WorldWideScience

Sample records for sunlight inactivation rates

  1. Sunlight inactivation of viruses in open-water unit process treatment wetlands: modeling endogenous and exogenous inactivation rates.

    Science.gov (United States)

    Silverman, Andrea I; Nguyen, Mi T; Schilling, Iris E; Wenk, Jannis; Nelson, Kara L

    2015-03-03

    Sunlight inactivation is an important mode of disinfection for viruses in surface waters. In constructed wetlands, for example, open-water cells can be used to promote sunlight disinfection and remove pathogenic viruses from wastewater. To aid in the design of these systems, we developed predictive models of virus attenuation that account for endogenous and exogenous sunlight-mediated inactivation mechanisms. Inactivation rate models were developed for two viruses, MS2 and poliovirus type 3; laboratory- and field-scale experiments were conducted to evaluate the models' ability to estimate inactivation rates in a pilot-scale, open-water, unit-process wetland cell. Endogenous inactivation rates were modeled using either photoaction spectra or total, incident UVB irradiance. Exogenous inactivation rates were modeled on the basis of virus susceptibilities to singlet oxygen. Results from both laboratory- and field-scale experiments showed good agreement between measured and modeled inactivation rates. The modeling approach presented here can be applied to any sunlit surface water and utilizes easily measured inputs such as depth, solar irradiance, water matrix absorbance, singlet oxygen concentration, and the virus-specific apparent second-order rate constant with singlet oxygen (k2). Interestingly, the MS2 k2 in the open-water wetland was found to be significantly larger than k2 observed in other waters in previous studies. Examples of how the model can be used to design and optimize natural treatment systems for virus inactivation are provided.

  2. Sunlight inactivation of faecal bacteria in waste stabilization ponds in a Sahelian region (Ouagadougou, Burkina Faso)

    Energy Technology Data Exchange (ETDEWEB)

    Maiga, Y.; Denyigba, K.; Wethe, J.; Ouattara, A. S.

    2009-07-01

    Waste stabilization ponds (WSPs) are an appropriate sewage treatment system for developing countries in Sahelian regions. Several studies on wastewater treatment in WSPs have shown that solar radiation is a major factor in the inactivation of faecal indicator, and that sunlight acts on interaction with other factors including dissolved oxygen (DO) and pH. However, the inactivation by sunlight is limited by the reduction of light penetration in ponds. (Author)

  3. Inactivation of enteropathogenic E. coli by solar disinfection (SODIS) under simulated sunlight conditions

    Energy Technology Data Exchange (ETDEWEB)

    Ubomba-Jaswa, E; Boyle, M A R; McGuigan, K G [Department of Physiology and Medical Physics, Royal College of Surgeons in Ireland, Dublin 2 (Ireland)], E-mail: kmcguigan@rcsi.ie

    2008-02-01

    Solar Disinfection (SODIS) is a low cost water treatment method currently used in communities that do not have year round access to safe water. However, there is still reluctance in widespread adoption of this treatment method due to a number of limitations. An important limitation is the lack of SODIS inactivation studies on some waterborne pathogens in the developing world. SODIS inactivation of enteropathogenic E. coli (EPEC), a major cause of infantile diarrhoea is reported for the first time under simulated sunlight conditions and following a natural temperature profile. EPEC was exposed to simulated sunlight (885Wm{sup -2}) for periods up to a cumulative time of 4 hours. Inactivation was determined by a log reduction in growth of the organisms. The temperature (deg. C) of the water was taken at every time point. After 4 hours exposure EPEC was completely inactivated (7 log reduction) by SODIS. Imposing a realistic water temperature profile (min-max) concomitant with irradiation produces a greater kill of EPEC. Maintaining simulated sunlight experiments at a high fixed temperature may result in over-estimation of inactivation. Following a natural water temperature profile will result in more reliable inactivation comparable with those that might be obtained under natural sunlight conditions.

  4. Inactivation of enteropathogenic E. coli by solar disinfection (SODIS) under simulated sunlight conditions

    Science.gov (United States)

    Ubomba-Jaswa, E.; Boyle, M. A. R.; McGuigan, K. G.

    2008-02-01

    Solar Disinfection (SODIS) is a low cost water treatment method currently used in communities that do not have year round access to safe water. However, there is still reluctance in widespread adoption of this treatment method due to a number of limitations. An important limitation is the lack of SODIS inactivation studies on some waterborne pathogens in the developing world. SODIS inactivation of enteropathogenic E. coli (EPEC), a major cause of infantile diarrhoea is reported for the first time under simulated sunlight conditions and following a natural temperature profile. EPEC was exposed to simulated sunlight (885Wm-2) for periods up to a cumulative time of 4 hours. Inactivation was determined by a log reduction in growth of the organisms. The temperature (°C) of the water was taken at every time point. After 4 hours exposure EPEC was completely inactivated (7 log reduction) by SODIS. Imposing a realistic water temperature profile (min-max) concomitant with irradiation produces a greater kill of EPEC. Maintaining simulated sunlight experiments at a high fixed temperature may result in over --estimation of inactivation. Following a natural water temperature profile will result in more reliable inactivation comparable with those that might be obtained under natural sunlight conditions.

  5. Sunlight-induced inactivation of human Wa and porcine OSU rotaviruses in the presence of exogenous photosensitizers

    KAUST Repository

    Romero-Maraccini, Ofelia C.

    2013-10-01

    Human rotavirus Wa and porcine rotavirus OSU solutions were irradiated with simulated solar UV and visible light in the presence of different photosensitizers dissolved in buffered solutions. For human rotavirus, the exogenous effects were greater than the endogenous effects under irradiation with full spectrum and UVA and visible light at 25 C. For porcine rotavirus, the exogenous effects with UVA and visible light irradiation were only observed at high temperatures, >40 C. The results from dark experiments conducted at different temperatures suggest that porcine rotavirus has higher thermostability than human rotavirus. Concentrations of 3′-MAP excited triplet states of 1.8 fM and above resulted in significant human rotavirus inactivation. The measured excited triplet state concentrations of ≤0.45 fM produced by UVA and visible light irradiation of natural dissolved organic matter solutions were likely not directly responsible for rotavirus inactivation. Instead, the linear correlation for human rotavirus inactivation rate constant (kobs) with the phenol degradation rate constant (kexp) found in both 1 mM NaHCO3 and 1 mM phosphate-buffered solutions suggested that OH radical was a major reactive species for the exogenous inactivation of rotaviruses. Linear correlations between rotavirus kobs and specific UV254 nm absorbance of two river-dissolved organic matter and two effluent organic matter isolates indicated that organic matter aromaticity may help predict formation of radicals responsible for rotavirus inactivation. The results from this study also suggested that the differences in rotavirus strains should be considered when predicting solar inactivation of rotavirus in sunlit surface waters. © 2013 American Chemical Society.

  6. A comparison of hip fracture incidence rates among elderly in Sweden by latitude and sunlight exposure.

    Science.gov (United States)

    Nilson, Finn; Moniruzzaman, Syed; Andersson, Ragnar

    2014-03-01

    Research has shown that hip fracture risk increases with latitude; hypothetically due to reduced sunlight exposure and its effect on bone quality. Sweden, with large differences in latitude and UV radiation, is ideal to study in order to analyse the association between latitude and UV radiation on age- and sex-specific hip fracture rates among elderly. Aggregated (2006-2008) age- and sex-specific hip fracture data was obtained for each Swedish municipality as well as the municipality's latitudinal coordinates and aggregated (2006-2008) UV radiation levels. Pearson correlations were calculated between hip fracture incidence rates, latitude and UV radiation. Independent t tests were calculated on tertile-categorized latitudinal data in order to investigate the difference in hip fracture risk between these categories. Statistically significant correlations were seen in all groups between hip fracture incidence rates and latitude as well as UV radiation. The independent t tests showed that this correlation was mainly due to high incidence rates in high latitude municipalities. Statistically significant correlations are seen between hip fracture incidence rates and latitude as well as UV radiation in Sweden and the northern parts of Sweden have an increased risk of hip fractures compared to the middle and southern parts. To our knowledge this is the first study using a national discharge register that shows this relationship and provides a starting point for further research to investigate why populations in northern Sweden have a higher risk of hip fractures compared to other Swedish regions.

  7. Measurements of pulse rate using long-range imaging photoplethysmography and sunlight illumination outdoors

    Science.gov (United States)

    Blackford, Ethan B.; Estepp, Justin R.

    2017-02-01

    Imaging photoplethysmography, a method using imagers to record absorption variations caused by microvascular blood volume pulsations, shows promise as a non-contact cardiovascular sensing technology. The first long-range imaging photoplethysmography measurements at distances of 25, 50, and 100 meters from the participant was recently demonstrated. Degraded signal quality was observed with increasing imager-to-subject distances. The degradation in signal quality was hypothesized to be largely attributable to inadequate light return to the image sensor with increasing lens focal length. To test this hypothesis, a follow-up evaluation with 27 participants was conducted outdoors with natural sunlight illumination resulting in 5-33 times the illumination intensity. Video was recorded from cameras equipped with ultra-telephoto lenses and positioned at distances of 25, 50, 100, and 150 meters. The brighter illumination allowed high-definition video recordings at increased frame rates of 60fps, shorter exposure times, and lower ISO settings, leading to higher quality image formation than the previous indoor evaluation. Results were compared to simultaneous reference measurements from electrocardiography. Compared to the previous indoor study, we observed lower overall error in pulse rate measurement with the same pattern of degradation in signal quality with respect to increasing distance. This effect was corroborated by the signal-to-noise ratio of the blood volume pulse signal which also showed decreasing quality with respect to increasing distance. Finally, a popular chrominance-based method was compared to a blind source separation approach; while comparable in measurement of signal-to-noise ratio, we observed higher overall error in pulse rate measurement using the chrominance method in this data.

  8. HIGH HEATING RATES AFFECTS GREATLY THE INACTIVATION RATE OF ESCHERICHIA COLI

    Directory of Open Access Journals (Sweden)

    Juan Pablo Huertas

    2016-08-01

    Full Text Available Heat resistance of microorganisms can be affected by different influencing factors. Although the effect of heating rates has been scarcely explored by the scientific community, recent researches have unraveled its important effect on the thermal resistance of different species of vegetative bacteria. Typically heating rates described in the literature ranged from 1 to 20ºC/min but the impact of much higher heating rates is unclear. The aim of this research was to explore the effect of different heating rates, such as those currently achieved in the heat exchangers used in the food industry, on the heat resistance of Escherichia coli. A pilot plant tubular heat exchanger and a thermoresistometer Mastia were used for this purpose. Results showed that fast heating rates had a deep impact on the thermal resistance of E. coli. Heating rates between 20 and 50ºC/min were achieved in the heat exchanger, which were much slower than those around 20ºC/s achieved in the thermoresistometer. In all cases, these high heating rates led to higher inactivation than expected: in the heat exchanger, for all the experiments performed, when the observed inactivation had reached about seven log cycles, the predictions estimates about 1 log cycle of inactivation; in the thermoresistometer these differences between observed and predicted values were even more than ten times higher, from 4.07 log cycles observed to 0.34 predicted at a flow rate of 70 mL/min and a maximum heating rate of 14.7ºC/s. A quantification of the impact of the heating rates on the level of inactivation achieved was established. These results point out the important effect that the heating rate has on the thermal resistance of E. coli, with high heating rates resulting in an additional sensitization to heat and therefore an effective food safety strategy in terms of food processing.

  9. High Heating Rates Affect Greatly the Inactivation Rate of Escherichia coli

    Science.gov (United States)

    Huertas, Juan-Pablo; Aznar, Arantxa; Esnoz, Arturo; Fernández, Pablo S.; Iguaz, Asunción; Periago, Paula M.; Palop, Alfredo

    2016-01-01

    Heat resistance of microorganisms can be affected by different influencing factors. Although, the effect of heating rates has been scarcely explored by the scientific community, recent researches have unraveled its important effect on the thermal resistance of different species of vegetative bacteria. Typically heating rates described in the literature ranged from 1 to 20°C/min but the impact of much higher heating rates is unclear. The aim of this research was to explore the effect of different heating rates, such as those currently achieved in the heat exchangers used in the food industry, on the heat resistance of Escherichia coli. A pilot plant tubular heat exchanger and a thermoresistometer Mastia were used for this purpose. Results showed that fast heating rates had a deep impact on the thermal resistance of E. coli. Heating rates between 20 and 50°C/min were achieved in the heat exchanger, which were much slower than those around 20°C/s achieved in the thermoresistometer. In all cases, these high heating rates led to higher inactivation than expected: in the heat exchanger, for all the experiments performed, when the observed inactivation had reached about seven log cycles, the predictions estimated about 1 log cycle of inactivation; in the thermoresistometer these differences between observed and predicted values were even more than 10 times higher, from 4.07 log cycles observed to 0.34 predicted at a flow rate of 70 mL/min and a maximum heating rate of 14.7°C/s. A quantification of the impact of the heating rates on the level of inactivation achieved was established. These results point out the important effect that the heating rate has on the thermal resistance of E. coli, with high heating rates resulting in an additional sensitization to heat and therefore an effective food safety strategy in terms of food processing. PMID:27563300

  10. Solar radiation disinfection of drinking water at temperate latitudes: inactivation rates for an optimised reactor configuration.

    Science.gov (United States)

    Davies, C M; Roser, D J; Feitz, A J; Ashbolt, N J

    2009-02-01

    Solar radiation-driven inactivation of bacteria, virus and protozoan pathogen models was quantified in simulated drinking water at a temperate latitude (34 degrees S). The water was seeded with Enterococcus faecalis, Clostridium sporogenes spores, and P22 bacteriophage, each at ca 1x10(5) mL(-1), and exposed to natural sunlight in 30-L reaction vessels. Water temperature ranged from 17 to 39 degrees C during the experiments lasting up to 6h. Dark controls showed little inactivation and so it was concluded that the inactivation observed was primarily driven by non-thermal processes. The optimised reactor design achieved S90 values (cumulative exposure required for 90% reduction) for the test microorganisms in the range 0.63-1.82 MJ m(-2) of Global Solar Exposure (GSX) without the need for TiO2 as a catalyst. High turbidity (840-920 NTU) only reduced the S(90) value by 0.05). However, inactivation was significantly reduced for E. faecalis and P22 when the transmittance of UV wavelengths was attenuated by water with high colour (140 PtCo units) or a suboptimally transparent reactor lid (prob.waters and microorganisms. Although temperatures required for SODIS type pasteurization were not produced, non-thermal inactivation alone appeared to offer a viable means for reliably disinfecting low colour source waters by greater than 4 orders of magnitude on sunny days at 34 degrees S latitude.

  11. Comparison between conformational change and inactivation rates of aminoacylase during denaturation in urea solutions

    Institute of Scientific and Technical Information of China (English)

    王洪睿; 王希成; 张彤; 周海梦

    1995-01-01

    The kinetic method of the substrate reaction in the presence of mactivator previously described by Tsou has been applied to the determination of inactivation rates of aminoacylase during denaturation in urea solutions. The protective effect of substrate on the inactivation of aminoacylase by urea has been investigated. Simultaneously, the comparison between conformational change and inactivation rates of enzyme in the urea solutions of different concentrations has been studied. Results obtained show that the inactivation rate constants of the enzyme are larger than the rate constants of conformational changes. The present results show that the active site of metal enzyme-aminoacylase is also located in a limited and flexible region of the molecule that is more sensitive to denaturants than the enzyme as a whole.

