the resistance and critical current using a 4-wire measurement on the trap structure, and observing change in the rf reflection. The lowest observed heating rate is 2.1(3) quanta/sec at 800 kHz at 6 K and shows no significant change across the superconducting transition, suggesting that anomalous heating is primarily caused by noise sources on the surface. This demonstration of superconducting ion traps opens up possibilities for integrating trapped ions and molecular ions with superconducting devices.

  13. Superconducting material development

    Science.gov (United States)

    1987-09-01

    A superconducting compound was developed that showed a transition to a zero-resistance state at 65 C, or 338 K. The superconducting material, which is an oxide based on strontium, barium, yttrium, and copper, continued in the zero-resistance state similar to superconductivity for 10 days at room temperature in the air. It was also noted that measurements of the material allowed it to observe a nonlinear characteristic curve between current and voltage at 65 C, which is another indication of superconductivity. The research results of the laboratory experiment with the superconducting material will be published in the August edition of the Japanese Journal of Applied Physics.

  14. Protective link for superconducting coil

    Science.gov (United States)

    Umans, Stephen D.

    2009-12-08

    A superconducting coil system includes a superconducting coil and a protective link of superconducting material coupled to the superconducting coil. A rotating machine includes first and second coils and a protective link of superconducting material. The second coil is operable to rotate with respect to the first coil. One of the first and second coils is a superconducting coil. The protective link is coupled to the superconducting coil.

  15. Study of the relation between evaluation of strain distribution on superconducting coil and mechanical heat generation

    Science.gov (United States)

    Seino, Hiroshi; Kurihara, Minoru; Herai, Toshiki; Suzuki, Eiji

    2002-10-01

    In the superconducting Maglev system, on-board superconducting magnets (SCMs) are vibrated at various frequencies according to the train speed by the electromagnetic disturbance which is caused when the train passes over ground coils. Then a mechanical loss is generated inside the inner vessel in the SCM. This phenomenon increases the heat load on the cryogenic equipment in the SCM. It has been surmised that the mechanical heat inside the inner vessel is generated by the frictional heat caused by the relative microscopic slips between fasteners and superconducting coil (SC coil). Nevertheless, heat generation mechanisms inside the inner vessel have not been studied sufficiently. In this study, we suggest a hypothesis that the frictional heat generated by the relative microscopic slips between fasteners and a SC coil will be indicated if the calculated strain distribution on the SC coil is evaluated. The results of this study supported this hypothesis.

  16. 2010 ARRA Lidar: Hampton County (SC)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Provide high density LiDAR elevation data map of Hampton County, SC. Provide Bare Earth DEM (vegetation removal) of Hampton County, SC.

  17. Magnetic moment of {sup 48}Sc

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Kawamura, Y.; Ohya, S. [Niigata University, Department of Physics (Japan); Izumikawa, T. [Niigata University, Radioisotope Center (Japan); Nishimura, K. [Toyama University, Faculty of Engineering (Japan); Muto, S. [Neutron Science Laboratory, KEK (Japan); Shinozuka, T. [Tohoku University, Cyclotron and Radioisotope Center (Japan)

    2007-11-15

    Nuclear magnetic resonances were measured for {sup 48}Sc and {sup 44m}Sc oriented at 8 mK in an Fe host metal. The magnetic hyperfine splitting frequencies at an external magnetic field of 0.2 T were determined to be 63.22(11) MHz and 64.81(1) MHz for {sup 48}Sc and {sup 44m}Sc, respectively. With the known magnetic moment of {mu}({sup 44m}Sc)=+3.88 (1) {mu}{sub N}, the magnetic moment of {sup 48}Sc is deduced as {mu}({sup 44}Sc)=+3.785(12) {mu}{sub N}. The measured magnetic moment of {sup 48}Sc is discussed in terms of the shell model using the effective interactions.

  18. Superconductivity in transition metals.

    Science.gov (United States)

    Slocombe, Daniel R; Kuznetsov, Vladimir L; Grochala, Wojciech; Williams, Robert J P; Edwards, Peter P

    2015-03-13

    A qualitative account of the occurrence and magnitude of superconductivity in the transition metals is presented, with a primary emphasis on elements of the first row. Correlations of the important parameters of the Bardeen-Cooper-Schrieffer theory of superconductivity are highlighted with respect to the number of d-shell electrons per atom of the transition elements. The relation between the systematics of superconductivity in the transition metals and the periodic table high-lights the importance of short-range or chemical bonding on the remarkable natural phenomenon of superconductivity in the chemical elements. A relationship between superconductivity and lattice instability appears naturally as a balance and competition between localized covalent bonding and so-called broken covalency, which favours d-electron delocalization and superconductivity. In this manner, the systematics of superconductivity and various other physical properties of the transition elements are related and unified.

  19. A self-consistent determination of the RVB and SC gaps in the YRZ ansatz

    Science.gov (United States)

    Rao, Zi-Ye; Wang, Xiao-Min; Jiang, Hong-Min

    2017-03-01

    A correct understanding of the origin of the pseudogap in high temperature (high-T c) cuprate superconductors is considered to be a peripheral breakthrough in the understanding of the microscopic mechanism of the high-T c superconductivity. Yang-Rice-Zhang (YRZ) ansatz is an important phenomenological theory to describe the phenomenon of pseudogap. However, in the framework of YRZ, the pseudogap (resonant valence bond (RVB) gap) and the superconducting (SC) gap are unable to have a self-consistent determination at different doping concentrations, and this severely limits the application of the YRZ ansatz. Based on the YRZ ansatz, this study develops a technical method to determine the RVB and SC gaps in a self-consistent manner. It is revealed that the self-consistent calculations of the doping dependence of RVB, SC gaps and spectral function are not only consistent with the empirical gap formula in the YRZ framework, but also consistent with the doping evolution of the Fermi surface observed in the angle-resolved photoemission spectroscopy (ARPES) experiments. Our method will greatly extend the applications of the YRZ ansatz, and will deepen our understanding of the origin of pseudogap as well as the mechanism of high-T c superconductivity.

  20. Xemilofiban: SC 54684A, xemlofiban.

    Science.gov (United States)

    2003-01-01

    Xemilofiban [SC 54684, SC 54684A (HCl), xemlofiban], a glycoprotein IIb/IIIa antagonist, is an orally available prodrug of a non-peptide mimetic of the tetrapeptide RGDF. It is converted to the active metabolite, SC 54701 (the free base form of SC 54701A). Development was initiated by Searle (Monsanto). Searle became part of Pharmacia Corporation, which was acquired by, and merged into, Pfizer in April 2003. Searle had co-development and co-marketing agreements with Sankyo in Japan; these have been discontinued. In January 2003, Pharmacia donated the intellectual property for xemilofiban to Western Michigan University. In February 2003, Western Michigan University granted an exclusive worldwide licence of xemilofiban to VDDI Pharmaceuticals (formerly Virtual Drug Development Inc.). Xemilofiban was in a phase III clinical trial, the Evaluation of Xemilofiban in Controlling Thrombotic Events (EXCITE) trial, with Searle (Monsanto) in the US and Europe for the treatment of thrombosis in patients with unstable angina pectoris and acute myocardial infarction undergoing angioplasty. However, as xemilofiban demonstrated no significant clinical benefit, Searle discontinued its development. In Japan, Sankyo discontinued the development of xemilofiban for thrombosis at phase II following Searle's decision to drop the project. VDDI Pharmaceuticals plans to develop xemilofiban in cardiovascular disorders following on from the phase III studies completed by Pharmacia; a restructured dosing schedule and narrowed patient selection will be used. VDDI has research facilities worldwide and will utilise facilities in Ireland for the European clinical development programme; research facilities in the Southwest Michigan Innovation Center are planned while the head office of VDDI is based in Tennessee. Xemilofiban is in phase III development for the treatment of cardiovascular disease in conjunction with percutaneous coronary intervention.

  1. Technology of superconducting accelerator dipoles

    Energy Technology Data Exchange (ETDEWEB)

    Hassenzahl, W.V.; Meuser, R.B.; Taylor, C.

    1983-06-01

    We discuss accelerator dipoles and their characteristics. Other types of magnets, in particular bubble chamber magnets have been quite successful. Their performance is based on cryogenic stability which is addressed only briefly in this chapter. This type of stability is not available to the accelerator designer because of the large quantities of copper or other stabilizer that would reduce the current density in the windings to an unacceptably low value.

  2. Superconducting Radiofrequency (SRF) Acceleration Technology

    Data.gov (United States)

    Federal Laboratory Consortium — SRF cavities enable accelerators to increase particle beam energy levels while minimizing the use of electrical power by all but eliminating electrical resistance....

  3. Competition between superconductivity and charge density waves

    Science.gov (United States)

    Kim, Ki-Seok

    2007-02-01

    We derive an effective field theory for the competition between superconductivity (SC) and charge density waves (CDWs) by employing the SO(3) pseudospin representation of the SC and CDW order parameters. One important feature in the effective nonlinear σ model is the emergence of a Berry phase even at half filling, originating from the competition between SC and CDWs, i.e., the pseudospin symmetry. A-well known conflict between the previous studies of Oshikawa [Phys. Rev. Lett. 84, 1535 (2000)] and Lee and Shankar [Phys. Rev. Lett. 65, 1490 (1990)] is resolved by the appearance of the Berry phase. The Berry phase contribution allows a deconfined quantum critical point of fractionalized charge excitations with e instead of 2e in the SC-CDW quantum transition at half filling. Furthermore, we investigate the stability of the deconfined quantum criticality against quenched randomness by performing a renormalization group analysis of an effective vortex action. We argue that, although randomness results in a weak disorder fixed point differing from the original deconfined quantum critical point, deconfinement of the fractionalized charge excitations still survives at the disorder fixed point owing to a nonzero fixed point value of the vortex charge.

  4. A superconducting large-angle magnetic suspension

    Science.gov (United States)

    Downer, James R.; Anastas, George V., Jr.; Bushko, Dariusz A.; Flynn, Frederick J.; Goldie, James H.; Gondhalekar, Vijay; Hawkey, Timothy J.; Hockney, Richard L.; Torti, Richard P.

    1992-01-01

    SatCon Technology Corporation has completed a Small Business Innovation Research (SBIR) Phase 2 program to develop a Superconducting Large-Angle Magnetic Suspension (LAMS) for the NASA Langley Research Center. The Superconducting LAMS was a hardware demonstration of the control technology required to develop an advanced momentum exchange effector. The Phase 2 research was directed toward the demonstration for the key technology required for the advanced concept CMG, the controller. The Phase 2 hardware consists of a superconducting solenoid ('source coils') suspended within an array of nonsuperconducting coils ('control coils'), a five-degree-of-freedom positioning sensing system, switching power amplifiers, and a digital control system. The results demonstrated the feasibility of suspending the source coil. Gimballing (pointing the axis of the source coil) was demonstrated over a limited range. With further development of the rotation sensing system, enhanced angular freedom should be possible.

  5. 2-D Electromagnetic Model of Fast-Ramping Superconducting Magnets

    CERN Document Server

    Auchmann, B; Kurz, S; Russenschuck, Stephan

    2006-01-01

    Fast-ramping superconducting (SC) accelerator magnets are the subject of R&D efforts by magnet designers at various laboratories. They require modifications of magnet design tools such as the ROXIE program at CERN, i.e. models of dynamic effects in superconductors need to be implemented and validated. In this paper we present the efforts towards a dynamic 2-D simulation of fast-ramping SC magnets with the ROXIE tool. Models are introduced and simulation results are compared to measurements of the GSI001 magnet of a GSI test magnet constructed and measured at BNL.

  6. Magnetic instabilities along the superconducting phase boundary of Nb /Ni multilayers

    Science.gov (United States)

    Joshi, Amish G.; Kryukov, Sergiy A.; De Long, Lance E.; Gonzalez, Elvira M.; Navarro, Elena; Villegas, Javier E.; Vicent, Jose L.

    2007-05-01

    We report vibrating reed and superconducting quantum interference device magnetometer data that exhibit prominent dips or oscillations of the superconducting (SC) onset temperature, ΔTC(H )≈0.01-0.7K, for a [Nb(23nm)/Ni(5nm)]5 multilayer (ML) in dc magnetic fields applied nearly parallel to the ML plane. The vibrating reed data exhibit reproducible structures below TC that may reflect multiple SC transitions, but they are sensitive to ac field amplitude and dc field orientation. This striking behavior poses challenges for theoretical and experimental investigations of interfaces between SC and ferromagnetic layers that involve magnetic pair breaking effects, "pi phase shifts" of the SC order parameter, and exotic ("LOFF") pairing states. Alternatively, the anomalies may mark dynamical instabilities within a confined, strongly anisotropic Abrikosov vortex lattice.

  7. Cooling Technology of Rotor of High Temperature Superconducting Electrical Machines%高温超导电机转子冷却技术的研究

    Institute of Scientific and Technical Information of China (English)

    陈彪; 顾国彪

    2011-01-01

    Cooling technology of rotor is a key technology for high temperature superconducting electrical machines.Based on the theory of rotating piping flow and pool boiling,the heat transfer principles of cooling methods are proposed,which are including integrated rotating thermosyphon,distributed rotating thermosyphon,immersion cooling,layered open evaporative cooling,and rotating piping evaporative cooling,respectively.The temperature distributions of cooling methods of rotor section are simulated by ANSYS steady state model.An experimentally integrated test platform adaptable to five cooling methods is designed and built up.Experiments on characteristics of heat transfer and flow are investigated.The performances of five cooling methods were contrasted,and the results are that immersion cooling makes the best performance and the others are different with it.Moreover,the experimental results are compared with the simulated ones.It is verified that the simulations could match the experiments well.%本文针对高温超导电机关键技术之一的转子冷却技术,从旋转管道流动和池沸腾的基本理论出发,对现有的集中式旋转热管、浸泡式冷却方式和三种新型的冷却方式即:分布式旋转热管、分层开放式蒸发冷却和旋转管道蒸发冷却,总结并建立了分别适用于这些转子冷却方式的沸腾换热模型;另外对于旋转管道蒸发冷却的流体动力学问题,参照静止两相流流动阻力的计算模型来分析这种冷却方式的流动阻力。在模型计算、载荷和漏热等边界条件基础上,采用ANSYS温度场静态计算模块对各种冷却方式进行了仿真,得到各种工况的温度分布。建立了一台能实现五种高温超导电机冷却方式的综合性实验平台,对五种冷却方式进行了详细的换热和流动的实验研究,从温升和分布均匀度而言,浸泡式冷却的效果最好,其他几种方式次之。同时对比实验数据与仿真结果,

  8. Materials Characterization of High-Temperature Epoxy Resins: SC-79 and SC-15/SC-79 Blend

    Science.gov (United States)

    2011-03-01

    Army composite applications. SC-15 is a toughened commercial vacuum-assisted resin transfer molding ( VARTM ) resin produced by Applied Poleramic Inc...very well in VARTM processes and has good damage resistance in structural and ballistic applications. However, the relatively low glass transition...low-viscosity, two-phase toughened, cycloaliphatic amine–cured commercial VARTM resin system designed to be easy to handle and have a long processing

  9. Evidence for Triplet Superconductivity in a Superconductor-Ferromagnet Spin Valve

    Science.gov (United States)

    Leksin, P. V.; Garif'yanov, N. N.; Garifullin, I. A.; Fominov, Ya. V.; Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O. G.; Büchner, B.

    2012-08-01

    We have studied the dependence of the superconducting (SC) transition temperature on the mutual orientation of magnetizations of Fe1 and Fe2 layers in the spin valve system CoOx/Fe1/Cu/Fe2/Pb. We find that this dependence is nonmonotonic when passing from the parallel to the antiparallel case and reveals a distinct minimum near the orthogonal configuration. The analysis of the data in the framework of the SC triplet spin valve theory gives direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the two magnetizations.

  10. Control Effect of Tebuconazole 430 g/L SC on Wheat Scab and Its Application Technology%430 g/L戊唑醇SC防治小麦赤霉病效果及应用技术

    Institute of Scientific and Technical Information of China (English)

    蒋尚军; 方辉; 王会福

    2015-01-01

    Field efficacy trials indicated that tebuconazole 430 g/L SC had good control effect on wheat scab, and it was safe to wheat. The control effect increased significantly with the increase of spraying dose. The control effects of tebuconazole 430 g/L SC 300 mL/hm2 were 94.43% and 87.89% on the 20th and 30th after the second spraying. There were 2.18 and 2.21 percentage points more than the control effects of carbendazim 50% WP 1 350 g/hm2. Tebuconazole 430 g/L SC had good popularizing prospect.%田间试验结果表明,430 g/L戊唑醇SC对小麦赤霉病有较好的防治效果,其药效随用药量加大而极显著上升。第2次用药后20,30 d,430 g/L戊唑醇SC 300 mL/hm2的防效分别达到94.43%和87.89%,比对照药剂50%多菌灵WP 1350 g/hm2的防效高2.18百分点、2.21百分点,且对小麦安全性好。430 g/L戊唑醇SC在生产上有较好的推广应用前景。

  11. Electrostatic separation of superconducting particles from non-superconducting particles and improvement in fuel atomization by electrorheology

    Science.gov (United States)

    Chhabria, Deepika

    This thesis has two major topics: (1) Electrostatic Separation of Superconducting Particles from a Mixture of Non-Superconducting Particles. (2) Improvement in fuel atomization by Electrorheology. (1) Based on the basic science research, the interactions between electric field and superconductors, we have developed a new technology, which can separate superconducting granular particles from their mixture with non-superconducting particles. The electric-field induced formation of superconducting balls is important aspect of the interaction between superconducting particles and electric field. When the applied electric field exceeds a critical value, the induced positive surface energy on the superconducting particles forces them to aggregate into balls or cling to the electrodes. In fabrication of superconducting materials, especially HTSC materials, it is common to come across materials with multiple phases: some grains are in superconducting state while the others are not. Our technology is proven to be very useful in separating superconducting grains from the rest non-superconducting materials. To separate superconducting particles from normal conducting particles, we apply a suitable strong electric field. The superconducting particles cling to the electrodes, while normal conducting particles bounce between the electrodes. The superconducting particles could then be collected from the electrodes. To separate superconducting particles from insulating ones, we apply a moderate electric field to force insulating particles to the electrodes to form short chains while the superconducting particles are collected from the middle of capacitor. The importance of this technology is evidenced by the unsuccessful efforts to utilize the Meissner effect to separate superconducting particles from nonsuperconducting ones. Because the Meissner effect is proportional to the particle volume, it has been found that the Meissner effect is not useful when the superconducting

  12. Superconducting DC homopolar motors for ship propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Heiberger, M.; Reed, M.R.; Creedon, W.P.; O' Hea, B.J. [General Atomic (United States)

    2000-07-01

    Superconducting DC homopolar motors have undergone recent advances in technology, warranting serious consideration of their use for ship propulsion. Homopolar motor propulsion is now practical because of two key technology developments: cryogen-free superconducting refrigeration and high performance motor fiber brushes. These compact motors are ideal for podded applications, where reduced drag and fuel consumption are predicted. In addition, the simple DC motor controller is more efficient and reliable compared with AC motor controllers. Military ships also benefit from increased stealth implicit in homopolar DC excitation, which also allows the option for direct hull or pod mounting. (authors)

  13. Characteristics of persistent-current mode of HTS coil on superconducting electromagnet

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C.Y., E-mail: cylee@krri.re.kr [Korea Railroad Research Institute, Woram Dong, Uiwang Si 437-757 (Korea, Republic of); Kim, J.; Han, Y.J.; Kang, B. [Korea Railroad Research Institute, Woram Dong, Uiwang Si 437-757 (Korea, Republic of); Chung, Y.D. [Department of Electrical Engineering, Suwon University, Bongdang Eup, Hwaseong Si 445-743 (Korea, Republic of); Yoon, Y.S. [Department of Electrical Engineering, Ansan College of Technology, Choji-Dong, Ansan Si 425-792 (Korea, Republic of); Chu, S.Y.; Hwang, Y.J.; Jo, H.C.; Jang, J.Y.; Ko, T.K. [Department of Electrical and Electronic Engineering, Yonsei University, Sinchon-dong, Seoul 120-749 (Korea, Republic of)

    2011-11-15

    The levitation gap of an electromagnetic suspension (EMS) system affects the current decay rate of superconducting electromagnet. The presence of iron core provides a significant benefit in the PCM performance of SC coil. The increased levitation gap of the EMS model with the SC-EM could negatively affect the design of SC-EM operated in PCM. This paper investigates the way in which the levitation gap of an electromagnetic suspension (EMS) system affects the current decay rate of superconducting electromagnet (SC-EM) operated in persistence-current mode (PCM). Using inductance analyzed from the magnetic circuit of an EMS model, the current decay rate caused by the variation in the levitation gap was simulated. In order to experimentally verify the simulation results, we fabricated a small-scale EMS model with SC coil operated in PCM and measured the current decay rates at different levitation gaps. The result showed that the presence of iron core provides a significant benefit in the PCM performance of SC coil, but the benefit decreased as the levitation gap increases. This study revealed that the increased levitation gap of the EMS model with the SC-EM could negatively affect the design of SC-EM operated in PCM.

  14. Overview on superconducting photoinjectors

    Directory of Open Access Journals (Sweden)

    A. Arnold

    2011-02-01

    Full Text Available The success of most of the proposed energy recovery linac (ERL based electron accelerator projects for future storage ring replacements (SRR and high power IR–free-electron lasers (FELs largely depends on the development of an appropriate source. For example, to meet the FEL specifications [J. W. Lewellen, Proc. SPIE Int. Soc. Opt. Eng. 5534, 22 (2004PSISDG0277-786X10.1117/12.557378] electron beams with an unprecedented combination of high brightness, low emittance (0.1  μmrad, and high average current (hundreds of mA are required. An elegant way to create a beam of such quality is to combine the high beam quality of a normal conducting rf photoinjector with the superconducting technology, i.e., to build a superconducting rf photoinjector (SRF gun. SRF gun R&D programs based on different approaches have been launched at a growing number of institutes and companies (AES, Beijing University, BESSY, BNL, DESY, FZD, TJNAF, Niowave, NPS, Wisconsin University. Substantial progress was achieved in recent years and the first long term operation was demonstrated at FZD [R. Xiang et al., in Proceedings of the 31st International Free Electron Laser Conference (FEL 09, Liverpool, UK (STFC Daresbury Laboratory, Warrington, 2009, p. 488]. In the near future SRF guns are expected to play an important role for linac-driven FEL facilities. In this paper we will review the concepts, the design parameters, and the status of the major SRF gun projects.

  15. Gradient limitations in room temperature and superconducting acceleration structures

    Energy Technology Data Exchange (ETDEWEB)

    Solyak, N.A.; /Fermilab

    2008-10-01

    Accelerating gradient is a key parameter of the accelerating structure in large linac facilities, like future Linear Collider. In room temperature accelerating structures the gradient is limited mostly by breakdown phenomena, caused by high surface electric fields or pulse surface heating. High power processing is a necessary procedure to clean surface and improve the gradient. In the best tested X-band structures the achieved gradient is exceed 100 MV/m in of {approx}200 ns pulses for breakdown rate of {approx} 10{sup -7}. Gradient limit depends on number of factors and no one theory which can explain all sets of experimental results and predict gradient in new accelerating structure. In paper we briefly overview the recent experimental results of breakdown studies, progress in understanding of gradient limitations and scaling laws. Although superconducting rf technology has been adopted throughout the world for ILC, it has frequently been difficult to reach the predicted performance in these structures due to a number of factors: multipactoring, field emission, Q-slope, thermal breakdown. In paper we are discussing all these phenomena and the ways to increase accelerating gradient in SC cavity, which are a part of worldwide R&D program.

  16. Frontiers in Superconducting Materials

    CERN Document Server

    Narlikar, Anant V

    2005-01-01

    Frontiers in Superconducting Materials gives a state-of-the-art report of the most important topics of the current research in superconductive materials and related phenomena. It comprises 30 chapters written by renowned international experts in the field. It is of central interest to researchers and specialists in Physics and Materials Science, both in academic and industrial research, as well as advanced students. It also addresses electronic and electrical engineers. Even non-specialists interested in superconductivity might find some useful answers.

  17. Superconducting energy recovery linacs

    Science.gov (United States)

    Ben-Zvi, Ilan

    2016-10-01

    High-average-power and high-brightness electron beams from a combination of laser photocathode electron guns and a superconducting energy recovery linac (ERL) is an emerging accelerator science with applications in ERL light sources, high repetition rate free electron lasers , electron cooling, electron ion colliders and more. This paper reviews the accelerator physics issues of superconducting ERLs, discusses major subsystems and provides a few examples of superconducting ERLs.

  18. High-Temperature Superconductivity

    Science.gov (United States)

    Tanaka, Shoji

    2006-12-01

    A general review on high-temperature superconductivity was made. After prehistoric view and the process of discovery were stated, the special features of high-temperature superconductors were explained from the materials side and the physical properties side. The present status on applications of high-temperature superconductors were explained on superconducting tapes, electric power cables, magnets for maglev trains, electric motors, superconducting quantum interference device (SQUID) and single flux quantum (SFQ) devices and circuits.

  19. Fundamentals of Superconducting Nanoelectronics

    CERN Document Server

    Sidorenko, Anatolie

    2011-01-01

    This book demonstrates how the new phenomena in superconductivity on the nanometer scale (FFLO state, triplet superconductivity, Crossed Andreev Reflection, synchronized generation etc.) serve as the basis for the invention and development of novel nanoelectronic devices and systems. It demonstrates how rather complex ideas and theoretical models, like odd-pairing, non-uniform superconducting state, pi-shift etc., adequately describe the processes in real superconducting nanostructues and novel devices based on them. The book is useful for a broad audience of readers, researchers, engineers, P

  20. Superconductive imaging surface magnetometer

    Science.gov (United States)

    Overton, Jr., William C.; van Hulsteyn, David B.; Flynn, Edward R.

    1991-01-01

    An improved pick-up coil system for use with Superconducting Quantum Interference Device gradiometers and magnetometers involving the use of superconducting plates near conventional pick-up coil arrangements to provide imaging of nearby dipole sources and to deflect environmental magnetic noise away from the pick-up coils. This allows the practice of gradiometry and magnetometry in magnetically unshielded environments. One embodiment uses a hemispherically shaped superconducting plate with interior pick-up coils, allowing brain wave measurements to be made on human patients. another embodiment using flat superconducting plates could be used in non-destructive evaluation of materials.

  1. Superconducting optical modulator

    Science.gov (United States)

    Bunt, Patricia S.; Ference, Thomas G.; Puzey, Kenneth A.; Tanner, David B.; Tache, Nacira; Varhue, Walter J.

    2000-12-01

    An optical modulator based on the physical properties of high temperature superconductors has been fabricated and tested. The modulator was constructed form a film of Yttrium Barium Copper Oxide (YBCO) grown on undoped silicon with a buffer layer of Yttria Stabilized Zirconia. Standard lithographic procedures were used to pattern the superconducting film into a micro bridge. Optical modulation was achieved by passing IR light through the composite structure normal to the micro bridge and switching the superconducting film in the bridge region between the superconducting and non-superconducting states. In the superconducting state, IR light reflects from the superconducting film surface. When a critical current is passed through the micro bridge, it causes the film in this region to switch to the non-superconducting state allowing IR light to pass through it. Superconducting materials have the potential to switch between these two states at speeds up to 1 picosecond using electrical current. Presently, fiber optic transmission capacity is limited by the rate at which optical data can be modulated. The superconducting modulator, when combined with other components, may have the potential to increase the transmission capacity of fiber optic lines.

  2. Basic Study of Superconductive Actuator

    OpenAIRE

    涌井, 和也; 荻原, 宏康

    2000-01-01

    There are two kinds of electromagnetic propulsion ships : a superconductive electromagnetic propulsion ship and a superconductive electricity propulsion ship. A superconductive electromagnetic propulsion ship uses the electromagnetic force (Lorenz force) by the interaction between a magnetic field and a electric current. On the other hand, a superconductive electricity propulsion ship uses screws driven by a superconductive motor. A superconductive propulsion ship technique has the merits of ...

  3. High temperature superconducting compounds

    Science.gov (United States)

    Goldman, Allen M.

    1992-11-01

    The major accomplishment of this grant has been to develop techniques for the in situ preparation of high-Tc superconducting films involving the use of ozone-assisted molecular beam epitaxy. The techniques are generalizable to the growth of trilayer and multilayer structures. Films of both the DyBa2Cu3O(7-x) and YBa2Cu3O(7-x) compounds as well as the La(2-x)Sr(x)CuO4 compound have been grown on the usual substrates, SrTiO3, YSZ, MgO, and LaAlO3, as well as on Si substrates without any buffer layer. A bolometer has been fabricated on a thermally isolated SiN substrate coated with YSZ, an effort carried out in collaboration with Honeywell Inc. The deposition process facilitates the fabrication of very thin and transparent films creating new opportunities for the study of superconductor-insulator transitions and the investigation of photo-doping with carriers of high temperature superconductors. In addition to a thin film technology, a patterning technology has been developed. Trilayer structures have been developed for FET devices and tunneling junctions. Other work includes the measurement of the magnetic properties of bulk single crystal high temperature superconductors, and in collaboration with Argonne National Laboratory, measurement of electric transport properties of T1-based high-Tc films.

  4. First results from the new RIKEN superconducting electron cyclotron resonance ion source (invited).

    Science.gov (United States)

    Nakagawa, T; Higurashi, Y; Ohnishi, J; Aihara, T; Tamura, M; Uchiyama, A; Okuno, H; Kusaka, K; Kidera, M; Ikezawa, E; Fujimaki, M; Sato, Y; Watanabe, Y; Komiyama, M; Kase, M; Goto, A; Kamigaito, O; Yano, Y

    2010-02-01

    The next generation heavy ion accelerator facility, such as the RIKEN radio isotope (RI) beam factory, requires an intense beam of high charged heavy ions. In the past decade, performance of the electron cyclotron resonance (ECR) ion sources has been dramatically improved with increasing the magnetic field and rf frequency to enhance the density and confinement time of plasma. Furthermore, the effects of the key parameters (magnetic field configuration, gas pressure, etc.) on the ECR plasma have been revealed. Such basic studies give us how to optimize the ion source structure. Based on these studies and modern superconducting (SC) technology, we successfully constructed the new 28 GHz SC-ECRIS, which has a flexible magnetic field configuration to enlarge the ECR zone and to optimize the field gradient at ECR point. Using it, we investigated the effect of ECR zone size, magnetic field configuration, and biased disk on the beam intensity of the highly charged heavy ions with 18 GHz microwaves. In this article, we present the structure of the ion source and first experimental results with 18 GHz microwave in detail.

  5. Application of International Linear Collider superconducting cavities for acceleration of protons

    Directory of Open Access Journals (Sweden)

    P. N. Ostroumov

    2007-12-01

    Full Text Available Beam acceleration in the International Linear Collider (ILC will be provided by 9-cell 1300 MHz superconducting (SC cavities. The cavities are designed for effective acceleration of charged particles moving with the speed of light and are operated on π-mode to provide a maximum accelerating gradient. A significant research and development effort has been devoted to develop ILC SC technology and its rf system which resulted in excellent performance of ILC cavities. Therefore, the proposed 8-GeV proton driver in Fermilab is based on ILC cavities above ∼1.2  GeV. The efficiency of proton beam acceleration by ILC cavities drops fast for lower velocities and it was proposed to develop squeezed ILC-type (S-ILC cavities operating at 1300 MHz and designed for β_{G}=0.81, geometrical beta, to accelerate protons or H^{-} from ∼420  MeV to 1.2 GeV. This paper discusses the possibility of avoiding the development of new β_{G}=0.81 cavities by operating ILC cavities on 8/9π-mode of standing wave oscillations.

  6. Fiscal 1997 R and D project on industrial science and technology under a consignment from NEDO. R and D of the superconducting material and device (technical development of the Josephson device hybrid system); 1997 nendo sangyo kagaku gijutsu kenkyu kaihatsu jigyo Shin energy Sangyo Gijutsu Sogo Kaihatsu Kiko itaku. Chodendo zairyo chodendo soshi no kenkyu kaihatsu (Josephson soshi hybrid system no gijutsu kaihatsu) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    In order to establish basic technology for hybrid systems of superconducting and semiconducting devices, study was made on ultrahigh speed and low energy consumption properties of Josephson devices. As Josephson IC technology, a logical circuit, ring network, memory circuit, and oxide superconductor logical circuit were studied. As superconducting hybrid system technology, a Josephson device- semiconductor device interface, formation technology of signal transmission lines, and Josephson-MOS IC technology were developed. In fiscal 1997, as Josephson IC technology, switch motion of 4GHz in clock frequency was achieved by new high-density wiring process. Integration of some semiconducting processor elements, junction of surface- stabilized superconducting thin films, and motion of combination structure of some SQUIDs were also confirmed. On the hybrid system, voltage conversion operation of all interfaces was confirmed. Proper logical operation of the Josephson device hybrid circuit was also confirmed. 95 refs., 90 figs., 5 tabs.