  12. Voltage dependence of rate functions for Na+ channel inactivation within a membrane

    CERN Document Server

    Vaccaro, Samuel R

    2015-01-01

    The inactivation of a Na+ channel occurs when the activation of the charged S4 segment of domain IV, with rate functions $\\alpha_{i}$ and $\\beta_{i}$, is followed by the binding of an intracellular hydrophobic motif which blocks conduction through the ion pore, with rate functions $\\gamma_{i}$ and $\\delta_{i}$. During a voltage clamp of the Na+ channel, the solution of the master equation for inactivation reduces to the relaxation of a rate equation when the binding of the inactivation motif is rate limiting ($\\alpha_{i} \\gg \\gamma_{i}$ and $\\beta_{i} \\gg \\delta_{i}$). The voltage dependence of the derived forward rate function for Na+ channel inactivation has an exponential dependence on the membrane potential for small depolarizations and approaches a constant value for larger depolarizations, whereas the voltage dependence of the backward rate function is exponential, and each rate has a similar form to the Hodgkin-Huxley empirical rate functions for Na+ channel inactivation in the squid axon.

  13. Evaluation of the Factors that Control the Time-Dependent Inactivation Rate Coefficients of Bacteriophage MS2 and PRD1

    Science.gov (United States)

    Anders, R.; Chrysikopoulos, C. V.

    2004-12-01

    Batch experiments were conducted under both static and dynamic conditions to study the effects of temperature and the presence of sand on the inactivation process of viruses. The male--specific RNA coliphage, MS2, and the Salmonella typhimurium phage, PRD1, were used as model viruses for this study. Over 100 oven--baked borosilicate glass bottles with or without Monterey sand were filled with a low--ionic--strength phosphate buffered saline solution containing both bacteriophage and incubated at temperatures of 4o, 15o, or 25oC. The results of the batch experiments indicate that the inactivation process can be represented by a pseudo first-order expression with time--dependent rate coefficients. A combination of high temperature and the presence of sand appears to produce the greatest disruption to the surrounding protein coat of MS2. However, for PRD1, the lower activation energies derived from Arrhenius plots indicate a weaker dependence of the inactivation rate on temperature. Furthermore, the presence of an air--liquid--solid interface in the dynamic batch experiment containing sand produces the greatest damage to specific viral components of PRD1 that are required for infection. These results indicate the use of thermodynamic parameters based on the pseudo first--order inactivation expression allows better prediction of the inactivation of viruses in the environment.

  14. Taxicab tipping and sunlight

    Science.gov (United States)

    2017-01-01

    Does the level of sunlight affect the tipping percentage in taxicab rides in New York City? We examined this question using data on 13.82 million cab rides from January to October in 2009 in New York City combined with data on hourly levels of solar radiation. We found a small but statistically significant positive relationship between sunlight and tipping, with an estimated tipping increase of 0.5 to 0.7 percentage points when transitioning from a dark sky to full sunshine. The findings are robust to two-way clustering of standard errors based on hour-of-the-day and day-of-the-year and controlling for day-of-the-year, month-of-the-year, cab driver fixed effects, weather conditions, and ride characteristics. The NYC cab ride context is suitable for testing the association between sunlight and tipping due to the largely random assignment of riders to drivers, direct exposure to sunlight, and low confounding from variation in service experiences. PMID:28594917

  15. Inactivation of E. Coli in Water Using Photocatalytic, Nanostructured Films Synthesized by Aerosol Routes

    Directory of Open Access Journals (Sweden)

    Pratim Biswas

    2013-03-01

    Full Text Available TiO2 nanostructured films were synthesized by an aerosol chemical vapor deposition (ACVD method with different controlled morphologies: columnar, granular, and branched structures for the photocatalytic inactivation of Escherichia coli (E. coli in water. Effects of film morphology and external applied voltage on inactivation rate were investigated. As-prepared films were characterized using scanning electron microscopy (SEM, transmission electron microscopy (TEM, X-ray diffractometry (XRD, and UV-VIS. Photocatalytic and photoelectrochemical inactivation of E. coli using as-prepared TiO2 films were performed under irradiation of UVA light (note: UVA has a low efficiency to inactivate E. coli. Inactivation rate constants for each case were obtained from their respective inactivation curve through a 2 h incubation period. Photocatalytic inactivation rate constants of E. coli are 0.02/min (using columnar films, and 0.08/min (using branched films. The inactivation rate constant for the columnar film was enhanced by 330% by applied voltage on the film while that for the branched film was increased only by 30%. Photocatalytic microbial inactivation rate of the columnar and the branched films were also compared taking into account their different surface areas. Since the majority of the UV radiation that reaches the Earth’s surface is UVA, this study provides an opportunity to use sunlight to efficiently decontaminate drinking water.

  16. Solar Radiation Disinfection of Drinking Water at Temperate Latitudes: Inactivation rates for an optimized reactor configuration

    Science.gov (United States)

    Solar radiation-driven inactivation of bacteria, virus and protozoan pathogen models was quantified in simulated drinking water at a temperate latitude (34°S). The water was seeded with Enterococcus faecalis, Clostridium sporogenes spores, and P22 bacteriophage, each at ca 1 x 10...

  17. Inactivation and regrowth of multidrug resistant bacteria in urban wastewater after disinfection by solar-driven and chlorination processes.

    Science.gov (United States)

    Fiorentino, Antonino; Ferro, Giovanna; Alferez, María Castro; Polo-López, Maria Inmaculada; Fernández-Ibañez, Pilar; Rizzo, Luigi

    2015-07-01

    Solar disinfection and solar-driven advanced oxidation processes (AOPs) (namely H2O2/sunlight, TiO2/sunlight, H2O2/TiO2/sunlight, solar photo-Fenton) were evaluated in the inactivation of indigenous antibiotic-resistant bacteria (ARB) in real urban wastewater. A multidrug resistant (MDR) Escherichia coli strain isolated from the effluent of the biological process of an urban wastewater treatment plant was the target ARB. The higher inactivation rates (residual density under detection limit, 2 CFUm L(-1)) were achieved with H2O2/TiO2/sunlight (cumulative energy per unit of volume (QUV) in the range 3-5 kJ L(-1), depending on H2O2/TiO2 ratio) and H2O2/sunlight (QUV of 8 kJ L(-1)) processes. All investigated processes did not affect antibiotic resistance of survived colonies. Moreover, H2O2/sunlight was compared with conventional chlorination process to evaluate bacterial regrowth potential and particularly the proportion of indigenous MDR E. coli with respect to total indigenous E. coli population. Chlorination (1.0 mg Cl2 L(-1)) was more effective than H2O2/sunlight (50 mg H2O2 L(-1)) to achieve total inactivation of MDR E. coli (15 min Vs 90 min) but less effective in controlling their regrowth (24 h Vs 48 h). Interestingly, the percentage of MDR E. coli in H2O2/sunlight treated samples decreased as incubation time increased; the opposite was observed for chlorinated samples.

  18. Persistence of Bacteroides ovatus under simulated sunlight irradiation

    KAUST Repository

    Dong, Shengkun

    2014-07-04

    Background: Bacteroides ovatus, a member of the genus Bacteroides, is considered for use in molecular-based methods as a general fecal indicator. However, knowledge on its fate and persistence after a fecal contamination event remains limited. In this study, the persistence of B. ovatus was evaluated under simulated sunlight exposure and in conditions similar to freshwater and seawater. By combining propidium monoazide (PMA) treatment and quantitative polymerase chain reaction (qPCR) detection, the decay rates of B. ovatus were determined in the presence and absence of exogenous photosensitizers and in salinity up to 39.5 parts per thousand at 27°C. Results: UVB was found to be important for B. ovatus decay, averaging a 4 log10 of decay over 6 h of exposure without the presence of extracellular photosensitizers. The addition of NaNO2, an exogenous sensitizer producing hydroxyl radicals, did not significantly change the decay rate of B. ovatus in both low and high salinity water, while the exogenous sensitizer algae organic matter (AOM) slowed down the decay of B. ovatus in low salinity water. At seawater salinity, the decay rate of B. ovatus was slower than that in low salinity water, except when both NaNO2 and AOM were present. Conclusion: The results of laboratory experiments suggest that if B. ovatus is released into either freshwater or seawater environment in the evening, 50% of it may be intact by the next morning; if it is released at noon, only 50% may be intact after a mere 5 min of full spectrum irradiation on a clear day. This study provides a mechanistic understanding to some of the important environmental relevant factors that influenced the inactivation kinetics of B. ovatus in the presence of sunlight irradiation, and would facilitate the use of B. ovatus to indicate the occurrence of fecal contamination.

  19. Degadation of semiconducting polymers by concentrated sunlight

    DEFF Research Database (Denmark)

    Tromholt, Thomas; Manceau, Matthieu; Petersen, Martin Helgesen

    2011-01-01

    A lens based sunlight concentration setup was used to accelerate the degradation of semiconducting polymers. Sunlight was collected outdoor and focused into an optical fiber bundle allowing for indoor experimental work. Photo-degradation of several polymers was studied by UV–vis absorbance...... spectroscopy and infra-red spectroscopy. This showed that the degradation rate is significantly increased by increasing illumination intensity. Acceleration factors exceeding 100 compared to standard 1 sun illumination were observed for solar concentration of 200 suns in the case of P3HT. A comparison between...

  20. Role of Temperature and Suwannee River Natural Organic Matter on Inactivation Kinetics of Rotavirus and Bacteriophage MS2 by Solar Irradiation

    KAUST Repository

    Romero, Ofelia C.

    2011-12-15

    Although the sunlight-mediated inactivation of viruses has been recognized as an important process that controls surface water quality, the mechanisms of virus inactivation by sunlight are not yet clearly understood. We investigated the synergistic role of temperature and Suwannee River natural organic matter (SRNOM), an exogenous sensitizer, for sunlight-mediated inactivation of porcine rotavirus and MS2 bacteriophage. Upon irradiation by a full spectrum of simulated sunlight in the absence of SRNOM and in the temperature range of 14-42 °C, high inactivation rate constants, kobs, of MS2 (k obs ≤ 3.8 h-1 or 1-log10 over 0.6 h) and rotavirus (kobs ≤ 11.8 h-1 or ∼1-log10 over 0.2 h) were measured. A weak temperature (14-42 °C) dependence of kobs values was observed for both viruses irradiated by the full sunlight spectrum. Under the same irradiation condition, the presence of SRNOM reduced the inactivation of both viruses due to attenuation of lower wavelengths of the simulated sunlight. For rotavirus and MS2 solutions irradiated by only UVA and visible light in the absence of SRNOM, inactivation kinetics were slow (kobs < 0.3 h-1 or <1-log10 unit reduction over 7 h) and temperature-independent for the range considered. Conversely, under UVA and visible light irradiation and in the presence of SRNOM, temperature-dependent inactivation of MS2 was observed. For rotavirus, the SRNOM-mediated exogenous inactivation was only important at temperatures >33 °C, with low rotavirus kobs values (kobs ≈ 0.2 h-1; 1-log10 unit reduction over 12 h) for the temperature range of 14-33 °C. These kobs values increased to 0.5 h-1 at 43 °C and 1.5 h-1 (1-log10 reduction over 1.6 h) at 50 °C. While SRNOM-mediated exogenous inactivation of MS2 was triggered by singlet oxygen, the presence of hydrogen peroxide was important for rotavirus inactivation in the 40-50 °C range. © 2011 American Chemical Society.

  1. The genotoxic effects of DNA lesions induced by artificial UV-radiation and sunlight.

    Science.gov (United States)

    Schuch, André Passaglia; Menck, Carlos Frederico Martins

    2010-06-01

    Solar radiation sustains and affects all life forms on Earth. The increase in solar UV-radiation at environmental levels, due to depletion of the stratospheric ozone layer, highlights serious issues of social concern. This becomes still more dramatic in tropical and subtropical regions where radiation-intensity is still higher. Thus, there is the need to evaluate the harmful effects of solar UV-radiation on the DNA molecule as a basis for assessing the risks involved for human health, biological productivity and ecosystems. In order to evaluate the profile of DNA damage induced by this form of radiation and its genotoxic effects, plasmid DNA samples were exposed to artificial-UV lamps and directly to sunlight. The induction of cyclobutane pyrimidine dimer photoproducts (CPDs) and oxidative DNA damage in these molecules were evaluated by means of specific DNA repair enzymes. On the other hand, the biological effects of such lesions were determined through the analysis of the DNA inactivation rate and mutation frequency, after replication of the damaged pCMUT vector in an Escherichia coliMBL50 strain. The results indicated the induction of a significant number of CPDs after exposure to increasing doses of UVC, UVB, UVA radiation and sunlight. Interestingly, these photoproducts are those lesions that better correlate with plasmid inactivation as well as mutagenesis, and the oxidative DNA damages induced present very low correlation with these effects. The results indicated that DNA photoproducts play the main role in the induction of genotoxic effects by artificial UV-radiation sources and sunlight.

  2. Short-term inactivation rates of selected Gram-positive and Gram-negative bacteria attached to metal oxide mineral surfaces: role of solution and surface chemistry.

    Science.gov (United States)

    Asadishad, Bahareh; Ghoshal, Subhasis; Tufenkji, Nathalie

    2013-06-04

    Metal oxides such as ferric or aluminum oxides can play an important role in the retention of bacteria in granular aquatic environments; however, their role in bacterial inactivation is not well understood. Herein, we examined the role of water chemistry and surface chemistry on the short-term inactivation rates of three bacteria when adhered to surfaces. To evaluate the role of water chemistry on the inactivation of attached bacteria, the loss in membrane integrity of bacteria attached to an iron oxide (Fe2O3) surface was measured over a range of water ionic strengths of either monovalent or divalent salts in the absence of a growth substrate. The influence of surface chemistry on the inactivation of attached bacteria was examined by measuring the loss in membrane integrity of cells attached to three surfaces (SiO2, Fe2O3, and Al2O3) at a specific water chemistry (10 mM KCl). Bacteria were allowed to attach onto the SiO2 or metal oxide coated slides mounted in a parallel-plate flow cell, and their inactivation rate (loss in membrane integrity) was measured directly without removing the cells from the surface and without disturbing the system. X-ray photoelectron spectroscopy analysis revealed a high correlation between the amounts of C-metal or O-metal bonds and the corresponding bacterial inactivation rates for each surface. Finally, for all three surfaces, a consistent increase in inactivation rate was observed with the type of bacterium in the order: Enterococcus faecalis, Escherichia coli O157:H7, and Escherichia coli D21f2.

  3. Sunlight and Vitamin D

    Science.gov (United States)

    Wacker, Matthias; Holick, Michael F.