  7. Overview of Superconductivity and Challenges in Applications

    Science.gov (United States)

    Flükiger, Rene

    2012-01-01

    Considerable progress has been achieved during the last few decades in the various fields of applied superconductivity, while the related low temperature technology has reached a high level. Magnetic resonance imaging (MRI) and nuclear magnetic resonance (NMR) are so far the most successful applications, with tens of thousands of units worldwide, but high potential can also be recognized in the energy sector, with high energy cables, transformers, motors, generators for wind turbines, fault current limiters and devices for magnetic energy storage. A large number of magnet and cable prototypes have been constructed, showing in all cases high reliability. Large projects involving the construction of magnets, solenoids as well as dipoles and quadrupoles are described in the present book. A very large project, the LHC, is currently in operation, demonstrating that superconductivity is a reliable technology, even in a device of unprecedented high complexity. A project of similar complexity is ITER, a fusion device that is presently under construction. This article starts with a brief historical introduction to superconductivity as a phenomenon, and some fundamental properties necessary for the understanding of the technical behavior of superconductors are described. The introduction of superconductivity in the industrial cycle faces many challenges, first for the properties of the base elements, e.g. the wires, tapes and thin films, then for the various applied devices, where a number of new difficulties had to be resolved. A variety of industrial applications in energy, medicine and communications are briefly presented, showing how superconductivity is now entering the market.

  8. Design and comparative analysis of 10 MW class superconducting wind power generators according to different types of superconducting wires

    Science.gov (United States)

    Sung, Hae-Jin; Kim, Gyeong-Hun; Kim, Kwangmin; Park, Minwon; Yu, In-Keun; Kim, Jong-Yul

    2013-11-01

    Wind turbine concepts can be classified into the geared type and the gearless type. The gearless type wind turbine is more attractive due to advantages of simplified drive train and increased energy yield, and higher reliability because the gearbox is omitted. In addition, this type resolves the weight issue of the wind turbine with the light weight of gearbox. However, because of the low speed operation, this type has disadvantage such as the large diameter and heavy weight of generator. Super-Conducting (SC) wind power generator can reduce the weight and volume of a wind power system. Properties of superconducting wire are very different from each company. This paper considers the design and comparative analysis of 10 MW class SC wind power generators according to different types of SC wires. Super-Conducting Synchronous Generators (SCSGs) using YBCO and Bi-2223 wires are optimized by an optimal method. The magnetic characteristics of the SCSGs are investigated using the finite elements method program. The optimized specifications of the SCSGs are discussed in detail, and the optimization processes can be used effectively to develop large scale wind power generation systems.

  9. Superconducting quantum circuits theory and application

    Science.gov (United States)

    Deng, Xiuhao

    states. The model and toolbox are engineered with a superconducting quantum circuit where two superconducting resonators are coupled via the UQDP circuit. Using fourth order perturbation theory one can realize a complete set of quantum operations between these two photon modes. This helps open a new field to treat photon modes as qubits. Additional, a three-wave mixing scheme using phase qubits permits one to engineer the coupling Hamiltonian using a phase qubit as a tunable coupler. Along with Feynman's idea using quantum to simulate quantum, superconducting quantum simulators have been studied intensively recently. Taking the advantage of mesoscopic size of superconducting circuit and local tunability, we came out the idea to simulate quantum phase transition due to disorder. Our first paper was to propose a superconducting quantum simulator of Bose-Hubbard model to do site-wise manipulation and observe Mott-insulator to superfluid phase transition. The side-band cooling of an array of superconducting resonators is solved after the paper was published. In light of the developed technology in manipulating quantum information with superconducting circuit, one can couple other quantum oscillator system to superconducting resonators in order manipulation of its quantum states or parametric amplification of weak quantum signal. A theory that works for different coupling schemes has been studied in chapter 5. This will be a platform for further research.

  10. Radiation Shielding Utilizing A High Temperature Superconducting Magnet Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This project aims to leverage near-term high-temperature superconducting technologies to assess applicability of magnetic shielding for protecting against exposure...

  11. Coupling nitrogen-vacancy centers in diamond to superconducting flux qubits.

    Science.gov (United States)

    Marcos, D; Wubs, M; Taylor, J M; Aguado, R; Lukin, M D; Sørensen, A S

    2010-11-19

    We propose a method to achieve coherent coupling between nitrogen-vacancy (NV) centers in diamond and superconducting (SC) flux qubits. The resulting coupling can be used to create a coherent interaction between the spin states of distant NV centers mediated by the flux qubit. Furthermore, the magnetic coupling can be used to achieve a coherent transfer of quantum information between the flux qubit and an ensemble of NV centers. This enables a long-term memory for a SC quantum processor and possibly an interface between SC qubits and light.

  12. Coupling nitrogen-vacancy centers in diamond to superconducting flux qubits

    DEFF Research Database (Denmark)

    Marcos, D.; Wubs, Martijn; Taylor, J.M.

    2010-01-01

    We propose a method to achieve coherent coupling between nitrogen-vacancy (NV) centers in diamond and superconducting (SC) flux qubits. The resulting coupling can be used to create a coherent interaction between the spin states of distant NV centers mediated by the flux qubit. Furthermore, the ma......, the magnetic coupling can be used to achieve a coherent transfer of quantum information between the flux qubit and an ensemble of NV centers. This enables a long-term memory for a SC quantum processor and possibly an interface between SC qubits and light....

  13. Main: 3SC2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3SC2 小麦 Bread Wheat Triticum aestivum Serine Carboxypeptidase Ii Chains A And B Nam... 1WHS; X-ray; A=6-260, B=266-418.|PDB; 1WHT; X-ray; A=5-260, B=266-418.|PDB; 3SC2; X-ray; A=1-259, B=266-417...WHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT wheat_3SC2.jpg ...

  14. Graphene: Carbon's superconducting footprint

    Science.gov (United States)

    Vafek, Oskar

    2012-02-01

    Graphene exhibits many extraordinary properties, but superconductivity isn't one of them. Two theoretical studies suggest that by decorating the surface of graphene with the right species of dopant atoms, or by using ionic liquid gating, superconductivity could yet be induced.

  15. Superconducting cavities for LEP

    CERN Multimedia

    1983-01-01

    Above: a 350 MHz superconducting accelerating cavity in niobium of the type envisaged for accelerating electrons and positrons in later phases of LEP. Below: a small 1 GHz cavity used for investigating the surface problems of superconducting niobium. Albert Insomby stays on the right. See Annual Report 1983 p. 51.

  16. Academic training: Applied superconductivity

    CERN Multimedia

    2007-01-01

    LECTURE SERIES 17, 18, 19 January from 11.00 to 12.00 hrs Council Room, Bldg 503 Applied Superconductivity : Theory, superconducting Materials and applications E. PALMIERI/INFN, Padova, Italy When hearing about persistent currents recirculating for several years in a superconducting loop without any appreciable decay, one realizes that we are dealing with a phenomenon which in nature is the closest known to the perpetual motion. Zero resistivity and perfect diamagnetism in Mercury at 4.2 K, the breakthrough during 75 years of several hundreds of superconducting materials, the revolution of the "liquid Nitrogen superconductivity"; the discovery of still a binary compound becoming superconducting at 40 K and the subsequent re-exploration of the already known superconducting materials: Nature discloses drop by drop its intimate secrets and nobody can exclude that the last final surprise must still come. After an overview of phenomenology and basic theory of superconductivity, the lectures for this a...

  17. Oxide-based platform for reconfigurable superconducting nanoelectronics

    Science.gov (United States)

    Veazey, Joshua P.; Cheng, Guanglei; Irvin, Patrick; Cen, Cheng; Bogorin, Daniela F.; Bi, Feng; Huang, Mengchen; Bark, Chung-Wung; Ryu, Sangwoo; Cho, Kwang-Hwan; Eom, Chang-Beom; Levy, Jeremy

    2013-09-01

    We report quasi-1D superconductivity at the interface of LaAlO3 and SrTiO3. The material system and nanostructure fabrication method supply a new platform for superconducting nanoelectronics. Nanostructures having line widths w ˜ 10 nm are formed from the parent two-dimensional electron liquid using conductive atomic force microscope lithography. Nanowire cross-sections are small compared to the superconducting coherence length in LaAlO3/SrTiO3, placing them in the quasi-1D regime. Broad superconducting transitions versus temperature and finite resistances in the superconducting state well below Tc ≈ 200 mK are observed, suggesting the presence of fluctuation- and heating-induced resistance. The superconducting resistances and V-I characteristics are tunable through the use of a back gate. Four-terminal resistances in the superconducting state show an unusual dependence on the current path, varying by as much as an order of magnitude. This new technology, i.e., the ability to ‘write’ gate-tunable superconducting nanostructures on an insulating LaAlO3/SrTiO3 ‘canvas’, opens possibilities for the development of new families of reconfigurable superconducting nanoelectronics.

  18. 19 September 2011 - Japan Science and Technology Agency President K. Kitazawa visiting the LHC superconducting magnet test hall with engineer M. Bajko; the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni and Senior Scientist T. Kondo; signing the guest book with Adviser R.Voss and Head of International Relations F. Pauss.

    CERN Multimedia

    2011-01-01

    19 September 2011 - Japan Science and Technology Agency President K. Kitazawa visiting the LHC superconducting magnet test hall with engineer M. Bajko; the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni and Senior Scientist T. Kondo; signing the guest book with Adviser R.Voss and Head of International Relations F. Pauss.

  19. 8 April 2011 - Brazilian Minister of State for Science and Technology A. Mercadante Oliva signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni; visiting LHC superconducting magnet test hall with J.M. Jimenez.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    8 April 2011 - Brazilian Minister of State for Science and Technology A. Mercadante Oliva signing the guest book with CERN Director-General R. Heuer and Head of International Relations F. Pauss; in the ATLAS visitor centre with Collaboration Former Spokesperson P. Jenni; visiting LHC superconducting magnet test hall with J.M. Jimenez.

  20. 26th August 2010 - World Meteorological Organization Secretary-General M. Jarraud signing the guest book with CERN Director-General R. Heuer and visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry; throughout accompanied by M. Bona, CERN Relations with International Organisations

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    26th August 2010 - World Meteorological Organization Secretary-General M. Jarraud signing the guest book with CERN Director-General R. Heuer and visiting the LHC superconducting magnet test hall with Technology Department Head F. Bordry; throughout accompanied by M. Bona, CERN Relations with International Organisations

  1. William Brinkman (centre), Director of the Department of Energy, U.S.A. at the superconducting magnet test hall SM18 with (from left to right) Coordinator for External Relations F. Pauss, Advisor for Non-Member States J. Ellis, J. Strait from Fermilab and Deputy Head of Technology Department L. Rossi on 13 November 2009.

    CERN Multimedia

    Maximilien Brice; SM18

    2009-01-01

    William Brinkman (centre), Director of the Department of Energy, U.S.A. at the superconducting magnet test hall SM18 with (from left to right) Coordinator for External Relations F. Pauss, Advisor for Non-Member States J. Ellis, J. Strait from Fermilab and Deputy Head of Technology Department L. Rossi on 13 November 2009.

  2. 18 January 2011 - The British Royal Academy of Engineering in the LHC tunnel with CMS Collaboration Spokesperson G. Tonelli and Beams Department Head P. Collier; in the CERN Control Centre with P. Collier and LHC superconducting magnet test hall with Technology Department Head F. Bordry.

    CERN Multimedia

    Jean-Claude Gadmer

    2011-01-01

    18 January 2011 - The British Royal Academy of Engineering in the LHC tunnel with CMS Collaboration Spokesperson G. Tonelli and Beams Department Head P. Collier; in the CERN Control Centre with P. Collier and LHC superconducting magnet test hall with Technology Department Head F. Bordry.

  3. Topological Crystalline Superconductivity in Locally Noncentrosymmetric Multilayer Superconductors.

    Science.gov (United States)

    Yoshida, Tomohiro; Sigrist, Manfred; Yanase, Youichi

    2015-07-10

    Topological crystalline superconductivity in locally noncentrosymmetric multilayer superconductors (SCs) is proposed. We study the odd-parity pair-density wave (PDW) state induced by the spin-singlet pairing interaction through the spin-orbit coupling. It is shown that the PDW state is a topological crystalline SC protected by a mirror symmetry, although it is topologically trivial according to the classification based on the standard topological periodic table. The topological property of the mirror subsectors is intuitively explained by adiabatically changing the Bogoliubov-de Gennes Hamiltonian. A subsector of the bilayer PDW state reduces to the two-dimensional noncentrosymmetric SC, while a subsector of the trilayer PDW state is topologically equivalent to the spinless p-wave SC. Chiral Majorana edge modes in trilayers can be realized without Cooper pairs in the spin-triplet channel and chemical potential tuning.

  4. Photoemission studies of high-temperature superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Margaritondo, G. (Inst. de Physique Appliquee, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (CH))

    1990-11-01

    Photoemission spectroscopy has recently emerged as one of the leading techniques in the study of high-temperature superconductors. Relevant successes include the direct detection of the superconductivity gap, tests for departure from Fermi-liquid behavior, and many interface chemical studies with technological interest. The authors present a review of the fundamental and applied aspects of this technique.

  5. Superconductivity in carbon nanomaterials

    Science.gov (United States)

    Dlugon, Katarzyna

    The purpose of this thesis is to explain the phenomenon of superconductivity in carbon nanomaterials such as graphene, fullerenes and carbon nanotubes. In the introductory chapter, there is a description of superconductivity and how it occurs at critical temperature (Tc) that is characteristic and different to every superconducting material. The discovery of superconductivity in mercury in 1911 by Dutch physicist Heike Kamerlingh Onnes is also mentioned. Different types of superconductors, type I and type II, low and high temperatures superconductors, as well as the BCS theory that was developed in 1957 by Bardeen, Cooper, and Schrieffer, are also described in detail. The BCS theory explains how Cooper's pairs are formed and how they are responsible for the superconducting properties of many materials. The following chapters explain superconductivity in doped fullerenes, graphene and carbon nanotubes, respectively. There is a thorough explanation followed by many examples of different types of carbon nanomaterials in which small changes in chemical structure cause significant changes in superconducting properties. The goal of this research was not only to take into consideration well known carbon based superconductors but also to search for the newest available materials such as the fullerene nanowhiskers discovered quite recently. There is also a presentation of fairly new ideas about inducing superconductivity in a monolayer of graphene which is more challenging than inducing superconductivity in graphite by simply intercalating metal atoms between its graphene sheets. An effort has been taken to look for any available information about carbon nanomaterials that have the potential to superconduct at room temperature, mainly because discovery of such materials would be a real revolution in the modern world, although no such materials have been discovered yet.

  6. Quantum Memristors with Superconducting Circuits

    Science.gov (United States)

    Salmilehto, J.; Deppe, F.; di Ventra, M.; Sanz, M.; Solano, E.

    2017-02-01

    Memristors are resistive elements retaining information of their past dynamics. They have garnered substantial interest due to their potential for representing a paradigm change in electronics, information processing and unconventional computing. Given the advent of quantum technologies, a design for a quantum memristor with superconducting circuits may be envisaged. Along these lines, we introduce such a quantum device whose memristive behavior arises from quasiparticle-induced tunneling when supercurrents are cancelled. For realistic parameters, we find that the relevant hysteretic behavior may be observed using current state-of-the-art measurements of the phase-driven tunneling current. Finally, we develop suitable methods to quantify memory retention in the system.

  7. Quantum Memristors with Superconducting Circuits

    Science.gov (United States)

    Salmilehto, J.; Deppe, F.; Di Ventra, M.; Sanz, M.; Solano, E.

    2017-01-01

    Memristors are resistive elements retaining information of their past dynamics. They have garnered substantial interest due to their potential for representing a paradigm change in electronics, information processing and unconventional computing. Given the advent of quantum technologies, a design for a quantum memristor with superconducting circuits may be envisaged. Along these lines, we introduce such a quantum device whose memristive behavior arises from quasiparticle-induced tunneling when supercurrents are cancelled. For realistic parameters, we find that the relevant hysteretic behavior may be observed using current state-of-the-art measurements of the phase-driven tunneling current. Finally, we develop suitable methods to quantify memory retention in the system. PMID:28195193

  8. Superconductivity in aromatic hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Kubozono, Yoshihiro, E-mail: kubozono@cc.okayama-u.ac.jp [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Research Center of New Functional Materials for Energy Production, Storage and Transport, Okayama University, Okayama 700-8530 (Japan); Japan Science and Technology Agency, ACT-C, Kawaguchi 332-0012 (Japan); Goto, Hidenori; Jabuchi, Taihei [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Yokoya, Takayoshi [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Research Center of New Functional Materials for Energy Production, Storage and Transport, Okayama University, Okayama 700-8530 (Japan); Kambe, Takashi [Department of Physics, Okayama University, Okayama 700-8530 (Japan); Sakai, Yusuke; Izumi, Masanari; Zheng, Lu; Hamao, Shino; Nguyen, Huyen L.T. [Research Laboratory for Surface Science, Okayama University, Okayama 700-8530 (Japan); Sakata, Masafumi; Kagayama, Tomoko; Shimizu, Katsuya [Center of Science and Technology under Extreme Conditions, Osaka University, Osaka 560-8531 (Japan)

    2015-07-15

    Highlights: • Aromatic superconductor is one of core research subjects in superconductivity. Superconductivity is observed in certain metal-doped aromatic hydrocarbons. Some serious problems to be solved exist for future advancement of the research. This article shows the present status of aromatic superconductors. - Abstract: ‘Aromatic hydrocarbon’ implies an organic molecule that satisfies the (4n + 2) π-electron rule and consists of benzene rings. Doping solid aromatic hydrocarbons with metals provides the superconductivity. The first discovery of such superconductivity was made for K-doped picene (K{sub x}picene, five benzene rings). Its superconducting transition temperatures (T{sub c}’s) were 7 and 18 K. Recently, we found a new superconducting K{sub x}picene phase with a T{sub c} as high as 14 K, so we now know that K{sub x}picene possesses multiple superconducting phases. Besides K{sub x}picene, we discovered new superconductors such as Rb{sub x}picene and Ca{sub x}picene. A most serious problem is that the shielding fraction is ⩽15% for K{sub x}picene and Rb{sub x}picene, and it is often ∼1% for other superconductors. Such low shielding fractions have made it difficult to determine the crystal structures of superconducting phases. Nevertheless, many research groups have expended a great deal of effort to make high quality hydrocarbon superconductors in the five years since the discovery of hydrocarbon superconductivity. At the present stage, superconductivity is observed in certain metal-doped aromatic hydrocarbons (picene, phenanthrene and dibenzopentacene), but the shielding fraction remains stubbornly low. The highest priority research area is to prepare aromatic superconductors with a high superconducting volume-fraction. Despite these difficulties, aromatic superconductivity is still a core research target and presents interesting and potentially breakthrough challenges, such as the positive pressure dependence of T{sub c} that is clearly

  9. 46 CFR 7.70 - Folly Island, SC to Hilton Head Island, SC.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Folly Island, SC to Hilton Head Island, SC. 7.70 Section... BOUNDARY LINES Atlantic Coast § 7.70 Folly Island, SC to Hilton Head Island, SC. (a) A line drawn from the southernmost extremity of Folly Island to latitude 32°35′ N. longitude 79°58.2′ W. (Stono Inlet Lighted...

  10. Quantum Magnetomechanics with Levitating Superconducting Microspheres

    CERN Document Server

    Romero-Isart, O; Navau, C; Sanchez, A; Cirac, J I

    2011-01-01

    We show that by magnetically trapping a superconducting microsphere close to a quantum circuit, it is experimentally feasible to perform ground state cooling and to prepare quantum superpositions of the center-of-mass motion of the microsphere. Due to the absence of clamping losses and time dependent electromagnetic fields, the mechanical motion of micrometer-sized metallic spheres in the Meissner state is predicted to be extremely well isolated from the environment. Hence, we propose to combine the technology of magnetic mictrotraps and superconducting qubits to bring relatively large objects to the quantum regime.

  11. Compact superconducting coplanar microwave beam splitters

    Energy Technology Data Exchange (ETDEWEB)

    Baust, Alexander; Haeberlein, Max; Goetz, Jan; Hoffmann, Elisabeth; Menzel, Edwin P.; Schwarz, Manuel J.; Wulschner, Friedrich; Zhong, Ling; Deppe, Frank; Marx, Achim; Gross, Rudolf [Walther-Meissner-Institut, Bayerische Akademie der Wissenschaften, Garching (Germany); Physik-Department, TUM, Garching (Germany); Kalb, Norbert; Losinger, Thomas [Physik-Department, TUM, Garching (Germany)

    2012-07-01

    The recent evolution of circuit quantum electrodynamics systems making use of standing-wave microwave modes towards setups for propagating quantum microwaves has triggered the need for low-loss superconducting microwave beam splitters. Such a device should have ports compatible with the coplanar geometry relevant for circuit QED and, at the same time, be compact allowing for scalability. This combination presents fundamental and technological challenges. In this work, we present the fabrication and characterization of various compact superconducting coplanar microwave beam splitters. In addition, we discuss efforts towards a tunable beam splitter.

  12. Impact of eigenvalues on the pseudopotential calculation of superconducting parameters of metals Ga, Cd and In

    Science.gov (United States)

    Yadav, Jayprakash; Rafique, S. M.; Kumari, Shanti

    2009-10-01

    In the present paper some superconducting (SC) state parameters of metals Ga, Cd and In have been studied through Harrison's First Principle [HFP] pseudopotential technique using McMillan's formalism. The impact of choosing two different sets of core energy eigenvalues viz. Herman-Skillman and Clementi (or Experimental) has been studied.

  13. Model study of coexistence of Jahn-Teller distortion, antiferromagnetism and superconductivity in iron pnictide superconductors

    Science.gov (United States)

    Pradhan, B.; Goi, S. K.; Behera, Srikanta; Parida, P. K.; Mishra, R. N.

    2016-12-01

    We have proposed a theoretical model for the coexistence of superconductivity (SC), antiferromagnetism (AFM) and Jahn-Teller (JT) effect in the mean field approximation for iron based superconductors. The model is solved by using Zubarev's double-time Green's function technique to get their selfconsistent gap equations. Then these gap equations are solved numerically.

  14. Coupling nitrogen-vacancy centers in diamond to superconducting flux qubits

    DEFF Research Database (Denmark)

    Marcos, D.; Wubs, Martijn; Taylor, J.M.;

    2010-01-01

    We propose a method to achieve coherent coupling between nitrogen-vacancy (NV) centers in diamond and superconducting (SC) flux qubits. The resulting coupling can be used to create a coherent interaction between the spin states of distant NV centers mediated by the flux qubit. Furthermore, the ma...

  15. The first experimental results on laser ion loading into superconducting ECR ion source at RIKEN

    CERN Document Server

    Arzumanyan, G M; Shirkov, G D; Yano, Y

    2002-01-01

    The first experimental results on ions and neutrals injection by means of laser ablation from metal targets into the RIKEN 18 GHz superconducting electron cyclotron resonance ion source (SC ECRIS) are presented. Pulsed aluminium ion currents up to Al sup 8 sup + were generated in the source. The difference in pulse shapes of various charge states of the extracted ion currents is registered

  16. rotor of the SC rotating condenser

    CERN Multimedia

    1974-01-01

    The rotor of the rotating condenser was installed instead of the tuning fork as the modulating element of the radiofrequency system, when the SC accelerator underwent extensive improvements between 1973 to 1975 (see object AC-025). The SC was the first accelerator built at CERN. It operated from August 1957 until it was closed down at the end of 1990.

  17. Radiation Protection Section (SC/SL/RP)

    CERN Multimedia

    2006-01-01

    We should like to inform you that the Radiation Protection Section (SC/SL/RP) located on the Prévessin site has moved from Building 865 (ground floor) to new premises in Wing A of Building 892 (second floor). Telephone numbers remain the same. SC/SL/RP section

  18. The superconducting spin valve and triplet superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Garifullin, I.A., E-mail: ilgiz_garifullin@yahoo.com [Zavoisky Physical-Technical Institute, Kazan Scientific Center of Russian Academy of Sciences, 420029 Kazan (Russian Federation); Leksin, P.V.; Garif' yanov, N.N.; Kamashev, A.A. [Zavoisky Physical-Technical Institute, Kazan Scientific Center of Russian Academy of Sciences, 420029 Kazan (Russian Federation); Fominov, Ya.V. [L. D. Landau Institute for Theoretical Physics RAS, 119334 Moscow (Russian Federation); Moscow Institute of Physics and Technology, 141700 Dolgoprudny (Russian Federation); Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O.G. [Leibniz Institute for Solid State and Materials Research IFW Dresden, D-01171 Dresden (Germany); Büchner, B. [Leibniz Institute for Solid State and Materials Research IFW Dresden, D-01171 Dresden (Germany); Institut für Festkörperphysik, Technische Universität Dresden, D-01062 Dresden (Germany)

    2015-01-01

    A review of our recent results on the spin valve effect is presented. We have used a theoretically proposed spin switch design F1/F2/S comprising a ferromagnetic bilayer (F1/F2) as a ferromagnetic component, and an ordinary superconductor (S) as the second interface component. Based on it we have prepared and studied in detail a set of multilayers CoO{sub x}/Fe1/Cu/Fe2/S (S=In or Pb). In these heterostructures we have realized for the first time a full spin switch effect for the superconducting current, have observed its sign-changing oscillating behavior as a function of the Fe2-layer thickness and finally have obtained direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the magnetizations of the Fe1 and Fe2 layers. - Highlights: • We studied a spin switch design F1/F2/S. • We prepared a set of multilayers CoOx/Fe1/Cu/Fe2/S (S=In or Pb). • The full spin switch effect for the superconducting current was realized. • We observed its oscillating behavior as a function of the Fe2-layer thickness. • We obtained direct evidence for the long-range triplet superconductivity.

  19. 21 March 2011 - South African Ministry of Science and Technology, Department of Science and Technology (DST) Director General P. Mjwara signing the guest with Head of International Relations F. Pauss and Adviser J. Ellis and ALICE Collaboration Spokesperson P. Giubellino and J. Cleymans; in the CERN control centre with R. Steerenberg; visiting ALICE surface exhibition with P. Giubellino and LHC superconducting magnet test hall with L. Bottura.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    21 March 2011 - South African Ministry of Science and Technology, Department of Science and Technology (DST) Director General P. Mjwara signing the guest with Head of International Relations F. Pauss and Adviser J. Ellis and ALICE Collaboration Spokesperson P. Giubellino and J. Cleymans; in the CERN control centre with R. Steerenberg; visiting ALICE surface exhibition with P. Giubellino and LHC superconducting magnet test hall with L. Bottura.

  20. Superconducting homopolar motor and conductor development

    Science.gov (United States)

    Gubser, Donald U.

    1996-10-01

    The U.S. Navy has been developing superconducting homopolar motors for ship applications since 1969; a successful at-sea demonstration of the first motor, using NbTi wire for the magnet, was achieved in the early 1980s. Recently, this same motor was used as a test bed to demonstrate progress in high-critical-temperature superconducting magnet technology using bismuth-strontium- calcium-copper-oxide (BSCCO) compounds. In the fall of 1995, this motor achieved a performance of 124 kW operating at a temperature of 4.2 K and 91 kW while operating at 28 K. Future tests are scheduled using new magnets with conductors of both the 2223 and the 2212 BSCCO phases. This article describes the advantages of superconducting propulsion and recent progress in the development of BSCCO conductors for use in Navy power systems.

  1. Applied superconductivity handbook on devices and applications

    CERN Document Server

    2015-01-01

    This wide-ranging presentation of applied superconductivity, from fundamentals and materials right up to the latest applications, is an essential reference for physicists and engineers in academic research as well as in the field. Readers looking for a systematic overview on superconducting materials will expand their knowledge and understanding of both low and high Tc superconductors, including organic and magnetic materials. Technology, preparation and characterization are covered for several geometries, but the main benefit of this work lies in its broad coverage of significant applications in power engineering or passive devices, such as filter and antenna or magnetic shields. The reader will also find information on superconducting magnets for diverse applications in mechanical engineering, particle physics, fusion research, medicine and biomagnetism, as well as materials processing. SQUIDS and their usage in medicine or geophysics are thoroughly covered as are applications in quantum metrology, and, las...

  2. NATO Advanced Study Institute on Superconducting Electronics

    CERN Document Server

    Nisenhoff, Martin; Superconducting Electronics

    1989-01-01

    The genesis of the NATO Advanced Study Institute (ASI) upon which this volume is based, occurred during the summer of 1986 when we came to the realization that there had been significant progress during the early 1980's in the field of superconducting electronics and in applications of this technology. Despite this progress, there was a perception among many engineers and scientists that, with the possible exception of a limited number of esoteric fundamental studies and applications (e.g., the Josephson voltage standard or the SQUID magnetometer), there was no significant future for electronic systems incorporating superconducting elements. One of the major reasons for this perception was the aversion to handling liquid helium or including a closed-cycle helium liquefier. In addition, many critics felt that IBM's cancellation of its superconducting computer project in 1983 was "proof" that superconductors could not possibly compete with semiconductors in high-speed signal processing. From our persp...

  3. Static Measurements on HTS Coils of Fully Superconducting AC Electric Machines for Aircraft Electric Propulsion System

    Science.gov (United States)

    Choi, Benjamin B.; Hunker, Keith R.; Hartwig, Jason; Brown, Gerald V.

    2017-01-01

    The NASA Glenn Research Center (GRC) has been developing the high efficiency and high-power density superconducting (SC) electric machines in full support of electrified aircraft propulsion (EAP) systems for a future electric aircraft. A SC coil test rig has been designed and built to perform static and AC measurements on BSCCO, (RE)BCO, and YBCO high temperature superconducting (HTS) wire and coils at liquid nitrogen (LN2) temperature. In this paper, DC measurements on five SC coil configurations of various geometry in zero external magnetic field are measured to develop good measurement technique and to determine the critical current (Ic) and the sharpness (n value) of the super-to-normal transition. Also, standard procedures for coil design, fabrication, coil mounting, micro-volt measurement, cryogenic testing, current control, and data acquisition technique were established. Experimentally measured critical currents are compared with theoretical predicted values based on an electric-field criterion (Ec). Data here are essential to quantify the SC electric machine operation limits where the SC begins to exhibit non-zero resistance. All test data will be utilized to assess the feasibility of using HTS coils for the fully superconducting AC electric machine development for an aircraft electric propulsion system.

  4. Cs3ScCl6

    Directory of Open Access Journals (Sweden)

    Matthew D. Ward

    2014-06-01

    Full Text Available Crystals of tricaesium scandium(III hexachloride were obtained as a side product from the reaction of U, SnCl2, Sc, and S in a CsCl flux at 1073 K. Cs3ScCl6 crystallizes in the Rb3YCl6 structure type. The asymmetric unit comprises three Cs sites, two Sc sites, and six Cl sites, all of which have site symmetry 1, except for the two Sc sites that have site symmetries of 2 and -1, respectively. The structure is composed of isolated [ScCl6]3− octahedra that are surrounded by Cs+ cations. Two Cs+ cations have interactions with eight Cl− anions, while the third has interactions with ten Cl− anions.

  5. Tunneling in superconducting structures

    Science.gov (United States)

    Shukrinov, Yu. M.

    2010-12-01

    Here we review our results on the breakpoint features in the coupled system of IJJ obtained in the framework of the capacitively coupled Josephson junction model with diffusion current. A correspondence between the features in the current voltage characteristics (CVC) and the character of the charge oscillations in superconducting layers is demonstrated. Investigation of the correlations of superconducting currents in neighboring Josephson junctions and the charge correlations in neighboring superconducting layers reproduces the features in the CVC and gives a powerful method for the analysis of the CVC of coupled Josephson junctions. A new method for determination of the dissipation parameter is suggested.

  6. Superconductivity in doped insulators

    Energy Technology Data Exchange (ETDEWEB)

    Emery, V.J. [Brookhaven National Lab., Upton, NY (United States); Kivelson, S.A. [California Univ., Los Angeles, CA (United States). Dept. of Physics

    1995-12-31

    It is shown that many synthetic metals, including high temperature superconductors are ``bad metals``, with such a poor conductivity that the usual meanfield theory of superconductivity breaks down because of anomalously large classical and quantum fluctuations of the phase of the superconducting order parameter. It is argued that the supression of a first order phase transition (phase separation) by the long-range Coulomb interaction leads to high temperature superconductivity accompanied by static or dynamical charge inhomogeneIty. Evidence in support of this picture for high temperature superconductors is described.

  7. Quasiparticle entropy in the high-field superconducting phase of CeCoIn(5).

    Science.gov (United States)

    Tokiwa, Y; Bauer, E D; Gegenwart, P

    2012-09-14

    The heavy-fermion superconductor CeCoIn(5) displays an additional transition within its superconducting (SC) state, whose nature is characterized by high-precision studies of the isothermal field dependence of the entropy, derived from combined specific heat and magnetocaloric effect measurements at temperatures T≥100  mK and fields H≤12  T aligned along different directions. For any of these conditions, we do not observe an additional entropy contribution upon tuning at constant temperature by magnetic field from the homogeneous SC into the presumed Fulde-Ferrell-Larkin-Ovchinnikov (FFLO) SC state. By contrast, for H∥[100] a reduction of entropy was found that quantitatively agrees with the expectation for spin-density-wave order without FFLO superconductivity. Our data exclude the formation of a FFLO state in CeCoIn(5) for out-of-plane field directions, where no spin-density-wave order exists.

  8. Magnetic and superconducting nanowires

    DEFF Research Database (Denmark)

    Piraux, L.; Encinas, A.; Vila, L.

    2005-01-01

    magnetic and superconducting nanowires. Using different approaches entailing measurements on both single wires and arrays, numerous interesting physical properties have been identified in relation to the nanoscopic dimensions of these materials. Finally, various novel applications of the nanowires are also...

  9. Superconductivity fundamentals and applications

    CERN Document Server

    Buckel, Werner

    2004-01-01

    This is the second English edition of what has become one of the definitive works on superconductivity in German -- currently in its sixth edition. Comprehensive and easy to understand, this introductory text is written especially with the non-specialist in mind. The authors, both long-term experts in this field, present the fundamental considerations without the need for extensive mathematics, describing the various phenomena connected with the superconducting state, with liberal insertion of experimental facts and examples for modern applications. While all fields of superconducting phenomena are dealt with in detail, this new edition pays particular attention to the groundbreaking discovery of magnesium diboride and the current developments in this field. In addition, a new chapter provides an overview of the elements, alloys and compounds where superconductivity has been observed in experiments, together with their major characteristics. The chapter on technical applications has been considerably expanded...

  10. Superconductivity and symmetry breaking

    Energy Technology Data Exchange (ETDEWEB)

    Sarasua, L.G., E-mail: sarasua@fisica.edu.uy [Instituto de Fisica, Facultad de Ciencias, Universidad de la Republica, Montevideo (Uruguay)

    2012-02-15

    In the present work we consider the relation between superconductivity and spontaneous gauge symmetry breaking (SGBS). We show that ODLRO does not require in principle SBGS, even in the presence of particle number fluctuations, by examining exact solutions of a fermionic pairing model. The criteria become equivalent if a symmetry breaking field is allowed, which can be attributed to the interaction with the environment. However, superconducting states without SBGS are not forbidden.

  11. Photoemission, Correlation and Superconductivity:

    Science.gov (United States)

    Abrecht, M.; Ariosa, D.; Cloëtta, D.; Pavuna, D.; Perfetti, L.; Grioni, M.; Margaritondo, G.

    We review some of the problems still affecting photoemission as a probe of high-temperature superconductivity, as well as important recent results concerning their solution. We show, in particular, some of the first important results on thin epitaxial films grown by laser ablation, which break the monopoly of cleaved BCSCO in this type of experiments. Such results, obtained on thin LSCO, may have general implications on the theory of high-temperature superconductivity.

  12. Emergent Higgsless Superconductivity

    Directory of Open Access Journals (Sweden)

    Cristina Diamantini M.

    2017-01-01

    Full Text Available We present a new Higgsless model of superconductivity, inspired from anyon superconductivity but P- and T-invariant and generalizable to any dimension. While the original anyon superconductivity mechanism was based on incompressible quantum Hall fluids as average field states, our mechanism involves topological insulators as average field states. In D space dimensions it involves a (D-1-form fictitious pseudovector gauge field which originates from the condensation of topological defects in compact lowenergy effective BF theories. There is no massive Higgs scalar as there is no local order parameter. When electromagnetism is switched on, the photon acquires mass by the topological BF mechanism. Although the charge of the gapless mode (2 and the topological order (4 are the same as those of the standard Higgs model, the two models of superconductivity are clearly different since the origins of the gap, reflected in the high-energy sectors are totally different. In 2D thi! s type of superconductivity is explicitly realized as global superconductivity in Josephson junction arrays. In 3D this model predicts a possible phase transition from topological insulators to Higgsless superconductors.

  13. Superconducting Fullerene Nanowhiskers

    Directory of Open Access Journals (Sweden)

    Yoshihiko Takano

    2012-04-01

    Full Text Available We synthesized superconducting fullerene nanowhiskers (C60NWs by potassium (K intercalation. They showed large superconducting volume fractions, as high as 80%. The superconducting transition temperature at 17 K was independent of the K content (x in the range between 1.6 and 6.0 in K-doped C60 nanowhiskers (KxC60NWs, while the superconducting volume fractions changed with x. The highest shielding fraction of a full shielding volume was observed in the material of K3.3C60NW by heating at 200 °C. On the other hand, that of a K-doped fullerene (K-C60 crystal was less than 1%. We report the superconducting behaviors of our newly synthesized KxC60NWs in comparison to those of KxC60 crystals, which show superconductivity at 19 K in K3C60. The lattice structures are also discussed, based on the x-ray diffraction (XRD analyses.

  14. High temperature interfacial superconductivity

    Science.gov (United States)

    Bozovic, Ivan [Mount Sinai, NY; Logvenov, Gennady [Port Jefferson Station, NY; Gozar, Adrian Mihai [Port Jefferson, NY

    2012-06-19

    High-temperature superconductivity confined to nanometer-scale interfaces has been a long standing goal because of potential applications in electronic devices. The spontaneous formation of a superconducting interface in bilayers consisting of an insulator (La.sub.2CuO.sub.4) and a metal (La.sub.1-xSr.sub.xCuO.sub.4), neither of which is superconducting per se, is described. Depending upon the layering sequence of the bilayers, T.sub.c may be either .about.15 K or .about.30 K. This highly robust phenomenon is confined to within 2-3 nm around the interface. After exposing the bilayer to ozone, T.sub.c exceeds 50 K and this enhanced superconductivity is also shown to originate from a 1 to 2 unit cell thick interfacial layer. The results demonstrate that engineering artificial heterostructures provides a novel, unconventional way to fabricate stable, quasi two-dimensional high T.sub.c phases and to significantly enhance superconducting properties in other superconductors. The superconducting interface may be implemented, for example, in SIS tunnel junctions or a SuFET.

  15. On-focal-plane superconducting signal processing for low- and intermediate-temperature operation

    Science.gov (United States)

    Smetana, Daryl L.; Carson, John C.

    1991-11-01

    The marriage of superconducting electronics with Z-plane FPA readout structures offer the potential for high speed, low power parallel digital processing on-focal plane. This paper reports on some early research into this marriage of two technologies conducted by Irvine Sensors Corporation (ISC) and TRW. Progress is reviewed for both low and high temperature superconducting technologies.

  16. SC-FDMA for mobile communications

    CERN Document Server

    Abd El-Samie, Fathi E

    2013-01-01

    SC-FDMA for Mobile Communications examines Single-Carrier Frequency Division Multiple Access (SC-FDMA). Explaining this rapidly evolving system for mobile communications, it describes its advantages and limitations and outlines possible solutions for addressing its current limitations. The book explores the emerging trend of cooperative communication with SC-FDMA and how it can improve the physical layer security. It considers the design of distributed coding schemes and protocols for wireless relay networks where users cooperate to send their data to the destination. Supplying you with the re

  17. The superconducting spin valve and triplet superconductivity

    Science.gov (United States)

    Garifullin, I. A.; Leksin, P. V.; Garif`yanov, N. N.; Kamashev, A. A.; Fominov, Ya. V.; Schumann, J.; Krupskaya, Y.; Kataev, V.; Schmidt, O. G.; Büchner, B.

    2015-01-01

    A review of our recent results on the spin valve effect is presented. We have used a theoretically proposed spin switch design F1/F2/S comprising a ferromagnetic bilayer (F1/F2) as a ferromagnetic component, and an ordinary superconductor (S) as the second interface component. Based on it we have prepared and studied in detail a set of multilayers CoOx/Fe1/Cu/Fe2/S (S=In or Pb). In these heterostructures we have realized for the first time a full spin switch effect for the superconducting current, have observed its sign-changing oscillating behavior as a function of the Fe2-layer thickness and finally have obtained direct evidence for the long-range triplet superconductivity arising due to noncollinearity of the magnetizations of the Fe1 and Fe2 layers.

  18. Development of Strip Casting Technology in Rare Earth Permanent Magnet Alloys and Hydrogen Storage Alloys in China

    Institute of Scientific and Technical Information of China (English)

    Han Weiping; Guo Binglin; Yu Xiaojun; Zhu Jinghan; Cheng Xinghua

    2007-01-01

    The SC technique is now being applied widely in material preparation, especially in rare earth functional materials in virtue of its advanced process and high performance product. The applications of SC technique in rare earth permanent magnet alloys and hydrogen storage alloys were analyzed integrative, on the basis of summary of SC technique development in this paper. The paper mainly includes development history of SC technology, effect of SC technology on alloy microstructure, application of SC technology in RE storage hydrogen alloy and sintered Nd-Fe-B alloy, development of SC equipment and SC product industry. At the same time, the paper points out the existing problem of SC products.

  19. Properties of superconductivity on a density wave background with small ungapped Fermi surface parts

    Science.gov (United States)

    Grigoriev, P. D.

    2008-06-01

    We investigate the properties and the microscopic structure of superconductivity (SC) coexisting and sharing the common conducting band with density wave (DW). Such coexistence may take place when the nesting of the Fermi surface (FS) is not perfect, and in the DW state some quasiparticle states remain on the Fermi level and lead to the Cooper instability. The dispersion of such quasiparticle states strongly differs from that without DW, and so do the properties of SC on the DW background. The upper critical field Hc2 in such a SC state increases as the system approaches the critical pressure, where the ungapped quasiparticles and superconductivity just appear, and it may considerably exceed the usual Hc2 value without DW. The spin-density wave (SDW) background strongly suppresses the singlet SC pairing, while it does not affect so much the triplet SC transition temperature. The results obtained explain the experimental observations in layered organic metals (TMTSF)2PF6 and α-(BEDT-TTF)2KHg(SCN)4 , where SC appears in the DW states under pressure and shows many unusual properties.

  20. Inter-institutional decision making in the technology transfer process: Some preliminary issues in the evaluation of ORNL's High-Temperature Superconductivity Pilot Center

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, D.L.

    1989-09-01

    This report illuminates the decision-making processes affecting technology transfer at ORNL as they potentially impact upon development of high-temperature superconductors. The methodology of this report consists of an analysis of Oak Ridge National Laboratory (ORNL) documents laws, and regulations; a review of relevant literature on licensing, patents, and user center decision making; and interviews with persons directly involved in technology development and transfer at the laboratory. The process of technology development at ORNL encompasses, among other things, activities aimed at research and development (R D), technology transfer, and technology utilization. Each of these activities has officially become part of an overall laboratory mission referred to as technology development. 28 refs., 1 fig., 3 tabs.

  1. Structural Stability Driven by the Spin-Orbit Coupling and the Superconductivity in simple-cubic Polonium

    Science.gov (United States)

    Kang, Chang-Jong; Kim, Kyoo; Min, B. I.

    2013-03-01

    Polonium is the only element which has the simple-cubic (SC) structure in the periodic table. We have studied its structural stability based on the phonon dispersion calculations using the first-principles all-electron full-potential band method. We have demonstrated that the strong spin-orbit coupling (SOC) in SC-Po suppresses the Peierls instability and makes the SC structure stable. We have also discussed the structural chirality realized in beta-Po, as a consequence of the phonon instability. Further, we have investigated the possible superconductivity in SC-Po, and predicted that it becomes a superconductor with Tc ~ 4 K at ambient pressure. The transverse soft phonon mode at q ~ 2/3 R, which is greatly affected by the SOC, plays an important role both in the structural stability and the superconductivity in SC-Po. We have explored effects of the SOC and the volume variation on the phonon dispersions and superconducting properties of SC-Po.

  2. Capacitações tecnológicas de micro e pequenas empresas inseridas em redes tecnoprodutivas: o caso da eletrometal-mecânica em Joinville (SC Technological capabilities of small and micro firms inserted in techno-productive networks: the case of electrometal-mechanic industry of Joinville (SC

    Directory of Open Access Journals (Sweden)

    Fabio Stallivieri

    2007-12-01

    structure, with patterns of specialization and complementarities according to the size of establishments and along different activities. The analysis of the labor division in the arrangement and of the specializations by size of the companies, combined with the market interactions and the types of sub contraction, will help to comprehend how micro and small companies insert themselves in the arrangement and technological capabilities they develop. The study is based on the neo-schumpeterian theoretical framework and has as its main objective the analysis of the different technological capabilities developed by these types of firms, according to their pattern of insertion in the local productive structure. For this purpose a survey with 83 companies of different sizes was made. An important finding was the existence of several kinds of techno-productive networks, which vary according to the forms of governance, the productive and technological characteristics and the nature of the learning processes. Such specificities affect, with different intensities, the possibilities of technological capacity building, which were also influenced by the relations with agents outside the arrangement.

  3. Introduction to superconductivity and high-T sub c materials

    Energy Technology Data Exchange (ETDEWEB)

    Cyrot, M. (Grenoble (FR)); Pavuna, D. (Lausanne (CH))

    1991-01-01

    What sets this book apart from other introductions to superconductivity and high-T{sub c} materials is its pragmatic approach. In this book the authors describe all relevant superconducting phenomena and rely on the macroscopic Ginzburg-Landau theory to derive the most important results. Examples are chosen from selected conventional superconductors like NbTi and compared to those high-T{sub c} materials. The text should be of interest to non-specialists in superconductivity either as a textbook for those entering the field (one semester course) or as researchers in advanced technologies and even some managers of interdisciplinary research projects.

  4. A high gradient test of a single-cell superconducting radio frequency cavity with a feedback waveguide

    Science.gov (United States)

    Kostin, Roman; Avrakhov, Pavel; Kanareykin, Alexei; Solyak, Nikolay; Yakovlev, Vyacheslav; Kazakov, Sergey; Wu, Genfa; Khabiboulline, Timergali; Rowe, Allan; Rathke, John

    2015-09-01

    The most severe problem of the international linear collider (ILC-type) is its high cost, resulting in part from the enormous length of the collider. This length is determined mainly by the achievable accelerating gradient in the RF system of the collider. In current technology, the maximum acceleration gradient in superconducting (SC) structures is determined mainly by the value of the surface RF magnetic field. In order to increase the gradient, a superconducting traveling wave accelerating (STWA) structure is suggested. Utilization of STWA structure with small phase advance per cell for future high energy linear colliders such as ILCs may provide an accelerating gradient 1.2-1.4 times larger [1] than a standing wave structure. However, STWA structure requires a feedback waveguide for power redirecting from the end of the structure back to the front end of accelerating structure. Recent tests of a 1.3 GHz model of a single-cell cavity with waveguide feedback demonstrated an accelerating gradient comparable to the gradient of a single-cell ILC-type cavity from the same manufacturer [2]. In the present paper, high gradient test results are presented.

  5. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  6. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  7. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  8. z107sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z107SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  9. Bandwidth challenge teams at SC2003 conference

    CERN Multimedia

    2003-01-01

    Results from the fourth annual High-Performance Bandwidth Challenge, held in conjunction with SC2003, the international conference on high-performance computing and networking which occurred last week in Phoenix, AZ (1 page).

  10. Recrystallization of Al-Sc alloys

    Energy Technology Data Exchange (ETDEWEB)

    Drits, M.E.; Toropova, L.S.; Bykov, Yu.G.; Ber, L.B.

    Scandium effect on the temperature range of aluminium recrystallization was investigated. Al-Sc alloys were studied under cold rolled and hot pressed conditions. It is found that the temperature range of Al-Sc alloy recrystallization depends on ScAl/sub 3/ particle dispersion during recrystallization heats. During heating in quenched alloys at 200-300 deg C decomposition occurs which prevents recrystallization, In the alloys with scandium contents less 0.2% decomposition and recrystallization processes pass simultaneously. In quenched alloys with scandium contents over 0.2% and in aged alloys the initiation and subsequent development of recrystallization are determined by the processes of coalescence and solution of ScAl/sub 3/ phase particles.

  11. Effects of the Next Nearest Neighbor Hopping on Superconductivity and Antiferromagnetism of Gossamer Superconductivity

    Institute of Scientific and Technical Information of China (English)

    刘芬芬; 张勇; 袁峰; 夏临华

    2012-01-01

    The two dimensions hole-doped t-t '-J-U model was studied based on the Gutzwiller approach and the renormalized mean-field theory.The phase diagrams of gossamer superconductors and the effects of the next-nearestneighbor hopping(t ') on superconductivity and antiferromagnetism based on the t-t '-J-U model were investigated.The results show that the qualitative feature of the phase diagrams in the t-t '-J-U model is the same as in the case of the t-J-U model.The antiferromagnetic order coexists with the d-wave superconductivity(dSC) in the underdoped region below the doping δ≈ 0.1 and is enhanced by the t '.The dSC order is slightly suppressed by t ' in the underdoped region and greatly enhanced in the overdoped region.The dSC order is pushed to a larger doping region and the coexistence region of the AF and dSC extends to higher doping.

  12. Proceedings of the fourth international conference and exhibition: World Congress on superconductivity. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    Krishen, K.; Burnham, C. [eds.] [National Aeronautics and Space Administration, Houston, TX (United States). Lyndon B. Johnson Space Center

    1994-12-31

    The goals of the World Congress on Superconductivity (WCS) have been to establish and foster the development and commercial application of superconductivity technology on a global scale by providing a non-adversarial, non-advocacy forum where scientists, engineers, businessmen and government personnel can freely exchange information and ideas on recent developments and directions for the future of superconductive research. Sessions were held on: accelerator technology, power and energy, persistent magnetic fields, performance characterization, physical properties, fabrication methodology, superconductive magnetic energy storage (SMES), thin films, high temperature materials, device applications, wire fabrication, and granular superconductors. Individual papers are indexed separately.

  13. Impact of pseudogap on photoinduced superconducting phase transition in underdoped Bi2212

    Energy Technology Data Exchange (ETDEWEB)

    Toda, Y., E-mail: toda@eng.hokudai.ac.jp [Department of Applied Physics, Hokkaido University, Sapporo 060-8628 (Japan); Mertelj, T.; Kusar, P. [Complex Matter Department, Jozef Stefan Institute, Jamova 39, Ljubljana SI-1000 (Slovenia); Kurosawa, T.; Oda, M.; Ido, M. [Department of Physics, Hokkaido University, Sapporo 060-0810 (Japan); Mihailovic, D. [Complex Matter Department, Jozef Stefan Institute, Jamova 39, Ljubljana SI-1000 (Slovenia)

    2013-10-15

    Highlights: • QP dynamics of UD-Bi2212 in the photoinduced phase transition was investigated by pump-probe spectroscopy. • The pump fluence dependence of the QP dynamics shows a delay of the SC recovery. • The observed delay time is comparable to a recovery time of PG, suggesting a role of PG responsible for the SC formation. -- Abstract: We report nonequilibrium quasiparticle (QP) dynamics in underdoped Bi2212 crystals using ultrafast optical spectroscopy, which allows to analyze the dynamics associated with the superconducting (SC) and psuedogap (PG) QPs independently. In the saturation condition of the SC component, where the SC condensate is fully destroyed within the photoexcited volume, we found a delay of the SC state recovery associated with a transient normal state. The delay increases linearly with increasing the pump fluence. The QP dynamics also shows a contribution of the PG component, whose magnitude at the start of the SC state recovery was almost constant at various pump fluences, suggesting a critical level of PG order before the SC condensate can recover.

  14. Industrial Large Scale Applications of Superconductivity -- Current and Future Trends

    Science.gov (United States)

    Amm, Kathleen

    2011-03-01

    Since the initial development of NbTi and Nb3Sn superconducting wires in the early 1960's, superconductivity has developed a broad range of industrial applications in research, medicine and energy. Superconductivity has been used extensively in NMR low field and high field spectrometers and MRI systems, and has been demonstrated in many power applications, including power cables, transformers, fault current limiters, and motors and generators. To date, the most commercially successful application for superconductivity has been the high field magnets required for magnetic resonance imaging (MRI), with a global market well in excess of 4 billion excluding the service industry. The unique ability of superconductors to carry large currents with no losses enabled high field MRI and its unique clinical capabilities in imaging soft tissue. The rapid adoption of high field MRI with superconducting magnets was because superconductivity was a key enabler for high field magnets with their high field uniformity and image quality. With over 30 years of developing MRI systems and applications, MRI has become a robust clinical tool that is ever expanding into new and developing markets. Continued innovation in system design is continuing to address these market needs. One of the key questions that innovators in industrial superconducting magnet design must consider today is what application of superconductivity may lead to a market on the scale of MRI? What are the key considerations for where superconductivity can provide a unique solution as it did in the case of MRI? Many companies in the superconducting industry today are investigating possible technologies that may be the next large market like MRI.

  15. Effects of pressure and magnetic field on superconductivity in ZrTe3: local pair-induced superconductivity

    Science.gov (United States)

    Tsuchiya, S.; Matsubayashi, K.; Yamaya, K.; Takayanagi, S.; Tanda, S.; Uwatoko, Y.

    2017-06-01

    In this work, the origin of the highly anisotropic superconducting transition in ZrTe3, where the resistance along the a axis, R a , is reduced at 4 K but those along the b axis, R b , and {c}\\prime axis, R c‧, are reduced at 2 K, was explored with the application of a magnetic field and pressure by the electrical resistance measurements. We found that the behavior of the upper critical field and its anisotropy as well as the pressure dependence determined by the R a measurements are quite similar to those of R b . Moreover, the excess conductivity for R b indicates anomalous behavior. These results support an unconventional origin for the anisotropic transition rather than conventional superconducting fluctuation. The reduction in R a is due to filamentary superconductivity (SC) induced by locally bound electron pairs (local pairs), which correspond to bi-polarons, and the transition of R b corresponds to the emergence of bulk SC originating from the Cooper pairs triggered by the transfer of the local pairs.

  16. A new family of high-Tc compounds-Stepping stones toward understanding unconventional superconductivity

    Institute of Scientific and Technical Information of China (English)

    SUN Yang; Mike GUIDRY; WU ChengLi

    2008-01-01

    @@ High-transition temperature (Tc) superconductivity was first discovered in layered copper-based oxides (cuprates)more than two decades ago[1], but its theoretical inter-pretation remains controversial[2,3]. The main question concerning the high-Tc superconductivity phase diagram is the transition between the antiferromagnetic (AF) and superconducting (SC) phases, which is dominated by anomalous properties commonly attributed to a pseu-dogap[4,5] in the spectrum. It is believed that the high-Tc mechanism in cuprates cannot be fully understood within the BCS theory[6] that explains normal supercon-ductivity. Despite much effort, there is no consensus as to the origin of the pseudogap properties, and the high-Tc mechanism remains an open question.

  17. Superconductivity and the environment: a Roadmap

    Science.gov (United States)

    Nishijima, Shigehiro; Eckroad, Steven; Marian, Adela; Choi, Kyeongdal; Kim, Woo Seok; Terai, Motoaki; Deng, Zigang; Zheng, Jun; Wang, Jiasu; Umemoto, Katsuya; Du, Jia; Febvre, Pascal; Keenan, Shane; Mukhanov, Oleg; Cooley, Lance D.; Foley, Cathy P.; Hassenzahl, William V.; Izumi, Mitsuru

    2013-11-01

    There is universal agreement between the United Nations and governments from the richest to the poorest nations that humanity faces unprecedented global challenges relating to sustainable energy, clean water, low-emission transportation, coping with climate change and natural disasters, and reclaiming use of land. We have invited researchers from a range of eclectic research areas to provide a Roadmap of how superconducting technologies could address these major challenges confronting humanity. Superconductivity has, over the century since its discovery by Kamerlingh Onnes in 1911, promised to provide solutions to many challenges. So far, most superconducting technologies are esoteric systems that are used in laboratories and hospitals. Large science projects have long appreciated the ability of superconductivity to efficiently create high magnetic fields that are otherwise very costly to achieve with ordinary materials. The most successful applications outside of large science are high-field magnets for magnetic resonance imaging, laboratory magnetometers for mineral and materials characterization, filters for mobile communications, and magnetoencephalography for understanding the human brain. The stage is now set for superconductivity to make more general contributions. Humanity uses practically unthinkable amounts of energy to drive our modern way of life. Overall, global power usage has been predicted to almost double from 16.5 to 30 TW in the next four decades (2011 Equinox Summit: Energy 2030 http://wgsi.org/publications-resources). The economy with which electrons carry energy compels the continued quest for efficient superconducting power generation, energy storage, and power transmission. The growing global population requires new arable land and treatment of water, especially in remote areas, and superconductivity offers unique solutions to these problems. Exquisite detectors give warning of changes that are otherwise invisible. Prediction of climate and

  18. Sc3N and Sc2C2 encapsulated B40: Smarter than its carbon analogue

    Science.gov (United States)

    Shah, Esha V.; Roy, Debesh R.

    2016-10-01

    A detailed comparative investigation on the recently synthesised B40 and C40 along with their metal nitride (Sc3N)and carbide (Sc2C2) encapsulated endohedral fullerenes, is performed under density functional theory for the first time. The structures, electronic, thermodynamic and magnetic properties of all the considered compounds are explored in detail. The present study identifies borospherene (B40) and its encapsulated nitride (Sc3N@B40) and carbide (Sc2C2@B40) endohedral borofullerenes as the better candidates for future novel nano-applications compared to their carbon bucky ball analogues.

  19. STM/STS study of the superconducting gap in SmFeAsO1-xFx

    Science.gov (United States)

    Kawashima, Yuki; Ichimura, Koichi; Katono, Kazuhiro; Kurosawa, Tohru; Oda, Migaku; Tanda, Satoshi; Kamihara, Yoichi; Hosono, Hideo

    2015-02-01

    We report an electron tunneling study of SmFeAsO1-xFx in the low doping region (x=0, 0.045, 0.046, 0.069) by low temperature UHV-STM/STS. Superconducting gaps are observed for each superconducting sample x=0.045 (Tc=12.9 K), x=0.046 (Tc=32.9 K) and x=0.069 (Tc=46.9 K). We obtained corresponding superconducting gap size of ΔSC = 9.5 ± 0.5 meV, 9.75±0.25 meV and 11±1 meV. While Tc increases, ΔSC is kept the same. This suggests that the effective attractive interaction is the same and that there is some mechanism that suppresses the superconductivity in the low doping region. On the other hand, similar gap structures were found in a non-superconducting sample with x=0 at 7.8 K. The obtained gap size was ΔN = 8.5 ± 1.5 meV, which is almost the same as the superconducting gap in the superconducting samples (x=0.045, 0.046, 0.069).

  20. Evidence for strong-coupling s-wave superconductivity in MgB2: (11)B NMR Study.

    Science.gov (United States)

    Kotegawa, H; Ishida, K; Kitaoka, Y; Muranaka, T; Akimitsu, J

    2001-09-17

    We have investigated a gap structure in a newly discovered superconductor, MgB2, through measurement of the (11)B nuclear spin-lattice relaxation rate, (11)(1/T(1)). (11)(1/T(1)) is proportional to the temperature (T) in the normal state, and decreases exponentially in the superconducting (SC) state, revealing a tiny coherence peak just below T(c). The T dependence of 1/T(1) in the SC state can be accounted for by an s-wave SC model with a large gap size of 2Delta/k(B)T(c) approximately 5 which suggests it is in a strong-coupling regime.

  1. Magnetic and Superconducting Materials at High Pressures

    Energy Technology Data Exchange (ETDEWEB)

    Struzhkin, Viktor V. [Carnegie Inst. of Washington, Washington, DC (United States)

    2015-03-24

    transitions from magnetic to nonmagnetic phases in a broad pressure-temperature range; using X-ray methods including the newly developed RIXS high-pressure technique to explore pressure-tuned electronic excitations in strongly correlated 3d-materials; and advancing transport and magnetic techniques for measurements on small samples at very high pressures in a wide temperature range, with the application of focused ion beam technology and photolithography tailored to the design of microcircuits down to a nanoscale size, thus expanding the horizon in the search for novel physical phenomena at ultrahigh pressures. Apply new optical magnetic sensing techniques with NV- centers in diamond to detect superconductivity and magnetic transitions with unprecedented spatial resolution.

  2. Interface high-temperature superconductivity

    Science.gov (United States)

    Wang, Lili; Ma, Xucun; Xue, Qi-Kun

    2016-12-01

    Cuprate high-temperature superconductors consist of two quasi-two-dimensional (2D) substructures: CuO2 superconducting layers and charge reservoir layers. The superconductivity is realized by charge transfer from the charge reservoir layers into the superconducting layers without chemical dopants and defects being introduced into the latter, similar to modulation-doping in the semiconductor superlattices of AlGaAs/GaAs. Inspired by this scheme, we have been searching for high-temperature superconductivity in ultra-thin films of superconductors epitaxially grown on semiconductor/oxide substrates since 2008. We have observed interface-enhanced superconductivity in both conventional and unconventional superconducting films, including single atomic layer films of Pb and In on Si substrates and single unit cell (UC) films of FeSe on SrTiO3 (STO) substrates. The discovery of high-temperature superconductivity with a superconducting gap of ∼20 meV in 1UC-FeSe/STO has stimulated tremendous interest in the superconductivity community, for it opens a new avenue for both raising superconducting transition temperature and understanding the pairing mechanism of unconventional high-temperature superconductivity. Here, we review mainly the experimental progress on interface-enhanced superconductivity in the three systems mentioned above with emphasis on 1UC-FeSe/STO, studied by scanning tunneling microscopy/spectroscopy, angle-resolved photoemission spectroscopy and transport experiments. We discuss the roles of interfaces and a possible pairing mechanism inferred from these studies.

  3. Fiber Optic Cryogenic Sensors for Superconducting Magnets and Superconducting Power Transmission lines at CERN

    CERN Document Server

    Chiuchiolo, A; Cusano, A; Bajko, M; Perez, J C; Bajas, H; Giordano, M; Breglio, G; Palmieri, L

    2014-01-01

    The design, fabrication and tests of a new generation of superconducting magnets for the upgrade of the LHC require the support of an adequate, robust and reliable sensing technology. The use of Fiber Optic Sensors is becoming particularly challenging for applications in extreme harsh environments such as ultra-low temperatures, high electromagnetic fields and strong mechanical stresses offering perspectives for the development of technological innovations in several applied disciplines.

  4. Overview of Superconductivity and Challenges in Applications

    CERN Document Server

    Flükiger, Rene

    2012-01-01

    Considerable progress has been achieved during the last few decades in the various fields of applied superconductivity, while the related low temperature technology has reached a high level. Magnetic resonance imaging (MRI) and nuclear magnetic resonance (NMR) are so far the most successful applications, with tens of thousands of units worldwide, but high potential can also be recognized in the energy sector, with high energy cables, transformers, motors, generators for wind turbines, fault current limiters and devices for magnetic energy storage. A large number of magnet and cable prototypes have been constructed, showing in all cases high reliability. Large projects involving the construction of magnets, solenoids as well as dipoles and quadrupoles are described in the present book. A very large project, the LHC, is currently in operation, demonstrating that superconductivity is a reliable technology, even in a device of unprecedented high complexity. A project of similar complexity is ITER, a fusion device...

  5. Manufacturing and Testing of Accelerator Superconducting Magnets

    CERN Document Server

    Rossi, L

    2014-01-01

    Manufacturing of superconducting magnet for accelerators is a quite complex process that is not yet fully industrialized. In this paper, after a short history of the evolution of the magnet design and construction, we review the main characteristics of the accelerator magnets having an impact on the construction technology. We put in evidence how the design and component quality impact on construction and why the final product calls for a total-quality approach. LHC experience is widely discussed and main lessons are spelled out. Then the new Nb3Sn technology, under development for the next generation magnet construction, is outlined. Finally, we briefly review the testing procedure of accelerator superconducting magnets, underlining the close connection with the design validation and with the manufacturing process.

  6. Connectivity and superconductivity

    CERN Document Server

    Rubinstein, Jacob

    2000-01-01

    The motto of connectivity and superconductivity is that the solutions of the Ginzburg--Landau equations are qualitatively influenced by the topology of the boundaries, as in multiply-connected samples. Special attention is paid to the "zero set", the set of the positions (also known as "quantum vortices") where the order parameter vanishes. The effects considered here usually become important in the regime where the coherence length is of the order of the dimensions of the sample. It takes the intuition of physicists and the awareness of mathematicians to find these new effects. In connectivity and superconductivity, theoretical and experimental physicists are brought together with pure and applied mathematicians to review these surprising results. This volume is intended to serve as a reference book for graduate students and researchers in physics or mathematics interested in superconductivity, or in the Schrödinger equation as a limiting case of the Ginzburg--Landau equations.

  7. Large Superconducting Magnet Systems

    CERN Document Server

    Védrine, P.

    2014-07-17

    The increase of energy in accelerators over the past decades has led to the design of superconducting magnets for both accelerators and the associated detectors. The use of Nb−Ti superconducting materials allows an increase in the dipole field by up to 10 T compared with the maximum field of 2 T in a conventional magnet. The field bending of the particles in the detectors and generated by the magnets can also be increased. New materials, such as Nb3Sn and high temperature superconductor (HTS) conductors, can open the way to higher fields, in the range 13–20 T. The latest generations of fusion machines producing hot plasma also use large superconducting magnet systems.

  8. Concepts relating magnetic interactions, intertwined electronic orders, and strongly correlated superconductivity.

    Science.gov (United States)

    Davis, J C Séamus; Lee, Dung-Hai

    2013-10-29

    Unconventional superconductivity (SC) is said to occur when Cooper pair formation is dominated by repulsive electron-electron interactions, so that the symmetry of the pair wave function is other than an isotropic s-wave. The strong, on-site, repulsive electron-electron interactions that are the proximate cause of such SC are more typically drivers of commensurate magnetism. Indeed, it is the suppression of commensurate antiferromagnetism (AF) that usually allows this type of unconventional superconductivity to emerge. Importantly, however, intervening between these AF and SC phases, intertwined electronic ordered phases (IP) of an unexpected nature are frequently discovered. For this reason, it has been extremely difficult to distinguish the microscopic essence of the correlated superconductivity from the often spectacular phenomenology of the IPs. Here we introduce a model conceptual framework within which to understand the relationship between AF electron-electron interactions, IPs, and correlated SC. We demonstrate its effectiveness in simultaneously explaining the consequences of AF interactions for the copper-based, iron-based, and heavy-fermion superconductors, as well as for their quite distinct IPs.