    2013-01-01

    Vitamin D is the sunshine vitamin that has been produced on this earth for more than 500 million years. During exposure to sunlight 7-dehydrocholesterol in the skin absorbs UV B radiation and is converted to previtamin D3 which in turn isomerizes into vitamin D3. Previtamin D3 and vitamin D3 also absorb UV B radiation and are converted into a variety of photoproducts some of which have unique biologic properties. Sun induced vitamin D synthesis is greatly influenced by season, time of day, latitude, altitude, air pollution, skin pigmentation, sunscreen use, passing through glass and plastic, and aging. Vitamin D is metabolized sequentially in the liver and kidneys into 25-hydroxyvitamin D which is a major circulating form and 1,25-dihydroxyvitamin D which is the biologically active form respectively. 1,25-dihydroxyvitamin D plays an important role in regulating calcium and phosphate metabolism for maintenance of metabolic functions and for skeletal health. Most cells and organs in the body have a vitamin D receptor and many cells and organs are able to produce 1,25-dihydroxyvitamin D. As a result 1,25-dihydroxyvitamin D influences a large number of biologic pathways which may help explain association studies relating vitamin D deficiency and living at higher latitudes with increased risk for many chronic diseases including autoimmune diseases, some cancers, cardiovascular disease, infectious disease, schizophrenia and type 2 diabetes. A three-part strategy of increasing food fortification programs with vitamin D, sensible sun exposure recommendations and encouraging ingestion of a vitamin D supplement when needed should be implemented to prevent global vitamin D deficiency and its negative health consequences. PMID:24494042

  4. Factors affecting the infectivity of tissues from pigs with classical swine fever: thermal inactivation rates and oral infectious dose.

    Science.gov (United States)

    Cowan, Lucie; Haines, Felicity J; Everett, Helen E; Crudgington, Bentley; Johns, Helen L; Clifford, Derek; Drew, Trevor W; Crooke, Helen R

    2015-03-23

    Outbreaks of classical swine fever are often associated with ingestion of pig meat or products derived from infected pigs. Assessment of the disease risks associated with material of porcine origin requires knowledge on the likely amount of virus in the original material, how long the virus may remain viable within the resulting product and how much of that product would need to be ingested to result in infection. Using material from pigs infected with CSFV, we determined the viable virus concentrations in tissues that comprise the majority of pork products. Decimal reduction values (D values), the time required to reduce the viable virus load by 90% (or 1 log10), were determined at temperatures of relevance for chilling, cooking, composting and ambient storage. The rate of CSFV inactivation varied in different tissues. At lower temperatures, virus remained viable for substantially longer in muscle and serum compared to lymphoid and fat tissues. To enable estimation of the temperature dependence of inactivation, the temperature change required to change the D values by 90% (Z values) were determined as 13 °C, 14 °C, 12 °C and 10 °C for lymph node, fat, muscle and serum, respectively. The amount of virus required to infect 50% of pigs by ingestion was determined by feeding groups of animals with moderately and highly virulent CSFV. Interestingly, the virulent virus did not initiate infection at a lower dose than the moderately virulent strain. Although higher than for intranasal inoculation, the amount of virus required for infection via ingestion is present in only a few grams of tissue from infected animals.

  5. Protein A chromatography increases monoclonal antibody aggregation rate during subsequent low pH virus inactivation hold

    Science.gov (United States)

    Mazzer, Alice R.; Perraud, Xavier; Halley, Jennifer; O’Hara, John; Bracewell, Daniel G.

    2015-01-01

    Protein A chromatography is a near-ubiquitous method of mAb capture in bioprocesses. The use of low pH buffer for elution from protein A is known to contribute to product aggregation. Yet, a more limited set of evidence suggests that low pH may not be the sole cause of aggregation in protein A chromatography, rather, other facets of the process may contribute significantly. This paper presents a well-defined method for investigating this problem. An IgG4 was incubated in elution buffer after protein A chromatography (typical of the viral inactivation hold) and the quantity of monomer in neutralised samples was determined by size exclusion chromatography; elution buffers of different pH values predetermined to induce aggregation of the IgG4 were used. Rate constants for monomer decay over time were determined by fitting exponential decay functions to the data. Similar experiments were implemented in the absence of a chromatography step, i.e. IgG4 aggregation at low pH. Rate constants for aggregation after protein A chromatography were considerably higher than those from low pH exposure alone; a distinct shift in aggregation rates was apparent across the pH range tested. PMID:26346187

  6. Concentrated sunlight for organic solar cells

    DEFF Research Database (Denmark)

    Tromholt, Thomas

    2010-01-01

    Concentrated sunlight provides a novel approach to the study of the physical and electrical parameters of organic solar cells. The study of performance of organic solar cells at high solar concentrations provides insight into the physics, which cannot be studied with conventional solar simulators....... A high solar intensity study of inverted P3HT:PCBM solar cells is presented. Performance peak positions were found to be in the range of 1-5 suns, with smaller cells peaking at higher solar concentrations. Additionally, concentrated sunlight is demonstrated as a practical tool for accelerated stability...... studies of polymers for organic solar cells. Degradation was monitored by the evolution of the UV-vis absorption over time. Varying the solar intensity from 1 to 200 suns, the degradation rates were increased by more than a factor of 100 relative to degradation at 1 simulated sun. 5 different polymers...

  7. Concentrated sunlight for organic solar cells

    DEFF Research Database (Denmark)

    Tromholt, Thomas

    2010-01-01

    Concentrated sunlight provides a novel approach to the study of the physical and electrical parameters of organic solar cells. The study of performance of organic solar cells at high solar concentrations provides insight into the physics, which cannot be studied with conventional solar simulators...... studies of polymers for organic solar cells. Degradation was monitored by the evolution of the UV-vis absorption over time. Varying the solar intensity from 1 to 200 suns, the degradation rates were increased by more than a factor of 100 relative to degradation at 1 simulated sun. 5 different polymers....... A high solar intensity study of inverted P3HT:PCBM solar cells is presented. Performance peak positions were found to be in the range of 1-5 suns, with smaller cells peaking at higher solar concentrations. Additionally, concentrated sunlight is demonstrated as a practical tool for accelerated stability...

  8. Thin-film fixed-bed reactor (TFFBR for solar photocatalytic inactivation of aquaculture pathogen Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Khan Sadia J

    2012-01-01

    Full Text Available Abstract Background Outbreaks of infectious diseases by microbial pathogens can cause substantial losses of stock in aquaculture systems. There are several ways to eliminate these pathogens including the use of antibiotics, biocides and conventional disinfectants, but these leave undesirable chemical residues. Conversely, using sunlight for disinfection has the advantage of leaving no chemical residue and is particularly suited to countries with sunny climates. Titanium dioxide (TiO2 is a photocatalyst that increases the effectiveness of solar disinfection. In recent years, several different types of solar photocatalytic reactors coated with TiO2 have been developed for waste water and drinking water treatment. In this study a thin-film fixed-bed reactor (TFFBR, designed as a sloping flat plate reactor coated with P25 DEGUSSA TiO2, was used. Results The level of inactivation of the aquaculture pathogen Aeromonas hydrophila ATCC 35654 was determined after travelling across the TFFBR under various natural sunlight conditions (300-1200 W m-2, at 3 different flow rates (4.8, 8.4 and 16.8 L h-1. Bacterial numbers were determined by conventional plate counting using selective agar media, cultured (i under conventional aerobic conditions to detect healthy cells and (ii under conditions designed to neutralise reactive oxygen species (agar medium supplemented with the peroxide scavenger sodium pyruvate at 0.05% w/v, incubated under anaerobic conditions, to detect both healthy and sub-lethally injured (oxygen-sensitive cells. The results clearly demonstrate that high sunlight intensities (≥ 600 W m-2 and low flow rates (4.8 L h-1 provided optimum conditions for inactivation of A. hydrophila ATCC 3564, with greater overall inactivation and fewer sub-lethally injured cells than at low sunlight intensities or high flow rates. Low sunlight intensities resulted in reduced overall inactivation and greater sub-lethal injury at all flow rates. Conclusions This

  9. GCR Transport in the Brain: Assessment of Self-Shielding, Columnar Damage, and Nuclear Reactions on Cell Inactivation Rates

    Science.gov (United States)

    Shavers, M. R.; Atwell, W.; Cucinotta, F. A.; Badhwar, G. D. (Technical Monitor)

    1999-01-01

    Radiation shield design is driven by the need to limit radiation risks while optimizing risk reduction with launch mass/expense penalties. Both limitation and optimization objectives require the development of accurate and complete means for evaluating the effectiveness of various shield materials and body-self shielding. For galactic cosmic rays (GCR), biophysical response models indicate that track structure effects lead to substantially different assessments of shielding effectiveness relative to assessments based on LET-dependent quality factors. Methods for assessing risk to the central nervous system (CNS) from heavy ions are poorly understood at this time. High-energy and charge (HZE) ion can produce tissue events resulting in damage to clusters of cells in a columnar fashion, especially for stopping heavy ions. Grahn (1973) and Todd (1986) have discussed a microlesion concept or model of stochastic tissue events in analyzing damage from HZE's. Some tissues, including the CNS, maybe sensitive to microlesion's or stochastic tissue events in a manner not illuminated by either conventional dosimetry or fluence-based risk factors. HZE ions may also produce important lateral damage to adjacent cells. Fluences of high-energy proton and alpha particles in the GCR are many times higher than HZE ions. Behind spacecraft and body self-shielding the ratio of protons, alpha particles, and neutrons to HZE ions increases several-fold from free-space values. Models of GCR damage behind shielding have placed large concern on the role of target fragments produced from tissue atoms. The self-shielding of the brain reduces the number of heavy ions reaching the interior regions by a large amount and the remaining light particle environment (protons, neutrons, deuterons. and alpha particles) may be the greatest concern. Tracks of high-energy proton produce nuclear reactions in tissue, which can deposit doses of more than 1 Gv within 5 - 10 cell layers. Information on rates of

  10. CuFe2O4/TiO2复合光催化剂在模拟太阳光下对大肠杆菌杀灭作用的研究%Photocatalytic Inactivation of Escherichia Coli by CuFe2O4/TiO2 Comoosite Photocatalvst under Simulated Sunlight Irradiation

    Institute of Scientific and Technical Information of China (English)

    张丽; 黄可龙; 陈浩; 阎建辉

    2011-01-01

    Copper ferrite(CuFe2O4) nanoparticles were synthesized by sol-gel method and compounded with TiO2 to form CuFe2O4/TiO2 composite photocatalyst via solid-state reaction. The composite photocatalyst was characterized by transmission electron microscopy ( TEM ), X-ray diffraction ( XRD ) and UV-vis diffuse reflectance spectrum ( UV-vis DRS). It tells that the sample prepared is composed of nanoparticles with a grain size of about 80 nm and features uniform crystal structure. The photocatalytic inactivation of Escherichia coli, a Gram-negative bacterium, was performed with the photocatalyst to investigate its photocatalytic bactericidal capability under simulated sunlight ( 150 W xenon lamp, λ = 200 ~ 900 nm) irradiation. The results show that CuFe2O4/TiO2 composite photocatalyst exhibites a much better photocatalytic activity than single CuFe2O4 or TiO2. Under optimal conditions, after 30 min irradiation of the simulated sunlight, the photocatalytic sterilization efficiency of CuFe2O4/TiO2 is 1.71 and 1. 13 times more than that of CuFe2O4 and TiO2, respectively. The mass ratio of CuFe2O4 to TiO2 and the calcination temperature for solid-phase synthesis have effects on the bactericidal performance of the composite. When the photocatalyst prepared at 80% TiO2 mass fraction and 600 ℃ calcination temperature is used to treat Escherichia coli, its survival ratio is only 3.2% after 30 mins simulated sunlight irradiation. However, when CuFe2O4 or TiO2 is used under optimum conditions the survival ratio is 43.3% or 14.2% after 30 rains irradiation. Using photocatalyst in the dark and no photocatalyst in the light resulted in the survival ratio of Escherichia coli of 97.0% and 93.2%, respectively under the same conditions.%采用溶胶-凝胶法制备了纳米CuFe2O4,然后与TiO2固相烧结成复合光催化剂,并通过TEM,XRD和UV-visDRS对复合光催化剂进行了表征,表明样品由粒径约为80nm的粒子组成,晶体结

  11. STUDIES ON THE BACTERIOPHAGE OF D'HERELLE : V. EFFECT OF ELECTROLYTES ON THE RATE OF INACTIVATION OF BACTERIOPHAGE BY ALCOHOL.

    Science.gov (United States)

    Bronfenbrenner, J J; Korb, C

    1926-01-01

    Addition of neutral salts to the lytic filtrate results in an increased rate of inactivation of the latter when alcohol is added to it. This effect of salts is the more marked the higher the valency of the cation. Conversely, removal by dialysis of salts originally present in the lytic filtrate tends to render lytic agent less sensitive to alcohol. Restitution of the original salt content to the dialyzed filtrate tends to bring the sensitiveness to alcohol in the dialyzed filtrate to the level of the non-dialyzed control. It appears, therefore, that inactivation of the lytic agent by alcohol depends directly on the rate of precipitation of the coagulable constituents of the medium, and is not the result of a direct toxic action of alcohol on "bacteriophagum intestinale." Considered in association with our earlier findings, these results speak in favor of the chemical nature of the agent of transmissible lysis.

  12. Sunlight Responsive Thermochromic Window System

    Energy Technology Data Exchange (ETDEWEB)

    Millett, F,A; Byker,H, J

    2006-10-27

    Pleotint has embarked on a novel approach with our Sunlight Responsive Thermochromic, SRT™, windows. We are integrating dynamic sunlight control, high insulation values and low solar heat gain together in a high performance window. The Pleotint SRT window is dynamic because it reversibly changes light transmission based on thermochromics activated directly by the heating effect of sunlight. We can achieve a window package with low solar heat gain coefficient (SHGC), a low U value and high insulation. At the same time our windows provide good daylighting. Our innovative window design offers architects and building designers the opportunity to choose their desired energy performance, excellent sound reduction, external pane can be self-cleaning, or a resistance to wind load, blasts, bullets or hurricanes. SRT windows would provide energy savings that are estimated at up to 30% over traditional window systems. Glass fabricators will be able to use existing equipment to make the SRT window while adding value and flexibility to the basic design. Glazing installers will have the ability to fit the windows with traditional methods without wires, power supplies and controllers. SRT windows can be retrofit into existing buildings,

  13. Photocatalytic oxidation of ciprofloxacin under simulated sunlight.

    Science.gov (United States)

    Gad-Allah, Tarek A; Ali, Mohamed E M; Badawy, Mohamed I

    2011-02-15

    Ciprofloxacin (CIP) is a famous synthetic chemotherapeutic antibiotic. It is widely found either in water or wastewater. In this study ciprofloxacin was photocatalytically degraded using commercial anatase titanium dioxide (TiO(2)) under simulated sunlight. The rate of reaction was found to be affected by pH, TiO(2) concentration and antibiotic concentration. The best reaction rate was obtained in natural ciprofloxacin pH (5.8) and 1000 mg/L TiO(2). More titania concentration was found to reduce the reaction rate because of the limitation in light transmittance. From kinetic studies, the reaction was proved to proceed through adsorption step then photooxidation and obeys pseudo-first order kinetics. Copyright © 2010 Elsevier B.V. All rights reserved.

  14. Sunlight exposure: Do health benefits outweigh harm?

    Science.gov (United States)

    Razzaque, Mohammed S

    2016-09-16

    Vitamin D is a fat-soluble vitamin whose levels within the body are elevated following sunlight exposure. Numerous studies have shown that sunlight exposure can provide protection to a wide variety of diseases, ranging from different types of tumors to hypertension to type 1 diabetes to multiple sclerosis. Moreover, studies have shown that avoiding sunlight may influence the initiation and progression of some of these diseases. Avoidance of sunlight, coupled with the inclination towards consuming supplements, is becoming the primary choice to obtain vitamin D. The purpose of this article is to present evidences from published literature, to show that the expected benefits of vitamin D supplements are minimized by the potential risk of cardiovascular events and beyond. Since hypovitaminosis D status usually reflects reduced sunlight exposure, the obvious primary replacement should be safe sunlight exposure, and not exogenous supplements. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Inactivation of the central nucleus of the amygdala blocks classical conditioning but not conditioning-specific reflex modification of rabbit heart rate.