  9. Superconductivity on the density-wave background with soliton-wall structure

    Science.gov (United States)

    Grigoriev, P. D.

    2009-03-01

    Superconductivity (SC) may microscopically coexist with density wave (DW) when the nesting of the Fermi surface (FS) is not perfect. There are, at least, two possible microscopic structures of a DW state with quasi-particle states remaining on the Fermi level and leading to the Cooper instability: (i) the soliton-wall phase and (ii) the small ungapped FS pockets. The dispersion of such quasi-particle states strongly differs from that without DW, and so do the properties of SC on the DW background. The upper critical field H in such an SC state strongly increases as the system approaches the critical pressure, where SC first appears. H may considerably exceed its typical value without DW and has unusual upward curvature as function of temperature. The results obtained explain the experimental observations in layered organic superconductors (TMTSF)2PF6 and α-(BEDT-TTF)2KHg(SCN)4.

  10. Preliminary Tests Of The Decris-sc Ion Source

    CERN Document Server

    Efremov, A; Bechterev, V; Bogomolov, S L; Bondarenko, P G; Datskov, V I; Dmitriev, S; Drobin, V; Lebedev, A; Leporis, M; Malinowski, H; Nikiforov, A; Paschenko, S V; Seleznev, V; Shishov, Yu A; Smirnov, Yu; Tsvineva, G; Yakovlev, B; Yazvitsky, N Yu

    2004-01-01

    A new "liquid He-free" superconducting Electron Cyclotron Resonance Ion Source DECRIS-SC, to be used as injector for the IC-100 small cyclotron, has been designed by FLNR and LHE JINR. The main feature is that a compact refrigerator of Gifford-McMahon type is used to cool the solenoid coils. For the reason of very small cooling power at 4.2 K (about 1 W) our efforts were to optimize the magnetic structure and minimize an external heating of the coils. The maximum magnetic field strength is 3 T and 2 T in injection and extraction region respectively. For the radial plasma confinement a hexapole made of NdFeB permanent magnet is used. The source will be capable of ECR plasma heating using different frequencies (14 GHz or 18 GHz). To be able to deliver usable intensities of solids, the design is also allow axial access for evaporation oven and metal samples using the plasma sputtering technique. Very preliminary results of the source test are presented.

  11. Failed theories of superconductivity

    CERN Document Server

    Schmalian, Joerg

    2010-01-01

    Almost half a century passed between the discovery of superconductivity by Kammerlingh Onnes and the theoretical explanation of the phenomenon by Bardeen, Cooper and Schrieffer. During the intervening years the brightest minds in theoretical physics tried and failed to develop a microscopic understanding of the effect. A summary of some of those unsuccessful attempts to understand superconductivity not only demonstrates the extraordinary achievement made by formulating the BCS theory, but also illustrates that mistakes are a natural and healthy part of the scientific discourse, and that inapplicable, even incorrect theories can turn out to be interesting and inspiring.

  12. Superconducting magnetic quadrupole

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J.W.; Shepard, K.W.; Nolen, J.A.

    1995-08-01

    A design was developed for a 350 T/m, 2.6-cm clear aperture superconducting quadrupole focussing element for use in a very low q/m superconducting linac as discussed below. The quadrupole incorporates holmium pole tips, and a rectangular-section winding using standard commercially-available Nb-Ti wire. The magnet was modeled numerically using both 2D and 3D codes, as a basis for numerical ray tracing using the quadrupole as a linac element. Components for a prototype singlet are being procured during FY 1995.

  13. Fingerprints of Mott Superconductivity

    Institute of Scientific and Technical Information of China (English)

    王强华

    2003-01-01

    We improve a previous theory of doped Mott insulators with duality between pairing and magnetism by a further duality transform. As the result we obtained a quantum Ginzburg-Landau theory describing the Cooper pair condensate and the dual of spin condensate. We address the superconductivity by doping a Mott insulator,which we call the Mott superconductivity. Some fingerprints of such novelty in cuprates are the scaling between neutron resonance energy and superfluid density, and the induced quantized spin moment by vortices or Zn impurity (together with circulating charge super-current to be checked by experiments).

  14. Superconducting submillimeter and millimeter wave detectors

    Energy Technology Data Exchange (ETDEWEB)

    Nahum, M.

    1992-10-20

    The series of projects described in this dissertation was stimulated by the discovery of high temperature superconductivity. Our goal was to develop useful applications which would be competitive with the current state of technology. The high-[Tc] microbolometer was developed into the most sensitive direct detector of millimeter waves, when operated at liquid nitrogen temperatures. The thermal boundary resistance of thin YBa[sub 2]Cu[sub 3]0[sub 7-[delta

  15. Lattice parameters guide superconductivity in iron-arsenides

    Science.gov (United States)

    Konzen, Lance M. N.; Sefat, Athena S.

    2017-03-01

    The discovery of superconducting materials has led to their use in technological marvels such as magnetic-field sensors in MRI machines, powerful research magnets, short transmission cables, and high-speed trains. Despite such applications, the uses of superconductors are not widespread because they function much below room-temperature, hence the costly cooling. Since the discovery of Cu- and Fe-based high-temperature superconductors (HTS), much intense effort has tried to explain and understand the superconducting phenomenon. While no exact explanations are given, several trends are reported in relation to the materials basis in magnetism and spin excitations. In fact, most HTS have antiferromagnetic undoped ‘parent’ materials that undergo a superconducting transition upon small chemical substitutions in them. As it is currently unclear which ‘dopants’ can favor superconductivity, this manuscript investigates crystal structure changes upon chemical substitutions, to find clues in lattice parameters for the superconducting occurrence. We review the chemical substitution effects on the crystal lattice of iron-arsenide-based crystals (2008 to present). We note that (a) HTS compounds have nearly tetragonal structures with a-lattice parameter close to 4 Å, and (b) superconductivity can depend strongly on the c-lattice parameter changes with chemical substitution. For example, a decrease in c-lattice parameter is required to induce ‘in-plane’ superconductivity. The review of lattice parameter trends in iron-arsenides presented here should guide synthesis of new materials and provoke theoretical input, giving clues for HTS.

  16. Superconducting cables: Long distance energy transmission. (Latest citations from the NTIS bibliographic database). Published Search

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    The bibliography contains citations concerning the design, development, and evaluation of superconducting cables and power transmission lines for long distance energy transmission. Topics include methods of cryogenic refrigeration and electrical insulation, fabrication and development of niobium alloy conductors, energy loss analysis, and dielectric design of superconducting power transmission systems. Government research reports on superconducting technology for electric power transmission and distribution are also reviewed.(Contains 50-250 citations and includes a subject term index and title list.) (Copyright NERAC, Inc. 1995)

  17. Sc20C60: a volleyballene

    Science.gov (United States)

    Wang, Jing; Ma, Hong-Man; Liu, Ying

    2016-06-01

    An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable.An exceptionally stable hollow cage containing 20 scandium atoms and 60 carbon atoms has been identified. This Sc20C60 molecular cluster has a Th point group symmetry and a volleyball-like shape that we refer to below as ``Volleyballene''. Electronic structure analysis shows that the formation of delocalized π bonds between Sc atoms and the neighboring pentagonal rings made of carbon atoms is crucial for stabilizing the cage structure. A relatively large HOMO-LUMO gap (~1.4 eV) was found. The results of vibrational frequency analysis and molecular dynamics simulations both demonstrate that this Volleyballene molecule is exceptionally stable. Electronic supplementary information (ESI) available: Sc20C60: a Volleyballene_SI. See DOI: 10.1039/c5nr07784b

  18. Advanced Manufacturing of Superconducting Magnets

    Science.gov (United States)

    Senti, Mark W.

    1996-01-01

    The development of specialized materials, processes, and robotics technology allows for the rapid prototype and manufacture of superconducting and normal magnets which can be used for magnetic suspension applications. Presented are highlights of the Direct Conductor Placement System (DCPS) which enables automatic design and assembly of 3-dimensional coils and conductor patterns using LTS and HTS conductors. The system enables engineers to place conductors in complex patterns with greater efficiency and accuracy, and without the need for hard tooling. It may also allow researchers to create new types of coils and patterns which were never practical before the development of DCPS. The DCPS includes a custom designed eight-axis robot, patented end effector, CoilCAD(trademark) design software, RoboWire(trademark) control software, and automatic inspection.

  19. Undoped high-Tc superconductivity in T'-La1.8Eu0.2CuO4+δ revealed by 63,65Cu and 139La NMR: Bulk superconductivity and antiferromagnetic fluctuations

    Science.gov (United States)

    Fukazawa, Hideto; Ishiyama, Seiya; Goto, Masato; Kanamaru, Shuhei; Ohashi, Kohki; Kawamata, Takayuki; Adachi, Tadashi; Hirata, Michihiro; Sasaki, Takahiko; Koike, Yoji; Kohori, Yoh

    2017-10-01

    We performed 63,65Cu and 139La NMR measurements of T'-La1.8Eu0.2CuO4+δ (T'-LECO) with the Nd2CuO4-type structure (so-called T'-structure). As a result, we detected the 63,65Cu NMR signal under finite magnetic fields and found superconductivity without antiferromagnetic (AF) order only in the reduced T'-LECO, where excess apical oxygen atoms are properly removed. This indicates that the intrinsic ground state of the ideal T'-LECO is a paramagnetic and superconducting (SC) state. Below Tc, the Knight shift was found to rapidly decrease, which indicates the emergence of bulk superconductivity due to spin-singlet Cooper pairs in the reduced T'-LECO. In the SC state of the reduced T'-LECO, moreover, a characteristic temperature dependence of the spin-lattice relaxation rate 1/T1 was observed, which implies the existence of nodal lines in the SC gap. These findings suggest that the superconductivity in the reduced T'-LECO probably has d-wave symmetry. In the normal state of the reduced T'-LECO, on the other hand, AF fluctuations were found to exist from the temperature dependence of 1/T1T, though no clear pseudogap behavior was observed. This suggests that the AF correlation plays a key role in the superconductivity of undoped high-Tc cuprate superconductors with the T'-structure.

  20. Effects of Surface Electron Doping and Substrate on the Superconductivity of Epitaxial FeSe Films.

    Science.gov (United States)

    Zhang, W H; Liu, X; Wen, C H P; Peng, R; Tan, S Y; Xie, B P; Zhang, T; Feng, D L

    2016-03-09

    Superconductivity in FeSe is greatly enhanced in films grown on SrTiO3 substrates, although the mechanism behind remains unclear. Recently, surface potassium (K) doping has also proven able to enhance the superconductivity of FeSe. Here, by using scanning tunneling microscopy, we compare the K doping dependence of the superconductivity in FeSe films grown on two substrates: SrTiO3 (001) and graphitized SiC (0001). For thick films (20 unit cells (UC)), the optimized superconducting (SC) gaps are of similar size (∼9 meV) regardless of the substrate. However, when the thickness is reduced to a few UC, the optimized SC gap is increased up to ∼15 meV for films on SrTiO3, whereas it remains unchanged for films on SiC. This clearly indicates that the FeSe/SrTiO3 interface can further enhance the superconductivity, beyond merely doping electrons. Intriguingly, we found that this interface enhancement decays exponentially as the thickness increases, with a decay length of 2.4 UC, which is much shorter than the length scale for relaxation of the lattice strain, pointing to interfacial electron-phonon coupling as the likely origin.

  1. Spin-orbit-coupled superconductivity.

    Science.gov (United States)

    Lo, Shun-Tsung; Lin, Shih-Wei; Wang, Yi-Ting; Lin, Sheng-Di; Liang, C-T

    2014-06-25

    Superconductivity and spin-orbit (SO) interaction have been two separate emerging fields until very recently that the correlation between them seemed to be observed. However, previous experiments concerning SO coupling are performed far beyond the superconducting state and thus a direct demonstration of how SO coupling affects superconductivity remains elusive. Here we investigate the SO coupling in the critical region of superconducting transition on Al nanofilms, in which the strength of disorder and spin relaxation by SO coupling are changed by varying the film thickness. At temperatures T sufficiently above the superconducting critical temperature T(c), clear signature of SO coupling reveals itself in showing a magneto-resistivity peak. When T superconductivity. By studying such magneto-resistivity peaks under different strength of spin relaxation, we highlight the important effects of SO interaction on superconductivity.

  2. Application concepts of small regenerative cryocoolers in superconducting magnet systems

    Science.gov (United States)

    van der Laan, M. T. G.; Tax, R. B.; ten Kate, H. H. J.

    Superconducting magnets are in growing use outside laboratories for example MRI scanners in hospitals. Other applications under development are magnet systems for separation, levitated trains and ship propulsion. The application of cryocoolers can make these systems more practical. Interfacing these cryocoolers to the magnets can be designed in several different ways. The four basic methods will be dealt with. Test results of a realized GM cryocooler-SC magnet system will be shown. It handles about a 1:3 scale MRI magnet of which one of the six coils has been successfully tested at temperatures between 10 and 14 K.

  3. Heat Transfer in the LHC Main Superconducting Bus Bars

    CERN Document Server

    Granieri, P P; Richter, D

    2011-01-01

    CERN is performing a systematic analysis of the interconnecting bus bars of the Large Hadron Collider (LHC) main magnets. Their thermal, electrical, mechanical and hydraulic performances are addressed. In the frame of these studies, the heat transfer between the main superconducting (SC) bus bars and the surrounding He bath is investigated. It represents a key parameter in the comprehension of the bus bars stability and quench propagation mechanisms, thus crucial for the analysis of the 2008 incident which was triggered by a defective bus bars joint. This paper reports on the experimental tests and relative analysis aiming at describing the thermal behavior of the LHC main bus bars.

  4. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  5. Hybrid superconducting neutron detectors

    Energy Technology Data Exchange (ETDEWEB)

    Merlo, V.; Lucci, M.; Ottaviani, I. [Dipartimento di Fisica, Università Tor Vergata, Via della Ricerca Scientifica, I-00133 Roma (Italy); Salvato, M.; Cirillo, M. [Dipartimento di Fisica, Università Tor Vergata, Via della Ricerca Scientifica, I-00133 Roma (Italy); CNR SPIN Salerno, Università di Salerno, Via Giovanni Paolo II, n.132, 84084 Fisciano (Italy); Scherillo, A. [Science and Technology Facility Council, ISIS Facility Chilton, Didcot, Oxfordshire OX11 0QX (United Kingdom); Celentano, G. [ENEA Frascati Research Centre, Via. E. Fermi 45, 00044 Frascati (Italy); Pietropaolo, A., E-mail: antonino.pietropaolo@enea.it [ENEA Frascati Research Centre, Via. E. Fermi 45, 00044 Frascati (Italy); Mediterranean Institute of Fundamental Physics, Via Appia Nuova 31, 00040 Marino, Roma (Italy)

    2015-03-16

    A neutron detection concept is presented that is based on superconductive niobium (Nb) strips coated by a boron (B) layer. The working principle of the detector relies on the nuclear reaction, {sup 10}B + n → α + {sup 7}Li, with α and Li ions generating a hot spot on the current-biased Nb strip which in turn induces a superconducting-normal state transition. The latter is recognized as a voltage signal which is the evidence of the incident neutron. The above described detection principle has been experimentally assessed and verified by irradiating the samples with a pulsed neutron beam at the ISIS spallation neutron source (UK). It is found that the boron coated superconducting strips, kept at a temperature T = 8 K and current-biased below the critical current I{sub c}, are driven into the normal state upon thermal neutron irradiation. As a result of the transition, voltage pulses in excess of 40 mV are measured while the bias current can be properly modulated to bring the strip back to the superconducting state, thus resetting the detector. Measurements on the counting rate of the device are presented and the basic physical features of the detector are discussed.

  6. Levitation Kits Demonstrate Superconductivity.

    Science.gov (United States)

    Worthy, Ward

    1987-01-01

    Describes the "Project 1-2-3" levitation kit used to demonstrate superconductivity. Summarizes the materials included in the kit. Discusses the effect demonstrated and gives details on how to obtain kits. Gives an overview of the documentation that is included. (CW)

  7. LEP superconducting cavity

    CERN Multimedia

    1995-01-01

    Engineers work in a clean room on one of the superconducting cavities for the upgrade to the LEP accelerator, known as LEP-2. The use of superconductors allow higher electric fields to be produced so that higher beam energies can be reached.

  8. Niobium superconducting cavity

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    This 5-cell superconducting cavity, made from bulk-Nb, stems from the period of general studies, not all directed towards direct use at LEP. This one is dimensioned for 1.5 GHz, the frequency used at CEBAF and also studied at Saclay (LEP RF was 352.2 MHz). See also 7908227, 8007354, 8209255, 8210054, 8312339.

  9. LHC Superconducting Magnets

    CERN Document Server

    Jean Leyder

    2000-01-01

    The LHC is the next step in CERN's quest to unravel the mysteries of the Universe. It will accelerate protons to energies never before achieved in laboratories, and to hold them on course it will use powerful superconducting magnets on an unprecedented scale.

  10. Coupled superconducting flux qubits

    NARCIS (Netherlands)

    Plantenberg, J.H.

    2007-01-01

    This thesis presents results of theoretical and experimental work on superconducting persistent-current quantum bits. These qubits offer an attractive route towards scalable solid-state quantum computing. The focus of this work is on the gradiometer flux qubit which has a special geometric design, t

  11. Superconducting Quantum Circuits

    NARCIS (Netherlands)

    Majer, J.B.

    2002-01-01

    This thesis describes a number of experiments with superconducting cir- cuits containing small Josephson junctions. The circuits are made out of aluminum islands which are interconnected with a very thin insulating alu- minum oxide layer. The connections form a Josephson junction. The current trough

  12. Checking BEBC superconducting magnet

    CERN Multimedia

    1974-01-01

    The superconducting coils of the magnet for the 3.7 m Big European Bubble Chamber (BEBC) had to be checked, see Annual Report 1974, p. 60. The photo shows a dismantled pancake. By December 1974 the magnet reached again the field design value of 3.5 T.

  13. LHC superconducting strand

    CERN Multimedia

    Patrice Loiez

    1999-01-01

    This cross-section through a strand of superconducting matieral as used in the LHC shows the 8000 Niobium-Titanium filaments embedded like a honeycomb in copper. When cooled to 1.9 degrees above absolute zero in the LHC accelerator, these filaments will have zero resistance and so will carry a high electric current with no energy loss.

  14. Nonlinearities in Microwave Superconductivity

    OpenAIRE

    Ledenyov, Dimitri O.; Ledenyov, Viktor O.

    2012-01-01

    The research is focused on the modeling of nonlinear properties of High Temperature Superconducting (HTS) thin films, using Bardeen, Cooper, Schrieffer and Lumped Element Circuit theories, with purpose to enhance microwave power handling capabilities of microwave filters and optimize design of microwave circuits in micro- and nano- electronics.

  15. Coupled superconducting flux qubits

    NARCIS (Netherlands)

    Plantenberg, J.H.

    2007-01-01

    This thesis presents results of theoretical and experimental work on superconducting persistent-current quantum bits. These qubits offer an attractive route towards scalable solid-state quantum computing. The focus of this work is on the gradiometer flux qubit which has a special geometric design, t

  16. Applications of Superconductivity

    Science.gov (United States)

    Goodkind, John M.

    1971-01-01

    Presents a general review of current practical applications of the properties of superconducters. The devices are classified into groups according to the property that is of primary importance. The article is inteded as a first introduction for students and professionals. (Author/DS)

  17. Levitation Kits Demonstrate Superconductivity.

    Science.gov (United States)

    Worthy, Ward

    1987-01-01

    Describes the "Project 1-2-3" levitation kit used to demonstrate superconductivity. Summarizes the materials included in the kit. Discusses the effect demonstrated and gives details on how to obtain kits. Gives an overview of the documentation that is included. (CW)

  18. ISR Superconducting Quadrupoles

    CERN Multimedia

    1977-01-01

    Michel Bouvier is preparing for curing the 6-pole superconducting windings inbedded in the cylindrical wall separating liquid helium from vacuum in the quadrupole aperture. The heat for curing the epoxy glue was provided by a ramp of infrared lamps which can be seen above the slowly rotating cylinder. See also 7703512X, 7702690X.

  19. High temperature interface superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Gozar, A., E-mail: adrian.gozar@yale.edu [Yale University, New Haven, CT 06511 (United States); Bozovic, I. [Yale University, New Haven, CT 06511 (United States); Brookhaven National Laboratory, Upton, NY 11973 (United States)

    2016-02-15

    Highlight: • This review article covers the topic of high temperature interface superconductivity. • New materials and techniques used for achieving interface superconductivity are discussed. • We emphasize the role played by the differences in structure and electronic properties at the interface with respect to the bulk of the constituents. - Abstract: High-T{sub c} superconductivity at interfaces has a history of more than a couple of decades. In this review we focus our attention on copper-oxide based heterostructures and multi-layers. We first discuss the technique, atomic layer-by-layer molecular beam epitaxy (ALL-MBE) engineering, that enabled High-T{sub c} Interface Superconductivity (HT-IS), and the challenges associated with the realization of high quality interfaces. Then we turn our attention to the experiments which shed light on the structure and properties of interfacial layers, allowing comparison to those of single-phase films and bulk crystals. Both ‘passive’ hetero-structures as well as surface-induced effects by external gating are discussed. We conclude by comparing HT-IS in cuprates and in other classes of materials, especially Fe-based superconductors, and by examining the grand challenges currently laying ahead for the field.

  20. Transmission Level High Temperature Superconducting Fault Current Limiter

    Energy Technology Data Exchange (ETDEWEB)

    Stewart, Gary [SuperPower, Inc., Schenectady, NY (United States)

    2016-10-05

    The primary objective of this project was to demonstrate the feasibility and reliability of utilizing high temperature superconducting (HTS) materials in a Transmission Level Superconducting Fault Current Limiter (SFCL) application. During the project, the type of high temperature superconducting material used evolved from 1st generation (1G) BSCCO-2212 melt cast bulk high temperature superconductors to 2nd generation (2G) YBCO based high temperature superconducting tape. The SFCL employed SuperPower's “Matrix” technology that offers modular features to enable scale up to transmission voltage levels. The SFCL consists of individual modules that contain elements and parallel inductors that assist in carrying the current during the fault. A number of these modules are arranged in an m x n array to form the current limiting matrix.

  1. 13 kA Superconducting Busbars Manufacturing Process

    CERN Document Server

    Principe, R; Fornasiere, E

    2012-01-01

    In the LHC, the superconducting Main Bending magnets and Quadrupole magnets are series-connected electrically in different excitation circuits by means of superconducting busbars, carrying a maximum current of 13 kA. These superconducting busbars consist of a superconducting Rutherford cable thermally and electrically coupled to a copper section all along the length. The function of the copper section is essentially to provide an alternative path for the magnet current in case of resistive transition. The production of these components was originally outsourced. The decision to import the technology at CERN led to a global re-engineering of the standard process. Although based on the procedures adopted during the LHC construction, a few modifications and improvements have been implemented, profiting of the experience gained in the last few years. This document details the manufacturing process of the 13 kA busbars as it is actually performed at CERN, emphasizing the new solutions adopted during the first mon...

  2. Transmission Level High Temperature Superconducting Fault Current Limiter

    Energy Technology Data Exchange (ETDEWEB)

    Stewart, Gary [SuperPower, Inc., Schenectady, NY (United States)

    2016-10-05

    The primary objective of this project was to demonstrate the feasibility and reliability of utilizing high-temperature superconducting (HTS) materials in a Transmission Level Superconducting Fault Current Limiter (SFCL) application. During the project, the type of high-temperature superconducting material used evolved from 1st generation (1G) BSCCO-2212 melt cast bulk high-temperature superconductors to 2nd generation (2G) YBCO-based high-temperature superconducting tape. The SFCL employed SuperPower's “Matrix” technology, that offers modular features to enable scale up to transmission voltage levels. The SFCL consists of individual modules that contain elements and parallel inductors that assist in carrying the current during the fault. A number of these modules are arranged in an m x n array to form the current-limiting matrix.

  3. Universal limiting pressure for a three-flavor color superconducting PNJL model phase diagram

    CERN Document Server

    Ayriyan, A; Blaschke, D; Lastowiecki, R

    2016-01-01

    The phase diagram of a three-flavor Polyakov-loop Nambu-Jona-Lasinio model is analyzed for the case of isospin symmetric matter with color superconducting phases. The coexistence of chiral symmetry breaking and two-flavor color superconductivity (2SC phase) and a thermodynamic instability due to the implementation of a color neutrality constraint is observed. It is suggested to use a universal hadronization pressure to estimate the phase border between hadronic and quark-gluon plasma phases. Trajectories of constant entropy per baryon are analyzed for conditions appropriate for heavy-ion collisions in the NICA-FAIR energy range.

  4. Recrystallization and Morphology of Microstructure in Al-Sc Alloys

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun; Zhang Zonghua

    2007-01-01

    Minor addition of Sc to aluminum results in the rapid precipitation of homogeneously distributed Al3Sc dispersoids. The presence of Al3Sc dispersoids is more effective recrystallization inhibitors. Our work established the precipitation of homogeneously distributed Al3Sc dispersoids, which are coherent with the matrix, have the L12 structure. It was also established that the addition of Sc was effective in improving the recrystallization resistance.

  5. K2SC: K2 Systematics Correction

    Science.gov (United States)

    Aigrain, Suzanne; Parviainen, Hannu; Pope, Benjamin

    2016-05-01

    K2SC (K2 Systematics Correction) models instrumental systematics and astrophysical variability in light curves from the K2 mission. It enables the user to remove both position-dependent systematics and time-dependent variability (e.g., for transit searches) or to remove systematics while preserving variability (for variability studies). K2SC automatically computes estimates of the period, amplitude and evolution timescale of the variability for periodic variables and can be run on ASCII and FITS light curve files. Written in Python, this pipeline requires NumPy, SciPy, MPI4Py, Astropy (ascl:1304.002), and George (ascl:1511.015).

  6. Norma Audio Revo SC-/PA-150

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Norma audio是意大利一间顶级HI-Fi音响器材生产商。这款IRevo SC-2/PA-150为正是公司旗下的一款高端型号产品。其中,Revo SC-2前置放大器的放大电路以低噪音、高速和宽频作为设计重点,能反映出音频信号中的每一个细节。

  7. A superconducting large-angle magnetic suspension. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Downer, J.R.; Anastas, G.V. Jr.; Bushko, D.A.; Flynn, F.J.; Goldie, J.H.; Gondhalekar, V.; Hawkey, T.J.; Hockney, R.L.; Torti, R.P.

    1992-12-01

    SatCon Technology Corporation has completed a Small Business Innovation Research (SBIR) Phase 2 program to develop a Superconducting Large-Angle Magnetic Suspension (LAMS) for the NASA Langley Research Center. The Superconducting LAMS was a hardware demonstration of the control technology required to develop an advanced momentum exchange effector. The Phase 2 research was directed toward the demonstration for the key technology required for the advanced concept CMG, the controller. The Phase 2 hardware consists of a superconducting solenoid ('source coils') suspended within an array of nonsuperconducting coils ('control coils'), a five-degree-of-freedom positioning sensing system, switching power amplifiers, and a digital control system. The results demonstrated the feasibility of suspending the source coil. Gimballing (pointing the axis of the source coil) was demonstrated over a limited range. With further development of the rotation sensing system, enhanced angular freedom should be possible.

  8. CaFeAs2: A staggered intercalation of quantum spin Hall and high-temperature superconductivity

    Science.gov (United States)

    Wu, Xianxin; Qin, Shengshan; Liang, Yi; Le, Congcong; Fan, Heng; Hu, Jiangping

    2015-02-01

    We predict that CaFeAs2, a newly discovered iron-based high-temperature (Tc) superconductor, is a staggered intercalation compound that integrates topological quantum spin Hall (QSH) and superconductivity (SC). CaFeAs2 has a structure with staggered CaAs and FeAs layers. While the FeAs layers are known to be responsible for high Tc superconductivity, we show that with spin orbital coupling each CaAs layer is a Z2 topologically nontrivial two-dimensional QSH insulator and the bulk is a three-dimensional weak topological insulator. In the superconducting state, the edge states in the CaAs layer are natural one-dimensional topological superconductors. The staggered intercalation of QSH and SC provides us a unique opportunity to realize and explore physics, such as Majorana modes and Majorana fermion chains.

  9. Cryogenic, superconducting and rf results of the SRFQ2 of PIAVE

    Indian Academy of Sciences (India)

    A M Porcellato; G Bisoffi; V Andreev; G Bassato; G Bezzon; S Canella; F Chiurlotto; A Lombardi; L Bertazzo; D Conventi; G Galeazzi; S Marigo; V Palmieri; F Poletto; T Shirai; S Y Stark; F Stivanello

    2002-12-01

    SRFQ2 is the second RFQ superconducting (SC) structure of PIAVE, the positive ion injector of the SC LINAC for heavy ions ALPI, in operation at Legnaro. During 2001, SRFQ2 was extensively tested at cryogenic temperature reaching its design performance, i.e., 280 kV inter-electrode voltage (equivalent to 25 MV/m peak surface electrical field) at 7 W dissipated power. This paper describes the treatments, the main difficulties arisen during the tests, the way they were overcome and the measurement sequences that allowed the characterization of SRFQ2 behavior. A brief description of future programs is also given.

  10. Superconductivity and non-Fermi liquid behavior on the border of itinerant ferromagnetism

    Energy Technology Data Exchange (ETDEWEB)

    Ritz, Robert

    2013-10-04

    When magnetic order is suppressed under pressure, a superconducting (SC) phase emerges in the ferromagnet UGe{sub 2} and an extended non-Fermi liquid (NFL) regime is observed in the helimagnet MnSi. We report thermal expansion measurements of UGe{sub 2} under pressure by means of neutron Larmor diffraction. We find a new, putatively non-magnetic transition at the temperature TL at pressures close to the SC phase. In MnSi we report Hall effect measurements under pressure. We find a topological Hall effect, as the signature of a topologically non-trivial spin texture, above the critical pressure in the NFL regime.

  11. Competing ferromagnetism and superconductivity on FeAs layers in EuFe2(As0.73P0.27)2.

    Science.gov (United States)

    Ahmed, Aamir; Itou, M; Xu, Shenggao; Xu, Zhu'an; Cao, Guanghan; Sakurai, Y; Penner-Hahn, James; Deb, Aniruddha

    2010-11-12

    We have measured the spin-polarized electron momentum density distributions of EuFe2(As0.73P0.27)2 by magnetic Compton scattering (MCS) measurements. For the first time, we show direct evidence of competing ferromagnetism and superconductivity (SC) on FeAs layers in this iron pnictide system. The MCS orbitalwise decomposition of the density distributions reveals that between 16 and 19 K, the spin-polarized Fe-3d character is enhanced (as the ferromagnetic character supersedes superconducting character), where the resistivity shows a maximum, reentrant SC-like peak, at 18 K. The spin polarization of the Fe-3d orbital, enhanced by ferromagnetic Eu ions, suppresses the SC around 18 K, while at other temperatures the system indeed exhibits SC where the Fe-3d spin polarization is suppressed or collapses.

  12. Novel superconductivity in CeIr(In{sub 1-x}Cd{sub x}){sub 5} studied by In-NQR measurements

    Energy Technology Data Exchange (ETDEWEB)

    Yashima, M; Taniguchi, S; Tagami, N; Mukuda, H; Kitaoka, Y [Department of Materials Engineering Science, Osaka University, Osaka 560-8531 (Japan); Ota, Y; Shishido, H; Settai, R; Onuki, Y, E-mail: yashima@nmr.mp.es.osaka-u.ac.j [Department of Physics, Osaka University, Osaka 560-0043 (Japan)

    2010-01-15

    We report the superconducting characters in CeIrIns studied by In-NQR measurements under pressure (P). In CeCoIn{sub 5} and CeRhIn{sub 5}, the occurrence of superconductivity (SC) is related with the antiferrmagnetic spin fluctuations (AFM-SFs) originating from the antiferromagntic quantum-critical point (AFM-QCP). The high-T{sub c} SC (T{sub cmax} > 2 K) is realized in both compounds. However, in CeIrIn{sub 5} which is apart from the AFM-QCP, SC occurs even without AFM-SFs and the quite small value of T{sub cmax} ({approx} 1 K) is observed around P = 3 GPa. The mechanism of SC in CeIrIn{sub 5} may be different from that in CeCoIn{sub 5} and CeRhIn{sub 5}.

  13. Development of a superconducting claw-pole linear test-rig

    Science.gov (United States)

    Radyjowski, Patryk; Keysan, Ozan; Burchell, Joseph; Mueller, Markus

    2016-04-01

    Superconducting generators can help to reduce the cost of energy for large offshore wind turbines, where the size and mass of the generator have a direct effect on the installation cost. However, existing superconducting generators are not as reliable as the alternative technologies. In this paper, a linear test prototype for a novel superconducting claw-pole topology, which has a stationary superconducting coil that eliminates the cryocooler coupler will be presented. The issues related to mechanical, electromagnetic and thermal aspects of the prototype will be presented.

  14. Commercial Process of Bi-based 2212 Single Phase Superconducting Precursor Powder

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    Laying emphasis on the preparation of Bi-based 2212 single phase superconducting powder, some technological parameters, which effect the single phase degree and uniformity of powder, such as prebaking, sintering and heat treatment were investigated and discussed. Ensuring the powder Tc at 83~85 K, the crucial impurity carbon was reduced to 0.03% and less. Adopting uncommon technique made the powder size to micrometer level, meanwhile the superconducting performance of the powder was unchanged. The fine superconducting powder was characterized. This process of Bi-based 2212 superconducting powder was successful.

  15. Aerospace applications of high temperature superconductivity

    Science.gov (United States)

    Heinen, V. O.; Connolly, D. J.

    1991-01-01

    Space application of high temperature superconducting (HTS) materials may occur before most terrestrial applications because of the passive cooling possibilities in space and because of the economic feasibility of introducing an expensive new technology which has a significant system benefit in space. NASA Lewis Research Center has an ongoing program to develop space technology capitalizing on the potential benefit of HTS materials. The applications being pursued include space communications, power and propulsion systems, and magnetic bearings. In addition, NASA Lewis is pursuing materials research to improve the performance of HTS materials for space applications.

  16. Diagrammatic description of superconductivity in elements and A{sub n}B (n = 1, 2, 3) compounds based on pseudopotential radii

    Energy Technology Data Exchange (ETDEWEB)

    Makino, Yukio, E-mail: ymak@kuchem.kyoto-u.ac.jp [Graduate School of Science, Kyoto University, Oiwake-cho, Kitashirakawa, Sakyo-Ku, Kyoto 606-8502 (Japan); Yoshimura, Kazuyoshi [Graduate School of Science, Kyoto University, Oiwake-cho, Kitashirakawa, Sakyo-Ku, Kyoto 606-8502 (Japan)

    2013-02-14

    Highlights: ► Various superconducting materials can be two-dimensionally mapped. ► The orbital electronegativity and pseudopotential radii difference are taken as coordinates. ► The generation of superconductivity is closely related to the threshold for metal-semiconductor transition. ► The diagrammatic expression is available for the search of new superconducting materials. -- Abstract: Two dimensional diagrams for superconducting elements and A{sub n}B(n = 1, 2, 3) compounds have been constructed using the difference (Δr{sub ENav}) between Zunger’s pseudopotential radii and the orbital electronegativity ([(Z/r(s{sup n}p{sup m})){sup 1/2}]{sub ENav}) derived from the pseudopotential radii. It is found that both superconducting elements and A{sub n}B compounds are well placed in the same domain surrounded by four boundary lines in the Δr{sub ENav}-[(Z/r(s{sup n}p{sup m})){sup 1/2}]{sub ENav} diagram. For sp-bonded elements, the boundary for superconducting/non-superconducting (SC/non-SC) is determined by a constant orbital electronegativity of [(Z/r(s{sup n}p{sup m})){sup 1/2}]{sub ENav}≅2.3, which is close to the boundary ([(Z/r(s{sup n}p{sup m})){sup 1/2}]{sub ENav}=2.046) for the metal–semiconductor transition. Superconducting elements and compounds with relatively high T{sub c} values have an orbital electronegativity close to the value ranging between SC/non-SC and metal–semiconductor transition boundaries. It is suggested that arithmetically averaging of electronegativity is inadequate in AB-type transition metal nitrides and carbides.

  17. The NASA high temperature superconductivity program

    Science.gov (United States)

    Sokoloski, Martin M.; Romanofsky, Robert R.

    1990-01-01

    It has been recognized from the onset that high temperature superconductivity held great promise for major advances across a broad range of NASA interests. The current effort is organized around four key areas: communications and data, sensors and cryogenics, propulsion and power, and space materials technology. Recently, laser ablated YBa2Cu3O(7-x) films on LaAIO produced far superior RF characteristics when compared to metallic films on the same substrate. This achievement has enabled a number of unique microwave device applications, such as low insertion loss phase shifters and high Q filters. Melt texturing and melt quenched techniques are being used to produce bulk materials with optimized magnetic properties. These yttrium enriched materials possess enhanced flux pinning characteristics and will lead to prototype cryocooler bearings. Significant progress has also occurred in bolometer and current lead technology. Studies are being conducted to evaluate the effect of high temperature superconducting materials on the performance and life of high power magneto-plasma-dynamic thrusters. Extended studies were also performed to evaluate the benefit of superconducting magnetic energy storage for LEO space station, lunar and Mars mission applications. The project direction and level of effort of the program are also described.

  18. Measurement of the SC magnetic field

    CERN Multimedia

    CERN PhotoLab

    1973-01-01

    The 3.5-metre-arm carrying 100 Hall plates used for the measurmeent of the SC magnetic field. The arm rotates in a horizontal plane, its positioning and the data read-out are controlled by an on-line computer.

  19. Magnet measuring equipment of SC2

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator.

  20. Magnet measuring equipment of SC2

    CERN Multimedia

    1974-01-01

    Checking the positioning of the magnet measuring equipment installed between the poles of SC2. The steel structure in front of the magnet is designed to house the rotary condenser and to shield it from the stray magnetic field of the accelerator. On the left, Marinus van Gulik. (See Photo Archive 7402005 and Annual Report 1974, p. 44.)

  1. The Synchrocyclotron (SC) in building 300

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    The red magnet of CERN's first accelerator, the Synchrocyclotron (SC), has occupied a large part of Hall 300 since it was installed in the late 1950s. The remaining part of the 300-square-metre building has been used as a storage room since the accelerator was shut down in 1990. Now a public exhibition will breathe new life into the hall.

  2. Running characteristics of the superconducting magnetically levitated train in the case of the superconducting coil quenching; Chodendo jiki fujo ressha no chodendo coil quenching ji no soko tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Ohashi, H. [Kansai University, Osaka (Japan); Osaki, H.; Masada, E. [The University of Tokyo, Tokyo (Japan)

    1998-07-01

    A superconducting (SC) magnetically levitated (Maglev) transportation system has been developed in Japan and various experiments have been done in the new test line at Yamanashi prefecture. Although the superconducting electrodynamic suspension (EDS) system has the advantage of stable levitation without active control, various electromagnetic or mechanical disturbances can cause the change of gap length and the displacement or oscillation of the bogie. In this system, the severest disturbance is SC coil quenching. Therefore it is important to show the running characteristics of the Maglev train and to increase the stability in this case. We developed three dimensional numerical simulation program for the Maglev train. Using this program, running simulation of the train for Yamanashi new test track was undertaken in the case of SC coil quenching. Because of the damping characteristics of the EDS system, influence of the coil quenching is smaller at a higher speed. In the train model, electromagnetic spring strength of the EDS system is larger than mechanical spring of the secondary suspension system connecting a bogie and cabins. Therefore influence of the quenching is only seen in the cabins connected to the quenched bogie. Demagnetization of the SC coil quenching is considered to increase the stability of the train. Although this method is useful to decrease large guidance force, lateral displacement, yaw and roll angle of the bogie, vertical displacement and pitch angle become large. 10 refs., 17 figs., 2 tabs.

  3. The Large Hadron Collider and the Role of Superconductivity in One of the Largest Scientific Enterprises

    CERN Document Server

    Rossi, Lucio

    2007-01-01

    After ten years of R&D and industrialization and seven years of construction, the LHC is near completion. The manufacture of the 1750 main superconducting magnets and of the 8000 superconducting correctors for the accelerator, as well as their cold test at CERN, is approaching the end, while their commissioning in the 27 km-long tunnel has started. The very large superconducting magnets for the main detectors, ATLAS and CMS, are installed and their commissioning is under way. Superconductivity is the key technology for the largest scientific enterprise of this decade: it accounts for half of the total cost and has proved to be affordable and reliable. Thanks to superconductivity we can probe new states of matters and reproduce conditions of 1 ps after the big bang. The paper will give the link between the Physics requirements and the answers that applied superconductivity has offered in this project.

  4. Knowledge insufficient: the management of haemoglobin SC disease.

    Science.gov (United States)

    Pecker, Lydia H; Schaefer, Beverly A; Luchtman-Jones, Lori

    2017-02-01

    Although haemoglobin SC (HbSC) accounts for 30% of sickle cell disease (SCD) in the United States and United Kingdom, evidence-based guidelines for genotype specific management are lacking. The unique pathology of HbSC disease is complex, characterized by erythrocyte dehydration, intracellular sickling and increased blood viscosity. The evaluation and treatment of patients with HbSC is largely inferred from studies of SCD consisting mostly of haemoglobin SS (HbSS) patients. These studies are underpowered to allow definitive conclusions about HbSC. We review the pathophysiology of HbSC disease, including known and potential differences between HbSS and HbSC, and highlight knowledge gaps in HbSC disease management. Clinical and translational research is needed to develop targeted treatments and to validate management recommendations for efficacy, safety and impact on quality of life for people with HbSC. © 2016 John Wiley & Sons Ltd.

  5. Superconducting nanowire single-photon imager

    CERN Document Server

    Zhao, Qing-Yuan; Calandri, Niccolò; Dane, Andrew E; McCaughan, Adam N; Bellei, Francesco; Wang, Hao-Zhu; Santavicca, Daniel F; Berggren, Karl K

    2016-01-01

    Detecting spatial and temporal information of individual photons is a crucial technology in today's quantum information science. Among the existing single-photon detectors, superconducting nanowire single-photon detectors (SNSPDs) have been demonstrated with a sub-50 ps timing jitter, near unity detection efficiency1, wide response spectrum from visible to infrared and ~10 ns reset time. However, to gain spatial sensitivity, multiple SNSPDs have to be integrated into an array, whose spatial and temporal resolutions are limited by the multiplexing circuit. Here, we add spatial sensitivity to a single nanowire while preserving the temporal resolution from an SNSPD, thereby turning an SNSPD into a superconducting nanowire single-photon imager (SNSPI). To achieve an SNSPI, we modify a nanowire's electrical behavior from a lumped inductor to a transmission line, where the signal velocity is slowed down to 0.02c (where c is the speed of light). Consequently, we are able to simultaneously read out the landing locati...

  6. PREFACE: Superconductivity in ultrathin films and nanoscale systems Superconductivity in ultrathin films and nanoscale systems

    Science.gov (United States)

    Bianconi, Antonio; Bose, Sangita; Garcia-Garcia, Antonio Miguel

    2012-12-01

    The recent technological developments in the synthesis and characterization of high-quality nanostructures and developments in the theoretical techniques needed to model these materials, have motivated this focus section of Superconductor Science and Technology. Another motivation is the compelling evidence that all new superconducting materials, such as iron pnictides and chalcogenides, diborides (doped MgB2) and fullerides (alkali-doped C60 compounds), are heterostrucures at the atomic limit, such as the cuprates made of stacks of nanoscale superconducting layers intercalated by different atomic layers with nanoscale periodicity. Recently a great amount of interest has been shown in the role of lattice nano-architecture in controlling the fine details of Fermi surface topology. The experimental and theoretical study of superconductivity in the nanoscale started in the early 1960s, shortly after the discovery of the BCS theory. Thereafter there has been rapid progress both in experiments and the theoretical understanding of nanoscale superconductors. Experimentally, thin films, granular films, nanowires, nanotubes and single nanoparticles have all been explored. New quantum effects appear in the nanoscale related to multi-component condensates. Advances in the understanding of shape resonances or Fano resonances close to 2.5 Lifshitz transitions near a band edge in nanowires, 2D films and superlattices [1, 2] of these nanosized modules, provide the possibility of manipulating new quantum electronic states. Parity effects and shell effects in single, isolated nanoparticles have been reported by several groups. Theoretically, newer techniques based on solving Richardson's equation (an exact theory incorporating finite size effects to the BCS theory) numerically by path integral methods or solving the entire Bogoliubov-de Gennes equation in these limits have been attempted, which has improved our understanding of the mechanism of superconductivity in these confined

  7. Superconductivity an introduction

    CERN Document Server

    Kleiner, Reinhold

    2016-01-01

    The third edition of this proven text has been developed further in both scope and scale to reflect the potential for superconductivity in power engineering to increase efficiency in electricity transmission or engines. The landmark reference remains a comprehensive introduction to the field, covering every aspect from fundamentals to applications, and presenting the latest developments in organic superconductors, superconducting interfaces, quantum coherence, and applications in medicine and industry. Due to its precise language and numerous explanatory illustrations, it is suitable as an introductory textbook, with the level rising smoothly from chapter to chapter, such that readers can build on their newly acquired knowledge. The authors cover basic properties of superconductors and discuss stability and different material groups with reference to the latest and most promising applications, devoting the last third of the book to applications in power engineering, medicine, and low temperature physics. An e...

  8. Superconducting Accelerator Magnets

    CERN Document Server

    Mess, K H; Wolff, S

    1996-01-01

    The main topic of the book are the superconducting dipole and quadrupole magnets needed in high-energy accelerators and storage rings for protons, antiprotons or heavy ions. The basic principles of low-temperature superconductivity are outlined with special emphasis on the effects which are relevant for accelerator magnets. Properties and fabrication methods of practical superconductors are described. Analytical methods for field calculation and multipole expansion are presented for coils without and with iron yoke. The effect of yoke saturation and geometric distortions on field quality is studied. Persistent magnetization currents in the superconductor and eddy currents the copper part of the cable are analyzed in detail and their influence on field quality and magnet performance is investigated. Superconductor stability, quench origins and propagation and magnet protection are addressed. Some important concepts of accelerator physics are introduced which are needed to appreciate the demanding requirements ...

  9. Statistical mechanics of superconductivity

    CERN Document Server

    Kita, Takafumi

    2015-01-01

    This book provides a theoretical, step-by-step comprehensive explanation of superconductivity for undergraduate and graduate students who have completed elementary courses on thermodynamics and quantum mechanics. To this end, it adopts the unique approach of starting with the statistical mechanics of quantum ideal gases and successively adding and clarifying elements and techniques indispensible for understanding it. They include the spin-statistics theorem, second quantization, density matrices, the Bloch–De Dominicis theorem, the variational principle in statistical mechanics, attractive interaction, and bound states. Ample examples of their usage are also provided in terms of topics from advanced statistical mechanics such as two-particle correlations of quantum ideal gases, derivation of the Hartree–Fock equations, and Landau’s Fermi-liquid theory, among others. With these preliminaries, the fundamental mean-field equations of superconductivity are derived with maximum mathematical clarity based on ...

  10. Superconducting switch pack

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, V.C.; Wollan, J.J.

    1990-07-24

    This patent describes a superconducting switch pack at least one switch element. The switch element including a length of superconductive wire having a switching portion and two lead portions, the switching portion being between the lead portions; means for supporting the switching portion in a plane in a common mold; hardened resin means encapsulating the switching portion in the plane in a solid body; wherein the solid body has an exterior surface which is planar and substantially parallel with and spaced apart from the plane in which the switching portion is positioned. The exterior surface being exposed to the exterior of the switch pack and the resin means filling the space between the exterior surface and the plane of the switching portion so as to provide uninterrupted thermal communication between the plane of the switching portion and the exterior of the switch pack; and a heater element in thermal contact with the switching portion.

  11. Tunable superconducting nanoinductors

    Energy Technology Data Exchange (ETDEWEB)

    Annunziata, Anthony J; Santavicca, Daniel F; Frunzio, Luigi; Rooks, Michael J; Prober, Daniel E [Department of Applied Physics, Yale University, New Haven, CT 06511 (United States); Catelani, Gianluigi [Department of Physics, Yale University, New Haven, CT 06511 (United States); Frydman, Aviad, E-mail: anthony.annunziata@yale.edu, E-mail: daniel.prober@yale.edu [Department of Physics, Bar-Ilan University, Ramat Gan 52900 (Israel)

    2010-11-05

    We characterize inductors fabricated from ultra-thin, approximately 100 nm wide strips of niobium (Nb) and niobium nitride (NbN). These nanowires have a large kinetic inductance in the superconducting state. The kinetic inductance scales linearly with the nanowire length, with a typical value of 1 nH {mu}m{sup -1} for NbN and 44 pH {mu}m{sup -1} for Nb at a temperature of 2.5 K. We measure the temperature and current dependence of the kinetic inductance and compare our results to theoretical predictions. We also simulate the self-resonant frequencies of these nanowires in a compact meander geometry. These nanowire inductive elements have applications in a variety of microwave frequency superconducting circuits.

  12. Relativistic Model for two-band Superconductivity

    OpenAIRE

    Ohsaku, Tadafumi

    2003-01-01

    To understand the superconductivity in MgB2, several two-band models of superconductivity were proposed. In this paper, by using the relativistic fermion model, we clearize the effect of the lower band in the superconductivity.

  13. Determination of the Planck constant using a watt balance with a superconducting magnet system at the National Institute of Standards and Technology

    CERN Document Server

    Schlamminger, Stephan; Seifert, Frank; Chao, Leon S; Newell, David B; Liu, Ruimin; Steiner, Richard L; Pratt, Jon R

    2014-01-01

    For the past two years, measurements have been performed with a watt balance at the National Institute of Standards and Technology (NIST) to determine the Planck constant. A detailed analysis of these measurements and their uncertainties has led to the value $h=6.626\\,069\\,79(30)\\times 10^{-34}\\,$J$\\,$s. The relative standard uncertainty is $ 45\\times 10^{-9}$. This result is $141\\times 10^{-9}$ fractionally higher than $h_{90}$. Here $h_{90}$ is the conventional value of the Planck constant given by $h_{90}\\equiv 4 /( K_{\\mathrm{J-90}}^2R_{\\mathrm{K-90}})$, where $K_{\\mathrm{J-90}}$ and $R_{\\mathrm{K-90}}$ denote the conventional values of the Josephson and von Klitzing constants, respectively.

  14. A 166.6 MHz superconducting rf system for the HEPS storage ring

    Science.gov (United States)

    Zhang, P.; Hao, X.; Huang, T.; Li, Z.; Lin, H.; Meng, F.; Mi, Z.; Sun, Y.; Wang, G.; Wang, Q.; Zhang, X.

    2017-07-01

    A superconducting 166.6 MHz quarter-wave beta=1 cavity was recently proposed for the High Energy Photon Source (HEPS), a 6 GeV kilometer-scale light source. Four 166.6 MHz cavities will be used for main acceleration in the newly planned on-axis beam injection scheme realized by a double-frequency RF system. The fundamental frequency, 166.6 MHz, was dictated by the fast injection kicker technology and the preference of using 499.8 MHz SC RF cavity as the third harmonic. Each 166.6 MHz cavity will be operated at 4.2 K providing 1.2 MV accelerating voltage and 150 kW of power to the electron beam. The input coupler will use single-window coaxial type graded up to 200 kW CW power. Each cavity will be equipped with a 200 kW solid-state amplifier and digital low-level RF system. This paper describes the 166.6 MHz RF system with a focus on the design and optimization of the RF cavity and its ancillaries, the LLRF system and the status of the solid-state amplifiers.

  15. Topological confinement and superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Al-hassanieh, Dhaled A [Los Alamos National Laboratory; Batista, Cristian D [Los Alamos National Laboratory

    2008-01-01

    We derive a Kondo Lattice model with a correlated conduction band from a two-band Hubbard Hamiltonian. This mapping allows us to describe the emergence of a robust pairing mechanism in a model that only contains repulsive interactions. The mechanism is due to topological confinement and results from the interplay between antiferromagnetism and delocalization. By using Density-Matrix-Renormalization-Group (DMRG) we demonstrate that this mechanism leads to dominant superconducting correlations in aID-system.

  16. Unconventional superconductivity near inhomogeneities

    Energy Technology Data Exchange (ETDEWEB)

    Poenicke, A.F.

    2008-01-25

    After the presentation of a quasi-classical theory the specific heat of Sr{sub 2}RuO{sub 4} is considered. Then tunneling spectroscopy on cuprate superconductors is discussed. Thereafter the subharmonic gap structure in d-wave superconductors is considered. Finally the application of the S-matrix in superconductivity is discussed with spin mixing, CrO{sub 2} as example, and an interface model. (HSI)

  17. Helical superconducting black holes.

    Science.gov (United States)

    Donos, Aristomenis; Gauntlett, Jerome P

    2012-05-25

    We construct novel static, asymptotically five-dimensional anti-de Sitter black hole solutions with Bianchi type-VII(0) symmetry that are holographically dual to superconducting phases in four spacetime dimensions with a helical p-wave order. We calculate the precise temperature dependence of the pitch of the helical order. At zero temperature the black holes have a vanishing entropy and approach domain wall solutions that reveal homogenous, nonisotropic dual ground states with an emergent scaling symmetry.

  18. Silicon superconducting quantum interference device

    Energy Technology Data Exchange (ETDEWEB)

    Duvauchelle, J. E.; Francheteau, A.; Marcenat, C.; Lefloch, F., E-mail: francois.lefloch@cea.fr [Université Grenoble Alpes, CEA - INAC - SPSMS, F-38000 Grenoble (France); Chiodi, F.; Débarre, D. [Université Paris-sud, CNRS - IEF, F-91405 Orsay - France (France); Hasselbach, K. [Université Grenoble Alpes, CNRS - Inst. Néel, F-38000 Grenoble (France); Kirtley, J. R. [Center for probing at nanoscale, Stanford University, Palo Alto, California 94305-4045 (United States)

    2015-08-17

    We have studied a Superconducting Quantum Interference Device (SQUID) made from a single layer thin film of superconducting silicon. The superconducting layer is obtained by heavily doping a silicon wafer with boron atoms using the gas immersion laser doping technique. The SQUID is composed of two nano-bridges (Dayem bridges) in a loop and shows magnetic flux modulation at low temperature and low magnetic field. The overall behavior shows very good agreement with numerical simulations based on the Ginzburg-Landau equations.

  19. Superconducting Qubit Optical Transducer (SQOT)

    Science.gov (United States)

    2015-08-05

    SECURITY CLASSIFICATION OF: The SQOT (Superconducting Qubit Optical Transducer ) project proposes to build a novel electro-optic system which can...Apr-2015 Approved for Public Release; Distribution Unlimited Final Report: "Superconducting Qubit Optical Transducer " (SQOT) The views, opinions and...journals: Number of Papers published in non peer-reviewed journals: Final Report: "Superconducting Qubit Optical Transducer " (SQOT) Report Title The

  20. Anomalous magnetic fluctuations in superconducting Sr2RuO4 revealed by 101Ru nuclear spin-spin relaxation

    Science.gov (United States)

    Manago, Masahiro; Yamanaka, Takayoshi; Ishida, Kenji; Mao, Zhiqiang; Maeno, Yoshiteru

    2016-10-01

    We carried out 101Ru nuclear quadrupole resonance (NQR) measurement on superconducting (SC) Sr2RuO4 under zero magnetic field (H =0 ) and found that the nuclear spin-spin relaxation rate 1 /T2 is enhanced in the SC state. The 1 /T2 measurement in the SC state under H =0 is effective for detecting slow magnetic fluctuations parallel to the quantized axis of the nuclear spin. Our results indicate that low-energy magnetic fluctuations perpendicular to the RuO2 plane emerge when the superconductivity sets in, which is consistent with the previous 17O-NQR result that the nuclear spin-lattice relaxation rate 1 /T1 of the in-plane O site exhibits anomalous behavior in the SC state. The enhancement of the magnetic fluctuations in the SC state is unusual and suggests that the fluctuations are related to the unconventional SC pairing. We suggest that this phenomenon is a consequence of the spin degrees of freedom of the spin-triplet pairing.

  1. Hybrid Superconducting Neutron Detectors

    CERN Document Server

    Merlo, V; Cirillo, M; Lucci, M; Ottaviani, I; Scherillo, A; Celentano, G; Pietropaolo, A

    2014-01-01

    A new neutron detection concept is presented that is based on superconductive niobium (Nb) strips coated by a boron (B) layer. The working principle of the detector relies on the nuclear reaction 10B+n $\\rightarrow$ $\\alpha$+ 7Li , with $\\alpha$ and Li ions generating a hot spot on the current-biased Nb strip which in turn induces a superconducting-normal state transition. The latter is recognized as a voltage signal which is the evidence of the incident neutron. The above described detection principle has been experimentally assessed and verified by irradiating the samples with a pulsed neutron beam at the ISIS spallation neutron source (UK). It is found that the boron coated superconducting strips, kept at a temperature T = 8 K and current-biased below the critical current Ic, are driven into the normal state upon thermal neutron irradiation. As a result of the transition, voltage pulses in excess of 40 mV are measured while the bias current can be properly modulated to bring the strip back to the supercond...

  2. Navy superconductivity efforts

    Science.gov (United States)

    Gubser, D. U.

    1990-04-01

    Both the new high temperature superconductors (HTS) and the low temperature superconductors (LTS) are important components of Navy's total plan to integrate superconductivity into field operational systems. Fundamental research is an important component of the total Navy program and focuses on the HTS materials. Power applications (ship propulsion, etc.) use LTS materials while space applications (MMW electronics, etc.) use HTS materials. The Space Experiment being conducted at NRL will involve space flight testing of HTS devices built by industry and will demonstrate the ability to engineer and space qualify these devices for systems use. Another important component of the Navy's effort is the development of Superconducting Quantum Interference Device (SQUID) magnetometers. This program will use LTS materials initially, but plans to implement HTS materials as soon as possible. Hybrid HTS/LTS systems are probable in many applications. A review of the status of the Navy's HTS materials research is given as well as an update on the Navy's development efforts in superconductivity, with particular emphasis on the related SDIO sponsored program on HTS applications.

  3. US Navy superconductivity program

    Science.gov (United States)

    Gubser, Donald U.

    1991-01-01

    Both the new high temperature superconductors (HTS) and the low temperature superconductors (LTS) are important components of the Navy's total plan to integrate superconductivity into field operational systems. Fundamental research is an important component of the total Navy program and focuses on the HTS materials. Power applications (ship propulsion) use LTS materials while space applications (millimeter wave electronics) use HTS materials. The Space Experiment to be conducted at NRL will involve space flight testing of HTS devices built by industry and will demonstrate the ability to engineer and space qualify these devices for systems use. Another important component of the Navy's effort is the development of Superconducting Quantum Interference Device (SQUID) magnetometers. This program will use LTS materials initially, but plans to implement HTS materials as soon as possible. Hybrid HTS/LTS systems are probable in many applications. A review of the status of the Navy's HTS materials research is given as well as an update on the Navy's development efforts in superconductivity.

  4. Navy superconductivity efforts

    Science.gov (United States)

    Gubser, D. U.

    1990-01-01

    Both the new high temperature superconductors (HTS) and the low temperature superconductors (LTS) are important components of Navy's total plan to integrate superconductivity into field operational systems. Fundamental research is an important component of the total Navy program and focuses on the HTS materials. Power applications (ship propulsion, etc.) use LTS materials while space applications (MMW electronics, etc.) use HTS materials. The Space Experiment being conducted at NRL will involve space flight testing of HTS devices built by industry and will demonstrate the ability to engineer and space qualify these devices for systems use. Another important component of the Navy's effort is the development of Superconducting Quantum Interference Device (SQUID) magnetometers. This program will use LTS materials initially, but plans to implement HTS materials as soon as possible. Hybrid HTS/LTS systems are probable in many applications. A review of the status of the Navy's HTS materials research is given as well as an update on the Navy's development efforts in superconductivity, with particular emphasis on the related SDIO sponsored program on HTS applications.

  5. Superconductivity in CVD diamond films.

    Science.gov (United States)

    Takano, Yoshihiko

    2009-06-24

    A beautiful jewel of diamond is insulator. However, boron doping can induce semiconductive, metallic and superconducting properties in diamond. When the boron concentration is tuned over 3 × 10(20) cm(-3), diamonds enter the metallic region and show superconductivity at low temperatures. The metal-insulator transition and superconductivity are analyzed using ARPES, XAS, NMR, IXS, transport and magnetic measurements and so on. This review elucidates the physical properties and mechanism of diamond superconductor as a special superconductivity that occurs in semiconductors.

  6. Unconventional superconductivity in honeycomb lattice

    Directory of Open Access Journals (Sweden)

    P Sahebsara

    2013-03-01

    Full Text Available   ‎ The possibility of symmetrical s-wave superconductivity in the honeycomb lattice is studied within a strongly correlated regime, using the Hubbard model. The superconducting order parameter is defined by introducing the Green function, which is obtained by calculating the density of the electrons ‎ . In this study showed that the superconducting order parameter appears in doping interval between 0 and 0.5, and x=0.25 is the optimum doping for the s-wave superconductivity in honeycomb lattice.

  7. Superconductivity in graphite intercalation compounds

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Robert P. [Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Weller, Thomas E.; Howard, Christopher A. [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom); Dean, Mark P.M. [Department of Condensed Matter Physics and Materials Science, Brookhaven National Laboratory, Upton, NY 11973 (United States); Rahnejat, Kaveh C. [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom); Saxena, Siddharth S. [Cavendish Laboratory, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Ellerby, Mark, E-mail: mark.ellerby@ucl.ac.uk [Department of Physics & Astronomy, University College of London, Gower Street, London WCIE 6BT (United Kingdom)

    2015-07-15

    Highlights: • Historical background of graphite intercalates. • Superconductivity in graphite intercalates and its place in the field of superconductivity. • Recent developments. • Relevant modeling of superconductivity in graphite intercalates. • Interpretations that pertain and questions that remain. - Abstract: The field of superconductivity in the class of materials known as graphite intercalation compounds has a history dating back to the 1960s (Dresselhaus and Dresselhaus, 1981; Enoki et al., 2003). This paper recontextualizes the field in light of the discovery of superconductivity in CaC{sub 6} and YbC{sub 6} in 2005. In what follows, we outline the crystal structure and electronic structure of these and related compounds. We go on to experiments addressing the superconducting energy gap, lattice dynamics, pressure dependence, and how these relate to theoretical studies. The bulk of the evidence strongly supports a BCS superconducting state. However, important questions remain regarding which electronic states and phonon modes are most important for superconductivity, and whether current theoretical techniques can fully describe the dependence of the superconducting transition temperature on pressure and chemical composition.

  8. Correlation of critical temperature with the vibrational spectra of high-temperature superconducters

    Energy Technology Data Exchange (ETDEWEB)

    Bush, A.A.; Dubenko, I.S.; Limonov, M.F.; Markov, IU.F.; Panfilov, A.G. (Moskovskii Institut Radiotekhniki, Elektroniki i Avtomatiki, Moscow (USSR) Fiziko-Tekhnicheskii Institut, Moscow (USSR))

    1989-09-01

    An empirical relation between an increase in Tc and an increase in the frequencies of the vibrational spectra of different high-temperature superconducters of perovskite type is established. Taking this relation into account, a new system (Y{sub 1-x}Sc{sub x})(Ba{sub 1-y}Sr{sub y})2 Cu{sub 3}O(delta) is proposed, in which an increase in Tc is observed at intermediate concentrations. 13 refs.

  9. Theoretical Study of Interplay Between Superconductivity and Itinerant Ferromagnetism

    Directory of Open Access Journals (Sweden)

    Subhra Kakani

    2014-08-01

    Full Text Available Following Green’s function technique and equation of motion method, the coexistence of superconductivity (SC and itinerant ferromagnetism (FM is investigated in a single band homogenous system. Self consistent equations for SC and FM order parameters, Δ and m or I respectively are derived. It is shown that there generally exists a coexistent (Δ ≠ 0, and m or I ≠ 0 solutions to the coupled equations of the order parameter in the, temperature range 0 < T < min(TC, TFM, where TC and TFM are respectively the superconducting and ferromagnetic transition temperatures. Expressions for specific heat, density of states, free energy and critical field are derived. The specific heat has linear temperature dependence as opposed to the exponential decrease in the BCS theory. The density of states for a finite m increases as opposed to that of a ferromagnetic metal. Free energy study reveals that FMSC state has lowest energy than the normal FM state and therefore realized at low enough temperature .Effect of small external field is also studied. The theory is applied to explain the observations in uranium based intermetallics systems UCoGe and UIr. The agreement between theory and experiments is quite encouraging.

  10. Linear beam dynamics and ampere class superconducting RF cavities at RHIC

    Science.gov (United States)

    Calaga, Rama R.