    Science.gov (United States)

    Burhans, Lauren B; Schreurs, Bernard G

    2013-02-01

    Heart rate (HR) conditioning in rabbits is a widely used model of classical conditioning of autonomic responding that is noted for being similar to the development of conditioned heart rate slowing (bradycardia) in humans. We have shown previously that in addition to HR changes to a tone conditioned stimulus (CS), the HR reflex itself can undergo associative change called conditioning-specific reflex modification (CRM) that manifests when tested in the absence of the CS. Because CRM resembles the conditioned bradycardic response to the CS, we sought to determine if HR conditioning and CRM share a common neural substrate. The central nucleus of the amygdala (CeA) is a critical part of the pathway through which conditioned bradycardia is established. To test whether the CeA is also involved in the acquisition and/or expression of CRM, we inactivated the CeA with muscimol during HR conditioning or CRM testing. CeA inactivation blocked HR conditioning without completely preventing CRM acquisition or expression. These results suggest that the CeA may therefore only play a modulatory role in CRM. Theories on the biological significance of conditioned bradycardia suggest that it may represent a state of hypervigilance that facilitates the detection of new and changing contingencies in the environment. We relate these ideas to our results and discuss how they may be relevant to the hypersensitivity observed in fear conditioning disorders like post-traumatic stress.

  16. Does sunlight exposure improve survival in patients with non-small cell lung cancer?

    Science.gov (United States)

    Mutlu, Hasan; Buyukcelik, Abdullah; Aksahin, Arzu; Kibar, Mustafa; Cihan, Yasemin Benderli; Kaya, Eser; Seyrek, Ertugrul; Yavuz, Sinan; Erden, Abdulsamet; Calikusu, Zuleyha; Aslan, Tuncay; Akca, Zeki

    2013-01-01

    Some epidemiological studies reported that sunlight exposure and highvitamin D levels may decrease the morbidity and mortality related to cancer. We aimed to evaluate whether sunlight exposure has an impact on survival in patients with non small cell lung cancer. A total of 546 patients with NSCLC from two different regions (Kayseri and Adana) differing according to sunlight exposure were analysed retrospectively. The median overall survival (OS) rates were 11. 6 (CI: 9.50-13.6) and 15.6 months (CI: 12.4-18.8) for Kayseri and Adana, respectively, in all patients (p=0.880). There were no differences between groups in terms of OS. While there is strong evidence regarding inverse relationship between cancer incidence and sunlight exposure, it is still controversial whether sunlight exposure is a good prognostic factor for survival in patients with lung cancer.

  17. Photocatalytic degradation of synthetic dye under sunlight

    Directory of Open Access Journals (Sweden)

    Mijin Dušan

    2007-01-01

    Full Text Available Synthetic dyes are widely used in the textile industry. Dye pollutants from the textile industry are an important source of environmental contamination. The majority of these dyes are toxic, mostly non-biodegradable and also resistant to decomposition by physico-chemical methods. Among new oxidation methods or "advanced oxidation processes", heterogeneous photocatalysis appears as an emerging destructive technology leading to the total mineralization of many organic pollutants. CI Basic Yellow 28 (BY28, commonly used as a textile dye, could be photocatalytically degraded using TiU2 as catalyst under sunlight. The effect of some parameters such as the initial catalyst concentration, initial dye concentration, initial NaCl and Na2CO3 concentrations, pH, H2O2 and type of catalyst on the degradation rate of BY28 was examined in details. The presence of NaCl and Na2CO3 led to inhibition of the photodegradation process. The highest photodegradation rate was observed at high pH, while the rate was the lowest at low pH. Increase of the initial H2O2 concentration increased the initial BY28 photodegradation efficiency. ZnO was a better catalyst than TiO2 at low dye concentrations.

  18. Technique to separate lidar signal and sunlight.

    Science.gov (United States)

    Sun, Wenbo; Hu, Yongxiang; MacDonnell, David G; Weimer, Carl; Baize, Rosemary R

    2016-06-13

    Sunlight contamination dominates the backscatter noise in space-based lidar measurements during daytime. The background scattered sunlight is highly variable and dependent upon the surface and atmospheric albedo. The scattered sunlight contribution to noise increases over land and snow surfaces where surface albedos are high and thus overwhelm lidar backscatter from optically thin atmospheric constituents like aerosols and thin clouds. In this work, we developed a novel lidar remote sensing concept that potentially can eliminate sunlight induced noise. The new lidar concept requires: (1) a transmitted laser light that carries orbital angular momentum (OAM); and (2) a photon sieve (PS) diffractive filter that separates scattered sunlight from laser light backscattered from the atmosphere, ocean and solid surfaces. The method is based on numerical modeling of the focusing of Laguerre-Gaussian (LG) laser beam and plane-wave light by a PS. The model results show that after passing through a PS, laser light that carries the OAM is focused on a ring (called "focal ring" here) on the focal plane of the PS filter, very little energy arrives at the center of the focal plane. However, scattered sunlight, as a plane wave without the OAM, focuses at the center of the focal plane and thus can be effectively blocked or ducted out. We also find that the radius of the "focal ring" increases with the increase of azimuthal mode (L) of LG laser light, thus increasing L can more effectively separate the lidar signal away from the sunlight noise.

  19. Effects of concentrated sunlight on organic photovoltaics

    DEFF Research Database (Denmark)

    Tromholt, Thomas; Katz, Eugene A.; Hirsch, Baruch

    2010-01-01

    gradually from 0.2 to 27 suns. Power conversion efficiency exhibited slow increase with C that was followed by saturation around 2% at C = 0.5–2.5 suns and subsequent strong reduction. Possible OPV applications in stationary solar concentrators (C ≤ 2 suns) are discussed. Finally, experiments at C = 55......We report the effects of concentrated sunlight on key photovoltaic parameters and stability of organic photovoltaics (OPV). Sunlight collected and concentrated outdoors was focused into an optical fiber and delivered onto a 1 cm2 bulk-heterojunction cell. Sunlight concentration C was varied...

  20. Can Natural Sunlight Induce Coherent Exciton Dynamics?

    CERN Document Server

    Olšina, Jan; Wang, Chen; Cao, Jianshu

    2014-01-01

    Excitation of a model photosynthetic molecular aggregate by incoherent sunlight is systematically examined. For a closed system, the excited state coherence induced by the sunlight oscillates with an average amplitude that is inversely proportional to the excitonic gap, and reaches a stationary amplitude that depends on the temperature and coherence time of the radiation field. For an open system, the light-induced dynamical coherence relaxes to a static coherence determined by the non-canonical thermal distribution resulting from the entanglement with the phonon bath. The decay of the excited state population to the common ground state establishes a non-equilibrium steady-state flux driven by the sunlight, and it defines a time window to observe the transition from dynamical to static coherence. For the parameters relevant to photosynthetic systems, the exciton dynamics initiated by the sunlight exhibits a non-negligible amount of dynamical coherence (quantum beats) on the sub-picosecond timescale; however, ...

  1. Supplementing vitamin D through sunlight: associating health literacy with sunlight exposure behavior.

    Science.gov (United States)

    Leung, Angela Yee Man; Cheung, Mike Kwun Ting; Chi, Iris

    2015-01-01

    To test whether health literacy is associated with sunlight exposure behavior, we interviewed 648 Chinese adults aged 65 years or older. Using the information-motivation-behavioral skills model and structural equation modeling, we tested whether health literacy was associated with the complex relationships among knowledge about vitamin D, attitudes toward sunlight exposure, doctor recommendations regarding sunlight exposure, and sunlight exposure behavior. Health literacy was directly associated with sunlight exposure (β=.20, psunlight exposure through health literacy (β=.46, psunlight exposure through health literacy (β=-.12, psunlight exposure. Providing relevant knowledge or making doctor recommendations might not be effective. Training should focus on individuals with low health literacy who may be less likely to receive sunlight exposure. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  2. Multi-Layered TiO2 Films towards Enhancement of Escherichia coli Inactivation

    Directory of Open Access Journals (Sweden)

    Sorachon Yoriya

    2016-09-01

    Full Text Available Crystalline TiO2 has shown its great photocatalytic properties in bacterial inactivation. This work presents a design fabrication of low-cost, layered TiO2 films assembled reactors and a study of their performance for a better understanding to elucidate the photocatalytic effect on inactivation of E. coli in water. The ability to reduce the number of bacteria in water samples for the layered TiO2 composing reactors has been investigated as a function of time, while varying the parameters of light sources, initial concentration of bacteria, and ratios of TiO2 film area and volume of water. Herein, the layered TiO2 films have been fabricated on the glass plates by thermal spray coating prior to screen printing, allowing a good adhesion of the films. Surface topology and crystallographic phase of TiO2 for the screen-printed active layer have been characterized, resulting in the ratio of anatase:rutile being 80:20. Under exposure to sunlight and a given condition employed in this study, the optimized film area:water volume of 1:2.62 has shown a significant ability to reduce the E. coli cells in water samples. The ratio of surface area of photocatalytic active base to volume of water medium is believed to play a predominant role facilitating the cells inactivation. The kinetic rate of inactivation and its behavior are also described in terms of adsorption of reaction species at different contact times.

  3. Combined Application of Natural Sunlight and Hydrogen peroxide on the Removal of Harmful Cyanobacteria

    Science.gov (United States)

    Wang, D. H.; Li, L.; Zhu, C. W.; Wang, Z. Y.; Xie, P.

    2017-08-01

    This study provides an efficient and environmentally friendly advanced oxidation technique involving the combined application of natural sunlight and hydrogen peroxide for the removal of harmful cyanobacteria from lakes and reservoirs. In this paper, we collected water samples from Taihu Lake (Wuxi, China) in August 2016 when cyanobacterial blooms had occurred and then performed an outdoor experiment. Hydrogen peroxide at 0.6 mM had no obvious effect on the cyanobacterial inactivation in the dark, even stimulating cyanobacterial growth to some extent. Cyanobacteria were inactivated by higher concentrations of hydrogen peroxide (1.0 mM) in the dark, as well as 0.4 mM hydrogen peroxide under sunlight irradiation, indicating that natural sunlight significantly enhanced the effect of hydrogen peroxide on the removal of cyanobacteria. An experiment involving Pseudanabaena sp. (a harmful species) led to similar conclusions as the study using algae attained from Taihu Lake. This study provides a practical and effective method for controlling harmful cyanobacteria in natural water bodies.

  4. Ultra-accelerated natural sunlight exposure testing

    Energy Technology Data Exchange (ETDEWEB)

    Jorgensen, G.J.; Bingham, C.; Goggin, R.; Lewandowski, A.A.; Netter, J.C.

    2000-06-13

    Process and apparatus are disclosed for providing ultra accelerated natural sunlight exposure testing of samples under controlled weathering without introducing unrealistic failure mechanisms in exposed materials and without breaking reciprocity relationships between flux exposure levels and cumulative dose that includes multiple concurrent levels of temperature and relative humidity at high levels of natural sunlight comprising: (a) concentrating solar flux uniformly; (b) directing the controlled uniform sunlight onto sample materials in a chamber enclosing multiple concurrent levels of temperature and relative humidity to allow the sample materials to be subjected to accelerated irradiance exposure factors for a sufficient period of time in days to provide a corresponding time of about at least a years worth of representative weathering of the sample materials.

  5. Ultra-accelerated natural sunlight exposure testing

    Energy Technology Data Exchange (ETDEWEB)

    Jorgensen, Gary J. (Pine, CO); Bingham, Carl (Lakewood, CO); Goggin, Rita (Englewood, CO); Lewandowski, Allan A. (Evergreen, CO); Netter, Judy C. (Westminster, CO)

    2000-06-13

    Process and apparatus for providing ultra accelerated natural sunlight exposure testing of samples under controlled weathering without introducing unrealistic failure mechanisms in exposed materials and without breaking reciprocity relationships between flux exposure levels and cumulative dose that includes multiple concurrent levels of temperature and relative humidity at high levels of natural sunlight comprising: a) concentrating solar flux uniformly; b) directing the controlled uniform sunlight onto sample materials in a chamber enclosing multiple concurrent levels of temperature and relative humidity to allow the sample materials to be subjected to accelerated irradiance exposure factors for a sufficient period of time in days to provide a corresponding time of about at least a years worth of representative weathering of the sample materials.

  6. Sunlight-Induced Coloration of Silk

    Science.gov (United States)

    Yao, Ya; Tang, Bin; Chen, Wu; Sun, Lu; Wang, Xungai

    2016-06-01

    Silk fabrics were colored by gold nanoparticles (NPs) that were in situ synthesized through the induction of sunlight. Owing to the localized surface plasmon resonance (LSPR) of gold NPs, the treated silk fabrics presented vivid colors. The photo-induced synthesis of gold NPs was also realized on wet silk through adsorbing gold ions out of solution, which provides a water-saving coloration method for textiles. Besides, the patterning of silk was feasible using this simple sunlight-induced coloration approach. The key factors of coloration including gold ion concentration, pH value, and irradiation time were investigated. Moreover, it was demonstrated that either ultraviolet (UV) light or visible light could induce the generation of gold NPs on silk fabrics. The silk fabrics with gold NPs exhibited high light resistance including great UV-blocking property and excellent fastness to sunlight.

  7. Sunlight Diffusing Tent for Lunar Worksite

    Science.gov (United States)

    Burleson, Blair; Clark, Todd; Deese, Todd; Gentry, Ernest; Samad, Abdul

    1990-01-01

    The purpose is to provide a solution to problems astronauts encounter with sunlight on the lunar surface. Due to the absence of an atmosphere the Moon is subjected to intense sunlight creating problems with color and contrast. This problem can be overcome by providing a way to reduce intensity and diffuse the light in a working environment. The solution to the problem utilizes an umbrella, tent-like structure covered with a diffusing material. The design takes into account structural materials, stresses, fabrics, and deployment.

  8. Inactivation differences of microorganisms by low pressure UV and pulsed xenon lamps.

    Science.gov (United States)

    Otaki, M; Okuda, A; Tajima, K; Iwasaki, T; Kinoshita, S; Ohgaki, S

    2003-01-01

    UV disinfection has been applied to water treatment in recent years with low-pressure and medium-pressure UV lamps mainly used as the light source. In general, UV disinfection is considered to be inefficient with water of high turbidity because of inhibition of light penetration. Additionally, photoreactivation may be a problem that should be considered in case a disinfected water is discharged to the environment where sunlight causes reactivation. Recently, other types of lamps have been proposed including a flush-type lamp (such as a pulsed-xenon lamp) that emits high energy and wide wavelength intermittently. In this study, the difference between inactivation efficiencies by low-pressure UV (LPUV) and pulsed-xenon (PXe) lamps was investigated using two coliphage types and three strains of Escherichia coli. PXe had a suppressive effect on photoreactivation rate of the E. coli strains even though there was no significant effect on inactivation rate and maximum survival ratio after photoreactivation. PXe also had a benefit when applied to high turbidity waters as no tailing phenomena were observed in the low survival ratio area although it was observed in LPUV inactivation. This efficiency difference was considered to be due to the difference in irradiated wavelength of both lamps.