    The Relativistic Heavy Ion Collider (RHIC) is a hadron collider designed to collide a range of ions from protons to gold. RHIC operations began in 2000 and has successfully completed five physics runs with several species including gold, deuteron, copper, and polarized protons. Linear optics and coupling are fundamental issues affecting the collider performance. Measurement and correction of optics and coupling are important to maximize the luminosity and sustain stable operation. A numerical approach, first developed at SLAC, was implemented to measure linear optics from coherent betatron oscillations generated by ac dipoles and recorded at multiple beam position monitors (BPMs) distributed around the collider. The approach is extended to a fully coupled 2D case and equivalence relationships between Hamiltonian and matrix formalisms are derived. Detailed measurements of the transverse coupling terms are carried out at RHIC and correction strategies are applied to compensate coupling both locally and globally. A statistical approach to determine BPM reliability and performance over the past three runs and future improvements also discussed. Aiming at a ten-fold increase in the average heavy-ion luminosity, electron cooling is the enabling technology for the next luminosity upgrade (RHIC II). Cooling gold ion beams at 100 GeV/nucleon requires an electron beam of approximately 54 MeV and a high average current in the range of 50-200 mA. All existing e-Coolers are based on low energy DC accelerators. The only viable option to generate high current, high energy, low emittance CW electron beam is through a superconducting energy-recovery linac (SC-ERL). In this option, an electron beam from a superconducting injector gun is accelerated using a high gradient (˜ 20 MV/m) superconducting RF (SRF) cavity. The electrons are returned back to the cavity with a 180° phase shift to recover the energy back into the cavity before being dumped. A design and development of a half

  11. Final Report: MATERIALS, STRANDS, AND CABLES FOR SUPERCONDUCTING ACCELERATOR MAGNETS [Grant Number DE-SC0010312

    Energy Technology Data Exchange (ETDEWEB)

    Sumption, Mike D. [The Ohio State Univ., Columbus, OH (United States). Center for Superconducting and Magnetic Materials (CSMM); Collings, Edward W. [The Ohio State Univ., Columbus, OH (United States). Center for Superconducting and Magnetic Materials (CSMM)

    2014-10-29

    Our program consisted of the two components: Strand Research and Cable Research, with a focus on Nb3Sn, Bi2212, and YBCO for accelerator magnet applications. We demonstrated a method to refine the grains in Nb3Sn by a factor of two, reaching 45 nm grain sizes, and layer Jcs of 6 kA/mm2 at 12 T. W also measured conductor magnetization for field quality. This has been done both with Nb3Sn conductor, as well as Bi:2212 strand. Work in support of quench studies of YBCO coils was also performed. Cable loss studies in Nb3Sn focused on connecting and comparing persistent magnetization and coupling magnetization for considering their relative impact on HEP machines. In the area of HTS cables, we have investigated both the quench in multistrand YBCO CORC cables, as well as the magnetization of these cables for use in high field magnets. In addition, we examined the magnetic and thermal properties of large (50 T) solenoids.

  12. Precipitation hardening in ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems

    Energy Technology Data Exchange (ETDEWEB)

    Kharakterova, M.L.; Eskin, D.G.; Toropova, L.S. (Russian Academy of Sciences, Moscow (Russian Federation). A.A. Baikov Inst. of Metallurgy)

    1994-07-01

    The processes of precipitation hardening in cast ternary alloys of the Al-Sc-Cu and Al-Sc-Si systems were studied in the temperature range of aging from 100 to 450 C and at exposures to 200 h. It was shown that the CuAl[sub 2] and ScAl[sub 3] phases were involved in the process of aging in ternary Al-Sc-Cu alloys, and the Si and V (AlSiSc) phases, in ternary Al-Sc-Si alloys with excess silicon in a supersaturated solid solution. The V phase was for the first time revealed as the hardening phase in aluminum alloys.

  13. Current limiting level-time characteristic of a superconducting fault current limiter

    Science.gov (United States)

    Tang, Y. J.; Yokomizu, Y.; Hayakawa, N.; Matsumura, T.; Okubo, H.; Kito, Y.

    A model superconducting fault current limiter (SE-FCL) has been developed. The adopted superconducting cable is composed of six strands insulated from each other. The current limiting level of the SC-FCL is measured under two types of overcurrent, a sinusoidal and an inrush current. The results show that the current limiting level of the SC-FCL Iq increases with an increase in the rate of rise of the overcurrent. By introducing a new parameter of time-to-quench tf, it is found that Iq increases with decreasing tf. This feature is taken as a current limiting level-time characteristic i.e. the Iq- tf characteristic. The existence of the Iq- tf characteristic found in the SC-FCL is qualitatively explained by measuring current distribution among the six strands. The superconducting cable is driven to the normal state strand by strand. Some delay in time is found from the quench of the first strand to that of the last and this is recognized as an Iq- tf characteristic in its current limiting performance.

  14. Optimization of superconducting tiling pattern for superconducting bearings

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R. (Hinsdale, IL)

    1996-01-01

    An apparatus and method for reducing magnetic field inhomogeneities which produce rotational loss mechanisms in high temperature superconducting magnetic bearings. Magnetic field inhomogeneities are reduced by dividing high temperature superconducting structures into smaller structures, and arranging the smaller structures into tiers which stagger the magnetic field maximum locations of the smaller structures.

  15. A superconducting shield to protect astronauts

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    The CERN Superconductors team in the Technology department is involved in the European Space Radiation Superconducting Shield (SR2S) project, which aims to demonstrate the feasibility of using superconducting magnetic shielding technology to protect astronauts from cosmic radiation in the space environment. The material that will be used in the superconductor coils on which the project is working is magnesium diboride (MgB2), the same type of conductor developed in the form of wire for CERN for the LHC High Luminosity Cold Powering project.   Image: K. Anthony/CERN. Back in April 2014, the CERN Superconductors team announced a world-record current in an electrical transmission line using cables made of the MgB2 superconductor. This result proved that the technology could be used in the form of wire and could be a viable solution for both electrical transmission for accelerator technology and long-distance power transportation. Now, the MgB2 superconductor has found another application: it wi...

  16. LHCb Data Replication During SC3

    CERN Multimedia

    Smith, A

    2006-01-01

    LHCb's participation in LCG's Service Challenge 3 involves testing the bulk data transfer infrastructure developed to allow high bandwidth distribution of data across the grid in accordance with the computing model. To enable reliable bulk replication of data, LHCb's DIRAC system has been integrated with gLite's File Transfer Service middleware component to make use of dedicated network links between LHCb computing centres. DIRAC's Data Management tools previously allowed the replication, registration and deletion of files on the grid. For SC3 supplementary functionality has been added to allow bulk replication of data (using FTS) and efficient mass registration to the LFC replica catalog.Provisional performance results have shown that the system developed can meet the expected data replication rate required by the computing model in 2007. This paper details the experience and results of integration and utilisation of DIRAC with the SC3 transfer machinery.

  17. Reduced-Latency SC Polar Decoder Architectures

    CERN Document Server

    Zhang, Chuan; Parhi, Keshab K

    2011-01-01

    Polar codes have become one of the most favorable capacity achieving error correction codes (ECC) along with their simple encoding method. However, among the very few prior successive cancellation (SC) polar decoder designs, the required long code length makes the decoding latency high. In this paper, conventional decoding algorithm is transformed with look-ahead techniques. This reduces the decoding latency by 50%. With pipelining and parallel processing schemes, a parallel SC polar decoder is proposed. Sub-structure sharing approach is employed to design the merged processing element (PE). Moreover, inspired by the real FFT architecture, this paper presents a novel input generating circuit (ICG) block that can generate additional input signals for merged PEs on-the-fly. Gate-level analysis has demonstrated that the proposed design shows advantages of 50% decoding latency and twice throughput over the conventional one with similar hardware cost.

  18. Preparation, microstructure and properties of Al-Zn-Mg-Sc alloy tubes

    Institute of Scientific and Technical Information of China (English)

    何振波; 尹志民; 林森; 邓英; 商宝川; 周向

    2010-01-01

    The Al-6.0Zn-2.0Mg-0.2Sc-0.10Zr hollow tube ingots, prepared by semi-continuous casting technology, were subjected to ho- mogenization treatment, hot extrusion, intermediate annealing, tension, solution and aging treatment. The microstructures and properties of as-cast Al-Zn-Mg-Sc alloy at different homogenization treatment conditions were studied using hardness measurement, X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analysis. The results showed th...

  19. Observation of pseudogap in the normal state of superconducting Mo{sub 3}Sb{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Tran, V.H. [Polish Academy of Sciences, Institute of Low Temperature and Structure Research, 50-422 Wroclaw (Poland); Batkova, M.; Batko, I.; Pribulova, Z. [Institute of Experimental Physics, Slovak Academy of Sciences, Watsonova 47, 040 01 Kosice (Slovakia); Bukowski, Z. [Laboratory for Solid State Physics, ETH Zuerich, 8093 Zuerich (Switzerland)

    2010-03-15

    Using electron tunneling spectroscopy, we investigated density of states of Mo{sub 3}Sb{sub 7} in the temperature range 1.7-60 K. The differential conductance dI/dV vs. V curve at 4.2 K shows that an energy pseudogap of 2{delta}{proportional_to} 15(2) meV is formed in the density of states. In the superconducting state, the tunneling spectra exhibit the presence of a BCS-type superconducting gap of {delta}{sub sc} (0) {proportional_to} 0.24 meV. Future investigations of the interplay between superconductivity and possible SDW ordering, and the anisotropic nature of the nesting of the Fermi surface in Mo{sub 3}Sb{sub 7} are highly desired. Tunneling spectra of Mo{sub 3}Sb{sub 7} measured in the normal state (a) and in the superconducting state (b). (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  20. Single chain Fab (scFab fragment

    Directory of Open Access Journals (Sweden)

    Brenneis Mariam

    2007-03-01

    Full Text Available Abstract Background The connection of the variable part of the heavy chain (VH and and the variable part of the light chain (VL by a peptide linker to form a consecutive polypeptide chain (single chain antibody, scFv was a breakthrough for the functional production of antibody fragments in Escherichia coli. Being double the size of fragment variable (Fv fragments and requiring assembly of two independent polypeptide chains, functional Fab fragments are usually produced with significantly lower yields in E. coli. An antibody design combining stability and assay compatibility of the fragment antigen binding (Fab with high level bacterial expression of single chain Fv fragments would be desirable. The desired antibody fragment should be both suitable for expression as soluble antibody in E. coli and antibody phage display. Results Here, we demonstrate that the introduction of a polypeptide linker between the fragment difficult (Fd and the light chain (LC, resulting in the formation of a single chain Fab fragment (scFab, can lead to improved production of functional molecules. We tested the impact of various linker designs and modifications of the constant regions on both phage display efficiency and the yield of soluble antibody fragments. A scFab variant without cysteins (scFabΔC connecting the constant part 1 of the heavy chain (CH1 and the constant part of the light chain (CL were best suited for phage display and production of soluble antibody fragments. Beside the expression system E. coli, the new antibody format was also expressed in Pichia pastoris. Monovalent and divalent fragments (DiFabodies as well as multimers were characterised. Conclusion A new antibody design offers the generation of bivalent Fab derivates for antibody phage display and production of soluble antibody fragments. This antibody format is of particular value for high throughput proteome binder generation projects, due to the avidity effect and the possible use of

  1. The SC gets ready for visitors

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Hall 300, which houses the Synchrocyclotron (SC), CERN’s first accelerator, is getting ready to host a brand-new exhibition. The site will be one of the stops on the new visit itineraries that will be inaugurated for the 2013 CERN Open Day.   The Synchrocyclotron through the years. Just as it did in the late 1950s, when the accelerator was first installed, the gigantic red structure of the Synchrocyclotron's magnet occupies a large part of the 300-square-metre hall. “We have completed the first phase of the project that will give the SC a new lease of life,” says Marco Silari, the project leader and a member of CERN’s Radiation Protection Group. “We have removed all the equipment that was not an integral part of the accelerator. The hall is now ready for the civil-engineering work that will precede the installation of the exhibition.” The SC was witness to a big part of the history of CERN. The accelerator produced ...

  2. First-order superconducting transition in the inter-band model

    Energy Technology Data Exchange (ETDEWEB)

    Gomes da Silva, M. [Universidade Federal do Amazonas, Departamento de Física, 3000, Japiim, 69077-00 Manaus, AM (Brazil); Instituto Federal de Educação Ciência e Tecnologia do Amazonas, Av. 7 de Setembro, 1975 - Centro, Manaus, AM 69020-120 (Brazil); Dinóla Neto, F., E-mail: dinola@ufam.edu.br [Universidade Federal do Amazonas, Departamento de Física, 3000, Japiim, 69077-00 Manaus, AM (Brazil); Padilha, I.T. [Universidade Federal do Amazonas, Departamento de Física, 3000, Japiim, 69077-00 Manaus, AM (Brazil); Ricardo de Sousa, J. [Universidade Federal do Amazonas, Departamento de Física, 3000, Japiim, 69077-00 Manaus, AM (Brazil); National Institute of Science and Technology for Complex Systems, Universidade Federal do Amazonas, 3000, Japiim, 69077-000 Manaus, AM (Brazil); Continentino, M.A. [Centro Brasileiro de Pesquisas Físicas, 22290-180 Rio de Janeiro, RJ (Brazil)

    2014-04-01

    The comprehension about the theoretical features of superconductivity is an interesting and fundamental topic in condensed matter physics. Several theoretical proposals were considered to describe the new classes of superconducting compounds and alloys. In this work we propose to study a non-conventional superconducting system where the Cooper pairs are formed by fermions from different bands described via two band model with hybridization. In this inter-band scenario we find a first-order phase transition at low temperatures and we observe a tricritical point in the phase diagram. In our description, the control parameter is the hybridization that can be tuned by external pressure. This fact indicates the possibility to observe discontinuities in the SC gap amplitude through applying pressure on the system.

  3. Dyson-Schwinger Approach to Color-Superconductivity: Effects of Selfconsistent Gluon Dressing

    CERN Document Server

    Müller, Daniel; Wambach, Jochen

    2016-01-01

    The phase diagram of dense QCD at nonvanishing temperatures and large quark chemical potentials is studied with Dyson-Schwinger equations for 2+1 quark flavors, focusing on color-superconducting phases with 2SC and CFL-like pairing. The truncation scheme of our previous investigations is extended to include the dressing of gluons with selfconsistently determined quarks, i.e., taking into account the dynamical masses and superconducting gaps of the quarks in the gluon polarization. As a consequence the gluon screening is reduced, leading to an enhancement of the critical temperatures of the color-superconducting phases by about a factor of 2 as compared to the case where the gluons are dressed with bare quarks. We also calculate the Debye and Meissner masses of the gluons and show that they are consistent with weak-coupling results.

  4. Pressure induced superconductivity on the border of magnetic order in MnP.

    Science.gov (United States)

    Cheng, J-G; Matsubayashi, K; Wu, W; Sun, J P; Lin, F K; Luo, J L; Uwatoko, Y

    2015-03-20

    We report the discovery of superconductivity on the border of long-range magnetic order in the itinerant-electron helimagnet MnP via the application of high pressure. Superconductivity with T(sc)≈1  K emerges and exists merely near the critical pressure P(c)≈8  GPa, where the long-range magnetic order just vanishes. The present finding makes MnP the first Mn-based superconductor. The close proximity of superconductivity to a magnetic instability suggests an unconventional pairing mechanism. Moreover, the detailed analysis of the normal-state transport properties evidenced non-Fermi-liquid behavior and the dramatic enhancement of the quasiparticle effective mass near P(c) associated with the magnetic quantum fluctuations.

  5. Magnet tests and status of the superconducting electron cyclotron resonance source SERSE

    Energy Technology Data Exchange (ETDEWEB)

    Ciavola, G.; Gammino, S.; Cafici, M.; Castro, M.; Chines, F.; Marletta, S. [INFN-Laboratorio Nazionale del Sud, Via S. Sofia 44, 95123 Catania (Italy); Alessandria, F. [INFN-LASA, Via F.lli Cervi 201, 20090 Segrate (Midway Islands) (Italy); Bourg, F.; Briand, P.; Melin, G.; Lagnier, R.; Seyfert, P. [CEA-Departement de Recherche Fondamentale sur la Matiere Condensee, Centre detudes Nucleaires de Grenoble, 38054 Grenoble Cedex 9 (France); Gaggero, G.; Losasso, M.; Penco, R. [ANSALDO-GIE, Via N. Lorenzi 8, 16152 Genova (Italy)

    1996-03-01

    At Laboratorio Nazionale del Sud a superconducting 14.5 GHz electron cyclotron resonance (ECR) source will be used as injector for the K-800 superconducting cyclotron. The original project of its magnetic system has been upgraded by taking into account the results of the high B mode operation of the 6.4 GHz SC-ECRIS at MSU-NSCL and now the mirror field may achieve 2.7 T, which is much higher than the confining field of any other ECR source. The magnet design will allow us to operate in a wide range of magnetic configurations making it easy to tune the source. The status of the project will be outlined and the preliminary results of the tests of the superconducting magnets will be described. A brief description of the tests to be carried out on the source during the first period of operation on the test bench in Grenoble follows. {copyright} {ital 1996 American Institute of Physics.}

  6. Beam commissioning for a superconducting proton linac

    Science.gov (United States)

    Wang, Zhi-Jun; He, Yuan; Jia, Huan; Dou, Wei-ping; Chen, Wei-long; Zhang, X. L.; Liu, Shu-hui; Feng, Chi; Tao, Yue; Wang, Wang-sheng; Wu, Jian-qiang; Zhang, Sheng-hu; Zhao, Hong-Wei

    2016-12-01

    To develop the next generation of safe and cleaner nuclear energy, the accelerator-driven subcritical (ADS) system emerges as one of the most attractive technologies. It will be able to transmute the long-lived transuranic radionuclides produced in the reactors of today's nuclear power plants into shorter-lived ones, and also it will provide positive energy output at the same time. The prototype of the Chinese ADS (C-ADS) proton accelerator comprises two injectors and a 1.5 GeV, 10 mA continuous wave (CW) superconducting main linac. The injector scheme II at the C-ADS demo facility inside the Institute of Modern Physics is a 10 MeV CW superconducting linac with a designed beam current of 10 mA, which includes an ECR ion source, a low-energy beam transport line, a 162.5 MHz radio frequency quadrupole accelerator, a medium-energy beam transport line, and a superconducting half wave resonator accelerator section. This demo facility has been successfully operating with an 11 mA, 2.7 MeV CW beam and a 3.9 mA, 4.3 MeV CW beam at different times and conditions since June 2014. The beam power has reached 28 kW, which is the highest record for the same type of linear accelerators. In this paper, the parameters of the test injector II and the progress of the beam commissioning are reported.

  7. Generation of a recombinant single-chain variable fragment (scFv) targeting 5-methyl-2'-deoxycytidine.

    Science.gov (United States)

    Ohshima, Motohiro; Tadakuma, Tomomi; Hayashi, Hideki; Inoue, Kazuyuki; Itoh, Kunihiko

    2010-01-01

    We generated a single-chain variable fragment (scFv) against 5-methyl-2'-deoxycytidine (m(5)dCyd) using phage display technology. The heavy and light chain variable region genes were amplified by the polymerase chain reaction (PCR) from hybridoma cell line FMC9 and assembled as an scFv fragment with a flexible linker (Gly(4)-Ser)(3). The scFv DNA fragment was then cloned into pCANTAB-5E, and a phage displaying the scFv was produced. Antigen-positive phage clones were successfully selected by enzyme-linked immunosorbent assay (ELISA). The scFv was modified with FLAG and His tags for detection and purification. The scFv reacted strongly with m(5)dCyd and weakly with 5-methylcytidine (m(5)Cyd) but not with cytidine (Cyd) and 1-methyladenosine in a manner similar to the monoclonal antibody (MoAb). Although the specificities of scFv and MoAb were almost identical, the sensitivity of the scFv (IC(50) 0.054 microg/ml) was approximately 80 times higher than that of the parent MoAb (IC(50) 4.27 microg/ml), determined by inhibition ELISA. As a biochemical application of this scFv, we quantified the m(5)dCyd content of genomic DNA by enzymatic hydrolysis using inhibition ELISA. The cancer cell lines HeLa, HeLa S3 and MDA-MB-453 contained approximately 1% of the methylated DNA in total genomic DNA, as did peripheral blood cell genomic DNA from healthy volunteers, but HT29 and T-47D showed hypomethylation compared with the HeLa, HeLa S3 and MDA-MB-453 cell lines. The scFv generated here may be applicable to the assessment of cellular DNA methylation levels and is more sensitive than the MoAb.

  8. The Danish Superconducting Cable Project

    DEFF Research Database (Denmark)

    Tønnesen, Ole

    1997-01-01

    The design and construction of a superconducting cable is described. The cable has a room temperature dielectric design with the cryostat placed inside the electrical insulation.BSCCO 2223 superconducting tapes wound in helix form around a former are used as the cable conductor. Results from...

  9. Superconducting bearings for flywheel applications

    DEFF Research Database (Denmark)

    Abrahamsen, A.B.

    2001-01-01

    A literature study on the application of superconducting bearings in energy storage flywheel systems. The physics of magnetic levitation and superconductors are presented in the first part of the report, followed by a discussion of the literature found onthe applications of superconducting bearings...

  10. Two-dimensional topological superconducting phases emerged from d-wave superconductors in proximity to antiferromagnets

    Science.gov (United States)

    Zhu, Guo-Yi; Wang, Ziqiang; Zhang, Guang-Ming

    2017-05-01

    Motivated by the recent observations of nodeless superconductivity in the monolayer CuO2 grown on the Bi2Sr2CaCu2O8+δ substrates, we study the two-dimensional superconducting (SC) phases described by the two-dimensional t\\text-J model in proximity to an antiferromagnetic (AF) insulator. We found that i) the nodal d-wave SC state can be driven via a continuous transition into a nodeless d-wave pairing state by the proximity-induced AF field. ii) The energetically favorable pairing states in the strong field regime have extended s-wave symmetry and can be nodal or nodeless. iii) Between the pure d-wave and s-wave paired phases, there emerge two topologically distinct SC phases with (s+\\text{i}d) symmetry, i.e., the weak and strong pairing phases, and the weak pairing phase is found to be a Z 2 topological superconductor protected by valley symmetry, exhibiting robust gapless nonchiral edge modes. These findings strongly suggest that the high-T c superconductors in proximity to antiferromagnets can realize fully gapped symmetry-protected topological SC.

  11. Mass measurement of 56Sc reveals a small A=56 odd-even mass staggering, implying a cooler accreted neutron star crust

    CERN Document Server

    Meisel, Z; Ahn, S; Bazin, D; Brown, B A; Browne, J; Carpino, J F; Chung, H; Cole, A L; Cyburt, R H; Estradé, A; Famiano, M; Gade, A; Langer, C; Matoš, M; Mittig, W; Montes, F; Morrissey, D J; Pereira, J; Schatz, H; Schatz, J; Scott, M; Shapira, D; Smith, K; Stevens, J; Tan, W; Tarasov, O; Towers, S; Wimmer, K; Winkelbauer, J R; Yurkon, J; Zegers, R G T

    2015-01-01

    We present the mass excesses of 52-57Sc, obtained from recent time-of-flight nuclear mass measurements at the National Superconducting Cyclotron Laboratory at Michigan State University. The masses of 56Sc and 57Sc were determined for the first time with atomic mass excesses of -24.85(59)(+0 -54) MeV and -21.0(1.3) MeV, respectively, where the asymmetric uncertainty for 56Sc was included due to possible contamination from a long-lived isomer. The 56Sc mass indicates a small odd-even mass staggering in the A = 56 mass-chain towards the neutron drip line, significantly deviating from trends predicted by the global FRDM mass model and favoring trends predicted by the UNEDF0 and UNEDF1 density functional calculations. Together with new shell-model calculations of the electron-capture strength function of 56Sc, our results strongly reduce uncertainties in model calculations of the heating and cooling at the 56Ti electron-capture layer in the outer crust of accreting neutron stars. We found that, in contrast to prev...

  12. Superconductivity in a chiral nanotube

    Science.gov (United States)

    Qin, F.; Shi, W.; Ideue, T.; Yoshida, M.; Zak, A.; Tenne, R.; Kikitsu, T.; Inoue, D.; Hashizume, D.; Iwasa, Y.

    2017-02-01

    Chirality of materials are known to affect optical, magnetic and electric properties, causing a variety of nontrivial phenomena such as circular dichiroism for chiral molecules, magnetic Skyrmions in chiral magnets and nonreciprocal carrier transport in chiral conductors. On the other hand, effect of chirality on superconducting transport has not been known. Here we report the nonreciprocity of superconductivity--unambiguous evidence of superconductivity reflecting chiral structure in which the forward and backward supercurrent flows are not equivalent because of inversion symmetry breaking. Such superconductivity is realized via ionic gating in individual chiral nanotubes of tungsten disulfide. The nonreciprocal signal is significantly enhanced in the superconducting state, being associated with unprecedented quantum Little-Parks oscillations originating from the interference of supercurrent along the circumference of the nanotube. The present results indicate that the nonreciprocity is a viable approach toward the superconductors with chiral or noncentrosymmetric structures.

  13. Pair density wave superconducting states and statistical mechanics of dimers

    Science.gov (United States)

    Soto Garrido, Rodrigo Andres

    3 we show that the pair-density-wave superconducting state emergent in extended Heisenberg-Hubbard models in two-leg ladders is topological in the presence of an Ising spin symmetry and supports a Majorana zero mode (MZM) at an open boundary and at a junction with a uniform d-wave one-dimensional superconductor. Similarly to a conventional finite-momentum paired state, the order parameter of the PDW state is a charge-2e field with finite momentum. However, the order parameter here is a quartic electron operator and conventional mean-field theory cannot be applied to study this state. We use bosonization to show that the 1D PDW state has a MZM at a boundary. This superconducting state is an exotic topological phase supporting Majorana fermions with finite-momentum pairing fields and charge-4e superconductivity. In chapter 4 we provide a quasi-one-dimensional model which can support a PDW state. The model consists of an array of strongly-interacting one-dimensional systems, where the one-dimensional systems are coupled to each other by local interactions.Within the interchain mean-field theory (MFT), we find several SC states from the model, including a conventional uniform SC state, PDW SC state, and a coexisting phase of the uniform SC and PDW states. In this quasi-1D regime we can treat the strong correlation physics essentially exactly using bosonization methods and the crossover to the 2D system by means of interchain MFT. The resulting critical temperatures of the SC phases generically exhibit a power-law scaling with the coupling constants of the array, instead of the essential singularity found in weak-coupling BCS-type theories. Electronic excitations with an open Fermi surface, which emerge from the electronic Luttinger liquid systems below their crossover temperature to the Fermi liquid, are then coupled to the SC order parameters via the proximity effect. From the Fermi surface thus coupled to the SC order parameters, we calculate the quasiparticle

  14. A preliminary study of the feasibility of using superconducting quarter-wave resonators for accelerating high intensity proton beams

    Institute of Scientific and Technical Information of China (English)

    YANG Liu; LU Xiang-Yang; QUAN Sheng-Wen; YAO Zhong-Yuan; LUO Xing; ZHOU Kui

    2012-01-01

    The superconducting (SC) cavities currently used for the acceleration of protons at a low velocity range are based on half-wave resonators.Due to the rising demand on high current,the issue of beam loading and space-charge problems has arisen.Qualities of low cost and high accelerating efficiency are required for SC cavities,which are properly fitted by using SC quarter-wave resonators (QWR).We propose a concept of using QWRs with frequency 162.5 MHz to accelerate high current proton beams.The main factor limiting SC QWRs being applied to high current proton beams is vertical beam steering,which is dominantly caused by the magnetic field on axis.In this paper,we intend to analyze steering and eliminate it to verify the qualification of using QWRs to accelerate high intensity proton beams.

  15. Effect of the time-dependent coupling on a superconducting qubit-field system under decoherence: Entanglement and Wehrl entropy

    Energy Technology Data Exchange (ETDEWEB)

    Abdel-Khalek, S., E-mail: sayedquantum@yahoo.co.uk [Mathematics Department, Faculty of Science, Sohag University, 82524 Sohag (Egypt); The Abdus Salam International Centre for Theoretical Physics, Strada Costiera 11, Miramare-Trieste (Italy); Berrada, K. [The Abdus Salam International Centre for Theoretical Physics, Strada Costiera 11, Miramare-Trieste (Italy); Al Imam Mohammad Ibn Saud Islamic University (IMSIU), College of Science, Department of Physics, Riyadh (Saudi Arabia); Eleuch, H. [Department of Physics, McGill University, 3600 rue University, Montreal, QC, H3A 2T8 (Canada); Department of Physics, Université de Montréal, 2900 boul. douard-Montpetit, Montreal, QC, H3T 1J4 (Canada)

    2015-10-15

    The dynamics of a superconducting (SC) qubit interacting with a field under decoherence with and without time-dependent coupling effect is analyzed. Quantum features like the collapse–revivals for the dynamics of population inversion, sudden birth and sudden death of entanglement, and statistical properties are investigated under the phase damping effect. Analytic results for certain parametric conditions are obtained. We analyze the influence of decoherence on the negativity and Wehrl entropy for different values of the physical parameters. We also explore an interesting relation between the SC-field entanglement and Wehrl entropy behavior during the time evolution. We show that the amount of SC-field entanglement can be enhanced as the field tends to be more classical. The studied model of SC-field system with the time-dependent coupling has high practical importance due to their experimental accessibility which may open new perspectives in different tasks of quantum formation processing.

  16. Balloon-Borne Superconducting Integrated Receiver for Atmospheric Research

    NARCIS (Netherlands)

    Kiselev, Oleg; Birk, Manfred; Ermakov, Andrey; Filippenko, Lyudmila; Golstein, Hans; Hoogeveen, Ruud; Kinev, Nickolay; van Kuik, Bart; de Lange, Arno; de Lange, Gert; Yagoubov, Pavel; Koshelets, Valery

    2011-01-01

    A Superconducting Integrated Receiver (SIR) was proposed more than 10 years ago and has since then been developed up to the point of practical applications. We have demonstrated for the first time the capabilities of the SIR technology for heterodyne spectroscopy both in the laboratory and at remote

  17. Superconducting dipole electromagnet

    Science.gov (United States)

    Purcell, John R.

    1977-07-26

    A dipole electromagnet of especial use for bending beams in particle accelerators is wound to have high uniformity of magnetic field across a cross section and to decrease evenly to zero as the ends of the electromagnet are approached by disposing the superconducting filaments of the coil in the crescent-shaped nonoverlapping portions of two intersecting circles. Uniform decrease at the ends is achieved by causing the circles to overlap increasingly in the direction of the ends of the coil until the overlap is complete and the coil is terminated.

  18. Superconductivity from correlated hopping

    CERN Document Server

    Batista, C D; Aligia, A A

    1995-01-01

    We consider a chain described by a next-nearest-neighbor hopping combined with a nearest-neighbor spin flip. In two dimensions this three-body term arises from a mapping of the three-band Hubbard model for CuO$_2$ planes to a generalized $t-J$ model and for large O-O hopping favors resonance-valence-bond superconductivity of predominantly $d$-wave symmetry. Solving the ground state and low-energy excitations by analytical and numerical methods we find that the chain is a Luther-Emery liquid with correlation exponent $K_{\\rho} = (2-n)^2/2$, where $n$ is the particle density.

  19. Superconductivity in nanowires

    CERN Document Server

    Bezryadin, Alexey

    2012-01-01

    The importance and actuality of nanotechnology is unabated and will be for years to come. A main challenge is to understand the various properties of certain nanostructures, and how to generate structures with specific properties for use in actual applications in Electrical Engineering and Medicine.One of the most important structures are nanowires, in particular superconducting ones. They are highly promising for future electronics, transporting current without resistance and at scales of a few nanometers. To fabricate wires to certain defined standards however, is a major challenge, and so i

  20. Introduction to superconductivity

    CERN Document Server

    Rose-Innes, AC

    1978-01-01

    Introduction to Superconductivity differs from the first edition chiefly in Chapter 11, which has been almost completely rewritten to give a more physically-based picture of the effects arising from the long-range coherence of the electron-waves in superconductors and the operation of quantum interference devices. In this revised second edition, some further modifications have been made to the text and an extra chapter dealing with """"high-temperature"""" superconductors has been added. A vast amount of research has been carried out on these since their discovery in 1986 but the results, both

  1. Superconducting Electronic Film Structures

    Science.gov (United States)

    1991-02-14

    cubic, yttria stabilized, zirconia (YSZ) single crystals with (100) orientation and ao = 0.512 to 0.516 nm. Films were magnetron-sputtered... Crown by Solid-State and Vapor-Phase Epitaxy," IEEE Trans. Uagn. 25(2), 2538 (1989). 6. J. H. Kang, R. T. Kampwirth, and K. E. Gray, "Superconductivity...summarized in Fig. 1, are too high for SrTiO3 or yttria- stabilized zirconia (YSZ) to be used in rf applications. MgO, LaAIO 3 , and LaGaO3 have a tan 6

  2. Heavy fermion superconductivity

    Science.gov (United States)

    Brison, Jean-Pascal; Glémot, Loı̈c; Suderow, Hermann; Huxley, Andrew; Kambe, Shinsaku; Flouquet, Jacques

    2000-05-01

    The quest for a precise identification of the symmetry of the order parameter in heavy fermion systems has really started with the discovery of the complex superconducting phase diagram in UPt 3. About 10 years latter, despite numerous experiments and theoretical efforts, this is still not achieved, and we will quickly review the present status of knowledge and the main open question. Actually, the more forsaken issue of the nature of the pairing mechanism has been recently tackled by different groups with macroscopic or microscopic measurement, and significant progress have been obtained. We will discuss the results emerging from these recent studies which all support non-phonon-mediated mechanisms.

  3. Investigation of Beam Dynamics in the Superconducting Synchrocyclotron for Proton Therapy

    Institute of Scientific and Technical Information of China (English)

    LI; Ming; ZHANG; Tian-jue

    2013-01-01

    With development of the superconducting technology,synchrocyclotron can be made very small through extreme high field,the structure of which is simple.So the synchrocyclotron is very suitable to be installed in the hospital for proton therapy.CIAE planned to build a 230 MeV superconducting synchrocyclotron,which is listed in the project of"Dragon 2020"and the key technology study is an

  4. Battery energy storage and superconducting magnetic energy storage for utility applications: A qualitative analysis

    Energy Technology Data Exchange (ETDEWEB)

    Akhil, A.A.; Butler, P.; Bickel, T.C.