  9. Water balance of goats in Jeneponto - South Sulawesi under sunlight exposure and water restriction

    Directory of Open Access Journals (Sweden)

    Djoni Prawira Rahardja

    2007-10-01

    Full Text Available Water balance of 5 does of Kacang goat of Jeneponto was studied under the condition of sunlight exposure and water restriction. The study was conducted in dry season with 4 consecutive treatments of 10 d with 4-5 d of adjustment period between two consecutive treatments: (1 indoor and unrestricted water; (2 indoor and restricted water; (3 10 h outdoor–and unrestricted water; (4 10 h outdoor – restricted water. The maximum air temperature of outdoor was 39.3OC, and it was 30OC in the indoor environment. In all treatments, the animals were placed in the individual crates. The plasma volume of the goats was higher under sunlight exposure, but it decreased by water restriction, while hematocrite value indicated a reverse responses. Sunlight exposure did not significantly decrease the intake and digestion of organic matter, but water restriction affected significantly and this effect was higher under sunlight exposre. The proportions of water loss through every avenue were maintained relatively constant either under water restriction or sunlight exposure in which the respration rate increased significantly. The findings suggest that sunlight exposure with unrestricted water resulted in a positive water balance without a significant change in organic matter intake and utilization. Water restriction resulted in a negative water balance, reducing organic matter intake and utilization. As the adaptive mechanisms, the goat appeared to be able to withstand in the harsh environment of Jeneponto by expanding plasma volume, increasing body temperature and respiration rate.

  10. Photochemical Transformation of Graphene Oxide in Sunlight

    Science.gov (United States)

    Graphene oxide (GO) is a graphene derivative that is more easily manufactured in large scale and used to synthesize reduced graphene oxide (rGO) with properties analogous to graphene. In this study, we investigate the photochemical fate of GO under sunlight conditions. The resu...

  11. The release of dipicolinic acid--the rate-limiting step of Bacillus endospore inactivation during the high pressure thermal sterilization process.

    Science.gov (United States)

    Reineke, Kai; Schlumbach, Karl; Baier, Daniel; Mathys, Alexander; Knorr, Dietrich

    2013-03-01

    High pressure combined with elevated temperatures can produce low acid, commercially sterile and shelf-stable foods. Depending on the temperature and pressure levels applied, bacterial endospores pass through different pathways, which can lead to a pressure-induced germination or inactivation. Regardless of the pathway, Bacillus endospores first release pyridine-2,6-dicarboxylic acid (DPA), which contributes to the low amount of free water in the spore core and is consequently responsible for the spore's high resistance against wet and dry heat. This is therefore the rate-limiting step in the high pressure sterilization process. To evaluate the impact of a broad pressure, temperature and time domain on the DPA release, Bacillus subtilis spores were pressure treated between 0.1 and 900 MPa at between 30 and 80 °C under isothermal isobaric conditions during dwell time. DPA quantification was assessed using HPLC, and samples were taken both immediately and 2 h after the pressure treatment. To obtain a release kinetic for some pressure-temperature conditions, samples were collected between 1s and 60 min after decompression. A multiresponse kinetic model was then used to derive a model covering all kinetic data. The isorate lines modeled for the DPA release in the chosen pressure-temperature landscape enabled the determination of three distinct zones. (I) For pressures 50 °C, a 90% DPA release was achievable in less than 5 min and no difference in the amount of DPA was found immediately 2 h after pressurization. This may indicate irreversible damage to the inner spore membrane or membrane proteins. (II) Above 600 MPa the synergism between pressure and temperature diminished, and the treatment temperature alone dominated DPA release. (III) Pressures pressure-induced physiological like germination with cortex degradation, which continues after pressure release. Furthermore, at 600 MPa and 40 °C, a linear relationship was found for the DPA release rate constants ln

  12. Sunlight decreased genotoxicity of azadirachtin on root tip cells of Allium cepa and Eucrosia bicolor.

    Science.gov (United States)

    Kwankua, W; Sengsai, S; Kuleung, C; Euawong, N

    2010-07-01

    Utilization of neem plant (Azadirachta indica A. Juss) extract for pest control in agriculture has raised concerns over contamination by the residues to the environment. Such residues, particularly azadirachtin (Aza), may cause deleterious effect to non-target organisms. This investigation was conducted to find out if Aza could be inactivated through exposures to sunlight. Activity of Aza was assessed as its ability to cause cytotoxic and genotoxic effects in the forms of nuclei abnormality and chromosome aberration as measured by mitotic index (MI) and mitotic aberration (MA). Varying concentrations of Aza were tested on Allium cepa and Eucrosia bicolor. It was found that the MI of all root tip meristematic cells of A. cepa and E. bicolor treated with 0.00005%, 0.00010%, 0.00015%, and 0.00020% (w/v) Aza-containing neem extract for 24h, were significantly lower than the controls. Complementary to the lower levels of MI, the Aza-treated groups showed higher MA levels in all cases investigated. Furthermore, the decreasing levels of MI and the increasing levels of MA related well with the increasing concentration of Aza. Microscopic examination of root tip meristematic cells revealed that the anomaly found most often were mitotic disturbances and chromosomal bridges. Exposures of 0.00020% (w/v) Aza to sunlight for 3 days and 7 days decreased Aza ability to induce cytotoxicity and genotoxicity, both in terms of MI and MA, to root tip meristematic cells in A. cepa and E. bicolor. Photodegradation of Aza upon exposure to direct sunlight was confirmed by HPLC. The study implicates that Aza would unlikely cause long term deleterious effects to the environment since it would be inactivated by sunlight. Copyright (c) 2010 Elsevier Inc. All rights reserved.

  13. Sunlight induced photo reactivity of drugs

    Energy Technology Data Exchange (ETDEWEB)

    Dallera, R.; Dondi, D.; Ricci, A.; Fasani, E.; Albini, A.

    2003-07-01

    The reactivity under natural light of some UVA-UVB photol able drugs belonging to the classes of fluoroquinolones, glucocortocosteroids, sunscreens and nitrophenyldihydropyridines has been investigated. The data suggest that exposition to sunlight for times ranging from some minutes to few hours at PSA is sufficient for promoting a high degradation in the drugs investigated. the chemical reactions are the same as observed under artificial UV light. (Author) 28 refs.

  14. How long can culturable bacteria and total DNA persist in environmental waters? The role of sunlight and solid particles.

    Science.gov (United States)

    Gutiérrez-Cacciabue, Dolores; Cid, Alicia G; Rajal, Verónica B

    2016-01-01

    In this work, sunlight inactivation of two indicator bacteria in freshwater, with and without solid particles, was studied and the persistence of culturable cells and total DNA was compared. Environmental water was used to prepare two matrices, with and without solid particles, which were spiked with Escherichia coli and Enterococcus faecalis. These matrices were used to prepare microcosm bags that were placed in two containers: one exposed to sunlight and the other in the dark. During one month, samples were removed from each container and detection was done by membrane filter technique and real-time PCR. Kinetic parameters were calculated to assess sunlight effect. Indicator bacteria without solid particles exposed to sunlight suffered an immediate decay (solid particles varied depending on the situation analyzed (T99 from 3 up to 60days), being always culturable E. coli more persistent than E. faecalis. On the other side, E. faecalis DNA persisted much longer than culturable cells (T99>40h in the dark with particles). In this case active cells were more prone to sunlight than total DNA and the protective effect of solid particles was also observed. Results highlight that the effects caused by the parameters which describe the behavior of culturable microorganisms and total DNA in water are different and must be included in simulation models but without forgetting that these parameters will also depend on bacterial properties, sensitizers, composition, type, and uses of the aquatic environment under assessment.

  15. Sunlight exposure assessment: can we accurately assess vitamin D exposure from sunlight questionnaires?

    Science.gov (United States)

    McCarty, Catherine A

    2008-04-01

    The purpose of this review is to summarize the peer-reviewed literature in relation to sunlight exposure assessment and the validity of using sunlight exposure questionnaires to quantify vitamin D status. There is greater variability in personal ultraviolet (UV) light exposure as the result of personal behavior than as the result of ambient UV light exposure. Although statistically significant, the correlation coefficients for the relation between personal report of sun exposure and ambient UV light measured by dosimetry (assessment of radiation dose) are relatively low. Moreover, the few studies to assess the relation between sunlight measures and serum 25-hydroxyvitamin D show low correlations. These low correlations may not be surprising given that personal factors like melanin content in skin and age also influence cutaneous synthesis of vitamin D. In summary, sunlight exposure questionnaires currently provide imprecise estimates of vitamin D status. Research should be directed to develop more objective, nonintrusive, and economical measures of sunlight exposure to quantify personal vitamin D status.

  16. Efficacy of scallop shell powders and slaked lime for inactivating avian influenza virus under harsh conditions.

    Science.gov (United States)

    Thammakarn, Chanathip; Tsujimura, Misato; Satoh, Keisuke; Hasegawa, Tomomi; Tamura, Miho; Kawamura, Akinobu; Ishida, Yuki; Suguro, Atsushi; Hakim, Hakimullah; Ruenphet, Sakchai; Takehara, Kazuaki

    2015-10-01

    The efficacy and stability of scallop shell powder (SSP) were investigated, in terms of its capacity to inactivate avian influenza virus (AIV), and compared with slaked lime (SL). An environmental simulation was conducted by emulating sunlight and wet-dry conditions. The powders were collected at consecutive 2-week intervals under sunlight and upon every resuspension. These materials were tested by mixing them with AIV and incubating the mixture for 3 min or 20 h, followed by AIV titration. At the same time, a pH buffering test was conducted by neutralization with Tris-HCl. The results revealed that SSP and SL have high alkalinity and excellent ability to inactivate AIV. In a simulated harsh environment, SSP and SL retained a satisfactory ability to inactivate AIV within 20 h throughout the experimental procedure. However, SSP was able to inactivate AIV during a short contact period (3 min), even under harsh conditions, and it was more resistant than SL to neutralization.

  17. Inactivation Data.xlsx

    Data.gov (United States)

    U.S. Environmental Protection Agency — The data set is a spreadsheet that contains results of inactivation experiments that were conducted to to determine the effectiveness of chlorine in inactivating B....

  18. Use of sunlight to degrade oxytetracycline in marine aquaculture's waters.

    Science.gov (United States)

    Leal, J F; Esteves, V I; Santos, E B H

    2016-06-01

    Oxytracycline (OTC) is a broad spectrum antibiotic authorized for use in European aquaculture. Its photo-degradation has been widely studied in synthetic aqueous solutions, sometimes resorting to expensive methods and without proven effectiveness in natural waters. Thus, this work studied the possibility to apply the solar photo-degradation for removal of OTC from marine aquaculture's waters. For that, water samples were collected at different locals of the water treatment circuit, from two different aquaculture companies. Water samples were firstly characterized regarding to pH, salinity, total suspended solids (TSS), organic carbon and UV-Vis spectroscopic characteristics. Then, the samples were spiked with OTC and irradiated using simulated sunlight in order to evaluate the matrix effects on OTC photo-degradation. From kinetic results, the apparent quantum yields and the outdoor half-life times, at 40°N for midsummer and midwinter days were estimated by the first time for these conditions. For a midsummer day, at sea level, the outdoor half-life time predicted for OTC in these aquaculture's waters ranged between 21 and 25 min. Additionally, the pH and salinity effects on the OTC photo-degradation were evaluated and it has been shown that high pH values and the presence of sea salt increase the OTC photo-degradation rate in aquaculture's waters, compared to results in deionised water. The results are very promising to apply this low-cost methodology using the natural sunlight in aquaculture's waters to remove OTC.

  19. Decomposition of S-Nitrosothiols Induced by UV and Sunlight

    Directory of Open Access Journals (Sweden)

    Manoj M. Veleeparampil

    2009-01-01

    Full Text Available Photochemical release of nitric oxide (NO from the S-nitroso derivatives of glutathione, L-cysteine, N-acetyl-L-cysteine, L-cysteinemethylester, D,L-penicillamine, N-acetyl-D,L-penicillamine, and N-acetylcysteamine has been investigated at neutral and acidic pH. The release of NO from RSNO is one of the key reactions that could be utilized in photodynamic therapy. The UV-VIS and HPLC analyses have shown that under argon saturated conditions, disulfide (RSSR is the major product of UV as well as sunlight induced decomposition. While in aerated conditions, nitirite—the end product of the oxidation of NO—was also observed along with disulfide. The formation of thiyl radical as the intermediate was reconfirmed by laser flash photolysis. The initial rate of formation of NO was on the order of 10−10dm3mol−1s−1. The quantum yields of these reactions were in the range of 0.2–0.8. The high quantum yields observed in the photo induced release of NO from RSNO using both UV and sunlight demonstrate the potential application of these reactions in photodynamic therapy.

  20. Roles of singlet oxygen and triplet excited state of dissolved organic matter formed by different organic matters in bacteriophage MS2 inactivation

    KAUST Repository

    Rosado-Lausell, Sahid L.

    2013-09-01

    Inactivation of bacteriophage MS2 by reactive oxygen species (ROS) and triplet excited state of dissolved organic matter (3DOM*) produced by irradiation of natural and synthetic sensitizers with simulated sunlight of wavelengths greater than 320nm was investigated. Natural sensitizers included purified DOM isolates obtained from wastewater and river waters, and water samples collected from Singapore River, Stamford Canal, and Marina Bay Reservoir in Singapore. Linear correlations were found between MS2 inactivation rate constants (kobs) and the photo-induced reaction rate constants of 2,4,6-trimethylphenol (TMP), a probe compound shown to react mainly with 3DOM*. Linear correlations between MS2 kobs and singlet oxygen (1O2) concentrations were also found for both purified DOM isolates and natural water samples. These correlations, along with data from quenching experiments and experiments with synthetic sensitizers, Rose Bengal (RB), 3\\'-methoxyacetophenone (3\\'-MAP), and nitrite (NO2-), suggest that 1O2, 3DOM*, and hydroxyl radicals (•OH) could inactivate bacteriophage MS2. Linear correlations between MS2 kobs and Specific Ultraviolet Absorption determined at 254nm (SUVA254) were also found for both purified DOM isolates and natural samples. These results suggest the potential use of TMP as a chemical probe and SUVA254 as an indicator for virus inactivation in natural and purified DOM water samples. © 2013 Elsevier Ltd.

  1. Stainless steel in coastal seawater: sunlight counteracts biologically enhanced cathodic kinetics.

    Science.gov (United States)

    Eashwar, M; Lakshman Kumar, A; Sreedhar, G; Kennedy, J; Suresh Bapu, R H

    2014-09-01

    The influence of sunlight of varying intensity on the performance of UNS S30400 stainless steel (SS) was explored under conditions of natural biofilm development in coastal seawater. In a series of tests performed outdoors under an opaque roof, a range of shades were fashioned to impart varied amounts of diurnal light. These were an ambient level where the underwater illumination was ~ 5% of full sunlight, two intermediate ranges of lighting with ~ 2.5% and ~ 1% of the daylight, and a condition of full darkness. In comparison with the dark, increments of sunlight rendered the SS progressively less aggressive as cathodes in galvanic couples with UNS C70600 alloy. Likewise, welded SS with pre-initiated localized corrosion sites exhibited substantially lower rates of propagation with light. Thus, biofilms and sunlight affected cathodic kinetics in opposite ways. Surface analytical tests showed that the accumulation of manganese (Mn) within the biofilms was small relative to reports from waters of lower salinity. These results not only reveal that extremely low amounts of sunlight are adequate to offset the microbial effect, but also highlight the lack of convincing evidence for Mn cycling as a potent mechanism for enhanced cathodic kinetics in full-strength seawater.

  2. Inactivation of Caliciviruses

    Science.gov (United States)

    Nims, Raymond; Plavsic, Mark

    2013-01-01

    The Caliciviridae family of viruses contains clinically important human and animal pathogens, as well as vesivirus 2117, a known contaminant of biopharmaceutical manufacturing processes employing Chinese hamster cells. An extensive literature exists for inactivation of various animal caliciviruses, especially feline calicivirus and murine norovirus. The caliciviruses are susceptible to wet heat inactivation at temperatures in excess of 60 °C with contact times of 30 min or greater, to UV-C inactivation at fluence ≥30 mJ/cm2, to high pressure processing >200 MPa for >5 min at 4 °C, and to certain photodynamic inactivation approaches. The enteric caliciviruses (e.g.; noroviruses) display resistance to inactivation by low pH, while the non-enteric species (e.g.; feline calicivirus) are much more susceptible. The caliciviruses are inactivated by a variety of chemicals, including alcohols, oxidizing agents, aldehydes, and β-propiolactone. As with inactivation of viruses in general, inactivation of caliciviruses by the various approaches may be matrix-, temperature-, and/or contact time-dependent. The susceptibilities of the caliciviruses to the various physical and chemical inactivation approaches are generally similar to those displayed by other small, non-enveloped viruses, with the exception that the parvoviruses and circoviruses may require higher temperatures for inactivation, while these families appear to be more susceptible to UV-C inactivation than are the caliciviruses. PMID:24276023

  3. Inactivation of Caliciviruses

    Directory of Open Access Journals (Sweden)

    Raymond Nims

    2013-03-01

    Full Text Available The Caliciviridae family of viruses contains clinically important human and animal pathogens, as well as vesivirus 2117, a known contaminant of biopharmaceutical manufacturing processes employing Chinese hamster cells. An extensive literature exists for inactivation of various animal caliciviruses, especially feline calicivirus and murine norovirus. The caliciviruses are susceptible to wet heat inactivation at temperatures in excess of 60 °C with contact times of 30 min or greater, to UV-C inactivation at fluence ≥30 mJ/cm2, to high pressure processing >200 MPa for >5 min at 4 °C, and to certain photodynamic inactivation approaches. The enteric caliciviruses (e.g.; noroviruses display resistance to inactivation by low pH, while the non-enteric species (e.g.; feline calicivirus are much more susceptible. The caliciviruses are inactivated by a variety of chemicals, including alcohols, oxidizing agents, aldehydes, and β-propiolactone. As with inactivation of viruses in general, inactivation of caliciviruses by the various approaches may be matrix-, temperature-, and/or contact time-dependent. The susceptibilities of the caliciviruses to the various physical and chemical inactivation approaches are generally similar to those displayed by other small, non-enveloped viruses, with the exception that the parvoviruses and circoviruses may require higher temperatures for inactivation, while these families appear to be more susceptible to UV-C inactivation than are the caliciviruses.

  4. Staphylococcus aureus Strain Newman Photoinactivation and Cellular Response to Sunlight Exposure.

    Science.gov (United States)

    McClary, Jill S; Sassoubre, Lauren M; Boehm, Alexandria B

    2017-09-01

    -threatening diseases, including pneumonia and sepsis. Cases of community-acquired S. aureus infection have been increasing in recent years, pointing to the importance of considering S. aureus transmission pathways outside the hospital environment. Associations have been observed between recreational water contact and staphylococcal skin infections, suggesting that recreational waters may be an important environmental transmission pathway for S. aureus However, prediction of human health risk in recreational waters is hindered by incomplete knowledge of pathogen sources, fate, and transport in this environment. This study is an in-depth investigation of the inactivation of a representative strain of S. aureus by sunlight exposure, one of the most important factors controlling the fate of microbial contaminants in clear waters, which will improve our ability to predict water quality changes and human health risk in recreational waters. Copyright © 2017 American Society for Microbiology.

  5. Persistence of benthiocarb in soil: influence of ultraviolet and sunlight

    Directory of Open Access Journals (Sweden)

    Md. Wasim Aktar

    2008-12-01

    Full Text Available Persistence of benthiocarb in soil as affected by UV and sunlight exposure was studied. Treated soil was placed in petri plate, brought to field capacity moisture and then exposed to UV and sunlight. Residues of benthiocarb in soil dissipated with half lives of 2.10, 11.85 and 43.63 days under UV, sunlight and dark condition, respectively. Soil samples kept under dark showed the slowest dissipation. Further, benthiocarb residues dissipated quickly under UV light as compared to sunlight. Exposure of thin film of benthiocarb confirmed that it is photo labile and dissipated very fast with half life of 1.16 and 1.77 days following exposure to UV and sunlight, respectively. The study revealed that UV component of sunlight is an important factor for benthiocarb dissipation.

  6. 40 CFR 795.70 - Indirect photolysis screening test: Sunlight photolysis in waters containing dissolved humic...

    Science.gov (United States)

    2010-07-01

    ... mobile phase is 2 percent acetic acid, 50 percent acetonitrile and 48 percent water (2 mL/min flow rate... of sunlight actinometers.” Environmental Science and Technology, 6:815. (1982). (6) Haag H.R., Hoigne... Science and Technology, 11:359. (1977). (20) Zepp, R.G., Wolfe N.L., Baughman G.L., Hollis R.C....

  7. South African university student knowledge of eye protection against sunlight

    OpenAIRE

    O. A. Oduntan; A. Carelson; P. Clarke-Farr; R. Hansraj

    2009-01-01

    Exposure to sunlight has been associated with several ocular conditions such as cataract, age-related macular degeneration, and conjunctival neoplasm. Knowledge of protective modalities and good behavioural practice involving eye protection is essential to prevent adverse effects of sunlight. The purpose of this study was to establish knowledge amongst randomly selected university students in South Africa, of prevention modalities against the adverse effects of sunlight. A questionnaire relat...

  8. Thin-film fixed-bed reactor for solar photocatalytic inactivation of Aeromonas hydrophila: influence of water quality

    Science.gov (United States)

    2012-01-01

    Background Controlling fish disease is one of the major concerns in contemporary aquaculture. The use of antibiotics or chemical disinfection cannot provide a healthy aquaculture system without residual effects. Water quality is also important in determining the success or failure of fish production. Several solar photocatalytic reactors have been used to treat drinking water or waste water without leaving chemical residues. This study has investigated the impact of several key aspects of water quality on the inactivation of the pathogenic bacterium Aeromonas hydrophila using a pilot-scale thin-film fixed-bed reactor (TFFBR) system. Results The level of inactivation of Aeromonas hydrophila ATCC 35654 was determined using a TFFBR with a photocatalytic area of 0.47 m2 under the influence of various water quality variables (pH, conductivity, turbidity and colour) under high solar irradiance conditions (980–1100 W m-2), at a flow rate of 4.8 L h-1 through the reactor. Bacterial enumeration were obtained through conventional plate count using trypticase soy agar media, cultured in conventional aerobic conditions to detect healthy cells and under ROS-neutralised conditions to detect both healthy and sub-lethally injured (oxygen-sensitive) cells. The results showed that turbidity has a major influence on solar photocatalytic inactivation of A. hydrophila. Humic acids appear to decrease TiO2 effectiveness under full sunlight and reduce microbial inactivation. pH in the range 7–9 and salinity both have no major effect on the extent of photoinactivation or sub-lethal injury. Conclusions This study demonstrates the effectiveness of the TFFBR in the inactivation of Aeromonas hydrophila under the influence of several water quality variables at high solar irradiance, providing an opportunity for the application of solar photocatalysis in aquaculture systems, as long as turbidity remains low. PMID:23194331

  9. Sunlight-induced carbon dioxide emissions from inland waters

    Science.gov (United States)

    Koehler, Birgit; Landelius, Tomas; Weyhenmeyer, Gesa A.; Machida, Nanako; Tranvik, Lars J.

    2014-07-01

    The emissions of carbon dioxide (CO2) from inland waters are substantial on a global scale. Yet the fundamental question remains open which proportion of these CO2 emissions is induced by sunlight via photochemical mineralization of dissolved organic carbon (DOC), rather than by microbial respiration during DOC decomposition. Also, it is unknown on larger spatial and temporal scales how photochemical mineralization compares to other C fluxes in the inland water C cycle. We combined field and laboratory data with atmospheric radiative transfer modeling to parameterize a photochemical rate model for each day of the year 2009, for 1086 lakes situated between latitudes from 55°N to 69°N in Sweden. The sunlight-induced production of dissolved inorganic carbon (DIC) averaged 3.8 ± 0.04 g C m-2 yr-1, which is a flux comparable in size to the organic carbon burial in the lake sediments. Countrywide, 151 ± 1 kt C yr-1 was produced by photochemical mineralization, corresponding to about 12% of total annual mean CO2 emissions from Swedish lakes. With a median depth of 3.2 m, the lakes were generally deep enough that incoming, photochemically active photons were absorbed in the water column. This resulted in a linear positive relationship between DIC photoproduction and the incoming photon flux, which corresponds to the absorbed photons. Therefore, the slope of the regression line represents the wavelength- and depth-integrated apparent quantum yield of DIC photoproduction. We used this relationship to obtain a first estimate of DIC photoproduction in lakes and reservoirs worldwide. Global DIC photoproduction amounted to 13 and 35 Mt C yr-1 under overcast and clear sky, respectively. Consequently, these directly sunlight-induced CO2 emissions contribute up to about one tenth to the global CO2 emissions from lakes and reservoirs, corroborating that microbial respiration contributes a substantially larger share than formerly thought, and generate annual C fluxes similar in

  10. Inactivation of enteropathogenic E. coli by solar disinfection (SODIS) under simulated sunlight conditions

    CSIR Research Space (South Africa)

    Ubomba-Jaswa, Eunice

    2008-12-01

    Full Text Available diarrhea in developing countries. Infants contract this bacteria through consumption of contaminated water and ingestion of milk formula which is prepared with contaminated water. EPEC still remains untested against SODIS [2]. The aims of the following... of 10ml of this preparation were placed in lidded 6 –well transparent polystyrene tissue culture plates. Optical transmission properties of polystyrene are comparable to those of PET as both transmit UVA (320nm – 400nm) and both are opaque...

  11. Comparative effect of simulated solar light, UV, UV/H2O2 and photo-Fenton treatment (UV-Vis/H2O2/Fe2+,3+) in the Escherichia coli inactivation in artificial seawater.

    Science.gov (United States)

    Rubio, D; Nebot, E; Casanueva, J F; Pulgarin, C

    2013-10-15

    Innovative disinfection technologies are being studied for seawater, seeking a viable alternative to chlorination. This study proposes the use of H2O2/UV254 and photo-Fenton as disinfection treatment in seawater. The irradiations were carried out using a sunlight simulator (Suntest) and a cylindrical UV reactor. The efficiency of the treatment was compared for Milli-Q water, Leman Lake water and artificial seawater. The presence of bicarbonates and organic matter was investigated in order to evaluate possible effects on the photo-Fenton disinfection treatment. The photo-Fenton treatment, employing 1 mg L(-1) Fe(2+) and 10 mg L(-1) of H2O2, led to the fastest bacterial inactivation kinetics. Using H2O2/UV254 high disinfection rates were obtained similar to those obtained with photo-Fenton under UV254 light. In Milli-Q water, the rate of inactivation for Escherichia coli was higher than in Leman Lake water and seawater due to the lack of inorganic ions affecting negatively bacteria inactivation. The presence of bicarbonate showed scavenging of the OH(•) radicals generated in the treatment of photo-Fenton and H2O2/UV254. Despite the negative effect of inorganic ions, especially HCO3(-), the disinfection treatments with AOPs in lake water and seawater improved significantly the disinfection compared to light alone (simulated sunlight and UV254). In the treatment of photo-Fenton with simulated sunlight, dissolved organic matter had a beneficial effect by increasing the rate of inactivation. This is associated with the formation of Fe(3+)-organo photosensitive complexes leading to the formation of ROS able to inactivate bacteria. This effect was not observed in the photo-Fenton with UV254. Growth of E. coli surviving in seawater was observed 24 and 48 h after treatment with UV light. However, growth of surviving bacteria was not detected after photo-Fenton with UV254 and H2O2/UV254 treatments. This study suggests H2O2/UV254 and photo-Fenton treatments for the

  12. Microbial Inactivation by Ultrasound Assisted Supercritical Fluids

    Science.gov (United States)

    Benedito, Jose; Ortuño, Carmen; Castillo-Zamudio, Rosa Isela; Mulet, Antonio

    A method combining supercritical carbon dioxide (SC-CO2) and high power ultrasound (HPU) has been developed and tested for microbial/enzyme inactivation purposes, at different process conditions for both liquid and solid matrices. In culture media, using only SC-CO2, the inactivation rate of E. coli and S. cerevisiae increased with pressure and temperature; and the total inactivation (7-8 log-cycles) was attained after 25 and 140 min of SC-CO2 (350 bar, 36 °C) treatment, respectively. Using SC-CO2+HPU, the time for the total inactivation of both microorganisms was reduced to only 1-2 min, at any condition selected. The SC-CO2+HPU inactivation of both microorganisms was slower in juices (avg. 4.9 min) than in culture media (avg. 1.5 min). In solid samples (chicken, turkey ham and dry-cured pork cured ham) treated with SC-CO2 and SC-CO2+HPU, the inactivation rate of E. coli increased with temperature. The application of HPU to the SC-CO2 treatments accelerated the inactivation rate of E. coli and that effect was more pronounced in treatments with isotonic solution surrounding the solid food samples. The application of HPU enhanced the SC-CO2 inactivation mechanisms of microorganisms, generating a vigorous agitation that facilitated the CO2 solubilization and the mass transfer process. The cavitation generated by HPU could damage the cell walls accelerating the extraction of vital constituents and the microbial death. Thus, using the combined technique, reasonable industrial processing times and mild process conditions could be used which could result into a cost reduction and lead to the minimization in the food nutritional and organoleptic changes.

  13. Inactivation of Bacillus anthracis in water by photocatalytic, photolytic and sonochemical treatment.

    Science.gov (United States)

    Venieri, Danae; Markogiannaki, Evangelia; Chatzisymeon, Efthalia; Diamadopoulos, Evan; Mantzavinos, Dionissios

    2013-04-01

    Bacillus anthracis is one of the most dangerous and pathogenic bacterial species and its intrusion in aquatic environments is a serious threat to public health. The aim of the present study was to investigate inactivation rates of B. anthracis in water by means of photocatalytic (UVA/TiO2), photolytic (UVC) and sonochemical treatment. The effect of various operating conditions such as bacterial concentration, TiO2 loading, UV irradiation source, ultrasound power and treatment time was examined. The reference strain of B. anthracis proved to be highly resistant during photocatalytic and sonochemical treatment of aquatic samples, even in the presence of hydrogen peroxide solution, which is considered among the chemical disinfectants recommended for B. anthracis removal from aqueous suspensions. UVC irradiation was far more effective, as it achieved total inactivation in short treatment time (10 min) and at high initial concentrations (10(6) CFU mL(-1)). The effectiveness of UVC irradiation is also reinforced by the fact that no photoreactivation occurred even after 72 h of exposure under sunlight after the end of the treatment. Furthermore, the virulence of residual cells was investigated, targeting two genes carried in the plasmids pXO1 and pXO2, respectively, which are required for a fully virulent type. Interestingly, the plasmid pXO2 seems to be lost from the host after photocatalytic and photolytic disinfection, resulting in apathogenic residual strains contained in the treated sample. Overall, our results highlight the importance of B. anthracis efficient inactivation in water, as it shows considerable resistance towards effective and reliable disinfection techniques.