    1993-11-01

    This report was prepared at the request of the US Department of Energy`s Office of Energy Management for an objective comparison of the merits of battery energy storage with superconducting magnetic energy storage technology for utility applications. Conclusions are drawn regarding the best match of each technology with these utility application requirements. Staff from the Utility Battery Storage Systems Program and the superconductivity Programs at Sandia National contributed to this effort.

  5. ScVO4 under non-hydrostatic compression: a new metastable polymorph

    Science.gov (United States)

    Garg, Alka B.; Errandonea, D.; Rodríguez-Hernández, P.; Muñoz, A.

    2017-02-01

    The high-pressure (HP) behaviour of scandium vanadate (ScVO4) is investigated under non-hydrostatic compression. The compound is studied by means of synchrotron-based powder x-ray diffraction (XRD) and optical-absorption techniques. The occurrence of a non-reversible phase transition is detected. The transition is from the zircon structure to the fergusonite-type structure and takes place around 6 GPa with nearly 10% volume discontinuity. XRD measurements on the pressure cycled sample confirm for the first time that the fergusonite-type ScVO4 can be recovered as the metastable phase at ambient conditions. Raman spectroscopic measurements verify the metastable phase to be of a fergusonite-type phase. Theoretical calculations also corroborate the experimental findings. The fergusonite phase is found to be stiffer than the ambient-pressure zircon phase, as indicated by the observed experimental and theoretical bulk moduli. The optical properties and lattice-dynamics calculation of the fergusonite ScVO4 are discussed. At ambient pressure the band gap of the zircon (fergusonite)-type ScVO4 is 2.75 eV (2.3 eV). This fact suggests that the novel metastable polymorph of ScVO4 can have applications in green technologies; for instance, it can be used as photocatalytic material for hydrogen production by water splitting.

  6. A Study to Develop an Industrial-Scale, Computer-Controlled High Magnetic Field Processing (HMFP) System to Assist in Commercializing the Novel, Enabling HMFP Manufacturing Technology

    Energy Technology Data Exchange (ETDEWEB)

    Ludtka, Gail Mackiewicz- [ORNL; Chourey, Aashish [American Magnetics Inc.

    2010-08-01

    As the original magnet designer and manufacturer of ORNL s 9T, 5-inch ID bore magnet, American Magnetics Inc. (AMI) has collaborated with ORNL s Materials Processing Group s and this partnership has been instrumental in the development of our unique thermo-magnetic facilities and expertise. Consequently, AMI and ORNL have realized that the commercial implementation of the High Magnetic Field Processing (HMFP) technology will require the evolution of robust, automated superconducting (SC) magnet systems that will be cost-effective and easy to operate in an industrial environment. The goal of this project and CRADA is to significantly expedite the timeline for implementing this revolutionary and pervasive cross-cutting technology for future US produced industrial components. The successful completion of this project is anticipated to significantly assist in the timely commercialization and licensing of our HMFP intellectual property for a broad spectrum of industries; and to open up a new market for AMI. One notable outcome of this project is that the ThermoMagnetic Processing Technology WON a prestigious 2009 R&D 100 Awards. This award acknowledges and recognizes our TMP Technology as one of the top 100 innovative US technologies in 2009. By successfully establishing the design requirements for a commercial scale magnetic processing system, this project effort has accomplished a key first step in facilitating the building and demonstration of a superconducting magnetic processing coil, enabling the transition of the High Magnetic Field Processing Technology beyond a laboratory novelty into a commercially viable and industrially scalable Manufacturing Technology.

  7. Relativistic Quantum Teleportation with superconducting circuits

    CERN Document Server

    Friis, Nicolai; Truong, Kevin; Sabín, Carlos; Solano, Enrique; Johansson, Göran; Fuentes, Ivette

    2012-01-01

    We study the effects of relativistic motion on quantum teleportation and propose a realizable experiment where our results can be tested. We compute bounds on the optimal fidelity of teleportation when one of the observers undergoes non-uniform motion for a finite time. The upper bound to the optimal fidelity is degraded due to the observer's motion however, we discuss how this degradation can be corrected. These effects are observable for experimental parameters that are within reach of cutting-edge superconducting technology.

  8. A New Superconducting Wire for Future Accelerators

    CERN Multimedia

    2006-01-01

    The CARE/NED project has developed a new superconducting wire that can achieve very high currents (1400 amps) at high magnetic fields (12 teslas). Cross-section of the CARE/NED wire produced by SMI. As we prepare to enter a new phase of particle physics with the LHC, technological development is a continuous process to ensure the demands of future research are met. The next generation of colliders and upgrades of the present ones will require significantly larger magnetic fields for bending and focusing the particle beams. NED (Next European Dipole) is one of the projects taking on this challenge to push technology beyond the present limit (see: More about NED). The magnets in the LHC rely on niobium titanium (NbTi) as the superconducting material, with a maximum magnetic field of 8 to 10T (tesla). In order to exceed this limitation, a different material together with the corresponding technology needs to be developed. NED is assessing the suitability of niobium tin (Nb3Sn), which has the potential to at le...

  9. Parameters of superfine interactions in Laves ScFe sub 2 alloy with hexagonal MnZn sub 2 structure

    CERN Document Server

    Pokatilov, V S

    2001-01-01

    The superfine fields, amplification coefficients and quadrupole splitting on the sup 4 sup 5 Sc nuclei in the ScFe sub 2 , Sc sub 0 sub . sub 9 sub 5 Fe sub 2 sub . sub 0 sub 5 and ScFe sub 1 sub . sub 9 sub 7 Al sub 0 sub . sub 0 sub 3 alloys are measured at the room temperature and 77 K through the method of the nuclear magnetic resonance (NMR). The NMR spectra peculiarities are studied and the superfine field shifts on the sup 4 sup 5 Sc nuclei in the considered alloys by appearance of the Fe atoms at the Sc atoms places and the Al atoms at the Fe atoms places in the Sc atoms nearest coordination sphere are determined. It is established that the electron quadrupole splitting in the considered alloys does not depend on the technology of obtaining the samples, on insignificant deviations from the alloy stoichiometric composition or on the minor additions of the Al atoms

  10. Superconducting magnets for MRI

    Energy Technology Data Exchange (ETDEWEB)

    Williams, J.E.

    1984-08-01

    Three types of magnets are currently used to provide the background field required for magnet resonance imaging (MRI). (i) Permanent magnets produce fields of up to 0.3 T in volumes sufficient for imaging the head or up to 0.15 T for whole body imaging. Cost and simplicity of operation are advantages, but relatively low field, weight (up to 100 tonnes) and, to a small extent, instability are limitations. (ii) Water-cooled magnets provide fields of up to 0.25 T in volumes suitable for whole body imaging, but at the expense of power (up to 150 kW for 0.25 T) and water-cooling. Thermal stability of the field requires the maintenance of constant temperature through periods both of use and of quiescence. (iii) Because of the limitations imposed by permanent and resistive magnets, particularly on field strength, the superconducting magnet is now most widely used to provide background fields of up to 2 T for whole body MRI. It requires very low operating power and that only for refrigeration. Because of the constant low temperature, 4.2 K, at which its stressed structure operates, its field is stable. The following review deals principally with superconducting magnets for MRI. However, the sections on field analysis apply to all types of magnet and the description of the source terms of circular coils and of the principals of design of solenoids apply equally to resistive solenoidal magnets.

  11. Superconducting properties of MgB2 from first principles.

    Science.gov (United States)

    Floris, A; Profeta, G; Lathiotakis, N N; Lüders, M; Marques, M A L; Franchini, C; Gross, E K U; Continenza, A; Massidda, S

    2005-01-28

    Solid MgB(2) has rather interesting and technologically important properties, such as a very high superconducting transition temperature. Focusing on this compound, we report the first nontrivial application of a novel density-functional-type theory for superconductors, recently proposed by the authors. Without invoking any adjustable parameters, we obtain the transition temperature, the gaps, and the specific heat of MgB(2) in very good agreement with experiment. Moreover, our calculations show how the Coulomb interaction acts differently on sigma and pi states, thereby stabilizing the observed superconducting phase.

  12. Using Superconducting Qubit Circuits to Engineer Exotic Lattice Systems

    Science.gov (United States)

    Tsomokos, Dimitris; Ashhab, Sahel; Nori, Franco

    2011-03-01

    We propose an architecture based on superconducting qubits and resonators for the implementation of a variety of exotic lattice systems, such as spin and Hubbard models in higher or fractal dimensions and higher-genus topologies. Spin systems are realized naturally using qubits, while superconducting resonators can be used for the realization of Bose-Hubbard models. Fundamental requirements for these designs, such as controllable interactions between arbitrary qubit pairs, have recently been implemented in the laboratory, rendering our proposals feasible with current technology.

  13. The current status of high temperature superconducting wires

    Science.gov (United States)

    Mikhailov, B. P.; Burkhanov, G. S.

    1991-12-01

    The principal technological difficulties associated with the manufacture of high temperature superconducting (HTSC) wires based on yttrium and lanthanum ceramics are briefly reviewed. It is noted that the superconducting and mechanical properties of HTSC wires or ribbons are largely determined by their microstructure. Particular attention is given to the currently used method of producing HTSC wires whereby the ceramic powder is encased in a pipe shell and then deformed by different methods, such as rolling, drawing, or pressing. The requirements for the shell material are examined, and current densities are presented for HTSC wires produced in shells of copper, silver, aluminum, nickel, stainless steel, and zirconium.

  14. First prototype Copper-Niobium RF Superconducting Cavity

    CERN Multimedia

    1983-01-01

    This is the first RF superconducting cavity made of copper with a very thin layer of pure niobium deposited on the inner wall by sputtering. This new developpment lead to a considerable increase of performance and stability of superconducting cavities and to non-negligible economy. The work was carried out in the ISR workshop. This technique was adopted for the LEP II accelerating cavities. At the centre is Cristoforo Benvenuti, inventor of this important technology, with his assistants, Nadia Circelli and Max Hauer, carrying the sputtering electrode. See also 8209255, 8312339.

  15. High temperature superconductivity space experiment (HTSSE)

    Science.gov (United States)

    Ritter, J. C.; Nisenoff, M.; Price, G.; Wolf, S. A.

    1991-01-01

    An experiment dealing with high-temperature superconducting devices and components in space is discussed. A variety of devices (primarily passive microwave and millimeter-wave components) has been procured and will be integrated with a cryogenic refrigerating and data acquisition system to form the space package, which will be launched in late 1992. This space experiment is expected to demonstrate that this technology is sufficiently robust to survive the space environment and that the technology has the potential to improve the operation of space systems significantly. The devices for the initial launch have been evaluated electrically, thermally, and mechanically, and will be integrated into the final space package early in 1991. The performance of the devices is summarized, and some potential applications of this technology in space systems are outlined.

  16. Innovative quantum technologies for microgravity fundamental physics and biological research

    Science.gov (United States)

    Kierk, I. K.

    2002-01-01

    This paper presents a new technology program, within the fundamental physics, focusing on four quantum technology areas: quantum atomics, quantum optics, space superconductivity and quantum sensor technology, and quantum field based sensor and modeling technology.

  17. Innovative quantum technologies for microgravity fundamental physics and biological research

    Science.gov (United States)

    Kierk, I. K.

    2002-01-01

    This paper presents a new technology program, within the fundamental physics, focusing on four quantum technology areas: quantum atomics, quantum optics, space superconductivity and quantum sensor technology, and quantum field based sensor and modeling technology.

  18. ViSC Social Competence Program.

    Science.gov (United States)

    Strohmeier, Dagmar; Hoffmann, Christine; Schiller, Eva-Maria; Stefanek, Elisabeth; Spiel, Christiane

    2012-01-01

    The ViSC Social Competence Program has been implemented in Austrian schools within the scope of a national strategy plan, Together Against Violence. The program is a primary preventive program designed for grades 5 to 8. The prevention of aggression and bullying is defined as a school development task, and the initial implementation of the program lasts one school year. The program consists of universal and specific actions that are implemented through in-school teacher training and a class project for students. The program was evaluated with a randomized intervention control group design. Data were collected from teachers and students. Results suggest that the program reduces aggression in schools.

  19. Superconductivity in doped Dirac semimetals

    Science.gov (United States)

    Hashimoto, Tatsuki; Kobayashi, Shingo; Tanaka, Yukio; Sato, Masatoshi

    2016-07-01

    We theoretically study intrinsic superconductivity in doped Dirac semimetals. Dirac semimetals host bulk Dirac points, which are formed by doubly degenerate bands, so the Hamiltonian is described by a 4 ×4 matrix and six types of k -independent pair potentials are allowed by the Fermi-Dirac statistics. We show that the unique spin-orbit coupling leads to characteristic superconducting gap structures and d vectors on the Fermi surface and the electron-electron interaction between intra and interorbitals gives a novel phase diagram of superconductivity. It is found that when the interorbital attraction is dominant, an unconventional superconducting state with point nodes appears. To verify the experimental signature of possible superconducting states, we calculate the temperature dependence of bulk physical properties such as electronic specific heat and spin susceptibility and surface state. In the unconventional superconducting phase, either dispersive or flat Andreev bound states appear between point nodes, which leads to double peaks or a single peak in the surface density of states, respectively. As a result, possible superconducting states can be distinguished by combining bulk and surface measurements.

  20. Meissner effect in superconducting microtraps

    Energy Technology Data Exchange (ETDEWEB)

    Cano, Daniel

    2009-04-30

    This thesis investigates the impact of the Meissner effect on magnetic microtraps for ultracold atoms near superconducting microstructures. This task has been accomplished both theoretically and experimentally. The Meissner effect distorts the magnetic fields near superconducting surfaces, thus altering the parameters of magnetic microtraps. Both computer simulations and experimental measurements demonstrate that the Meissner effect shortens the distance between the magnetic microtrap and the superconducting surface, reduces the magnetic-field gradients and dramatically lowers the trap depth. A novel numerical method for calculating magnetic fields in atom chips with superconducting microstructures has been developed. This numerical method overcomes the geometrical limitations of other calculation techniques and can solve superconducting microstructures of arbitrary geometry. The numerical method has been used to calculate the parameters of magnetic microtraps in computer-simulated chips containing thin-film wires. Simulations were carried out for both the superconducting and the normal-conducting state, and the differences between the two cases were analyzed. Computer simulations have been contrasted with experimental measurements. The experimental apparatus generates a magnetic microtrap for ultracold Rubidium atoms near a superconducting Niobium wire of circular cross section. The design and construction of the apparatus has met the challenge of integrating the techniques for producing atomic quantum gases with the techniques for cooling solid bodies to cryogenic temperatures. By monitoring the position of the atom cloud, one can observe how the Meissner effect influences the magnetic microtrap. (orig.)

  1. First Demonstration of Electron Beam Generation and Characterization with an All Superconducting Radio-frequency (SRF) Photoinjector

    Energy Technology Data Exchange (ETDEWEB)

    Kamps, T; Barday, R; Jankowiak, A; Knobloch, J; Kugeler, O; Matveenko, A N; Neumann, A; Quast, T; Rudolph, J; Schubert, S G; Volker, J; Kneisel, P; Nietubyc, R; Sekutowicz, J K; Smedley, J; Volkov, V; Weinberg, G

    2011-09-01

    In preparation for a high brightness, high average current electron source for the energy-recovery linac BERLinPro an all superconducting radio-frequency photoinjector is now in operation at Helmholtz-Zentrum Berlin. The aim of this experiment is beam demonstration with a high brightness electron source able to generate sub-ps pulse length electron bunches from a superconducting (SC) cathode film made of Pb coated on the backwall of a Nb SRF cavity. This paper describes the setup of the experiment and first results from beam measurements.

  2. Design of SuSI - superconducting source for ions at NSCL/MSU - II. The conventional parts

    Energy Technology Data Exchange (ETDEWEB)

    Zavodszky, P.A. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States)]. E-mail: zavodszky@nscl.msu.edu; Arend, B. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Cole, D. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); DeKamp, J. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Machicoane, G. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Marti, F. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Miller, P. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Moskalik, J. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Ottarson, J. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Vincent, J. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States); Zeller, A. [National Superconducting Cyclotron Laboratory, Michigan State University, 1 Cyclotron Road, East Lansing, MI 48824 (United States)

    2005-12-15

    An ECR ion source is being designed to initially serve as a test bench for development and later will replace the existing 6.4 GHz SC-ECRIS. This ECRIS will operate at 18 + 14.5 GHz microwave frequencies. The radial magnetic field will be produced by six superconducting hexapole coils, capable to reach 1.5 T at the aluminum plasma chamber wall (R = 50 mm). The axial trapping will be produced with six superconducting solenoids enclosed in an iron yoke. We will present the conventional parts of this ion source design: plasma chamber, injection and extraction hardware design and principles of the associated test beamline.

  3. DK SUPERCONDUCTING TAPE TECHNOLOGY 2002-2003

    DEFF Research Database (Denmark)

    Nielsen, Morten Storgaard; Andersen, Niels Hessel; Eriksen, Morten;

    Report on the work performed by AFM, Risø and IPL, DTU in collaboration with NST A/S and Haldor Topsøe A/S within the Danish Energy Research Program EFP, DK SUPERLEDERE I ELSEKTOREN 2002-2003......Report on the work performed by AFM, Risø and IPL, DTU in collaboration with NST A/S and Haldor Topsøe A/S within the Danish Energy Research Program EFP, DK SUPERLEDERE I ELSEKTOREN 2002-2003...

  4. Superconducting Materials and Conductors : Fabrication and Limiting Parameters

    CERN Document Server

    Bottura, Luca

    2012-01-01

    Superconductivity is the technology that enabled the construction of the most recent generation of high-energy particle accelerators, the largest scientific instruments ever built. In this review we trace the evolution of superconducting materials for particle accelerator magnets, from the first steps in the late 1960s, through the rise and glory of Nb–Ti in the 1970s, till the 2010s, and the promises of Nb3Sn for the 2020s. We conclude with a perspective on the opportunities for high-temperature superconductors (HTSs). Many such reviews have been written in the past, as witnessed by the long list of references provided. In this review we put particular emphasis on the practical aspects of wire and tape manufacturing, cabling, engineering performance, and potential for use in accelerator magnets, while leaving in the background matters such as the physics of superconductivity and fundamental material issues.

  5. Superconducting light generator for large offshore wind turbines

    Science.gov (United States)

    Sanz, S.; Arlaban, T.; Manzanas, R.; Tropeano, M.; Funke, R.; Kováč, P.; Yang, Y.; Neumann, H.; Mondesert, B.

    2014-05-01

    Offshore wind market demands higher power rate and reliable turbines in order to optimize capital and operational cost. These requests are difficult to overcome with conventional generator technologies due to a significant weight and cost increase with the scaling up. Thus superconducting materials appears as a prominent solution for wind generators, based on their capacity to held high current densities with very small losses, which permits to efficiently replace copper conductors mainly in the rotor field coils. However the state-of-the-art superconducting generator concepts still seem to be expensive and technically challenging for the marine environment. This paper describes a 10 MW class novel direct drive superconducting generator, based on MgB2 wires and a modular cryogen free cooling system, which has been specifically designed for the offshore wind industry needs.

  6. Superconducting Super Collider: A step in the 21st century

    Science.gov (United States)

    McAshan, M.

    1991-08-01

    The development of superconducting materials and the development of helium temperature refrigeration technology have both been propelled by their wide application in large-scale scientific research. The development of materials and technology for the Tevatron proton storage ring at Fermi National Accelerator Laboratory, Batavia, IL USA, in the decade of the seventies provided the basis in the decade of the eighties, for example, for the use of superconducting helium-cooled whole-body magnets for magnetic resonance imaging in medical diagnosis. In the decade of the nineties a number of particle accelerators for high energy physics will be constructed in national and international laboratories around the world. These devices will employ superconductivity on an ambitious scale, and their operation will require more than double the amount of helium refrigeration capacity now installed worldwide. This large increase in the use of helium refrigeration will have a significant effect on the technology and on the industry that produces it. The largest of these accelerator projects is the Superconducting Super Collider (SSC) now under construction at a new laboratory near Dallas, TX USA. This report discusses the development of this cryogenic system for the SSC magnets.

  7. Spinon Superconductivity and Superconductivities Mediated by Spin-Waves and Phonons in Cuprates

    OpenAIRE

    Mourachkine, A.

    1998-01-01

    The disclosure of spinon superconductivity and superconductivity mediated by spin-waves in hole-doped Bi2212 cuprate raises the question about the origin of the superconductivity in other cuprates and specially in an electron-doped NCCO cuprate.

  8. Superconducting interfaces between insulating oxides.

    Science.gov (United States)

    Reyren, N; Thiel, S; Caviglia, A D; Kourkoutis, L Fitting; Hammerl, G; Richter, C; Schneider, C W; Kopp, T; Rüetschi, A-S; Jaccard, D; Gabay, M; Muller, D A; Triscone, J-M; Mannhart, J

    2007-08-31

    At interfaces between complex oxides, electronic systems with unusual electronic properties can be generated. We report on superconductivity in the electron gas formed at the interface between two insulating dielectric perovskite oxides, LaAlO3 and SrTiO3. The behavior of the electron gas is that of a two-dimensional superconductor, confined to a thin sheet at the interface. The superconducting transition temperature of congruent with 200 millikelvin provides a strict upper limit to the thickness of the superconducting layer of congruent with 10 nanometers.

  9. Antiferromagnetic hedgehogs with superconducting cores

    Energy Technology Data Exchange (ETDEWEB)

    Goldbart, P.M.; Sheehy, D.E. [Department of Physics and Materials Research Laboratory, University of Illinois at Urbana-Champaign, Urbana, Illinois 61801 (United States)

    1998-09-01

    Excitations of the antiferromagnetic state that resemble antiferromagnetic hedgehogs at large distances but are predominantly superconducting inside a core region are discussed within the context of Zhang{close_quote}s SO(5)-symmetry-based approach to the physics of high-temperature superconducting materials. Nonsingular, in contrast with their hedgehog cousins in pure antiferromagnetism, these texture excitations are what hedgehogs become when the antiferromagnetic order parameter is permitted to {open_quotes}escape{close_quotes} into superconducting directions. The structure of such excitations is determined in a simple setting, and a number of their experimental implications are examined. {copyright} {ital 1998} {ital The American Physical Society}

  10. Superconducting cable connections and methods

    Energy Technology Data Exchange (ETDEWEB)

    van der Laan, Daniel Cornelis

    2017-09-05

    Superconducting cable connector structures include a terminal body (or other structure) onto which the tapes from the superconducting cable extend. The terminal body (or other structure) has a diameter that is sufficiently larger than the diameter of the former of the superconducting cable, so that the tapes spread out over the outer surface of the terminal body. As a result, gaps are formed between tapes on the terminal body (or other structure). Those gaps are filled with solder (or other suitable flowable conductive material), to provide a current path of relatively high conductivity in the radial direction. Other connector structures omit the terminal body.

  11. Domain wall description of superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Brito, F.A. [Departamento de Física, Universidade Federal de Campina Grande, Caixa Postal 10071, 58109-970 Campina Grande, Paraíba (Brazil); Freire, M.L.F. [Departamento de Física, Universidade Estadual da Paraíba, 58109-753 Campina Grande, Paraíba (Brazil); Mota-Silva, J.C. [Departamento de Física, Universidade Federal de Campina Grande, Caixa Postal 10071, 58109-970 Campina Grande, Paraíba (Brazil); Departamento de Física, Universidade Federal da Paraíba, Caixa Postal 5008, 58051-970 João Pessoa, Paraíba (Brazil)

    2014-01-20

    In the present work we shall address the issue of electrical conductivity in superconductors in the perspective of superconducting domain wall solutions in the realm of field theory. We take our set up made out of a dynamical complex scalar field coupled to gauge field to be responsible for superconductivity and an extra scalar real field that plays the role of superconducting domain walls. The temperature of the system is interpreted through the fact that the soliton following accelerating orbits is a Rindler observer experiencing a thermal bath.

  12. Position resolution of a double junction superconductive detector based on a single material

    Science.gov (United States)

    Samedov, V. V.

    2008-02-01

    The Naples group from Istituto Nazionale di Fisica Nucleare presented the results of theoretical investigations of a new class of superconductive radiation detectors - double junction superconductive detector based on a single material [1]. In such detectors, the absorption of energy occurs in a long superconductive strip while two superconductive tunnel junctions positioned at the ends of the strip provide the readout of the signals. The main peculiarity of this type of detectors is that they are based on a single superconducting material, i.e., without trapping layers at the ends of the strip. In this paper, general approach to the position resolution of this type of detectors has been attempted. The formula for the position resolution is derived. It is shown that the application of the aluminium for the absorber may be the best possible way not only due to the small gap energy, but also mainly for STJ fabrication technology based on the aluminium oxide tunnel barrier.

  13. Superconducting magnetic bearings for machine tools. Phase 1, SBIR program. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Anastas, G.; Bennett, A.; Downer, J.; Hockney, R.

    1988-01-01

    The research was directed toward investigating the role of superconducting materials in a magnetic bearing system. Superconducting magnetic bearings are shown to offer the potential for vastly improved performance. These bearings are expected to be especially applicable to rotors which have extremely tight position tolerances. The development of superconducting magnetic bearing technology is also expected to allow a number of novel approaches in the development of machinery and systems. Researchers studied an alternative bearing design which employs a superconducting coil and eliminates all conventional magnetic structures. The study has resulted in a design definition and detailed analysis for a superconducting bearing system which is sized to roughly duplicate the air bearing system of an existing air-bearing spindle.

  14. Discovery of Superconductivity in Hard Hexagonal ε-NbN.

    Science.gov (United States)

    Zou, Yongtao; Qi, Xintong; Zhang, Cheng; Ma, Shuailing; Zhang, Wei; Li, Ying; Chen, Ting; Wang, Xuebing; Chen, Zhiqiang; Welch, David; Zhu, Pinwen; Liu, Bingbing; Li, Qiang; Cui, Tian; Li, Baosheng

    2016-02-29

    Since the discovery of superconductivity in boron-doped diamond with a critical temperature (TC) near 4 K, great interest has been attracted in hard superconductors such as transition-metal nitrides and carbides. Here we report the new discovery of superconductivity in polycrystalline hexagonal ε-NbN synthesized at high pressure and high temperature. Direct magnetization and electrical resistivity measurements demonstrate that the superconductivity in bulk polycrystalline hexagonal ε-NbN is below ∼11.6 K, which is significantly higher than that for boron-doped diamond. The nature of superconductivity in hexagonal ε-NbN and the physical mechanism for the relatively lower TC have been addressed by the weaker bonding in the Nb-N network, the co-planarity of Nb-N layer as well as its relatively weaker electron-phonon coupling, as compared with the cubic δ-NbN counterpart. Moreover, the newly discovered ε-NbN superconductor remains stable at pressures up to ∼20 GPa and is significantly harder than cubic δ-NbN; it is as hard as sapphire, ultra-incompressible and has a high shear rigidity of 201 GPa to rival hard/superhard material γ-B (∼227 GPa). This exploration opens a new class of highly desirable materials combining the outstanding mechanical/elastic properties with superconductivity, which may be particularly attractive for its technological and engineering applications in extreme environments.

  15. BOOK REVIEW: Assessing Sc1 for GCSE

    Science.gov (United States)

    Reynolds, H.

    2000-01-01

    It is well known that investigations that `fit' the National Curriculum or examination board criteria are few in number. The fair testing emphasis means that pupils all over the country are finding out what affects the rate of a chemical reaction, the rate of photosynthesis or, in the case of Physics, the resistance of a wire. This book focuses on nine of the most common Sc1 investigations and how to prepare for them, manage and assess them. The author, a GCSE examiner, has turned his expertise into a handbook for improving Sc1 performance in the classroom. He has produced a book that would be extremely useful to both newly qualified teachers and experienced teachers. The first aim of the book, however, is to explain the requirements of Sc1. This is done comprehensively with examples of what the jargon means in practice. By breaking down the elements of planning, obtaining evidence, analysing evidence and evaluating, it is easy to see the subtleties of the mark descriptors. At first glance there seems to be little difference between the type of scientific knowledge needed for planning at level 6 and level 8. However, the level 8 statement specifies `detailed' scientific knowledge and understanding, which would mean a student should use equations from physics or symbolic chemical equations to support their arguments. One of the most useful sections in the book details the marking problems that can arise with some investigations. For example, in an investigation into electromagnets it is difficult for students to provide sufficient relevant scientific theory to satisfy the requirements of planning at level 6. One of the problems with Sc1 is that certain requirements, such as graph plotting, are difficult for many students. This book provides exercises that can be given to students to improve those skills. Each of the nine investigations is covered in great detail. Each investigation begins with an introduction detailing the rationale for choosing it, whether students

  16. Construction of multiform scFv antibodies using linker peptide

    Institute of Scientific and Technical Information of China (English)

    Shihua Wang; Cengjie Zheng; Ying Liu; Huirong Zheng; Zonghua Wang

    2008-01-01

    Multiform single chain variable fragments (acFvs) including different length linker scFvs and bispecific seFv were constructed. The linker lengths of 0, 3, 5, 8, 12, and 15 amino acids between VH and VL of antideoxynivalenol (anti-DON) scFv were used to analyze the affinities of scFvs. The affinity constants of these scFvs increased when the linker was lower than 12 amino acids. The affinity constant would not change when the linker was longer than 12 amino acids. Fusion gene of anti-DON seFv and antizearalenone (anti-ZEN) scFv was also constructed through eormection by a short peptide tinker DNA to express a bispecific scFv. The affinity constants assay showed that the two scFvs of fusion bispecific scFv remained their own affinity compared to their parental scFvs. Competitive direct enzyme linked immunosorbent assay was used to detect DON and ZEN in contaminated wheat (Triticum aestivum L.) samples, and the results indicated that this bispecifie acFv was applicable in DON and ZEN detection. This work confirmed that bispecific scFv could be successfully obtained, and might also have an application in diagnosing fungal infection, and breeding transgertic plants.

  17. Aspects of Color Superconductivity

    CERN Document Server

    Hong, D K

    2001-01-01

    I discuss some aspects of recent developments in color superconductivity in high density quark matter. I calculate the Cooper pair gap and the critical points at high density, where magnetic gluons are not screened. The ground state of high density QCD with three light flavors is shown to be a color-flavor locking state, which can be mapped into the low-density hadronic phase. The meson mass at the CFL superconductor is also calculated. The CFL color superconductor is bosonized, where the Fermi sea is identified as a $Q$-matter and the gapped quarks as topological excitations, called superqualitons, of mesons. Finally, as an application of color supercoductivity, I discuss the neutrino interactions in the CFL color superconductor.

  18. Superconducting energy storage

    Energy Technology Data Exchange (ETDEWEB)

    Giese, R.F.

    1993-10-01

    This report describes the status of energy storage involving superconductors and assesses what impact the recently discovered ceramic superconductors may have on the design of these devices. Our description is intended for R&D managers in government, electric utilities, firms, and national laboratories who wish an overview of what has been done and what remains to be done. It is assumed that the reader is acquainted with superconductivity, but not an expert on the topics discussed here. Indeed, it is the author`s aim to enable the reader to better understand the experts who may ask for the reader`s attention, support, or funding. This report may also inform scientists and engineers who, though expert in related areas, wish to have an introduction to our topic.

  19. Anyon Superconductivity of Sb

    Science.gov (United States)

    Maksoed, Wh-; Parengkuan, August

    2016-10-01

    In any permutatives to Pedro P. Kuczhynski from Peru, for anyon superconductivity sought EZ Kuchinskii et al.: ``Anion height dependence of Tc & d.o.s of Fe-based Superconductors'', 2010 as well as ``on the basis of electron microscopy & AFM measurements, these phenomena are quantified with focus on fractal dimension, particle perimeter & size of the side branch(tip width) in bert Stegemann et al.:Crystallization of Sb nanoparticles-Pattern Formation & Fractal Growth'', J.PhysChem B., 2004. For dendritic & dendrimer fractal characters shown further: ``antimony denrites were found to be composed of well-crystallized nanoflakes with size 20-4 nm''- Bou Zhau, et al., MaterialLetters, 59 (2005). The alkyl triisopropyl attached in TIPSb those includes in DNA, haemoglobin membrane/fixed-bed reactor for instance quotes in Dragony Fu, Nature Review Cancer, 12 (Feb 2012). Heartfelt Gratitudes to HE. Mr. Prof. Ir. Handojo.

  20. Superconductivity of columbium

    Energy Technology Data Exchange (ETDEWEB)

    Cook, D.B.; Zemansky, M.W.; Boorse, H.A.

    1950-11-15

    Isothermal critical magnetic field curves and zero field transitions for several annealed specimens of columbium have been measured by an a.c. mutual inductance method at temperatures from 5.1 deg K to the zero field transition temperature. The H-T curve was found to fit the usual parabolic relationship H = H{sub 0}(1-T(2)/T(2){sub 0}) with H{sub 0} = 8250 oersteds and T{sub 0} = 8.65 deg K. The initial slope of the curve was 1910 oersteds/deg. The electronic specific heat in the normal state calculated from the thermodynamic equations is 0.0375T and the approximate Debye characteristic temperature in the superconducting state, 67 deg K. Results on a different grade of columbium with a tantalum impurity of 0.4 percent, according to neutron scattering measurements, were in agreement, with the data obtained from columbium of 0.2 percent maximum tantalum impurity.