  14. Effect of sunlight irradiation on photocatalytic pyrene degradation in contaminated soils by micro-nano size TiO2.

    Science.gov (United States)

    Chang Chien, S W; Chang, C H; Chen, S H; Wang, M C; Madhava Rao, M; Satya Veni, S

    2011-09-01

    The enhanced catalytic pyrene degradation in quartz sand and alluvial and red soils by micro-nano size TiO(2) in the presence and absence of sunlight was investigated. The results showed that the synergistic effect of sunlight irradiation and TiO(2) was more efficient on pyrene degradation in quartz sand and red and alluvial soils than the corresponding reaction system without sunlight irradiation. In the presence of sunlight irradiation, the photooxidation (without TiO(2)) of pyrene was very pronounced in alluvial and red soils and especially in quartz sand. However, in the absence of sunlight irradiation, the catalytic pyrene degradation by TiO(2) and the photooxidation (without TiO(2)) of pyrene were almost nil. This implicates that ultra-violet (UV) wavelength range of sunlight plays an important role in TiO(2)-enhanced photocatalytic pyrene degradation and in photooxidation (without TiO(2)) of pyrene. The percentages of photocatalytic pyrene degradation by TiO(2) in quartz sand, alluvial and red soils under sunlight irradiation were 78.3, 23.4, and 31.8%, respectively, at 5h reaction period with a 5% (w/w) dose of the amended catalyst. The sequence of TiO(2)-enhanced catalytic pyrene degradation in quartz sand and alluvial and red soils was quartz sand>red soil>alluvial soil, due to different texture and total organic carbon (TOC) contents of the quartz sand and other two soils. The differential Fourier transform infrared (FT-IR) spectra of degraded pyrene in alluvial soil corroborate that TiO(2)-enhanced photocatalytic degradation rate of degraded pyrene was much greater than photooxidation (without TiO(2)) rate of degraded pyrene. Based on the data obtained, the importance for the application of TiO(2)-enhanced photocatalytic pyrene degradation and associated organic contaminants in contaminated soils was elucidated.

  15. Inactivation of jack bean urease by allicin.

    Science.gov (United States)

    Juszkiewicz, Adam; Zaborska, Wiesława; Sepioł, Janusz; Góra, Maciej; Zaborska, Anna

    2003-10-01

    Allicin--diallyl thiosulfinate--is the main biologically active component of freshly crushed garlic. Allicin was synthesized as described elsewhere and was tested for its inhibitory ability against jack bean urease in 20 mM phosphate buffer, pH 7.0 at 22 degrees C. The results indicate that allicin is an enzymatic inactivator. The loss of urease activity was irreversible, time- and concentration dependent and the kinetics of the inactivation was biphasic; each phase, obeyed pseudo-first-order kinetics. The rate constants for inactivation were measured for the fast and slow phases and for several concentrations of allicin. Thiol reagents, and competitive inhibitor (boric acid) protected the enzyme from loss of enzymatic activity. The studies demonstrate that urease inactivation results from the reaction between allicin and the SH-group, situated in the urease active site (Cys592).

  16. Sunlight, ultraviolet radiation, vitamin D and skin cancer: how much sunlight do we need?

    Science.gov (United States)

    Holick, Michael F

    2014-01-01

    Vitamin D is the sunshine vitamin for good reason. During exposure to sunlight, the UV B photons enter the skin and photolyze 7-dehydrocholesterol to previtamin D3 which in turn is isomerized by the body's temperature to vitamin D3. Most humans have depended on sun for their vitamin D requirement. Skin pigment, sunscreen use, aging, time of day, season and latitude dramatically affect previtamin 13 synthesis. Vitamin D deficiency was thought to have been conquered, but it is now recognized that more than 50% of the world's population is at risk for vitamin D deficiency. This deficiency is in part due to the inadequate fortification of foods with vitamin D and the misconception that a healthy diet contains an adequate amount of vitamin D. Vitamin D deficiency causes growth retardation and rickets in children and will precipitate and exacerbate osteopenia, osteoporosis and increase risk of fracture in adults. The vitamin D deficiency has been associated pandemic with other serious consequences including increased risk of common cancers, autoimmune diseases, infectious diseases and cardiovascular disease. There needs to be a renewed appreciation of the beneficial effect of moderate sunlight for providing all humans with their vitamin D requirement for health.

  17. Photodegradation of 2,4-Dichlorophenol in Aqueous Systems under Simulated and Natural Sunlight

    Directory of Open Access Journals (Sweden)

    Dorota Gryglik

    2016-01-01

    Full Text Available The work presents results of studies on 2,4-dichlorophenol (2,4-DCP degradation in aqueous solutions using photochemically initiated processes by simulated and natural sunlight. A number of possible substrate photodegradation routes were investigated, by both direct photolysis and photosensitized oxidation process. The major role of singlet oxygen in 2,4-DCP photodegradation was proved. Rose Bengal and derivatives of porphine and phthalocyanine were used as sensitizers. The influences of various process parameters on the reaction rate were investigated. On the basis of experimental data reaction rate constants of 2,4-DCP photosensitized oxidation were determined. The possibility of using natural sunlight to degrade 2,4-DCP in water in the middle latitudes was stated. The acute toxicity bioassay was conducted with the marine bacterium Vibrio fischeri as a bioluminescent indicator. The obtained results encourage further research on this process.

  18. Sunlight-induced DNA damage in human mononuclear cells

    DEFF Research Database (Denmark)

    Møller, Peter; Wallin, Hakan; Holst, Erik

    2002-01-01

    of sunlight was comparable to the interindividual variation, indicating that sunlight exposure and the individual's background were the two most important determinants for the basal level of DNA damage. Influence of other lifestyle factors such as exercise, intake of foods, infections, and age could......In this study of 301 blood samples from 21 subjects, we found markedly higher levels of DNA damage (nonpyrimidine dimer types) in the summer than in the winter detected by single-cell gel electrophoresis. The level of DNA damage was influenced by the average daily influx of sunlight ... to blood sampling. The 3 and 6 day periods before sampling influenced DNA damage the most. The importance of sunlight was further emphasized by a positive association of the DNA damage level to the amount of time the subjects had spent in the sun over a 3 day period prior to the sampling. The effect...

  19. Direct and Indirect Phototransformation of Graphene Oxide in Sunlight

    Science.gov (United States)

    Direct and indirect (with added H202 that serves as OH precursor) photoreactions of grapheme oxide (GO) were examined under sunlight exposure. The results indicate that GO photoreacts under both conditions, leading to significant alterations in GO's physicochemical properties. In...

  20. Sunlight exposure-mediated DNA damage in young adults.

    Science.gov (United States)

    Kato, Masashi; Iida, Machiko; Goto, Yuji; Kondo, Takaaki; Yajima, Ichiro

    2011-08-01

    Previous experimental studies showed that single ultraviolet B (UVB) light irradiation increased levels of 8-hydroxy-2'-deoxyguanosine (8-OHdG), a well-established biomarker of carcinogenesis and oxidative DNA damage, in epithelial cells in animals and humans. We conducted for the first time an epidemiologic study to investigate the correlations among levels of oxidative DNA damage, skin pigmentation, and sunlight exposure in human daily life. Digitalized skin pigmentation levels and creatinine-adjusted urinary 8-OHdG levels were examined in 127 healthy young adults aged 20 to 24 years and in hairless mice with normal pigmented skin (HL-mice; n = 20) and hyperpigmented skin (HL-HPS-mice; n = 20). Data obtained by a questionnaire were also analyzed for the 127 subjects. Binary logistic regression analysis showed that increased sunlight intensity, but not sunlight-exposed time or sunlight-exposed skin area, was correlated with elevation in creatinine-adjusted urinary 8-OHdG levels. In contrast, increased skin pigmentation level, but not the use of sunscreen, was correlated with reduction in urinary 8-OHdG level in humans. UVB irradiation corresponding to several minutes of sunlight exposure significantly increased urinary 8-OHdG levels in HL-mice but not in HL-HPS-mice. We showed that increase in intensity of sunlight in human daily life increased levels of DNA damage. We also showed a protective effect of skin pigmentation on sunlight exposure-mediated DNA damage. We have provided more reliable evidence of routine sunlight exposure-mediated DNA damage in humans through the combination of epidemiologic and experimental studies. ©2011 AACR.

  1. Accelerated stability testing of organic photovoltaics using concentrated sunlight

    DEFF Research Database (Denmark)

    Katz, Eugene A.; Manor, Assaf; Mescheloff, Asaf;

    2012-01-01

    We suggest to use concentrated sunlight for accelerated studies of light-induced mechanisms in the degradation of organic photovoltaics (OPV) based on the polymer (P3HT)/fullerene (PCBM) bulk heterojunctions. Two particular cases of the degradation are reported.......We suggest to use concentrated sunlight for accelerated studies of light-induced mechanisms in the degradation of organic photovoltaics (OPV) based on the polymer (P3HT)/fullerene (PCBM) bulk heterojunctions. Two particular cases of the degradation are reported....

  2. Hydrazine vapor inactivates Bacillus spores

    Science.gov (United States)

    Schubert, Wayne W.; Engler, Diane L.; Beaudet, Robert A.

    2016-05-01

    NASA policy restricts the total number of bacterial spores that can remain on a spacecraft traveling to any planetary body which might harbor life or have evidence of past life. Hydrazine, N2H4, is commonly used as a propellant on spacecraft. Hydrazine as a liquid is known to inactivate bacterial spores. We have now verified that hydrazine vapor also inactivates bacterial spores. After Bacillus atrophaeus ATCC 9372 spores deposited on stainless steel coupons were exposed to saturated hydrazine vapor in closed containers, the spores were recovered from the coupons, serially diluted, pour plated and the surviving bacterial colonies were counted. The exposure times required to reduce the spore population by a factor of ten, known as the D-value, were 4.70 ± 0.50 h at 25 °C and 2.85 ± 0.13 h at 35 °C. These inactivation rates are short enough to ensure that the bioburden of the surfaces and volumes would be negligible after prolonged exposure to hydrazine vapor. Thus, all the propellant tubing and internal tank surfaces exposed to hydrazine vapor do not contribute to the total spore count.

  3. Sunlight exposure and multiple sclerosis in a tropical country.

    Science.gov (United States)

    Espinosa-Ramírez, Guillermo; Ordoñez, Graciela; Flores-Rivera, Jose; Sotelo, Julio

    2014-07-01

    We analysed past and current sun exposure in multiple sclerosis (MS) patients as compared with matched controls in Mexico, a country with tropical climate. In a case-controlled study that include 83 MS patients and 166 matched controls, we inquired about sunlight exposure in two different periods: during adolescence and during the immediate past 5 years. Indicators were: exposure on quotidian and weekend outdoor activities with direct sunlight contact as expressed on frequency by mean number of days, daytime (morning, noon, afternoon), number of hours, visits to sunny places, and use of sunblocking agents. Additional elements were socioeconomic status, skin colour, and antecedent of varicella infection during childhood. MS patients showed a larger proportion of white skin. MS patients had more sunlight exposure during adolescence (80% versus 60%, P = 0·002); this tendency prevailed on current indicators (46% versus 30%, P = 0·02). However, current exposure on weekends (10% versus 22%, P = 0·02) and visits to the beach (64% versus 98%, P = 0·002) were lower in MS than in controls. Mexico gets more sunlight through the year than areas with high incidence of MS; nevertheless, its prevalence has greatly increased over the last decades, making it a relevant emerging disease. Our results indicate that in a tropical country, there is no association between sunlight exposure and the risk to develop MS, given the immunological effects of sunlight exposure either through UV radiation or vitamin D metabolism.

  4. Inactivation of enteroviruses in sewage with ozone

    Energy Technology Data Exchange (ETDEWEB)

    Ivanova, O.E.; Bogdanov, M.V.; Kazantseva, V.A.; Gabrilevskaia, L.N.; Kodkind, G.K.H.

    The study of ozone inactivation of enteroviruses in sewage showed the presence in sewage of suspensions of organic origin and bacterial flora to influence the rate of inactivation. The inactivation rate of poliomyelitis virus in sewage free from organic suspension and bacterial flora was significantly higher than that in sewage containing such suspension and bacterial flora. The inactivation rate of enteroviruses was found not to depend upon the protein and salt composition and pH of sewage or strain appurtenance of viruses. The inactivation rate of enteroviruses directly depended upon the dose of ozone and time of contact with it. Differences in the resistance of different types of poliomyelitis virus, ECHO and Coxsackie viruses to the effect of ozone are likely exist. These differences are manifested within the range of relatively small doses of ozone. E. coli is more resistant to ozone than entero-viruses. The results of laboratory studies were used to choose the regimen of sanitation of urban sewage to be used in technological cycles of industrial enterprises.

  5. Inactivation of human myeloperoxidase by hydrogen peroxide.

    Science.gov (United States)

    Paumann-Page, Martina; Furtmüller, Paul G; Hofbauer, Stefan; Paton, Louise N; Obinger, Christian; Kettle, Anthony J

    2013-11-01

    Human myeloperoxidase (MPO) uses hydrogen peroxide generated by the oxidative burst of neutrophils to produce an array of antimicrobial oxidants. During this process MPO is irreversibly inactivated. This study focused on the unknown role of hydrogen peroxide in this process. When treated with low concentrations of H2O2 in the absence of reducing substrates, there was a rapid loss of up to 35% of its peroxidase activity. Inactivation is proposed to occur via oxidation reactions of Compound I with the prosthetic group or amino acid residues. At higher concentrations hydrogen peroxide acts as a suicide substrate with a rate constant of inactivation of 3.9 × 10(-3) s(-1). Treatment of MPO with high H2O2 concentrations resulted in complete inactivation, Compound III formation, destruction of the heme groups, release of their iron, and detachment of the small polypeptide chain of MPO. Ten of the protein's methionine residues were oxidized and the thermal stability of the protein decreased. Inactivation by high concentrations of H2O2 is proposed to occur via the generation of reactive oxidants when H2O2 reacts with Compound III. These mechanisms of inactivation may occur inside neutrophil phagosomes when reducing substrates for MPO become limiting and could be exploited when designing pharmacological inhibitors.

  6. Factors affecting cellulose hydrolysis based on inactivation of adsorbed enzymes.

    Science.gov (United States)

    Ye, Zhuoliang; Berson, R Eric

    2014-09-01

    The rate of enzymatic hydrolysis of cellulose reaction is known to decrease significantly as the reaction proceeds. Factors such as reaction temperature, time, and surface area of substrate that affect cellulose conversion were analyzed relative to their role in a mechanistic model based on first order inactivation of adsorbed cellulases. The activation energies for the hydrolytic step and inactivation step were very close in magnitude: 16.3 kcal mol(-1) for hydrolysis and 18.0 kcal mol(-1) for inactivation, respectively. Therefore, increasing reaction temperature would cause a significant increase in the inactivation rate in addition to the catalytic reaction rate. Vmax,app was only 20% or less of the value at 72 h compared to at 2h as a result of inactivation of adsorbed cellulases, suggesting prolonged hydrolysis is not an efficient way to improve cellulose hydrolysis. Hydrolysis rate increased with corresponding increases in available substrate surface binding area. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. A practical demonstration of water disinfection using TiO2 films and sunlight.