  1. Superconducting pulsed magnets

    CERN Document Server

    CERN. Geneva

    2006-01-01

    Lecture 1. Introduction to Superconducting Materials Type 1,2 and high temperature superconductors; their critical temperature, field & current density. Persistent screening currents and the critical state model. Lecture 2. Magnetization and AC Loss How screening currents cause irreversible magnetization and hysteresis loops. Field errors caused by screening currents. Flux jumping. The general formulation of ac loss in terms of magnetization. AC losses caused by screening currents. Lecture 3. Twisted Wires and Cables Filamentary composite wires and the losses caused by coupling currents between filaments, the need for twisting. Why we need cables and how the coupling currents in cables contribute more ac loss. Field errors caused by coupling currents. Lecture 4. AC Losses in Magnets, Cooling and Measurement Summary of all loss mechanisms and calculation of total losses in the magnet. The need for cooling to minimize temperature rise in a magnet. Measuring ac losses in wires and in magnets. Lecture 5. Stab...

  2. CERN Developments for 704 MHz Superconducting Cavities

    CERN Document Server

    Capatina, O; Aviles Santillana, I; Arnau Izquierdo, G; Bonomi, R; Calatroni, S; Chambrillon, J; Gerigk, F; Garoby, R; Guinchard, M; Junginger, T; Malabaila, M; Marques Antunes Ferreira, L; Mikulas, S; Parma, V; Pillon, F; Renaglia, T; Schirm, K; Tardy, T; Therasse, M; Vacca, A; Valverde Alonso, N; Vande Craen, A

    2013-01-01

    The Superconducting Proton Linac (SPL) is an R&D effort coordinated by CERN in partnership with other international laboratories. It is aiming at developing key technologies for the construction of a multi-megawatt proton linac based on state-of-the-art RF superconducting technology, which would serve as a driver in new physics facilities for neutrinos and/or Radioactive Ion Beam (RIB). Amongst the main objectives of this R&D effort, is the development of 704 MHz bulk niobium beta=1 elliptical cavities, operating at 2 K with a maximum accelerating gradient of 25 MV/m, and the testing of a string of cavities integrated in a machine-type cryomodule. The cavity together with its helium tank had to be carefully designed in coherence with the innovative design of the cryomodule. New fabrication methods have also been explored. Five such niobium cavities and two copper cavities are in fabrication. The key design aspects are discussed, the results of the alternative fabrication methods presented and the stat...

  3. Superconducting Aero Propulsion Motor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Superconducting electric propulsion systems will yield improvements in total ownership costs due to the simplicity of electric drive when compared with gas turbine...

  4. Mixed-mu superconducting bearings

    Energy Technology Data Exchange (ETDEWEB)

    Hull, John R. (Hinsdale, IL); Mulcahy, Thomas M. (Western Springs, IL)

    1998-01-01

    A mixed-mu superconducting bearing including a ferrite structure disposed for rotation adjacent a stationary superconductor material structure and a stationary permanent magnet structure. The ferrite structure is levitated by said stationary permanent magnet structure.

  5. Superconductivity in all its states

    CERN Multimedia

    Globe Info

    2011-01-01

    Temporary exhibition at the Saint-Genis-Pouilly Tourist Office. For the 100th anniversary of its discovery, take a plunge into the amazing world of superconductivity. Some materials, when cooled down to extreme temperatures, acquire a remarkable property -  they become superconducting. Superconductivity is a rare example of a quantum effect that can be witnessed on the macroscopic scale and is today at the heart of much research. In laboratories, researchers try to gain a better understanding of its origins, study new superconducting materials, explore the phenomenon at the nanometric scale and pursue their indefatigable search for new applications. Monday to Friday: 09:00 a.m. to 12:00 and 2:30 p.m. to 6:30 p.m. Saturday: 10:00 a.m. to 12:00 noon » Open to all – Admission free For further information: +33 (0)4 50 42 29 37

  6. Search for superconductivity in micrometeorites.

    Science.gov (United States)

    Guénon, S; Ramírez, J G; Basaran, Ali C; Wampler, J; Thiemens, M; Taylor, S; Schuller, Ivan K

    2014-12-05

    We have developed a very sensitive, highly selective, non-destructive technique for screening inhomogeneous materials for the presence of superconductivity. This technique, based on phase sensitive detection of microwave absorption is capable of detecting 10(-12) cc of a superconductor embedded in a non-superconducting, non-magnetic matrix. For the first time, we apply this technique to the search for superconductivity in extraterrestrial samples. We tested approximately 65 micrometeorites collected from the water well at the Amundsen-Scott South pole station and compared their spectra with those of eight reference materials. None of these micrometeorites contained superconducting compounds, but we saw the Verwey transition of magnetite in our microwave system. This demonstrates that we are able to detect electro-magnetic phase transitions in extraterrestrial materials at cryogenic temperatures.

  7. Advanced Superconducting Test Accelerator (ASTA)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Superconducting Test Accelerator (ASTA) facility will be based on upgrades to the existing NML pulsed SRF facility. ASTA is envisioned to contain 3 to 6...

  8. Superconductivity in Layered Organic Metals

    Directory of Open Access Journals (Sweden)

    Jochen Wosnitza

    2012-04-01

    Full Text Available In this short review, I will give an overview on the current understanding of the superconductivity in quasi-two-dimensional organic metals. Thereby, I will focus on charge-transfer salts based on bis(ethylenedithiotetrathiafulvalene (BEDT-TTF or ET for short. In these materials, strong electronic correlations are clearly evident, resulting in unique phase diagrams. The layered crystallographic structure leads to highly anisotropic electronic as well as superconducting properties. The corresponding very high orbital critical field for in-plane magnetic-field alignment allows for the occurrence of the Fulde–Ferrell– Larkin–Ovchinnikov state as evidenced by thermodynamic measurements. The experimental picture on the nature of the superconducting state is still controversial with evidence both for unconventional as well as for BCS-like superconductivity.

  9. Advanced Superconducting Test Accelerator (ASTA)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Superconducting Test Accelerator (ASTA) facility will be based on upgrades to the existing NML pulsed SRF facility. ASTA is envisioned to contain 3 to...

  10. Cryogenic Systems and Superconductive Power

    Science.gov (United States)

    The report defines, investigates, and experimentally evaluates the key elements of a representative crogenic turborefrigerator subsystem suitable for providing reliable long-lived cryogenic refrigeration for a superconductive ship propulsion system.

  11. Recent advances in fullerene superconductivity

    CERN Document Server

    Margadonna, S

    2002-01-01

    Superconducting transition temperatures in bulk chemically intercalated fulleride salts reach 33 K at ambient pressure and in hole-doped C sub 6 sub 0 derivatives in field-effect-transistor (FET) configurations, they reach 117 K. These advances pose important challenges for our understanding of high-temperature superconductivity in these highly correlated organic metals. Here we review the structures and properties of intercalated fullerides, paying particular attention to the correlation between superconductivity and interfullerene separation, orientational order/disorder, valence state, orbital degeneracy, low-symmetry distortions, and metal-C sub 6 sub 0 interactions. The metal-insulator transition at large interfullerene separations is discussed in detail. An overview is also given of the exploding field of gate-induced superconductivity of fullerenes in FET electronic devices.

  12. A 200 MHz SC-RF System for the HL-LHC

    CERN Document Server

    Calaga, Rama

    2016-01-01

    A quarter wave β=1 superconducting cavity at 200 MHz is proposed for the LHC as an alternative to the present 400 MHz RF system. The primary motivation of such a system would be to accelerate higher intensity and longer bunches with improved capture efficiency. Advantages related to minimizing electron cloud effects, intra-beam scattering, heating and the possibility of luminosity levelling with bunch length are described. Some considerations related to cavity optimization, beam loading and technological challenges are addressed.

  13. Superconductivity in Potassium-Doped Metallic Polymorphs of MoS2.

    Science.gov (United States)

    Zhang, Renyan; Tsai, I-Ling; Chapman, James; Khestanova, Ekaterina; Waters, John; Grigorieva, Irina V

    2016-01-13

    Superconducting layered transition metal dichalcogenides (TMDs) stand out among other superconductors due to the tunable nature of the superconducting transition, coexistence with other collective electronic excitations (charge density waves), and strong intrinsic spin-orbit coupling. Molybdenum disulfide (MoS2) is the most studied representative of this family of materials, especially since the recent demonstration of the possibility to tune its critical temperature, Tc, by electric-field doping. However, just one of its polymorphs, band-insulator 2H-MoS2, has so far been explored for its potential to host superconductivity. We have investigated the possibility to induce superconductivity in metallic polytypes, 1T- and 1T'-MoS2, by potassium (K) intercalation. We demonstrate that at doping levels significantly higher than that required to induce superconductivity in 2H-MoS2, both 1T and 1T' phases become superconducting with Tc = 2.8 and 4.6 K, respectively. Unusually, K intercalation in this case is responsible both for the structural and superconducting phase transitions. By adding new members to the family of superconducting TMDs, our findings open the way to further manipulate and enhance the electronic properties of these technologically important materials.

  14. The superconducting bending magnets 'CESAR'

    CERN Document Server

    Pérot, J

    1978-01-01

    In 1975, CERN decided to build two high precision superconducting dipoles for a beam line in the SPS north experimental area. The aim was to determine whether superconducting magnets of the required accuracy and reliability can be built and what their economies and performances in operation will be. Collaboration between CERN and CAE /SACLAY was established in order to make use of the knowledge and experience already acquired in the two laboratories. (0 refs).

  15. Y-Ba Superconducting Ceramics

    Science.gov (United States)

    Shunbao, Tian; Xiaofei, Li; Tinglian, Wen; Zuxiang, Lin; Shichun, Li; Huijun, Yu

    Polycrystalline Y-Ba-Cu-O superconducting materials have been studied. It was found that chemical composition and processing condition may play an important role in the final structure and superconducting properties. The density has been determined and compared with the calculated value according to the structure model reported by Bell Labs. The grain size and the morphology of the materials were observed by SEM.

  16. Composite conductor containing superconductive wires

    Energy Technology Data Exchange (ETDEWEB)

    Larson, W.L.; Wong, J.

    1974-03-26

    A superconductor cable substitute made by coworking multiple rods of superconductive niobium--titanium or niobium--zirconium alloy with a common copper matrix to extend the copper and rods to form a final elongated product which has superconductive wires distributed in a reduced cross-section copper conductor with a complete metallurgical bond between the normal-conductive copper and the superconductor wires contained therein is described. The superconductor cable can be in the form of a tube.

  17. Entanglement witnessing in superconducting beamsplitters

    Science.gov (United States)

    Soller, H.; Hofstetter, L.; Reeb, D.

    2013-06-01

    We analyse a large class of superconducting beamsplitters for which the Bell parameter (CHSH violation) is a simple function of the spin detector efficiency. For these superconducting beamsplitters all necessary information to compute the Bell parameter can be obtained in Y-junction setups for the beamsplitter. Using the Bell parameter as an entanglement witness, we propose an experiment which allows to verify the presence of entanglement in Cooper pair splitters.

  18. Superconductivity in domains with corners

    DEFF Research Database (Denmark)

    Bonnaillie-Noel, Virginie; Fournais, Søren

    2007-01-01

    We study the two-dimensional Ginzburg-Landau functional in a domain with corners for exterior magnetic field strengths near the critical field where the transition from the superconducting to the normal state occurs. We discuss and clarify the definition of this field and obtain a complete...... asymptotic expansion for it in the large $\\kappa$ regime. Furthermore, we discuss nucleation of superconductivity at the boundary....

  19. 27 Febuary 2012 - US DoE Associate Director of Science for High Energy Physics J. Siegrist visiting the LHC superconducting magnet test hall with adviser J.-P. Koutchouk and engineer M. Bajko; in CMS experimental cavern with Spokesperson J. Incadela;in ATLAS experimental cavern with Deputy Spokesperson A. Lankford; in ALICE experimental cavern with Spokesperson P. Giubellino; signing the guest book with Director for Accelerators and Technology S. Myers.

    CERN Multimedia

    Laurent Egli

    2012-01-01

    27 Febuary 2012 - US DoE Associate Director of Science for High Energy Physics J. Siegrist visiting the LHC superconducting magnet test hall with adviser J.-P. Koutchouk and engineer M. Bajko; in CMS experimental cavern with Spokesperson J. Incadela;in ATLAS experimental cavern with Deputy Spokesperson A. Lankford; in ALICE experimental cavern with Spokesperson P. Giubellino; signing the guest book with Director for Accelerators and Technology S. Myers.

  20. 24 February 2012 - Portuguese Minister for Education and Science N. Crato visiting the LHC superconducting magnet test hall with technology Department Head F. Bordry and signing the guest book with CERN Director-General R. Heuer. The Minister is accompanied by Secretary of State for Science L. Parreira and LIP Director J.M. Gago. A. Henriques(ATLAS), C. Lourenço (CMS) and Adviser R. Voss accompany the delegation throughout.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    On 24 February Nuno Crato, the Portuguese minister for education and science, left, toured the LHC superconducting-magnet test hall accompanied by Frédérick Bordry, CERN’s technology department head. He also took the opportunity to visit the underground experimental areas of ATLAS and CMS, and heard about the LHC Computing Grid Project before meeting Portuguese scientists working at CERN.

  1. Recent developments in superconducting materials including ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Tachikawa, Kyoji

    1987-06-01

    This report describes the history of superconduction starting in 1911, when the superconducting phenomenon was first observed in murcury, until the recent discovery of superconducting materials with high critical temperatures. After outlining the BCS theory, basic characteristics are discussed including the critical temperature, magnetic field and current density to be reached for realizing the superconducting state. Various techniques for practical superconducting materials are discussed, including methods for producing extra fine multiconductor wires from such superconducting alloys as Nb-Ti, intermetallic Nb/sub 3/Sn compound and V/sub 3/Ga, as well as methods for producing wires of Nb/sub 3/Al, Nb/sub 3/(Al, Ge) and Nb/sub 3/Ge such as continuous melt quenching, electron beam irradiation, laser beam irradiation and chemical evaporation. Characteristics of superconducting ceramics are described, along with their applications including superconducting magnets and superconducting elements. (15 figs, 1 tab, 19 refs)

  2. Superconducting properties of the s ±-wave state: Fe-based superconductors

    Science.gov (United States)

    Bang, Yunkyu; Stewart, G. R.

    2017-03-01

    Although the pairing mechanism of Fe-based superconductors (FeSCs) has not yet been settled with consensus with regard to the pairing symmetry and the superconducting (SC) gap function, the vast majority of experiments support the existence of spin-singlet sign-changing s-wave SC gaps on multi-bands ({{s}+/- } -wave state). This multi-band {{s}+/- } -wave state is a very unique gap state per se and displays numerous unexpected novel SC properties, such as a strong reduction of the coherence peak, non-trivial impurity effects, nodal-gap-like nuclear magnetic resonance signals, various Volovik effects in the specific heat (SH) and thermal conductivity, and anomalous scaling behaviors with a SH jump and condensation energy versus T c, etc. In particular, many of these non-trivial SC properties can easily be mistaken as evidence for a nodal-gap state such as a d-wave gap. In this review, we provide detailed explanations of the theoretical principles for the various non-trivial SC properties of the {{s}+/- } -wave pairing state, and then critically compare the theoretical predictions with experiments on FeSCs. This will provide a pedagogical overview of to what extent we can coherently understand the wide range of different experiments on FeSCs within the {{s}+/- } -wave gap model.

  3. EngenuitySC Commercialization and Entrepreneurial Training Project

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, Meghan; Hutton, Katherine R

    2012-12-31

    A team led by EngenuitySC has performed education and outreach on development of advanced energy markets that will enable wider use of clean energy technologies. This report details the efforts that have made significant advances to improve the market place through education, outreach, and increased communications between industry members. The project resulted in two self-funded industry clusters known as the Fuel Cell Collaborative and NuHub. This project has focused on building and strengthening the leading clean energy clusters in South Carolina: nuclear energy and fuel cell technologies. For the nuclear industry, a new cluster was developed that is now known as NuHub. This cluster has already engaged over 25 nuclear industry leaders or suppliers, four public sector partners, six community economic development foundations, and nearly ten academic partners in a 175 mile radius between Augusta, Georgia and Charlotte, North Carolina. Our outreach has touched over 2,000 stakeholders through the website alone, not including the public audiences and members of the business community reached through news stories and releases that were distributed to over 620 print and online publications. NuHub has established a formal leadership structure, developed subcommittees to focus on industry issues, instituted educational programs for the workforce, and created an industry funding structure that will sustain the industry cluster and mission. NuHub has participated in a wide-variety of community building and outreach activities since its formation under this grant. In the two years since its creation in 2010, we have initiated efforts focused in four main areas that correlate with the four NuHub subcommittees including: innovation, workforce development, industry engagement, and marketing and communications. NuHub successfully raised over $160,000 in both public and private funding, which has supported work to grow the cluster and engage partners including NuScale, Fluor, and

  4. Phonon softening and superconductivity triggered by spin-orbit coupling in simple-cubic α-polonium crystals

    Science.gov (United States)

    Kang, Chang-Jong; Kim, Kyoo; Min, B. I.

    2012-08-01

    We have investigated the mechanism of stabilizing the simple-cubic (sc) structure in polonium (α-Po), based on the phonon dispersion calculations using the first-principles all-electron band method. We have demonstrated that the stable sc structure results from the suppression of the Peierls instability due to the strong spin-orbit coupling (SOC) in α-Po. We have also discussed the structural chirality realized in β-Po, as a consequence of the phonon instability. Further, we have explored the possible superconductivity in α-Po, and predicted that it becomes a superconductor with Tc˜4 K. The transverse soft phonon mode at q≈(2)/(3)R, which is greatly influenced by the SOC, plays an important role both in the structural stability and the superconductivity in α-Po.

  5. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is introduced in this paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AlCl3 aluminum coagulant and P-FeCl3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing, flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  6. SC response characteristics of two kinds of coagulant

    Institute of Scientific and Technical Information of China (English)

    杨万东; 宋爽; 史惠祥

    2002-01-01

    Automatic coagulant dosage control with streaming current (SC) technique is in troduced inthis paper. Aluminum and ferric coagulants are widely used in surface water treatment. The SC response characteristics of P-AiCI3 aluminum coagulant and P-FeCI3 ferric coagulant were investigated in this work. Bench-scale water treatment results were obtained from jar tests including rapid mixing,flocculation and undisturbed sedimentation. Results showed that aluminum coagulant is more sensitive than ferric coagulant to SC response.

  7. Final Scientific Report: DE-SC0002194

    Energy Technology Data Exchange (ETDEWEB)

    Seidler, Gerald [Univ. of Washington, Seattle, WA (United States)

    2017-04-07

    We provide the final scientific report for DE-SC0002194. During the term of this grant, 28 publications spanning a variety of topics were addressed under the rubric of advanced x-ray methods and their application to extreme conditions of time-resolution or x-ray intensities. Notable accomplishments include a new observation of XANES features associated with f-shell reconfiguration in lanthanides, size-dependent x-ray heating effects under XFEL illumination conditions, theoretical development of improved treatments of inelastic x-ray scattering for 'warm dense matter' conditions, and several new instrument develop efforts for atomic, molecular, and condensed phase studies in the lab and at major facility lightsources.

  8. Generation and Characterization of an scFv Directed against Site II of Rabies Glycoprotein

    Directory of Open Access Journals (Sweden)

    Shukra M. Aavula

    2011-01-01

    Full Text Available Recombinant antibody phage display technology is a vital tool that facilitates identification of specific binding molecules to a target enabling the rapid generation and selection of high affinity, fully human, or mouse antibody product candidates essentially directed towards disease target appropriate for antibody therapy. In this study, a recombinant single-chain Fv antibody fragment (scFv A11 was isolated from immune spleen cells obtained from mice immunized with inactivated rabies virus (Pasteur strain using standard methodology and was characterized for its specificity towards the rabies virus glycoprotein. Epitope mapping using peptide libraries and truncated glycoprotein polypeptides suggested that A11 bound to the antigenic site II of rabies glycoprotein against which a majority of rabies virus neutralizing antibodies are directed. The use of the above technology could, therefore, allow development of scFvs with different specificities against the rabies glycoprotein as an alternative to the more cumbersome protocols used for the development of monoclonal antibodies.

  9. Nanoscale superconducting memory based on the kinetic inductance of asymmetric nanowire loops

    Science.gov (United States)

    Murphy, Andrew; Averin, Dmitri V.; Bezryadin, Alexey

    2017-06-01

    The demand for low-dissipation nanoscale memory devices is as strong as ever. As Moore’s law is staggering, and the demand for a low-power-consuming supercomputer is high, the goal of making information processing circuits out of superconductors is one of the central goals of modern technology and physics. So far, digital superconducting circuits could not demonstrate their immense potential. One important reason for this is that a dense superconducting memory technology is not yet available. Miniaturization of traditional superconducting quantum interference devices is difficult below a few micrometers because their operation relies on the geometric inductance of the superconducting loop. Magnetic memories do allow nanometer-scale miniaturization, but they are not purely superconducting (Baek et al 2014 Nat. Commun. 5 3888). Our approach is to make nanometer scale memory cells based on the kinetic inductance (and not geometric inductance) of superconducting nanowire loops, which have already shown many fascinating properties (Aprili 2006 Nat. Nanotechnol. 1 15; Hopkins et al 2005 Science 308 1762). This allows much smaller devices and naturally eliminates magnetic-field cross-talk. We demonstrate that the vorticity, i.e., the winding number of the order parameter, of a closed superconducting loop can be used for realizing a nanoscale nonvolatile memory device. We demonstrate how to alter the vorticity in a controlled fashion by applying calibrated current pulses. A reliable read-out of the memory is also demonstrated. We present arguments that such memory can be developed to operate without energy dissipation.

  10. Performance evaluation of high-temperature superconducting current leads for micro-SMES systems

    Science.gov (United States)

    Niemann, R. C.; Cha, Y. S.; Hull, J. R.; Buckles, W. E.; Weber, B. R.; Yang, S. T.

    As part of the US Department of Energy's Superconductivity Technology Program, Argonne National Laboratory and Superconductivity, Inc., are developing high-temperature superconductor (HTS) current leads for application to micro-superconducting magnetic energy storage systems. Two 1500-A HTS leads have been designed and constructed. The performance of the current lead assemblies is being evaluated in a zero-magnetic-field test program that includes assembly procedures, tooling, and quality assurance; thermal and electrical performance; and flow and mechanical characteristics. Results of evaluations performed to data are presented.

  11. Magnetoresistance peculiarities and magnetization of materials with two kinds of superconducting inclusions

    Directory of Open Access Journals (Sweden)

    Shevtsova O. N.

    2015-03-01

    Full Text Available Low-temperature properties of a crystal containing type I superconducting inclusions of two different materials have been studied. In the approximation assuming that the inclusions size is much smaller than the coherence length/penetration depth of the magnetic field, the theory of magnetoresistance of a crystal containing spherical superconducting inclusions of two different materials has been developed, and magnetization of crystals has been calculated. The obtained results can be used for correct explanation of the low temperature conductivity in binary and more complex semiconductors, in which precipitation of the superconducting phase is possible during the technological processing or under external impact.

  12. Anomalous Halo Formation in an Arc-Melted ScNi-Sc2Ni Off-Eutectic Binary Alloy

    Directory of Open Access Journals (Sweden)

    Kai Wang

    2016-07-01

    Full Text Available Diverse non-equilibrium eutectic structures have attracted numerous experimental and theoretical studies. One special type is the formation of a halo of one phase around a primary dendrite of another phase. In our experiments, it was occasionally observed that ScNi halos grow as dendritic morphology around the primary Sc 2 Ni dendrites in an arc-melted ScNi-Sc 2 Ni off-eutectic binary alloy. The formation of this anomalous halo structure was then well reproduced by employing quantitative phase-field simulations. Based on the phase-field simulation, It was found that (i the large undercooling and growth velocity of the ScNi phase during solidification causes the formation of halos; and (ii the released latent heat induces the recalescence phenomenon, and changes the solidification sequence largely, resulting in the anomalous halo structure in the Sc-34 at % Ni alloy.

  13. Stripe Order in Superconducting La2−xBaxCuO4 (0.095 x 0.155)

    Energy Technology Data Exchange (ETDEWEB)

    Hucker, M.; Zimmermann, M.v.; Gu, G.D.; Xu, Z.J.; Wen, J.S.; Xu, G.; Kang, H.J.; Zheludev, A.; Tranquada, J.M.

    2011-03-01

    The correlations between stripe order, superconductivity, and crystal structure in La{sub 2-x}Ba{sub x}CuO{sub 4} single crystals have been studied by means of x-ray and neutron diffraction as well as static magnetization measurements. The derived phase diagram shows that charge stripe order (CO) coexists with bulk superconductivity in a broad range of doping around x=1/8, although the CO order parameter and correlation length fall off quickly for x {ne} 1/8. Except for x=0.155, the onset of CO always coincides with the transition between the orthorhombic and the tetragonal or less orthorhombic low-temperature structures. The CO transition evolves from a sharp drop at low x to a more gradual transition at higher x, eventually falling below the structural phase boundary for optimum doping. With respect to the interlayer CO correlations, we find no qualitative change of the stripe stacking order as a function of doping, and in-plane and out-of-plane correlations disappear simultaneously at the transition. Similarly to the CO, the spin stripe order (SO) is also most pronounced at x=1/8. Truly static SO sets in below the CO and coincides with the first appearance of in-plane superconducting correlations at temperatures significantly above the bulk transition to superconductivity (SC). Indications that bulk SC causes a reduction of the spin or charge stripe order could not be identified. We argue that CO is the dominant order that is compatible with SC pairing but competes with SC phase coherence. Comparing our results with data from the literature, we find good agreement if all results are plotted as a function of x' instead of the nominal x, where x' represents an estimate of the actual Ba content, extracted from the doping dependence of the structural transition between the orthorhombic phase and the tetragonal high-temperature phase.

  14. Status Of The Work On The Base Directions Of The "rf Superconductivity For Accelerators" Program At The Federate Problem Lab At Ihep

    CERN Document Server

    Sevryukova, L

    2004-01-01

    In this report result of the study of electrophysical phenomena on the superconducting cavity surface, including plasma, bifurcation, hysteresis, emission and diffusion phenomena are considered. Science intensive recourse -saving technologies of superconducting cavities are being studied on the base of these phenomena. The superconducting cavities are made of Nb and Nb film, alloy film or HTC ceramics, which cover the working surface of the weldless copper shells using ion-plasma technologies (axial and planar magnetron sputtering). Quality monitoring (optical, emission, electrochemical and high frequency) of the working surface condition of superconducting cavities is developed under the realization of new technologies. The brief review of the experimental equipment is used as training base for individual students, post-graduate students and research staff in the field of technologies that use superconductivity phenomenon and ionic-plasma, electrochemical and high-vacuum technologies as well. For realizat...

  15. Experimental system design for the integration of trapped-ion and superconducting qubit systems

    Science.gov (United States)

    De Motte, D.; Grounds, A. R.; Rehák, M.; Rodriguez Blanco, A.; Lekitsch, B.; Giri, G. S.; Neilinger, P.; Oelsner, G.; Il'ichev, E.; Grajcar, M.; Hensinger, W. K.

    2016-12-01

    We present a design for the experimental integration of ion trapping and superconducting qubit systems as a step towards the realization of a quantum hybrid system. The scheme addresses two key difficulties in realizing such a system: a combined microfabricated ion trap and superconducting qubit architecture, and the experimental infrastructure to facilitate both technologies. Developing upon work by Kielpinski et al. (Phys Rev Lett 108(13):130504, 2012. doi: 10.1103/PhysRevLett.108.130504), we describe the design, simulation and fabrication process for a microfabricated ion trap capable of coupling an ion to a superconducting microwave LC circuit with a coupling strength in the tens of kHz. We also describe existing difficulties in combining the experimental infrastructure of an ion trapping set-up into a dilution refrigerator with superconducting qubits and present solutions that can be immediately implemented using current technology.

  16. Superconducting Antenna Concept for Gravitational Waves

    Science.gov (United States)

    Gulian, A.; Foreman, J.; Nikoghosyan, V.; Nussinov, S.; Sica, L.; Tollaksen, J.

    The most advanced contemporary efforts and concepts for registering gravitational waves are focused on measuring tiny deviations in large arm (kilometers in case of LIGO and thousands of kilometers in case of LISA) interferometers via photons. In this report we discuss a concept for the detection of gravitational waves using an antenna comprised of superconducting electrons (Cooper pairs) moving in an ionic lattice. The major challenge in this approach is that the tidal action of the gravitational waves is extremely weak compared with electromagnetic forces. Any motion caused by gravitational waves, which violates charge neutrality, will be impeded by Coulomb forces acting on the charge carriers (Coulomb blockade) in metals, as well as in superconductors. We discuss a design, which avoids the effects of Coulomb blockade. It exploits two different superconducting materials used in a form of thin wires -"spaghetti." The spaghetti will have a diameter comparable to the London penetration depth, and length of about 1-10 meters. To achieve competitive sensitivity, the antenna would require billions of spaghettis, which calls for a challenging manufacturing technology. If successfully materialized, the response of the antenna to the known highly periodic sources of gravitational radiation, such as the Pulsar in Crab Nebula will result in an output current, detectable by superconducting electronics. The antenna will require deep (0.3K) cryogenic cooling and magnetic shielding. This design may be a viable successor to LISA and LIGO concepts, having the prospect of higher sensitivity, much smaller size and directional selectivity. This concept of compact antenna may benefit also terrestrial gradiometry.

  17. Fusion development and technology

    Energy Technology Data Exchange (ETDEWEB)

    Montgomery, D.B.

    1992-01-01

    This report discusses the following: superconducting magnet technology; high field superconductors; advanced magnetic system and divertor development; poloidal field coils; gyrotron development; commercial reactor studies--aries; ITER physics: alpha physics and alcator R D for ITER; lower hybrid current drive and heating in the ITER device; ITER superconducting PF scenario and magnet analysis; ITER systems studies; and safety, environmental and economic factors in fusion development.

  18. High-performance Cr/Sc multilayers for the soft x-ray range

    Science.gov (United States)

    Yulin, Sergiy A.; Schaefers, Franz; Feigl, Torsten; Kaiser, Norbert

    2004-01-01

    Results of soft x-ray reflection measurements of Cr/Sc multilayer mirrors close to the Sc absorption edge at 3.11 nm are presented. Improvements in the deposition technology and the adjustment of the multilayer period with an accuracy of better than 0.01 nm to this absorption edge enabled a step forward towards soft x-ray mirrors with an adequate reflectance that allow the realization of normal incidence optical components in the water window. In particular, reflectivity measurements performed at the PTB reflectometer at BESSY II in Berlin revealed a reflectivity of R = 14.8% at an incidence angle of θ = 1.5° and R = 15.0% at θ = 5°. Simulation results show that the interface widths between the Cr and Sc nanolayers are less than 0.4 nm. The annealing effect in short-period Cr/Sc multilayers was studied in the temperature range from 50°C to 500°C by X-ray scattering and transmission electron microscopy. Structural and phase transformations and the corresponding changes of the optical properties are presented and discussed.

  19. Theoretical Discovery of a Superconducting Two-Dimensional Metal-Organic Framework.

    Science.gov (United States)

    Zhang, Xiaoming; Zhou, Yinong; Cui, Bin; Zhao, Mingwen; Liu, Feng

    2017-09-15

    Superconductivity is a fascinating quantum phenomenon characterized by zero electrical resistance and the Meissner effect. To date, several distinct families of superconductors (SCs) have been discovered. These include three-dimensional (3D) bulk SCs in both inorganic and organic materials as well as two-dimensional (2D) thin film SCs but only in inorganic materials. Here we predict superconductivity in 2D and 3D organic metal-organic frameworks by using first-principles calculations. We show that the highly conductive and recently synthesized Cu-benzenehexathial (BHT) is a Bardeen-Cooper-Schrieffer SC. Remarkably, the monolayer Cu-BHT has a critical temperature (Tc) of 4.43 K, while Tc of bulk Cu-BHT is 1.58 K. Different from the enhanced Tc in 2D inorganic SCs which is induced by interfacial effects, the Tc enhancement in this 2D organic SC is revealed to be the out-of-plane soft-mode vibrations, analogous to surface mode enhancement originally proposed by Ginzburg. Our findings not only shed new light on better understanding 2D superconductivity but also open a new direction to search for SCs by interface engineering with organic materials.

  20. IEC SC15E: Report on liaison activities of CIGRÉ-SC15

    DEFF Research Database (Denmark)

    Henriksen, Mogens

    2000-01-01

    WG’s activities under CIGRÉ SC15:WG 15.01 - Fluid impregnated systems.WG 15.02 - Dielectric Liquids.WG 15.03 - Gas Insulation.WG 15.04 - Outdoor Insulation.WG 15.05 - Capacitors.WG 15.07 - Solid Insulating Materials for Rotating Machines.WG 15/33.08 - Insulation Monitoring and Life Estimation. WG...