    Science.gov (United States)

    Gelover, Silvia; Gómez, Luis A; Reyes, Karina; Teresa Leal, Ma

    2006-10-01

    The scope of this study is the assessment of the efficiency of solar disinfection by heterogeneous photocatalysis with sol-gel immobilized (titanium dioxide) TiO2 films over glass cylinders. The solar disinfection process known as SODIS was considered as a reference. Spring water naturally polluted with coliform bacteria was exposed to sunlight in plastic bottles with and without TiO2 over simple solar collectors and the disinfection effectiveness was measured. Total and fecal coliforms quantification was performed by means of the chromogenic substrate method in order to obtain the efficiency of each disinfection treatment. The disinfection with TiO2 was more efficient than the SODIS process, inactivating total coliforms as well as fecal coliforms. On a sunny day (more than 1000 W m(-2) irradiance), it took the disinfection with immobilized TiO2 15 min of irradiation to inactivate the fecal coliforms to make them undetectable. For inactivation of total coliforms, 30 min was required, so that in less than half the time it takes SODIS, the treated water complies with the microbial standards for drinking water in Mexico. Another important part of this study has been to determine the bacterial regrowth in water after the disinfection processes were tested. After SODIS, bacterial regrowth of coliforms was observed. In contrast, when using the TiO2 catalyst, coliforms regrowth was not detected, neither for total nor for fecal coliforms. The disinfection process using TiO2 kept treated water free of coliforms at least for seven days after sun irradiation. This demonstration opens the possibility of application of this simple method in rural areas of developing countries.

  8. Life-threatening motor vehicle crashes in bright sunlight.

    Science.gov (United States)

    Redelmeier, Donald A; Raza, Sheharyar

    2017-01-01

    Bright sunlight may create visual illusions that lead to driver error, including fallible distance judgment from aerial perspective. We tested whether the risk of a life-threatening motor vehicle crash was increased when driving in bright sunlight.This longitudinal, case-only, paired-comparison analysis evaluated patients hospitalized because of a motor vehicle crash between January 1, 1995 and December 31, 2014. The relative risk of a crash associated with bright sunlight was estimated by evaluating the prevailing weather at the time and place of the crash compared with the weather at the same hour and location on control days a week earlier and a week later.The majority of patients (n = 6962) were injured during daylight hours and bright sunlight was the most common weather condition at the time and place of the crash. The risk of a life-threatening crash was 16% higher during bright sunlight than normal weather (95% confidence interval: 9-24, P vehicle crash. An awareness of this risk might inform driver education, trauma staffing, and safety warnings to prevent a life-threatening motor vehicle crash.

  9. Hair cortisol and cortisone are decreased by natural sunlight.

    Science.gov (United States)

    Wester, Vincent L; van der Wulp, Nils R P; Koper, Jan W; de Rijke, Yolanda B; van Rossum, Elisabeth F C

    2016-10-01

    Hair glucocorticoids (cortisol and cortisone) are increasingly used as measures of long-term integrated exposure to glucocorticoid hormones. Glucocorticoids gradually disappear from the hair shaft, which may result from exposure to ultraviolet (UV) radiation in natural sunlight. We aimed to study the influence of sun exposure on hair glucocorticoids. Scalp hair samples were obtained from nine volunteers (median age 33 [range 21-81], 7 females), and part of each hair sample was exposed to three experimental conditions: repeated exposure to natural sunlight for 40h (natural UV), exposure to a high amount of artificial UV radiation, and storage in the dark (control). Hair cortisol (HairF) and cortisone (HairE) were quantified by liquid chromatography-tandem mass spectrometry. When compared to control, HairF was decreased in 9 out of 9 hair samples after natural sunlight exposure (median decrease -3.1pg/mg or -54%, PUV radiation (-4.7pg/mg or -75%, P=0.003). HairE decreased in 8 out of 9 samples, both after natural sunlight (-7.6pg/mg or -32%, P=0.012) and artificial UV (-10.7pg/mg or -52%, P=0.026). Exposure to natural sunlight decreases the glucocorticoid content of scalp hair, apparently through UV radiation, and is therefore an important confounder that should be considered in studies involving the measurement of hair glucocorticoids. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Stability of Bacillus thuringiensis and NPV Microencapsulated Formulation under Sunlight

    Directory of Open Access Journals (Sweden)

    Samaneh Sadat Naghavi

    2016-06-01

    Full Text Available Microencapsulation technology is used for the formulation of bio pesticides and is effective against the ultra-violet radiation of sunlight. The present research studied the stability of Bt and NPV formulations microencapsulated with gelatin and sodium alginate, individually or in combination. The formulations were evaluated in outdoor space and under sunlight on potted growing cabbage. The stability of each active ingredient tested in each formulation was studied at 0, 3, 7 and 10 days after spraying on cabbage infested with diamondback moth Plutella xylostella second instars larvae. Results showed that non-formulated and microencapsulated formulations not exposed to sunlight (time zero had similar mortality. However, after being exposed to sunlight for three days, the non-formulated Bt and NPV resulted in a significantly lower mortality (less than 40%; compared with the microencapsulated bio pesticides (more than 70% mortality. Fifty percent (50% mortality was reached in microencapsulated formulations after seven and ten days of exposure to sunlight, whereas there was no mortality in larvae exposed to unformulated treated plants after ten days. ANOVA analysis showed the highest larval mortality was achieved by the Bt+NPV gelatin microencapsulated formulation followed by gelatin coated Bt, sodium alginate coated NPV, sodium alginate coated Bt+NPV, gelatin coated NPV and sodium alginate coated Bt. The formulations showed no significant LT50 differences between microencapsulated versus unformulated Bt and NPV.

  11. Functional Inactivation of Putative Photosynthetic Electron Acceptor Ferredoxin C2 (FdC2) Induces Delayed Heading Date and Decreased Photosynthetic Rate in Rice.

    Science.gov (United States)

    Zhao, Juan; Qiu, Zhennan; Ruan, Banpu; Kang, Shujing; He, Lei; Zhang, Sen; Dong, Guojun; Hu, Jiang; Zeng, Dali; Zhang, Guangheng; Gao, Zhenyu; Ren, Deyong; Hu, Xingming; Chen, Guang; Guo, Longbiao; Qian, Qian; Zhu, Li

    2015-01-01

    Ferredoxin (Fd) protein as unique electron acceptor, involved in a variety of fundamental metabolic and signaling processes, which is indispensable for plant growth. The molecular mechanisms of Fd such as regulation of electron partitioning, impact of photosynthetic rate and involvement in the carbon fixing remain elusive in rice. Here we reported a heading date delay and yellowish leaf 1 (hdy1) mutant derived from Japonica rice cultivar "Nipponbare" subjected to EMS treatment. In the paddy field, the hdy1 mutant appeared at a significantly late heading date and had yellow-green leaves during the whole growth stage. Further investigation indicated that the abnormal phenotype of hdy1 was connected with depressed pigment content and photosynthetic rate. Genetic analysis results showed that the hdy1 mutant phenotype was caused by a single recessive nuclear gene mutation. Map-based cloning revealed that OsHDY1 is located on chromosome 3 and encodes an ortholog of the AtFdC2 gene. Complementation and overexpression, transgenic plants exhibited the mutant phenotype including head date, leaf color and the transcription levels of the FdC2 were completely rescued by transformation with OsHDY1. Real-time PCR revealed that the expression product of OsHDY1 was detected in almost all of the organs except root, whereas highest expression levels were observed in seeding new leaves. The lower expression levels of HDY1 and content of iron were detected in hdy1 than WT's. The FdC2::GFP was detected in the chloroplasts of rice. Real-time PCR results showed that the expression of many photosynthetic electron transfer related genes in hdy1 were higher than WT. Our results suggest that OsFdC2 plays an important role in photosynthetic rate and development of heading date by regulating electron transfer and chlorophyll content in rice.

  12. Functional Inactivation of Putative Photosynthetic Electron Acceptor Ferredoxin C2 (FdC2 Induces Delayed Heading Date and Decreased Photosynthetic Rate in Rice.

    Directory of Open Access Journals (Sweden)

    Juan Zhao

    Full Text Available Ferredoxin (Fd protein as unique electron acceptor, involved in a variety of fundamental metabolic and signaling processes, which is indispensable for plant growth. The molecular mechanisms of Fd such as regulation of electron partitioning, impact of photosynthetic rate and involvement in the carbon fixing remain elusive in rice. Here we reported a heading date delay and yellowish leaf 1 (hdy1 mutant derived from Japonica rice cultivar "Nipponbare" subjected to EMS treatment. In the paddy field, the hdy1 mutant appeared at a significantly late heading date and had yellow-green leaves during the whole growth stage. Further investigation indicated that the abnormal phenotype of hdy1 was connected with depressed pigment content and photosynthetic rate. Genetic analysis results showed that the hdy1 mutant phenotype was caused by a single recessive nuclear gene mutation. Map-based cloning revealed that OsHDY1 is located on chromosome 3 and encodes an ortholog of the AtFdC2 gene. Complementation and overexpression, transgenic plants exhibited the mutant phenotype including head date, leaf color and the transcription levels of the FdC2 were completely rescued by transformation with OsHDY1. Real-time PCR revealed that the expression product of OsHDY1 was detected in almost all of the organs except root, whereas highest expression levels were observed in seeding new leaves. The lower expression levels of HDY1 and content of iron were detected in hdy1 than WT's. The FdC2::GFP was detected in the chloroplasts of rice. Real-time PCR results showed that the expression of many photosynthetic electron transfer related genes in hdy1 were higher than WT. Our results suggest that OsFdC2 plays an important role in photosynthetic rate and development of heading date by regulating electron transfer and chlorophyll content in rice.

  13. Childhood cancer incidence in relation to sunlight exposure.

    Science.gov (United States)

    Musselman, J R B; Spector, L G

    2011-01-04

    There is increasing interest in the possible association between cancer incidence and vitamin D through its role as a regulator of cell growth and differentiation. Epidemiological studies in adults and one paediatric study suggest an inverse association between sunlight exposure and cancer incidence. We carried out an ecological study using childhood cancer registry data and two population-level surrogates of sunlight exposure, (1) latitude of the registry city or population centroid of the registry nation and (2) annual solar radiation. All models were adjusted for nation-level socioeconomic status using socioeconomic indicators. Latitude and radiation were significantly associated with cancer incidence, and the direction of association was consistent between the surrogates. Findings were not consistent across tumour types. Our ecological study offers some evidence to support an association between sunlight exposure and risk of childhood cancer.

  14. Reversible degradation of inverted organic solar cells by concentrated sunlight

    DEFF Research Database (Denmark)

    Tromholt, Thomas; Manor, Assaf; Katz, Eugene A

    2011-01-01

    Concentrated sunlight was used to study the performance response of inverted P3HT:PCBM organic solar cells after exposure to high intensity sunlight. Correlations of efficiency as a function of solar intensity were established in the range of 0.5–15 suns at three different stages: for a pristine....... The transient state is believed to be a result of the breakdown of the diode behaviour of the ZnO electron transport layer by O2 desorption, increasing the hole conductivity. These results imply that accelerated degradation of organic solar cells by concentrated sunlight is not a straightforward process...... cell, after 30 min exposure at 5 suns and after 30 min of rest in the dark. High intensity exposure introduced a major performance decrease for all solar intensities, followed by a partial recovery of the lost performance over time: at 1 sun only 6% of the initial performance was conserved after...

  15. Carbon nanohorns-based nanofluids as direct sunlight absorbers.

    Science.gov (United States)

    Sani, E; Barison, S; Pagura, C; Mercatelli, L; Sansoni, P; Fontani, D; Jafrancesco, D; Francini, F

    2010-03-01

    The optimization of the poor heat transfer characteristics of fluids conventionally employed in solar devices are at present one of the main topics for system efficiency and compactness. In the present work we investigated the optical and thermal properties of nanofluids consisting in aqueous suspensions of single wall carbon nanohorns. The characteristics of these nanofluids were evaluated in view of their use as sunlight absorber fluids in a solar device. The observed nanoparticle-induced differences in optical properties appeared promising, leading to a considerably higher sunlight absorption. We found that the thermal conductivity of the nanofluids was higher than pure water. Both these effects, together with the possible chemical functionalization of carbon nanohorns, make this new kind of nanofluids very interesting for increasing the overall efficiency of the sunlight exploiting device.

  16. Chemically derived luminescent graphene oxide nanosheets and its sunlight driven photocatalytic activity against methylene blue dye

    Science.gov (United States)

    Kumar, Sumeet; Kumar, Ashok

    2016-12-01

    In the present work, graphene oxide (GO) nanosheets (NSs) have been synthesized with precise control over their thickness and molecular structure. The existence of oxygen containing functional groups on GO NSs through chemical treatment confers remarkable optical properties on GO. XRD, TEM, Raman and FTIR techniques were used to confirm the phase and degree of oxidation, morphology, structural information and chemical structure of the synthesized GO NSs. UV-Vis. spectroscopy was employed to study the optical absorption properties of the synthesized GO NSs. The excitation wavelength dependent PL measurements of the synthesized GO NSs were carried out which could be useful for the design and development of GO based next generation optoelectronic devices. The most fascinating luminescent property of synthesized GO NSs is that its luminescence peak position can be easily tuned by only varying the excitation wavelength without significant changes in its size and chemical composition. In order to study the photocatalytic degradation of methylene blue (MB) dye using GO NSs as a photocatalyst, a sunlight driven photocatalytic activity has been performed. The degradation rate of MB dye becomes fast when GO NSs are added to the dye solution. The photodegradation efficiency of GO NSs is calculated to be 60%. The present results indicate that synthesized GO NSs can be used as sunlight active photocatalyst. The optimistic response to sunlight irradiation validates the potential of GO NSs in solar energy conversion.

  17. Life-threatening motor vehicle crashes in bright sunlight

    Science.gov (United States)

    Redelmeier, Donald A.; Raza, Sheharyar

    2017-01-01

    Abstract Bright sunlight may create visual illusions that lead to driver error, including fallible distance judgment from aerial perspective. We tested whether the risk of a life-threatening motor vehicle crash was increased when driving in bright sunlight. This longitudinal, case-only, paired-comparison analysis evaluated patients hospitalized because of a motor vehicle crash between January 1, 1995 and December 31, 2014. The relative risk of a crash associated with bright sunlight was estimated by evaluating the prevailing weather at the time and place of the crash compared with the weather at the same hour and location on control days a week earlier and a week later. The majority of patients (n = 6962) were injured during daylight hours and bright sunlight was the most common weather condition at the time and place of the crash. The risk of a life-threatening crash was 16% higher during bright sunlight than normal weather (95% confidence interval: 9–24, P < 0.001). The increased risk was accentuated in the early afternoon, disappeared at night, extended to patients with different characteristics, involved crashes with diverse features, not apparent with cloudy weather, and contributed to about 5000 additional patient-days in hospital. The increased risk extended to patients with high crash severity as indicated by ambulance involvement, surgical procedures, length of hospital stay, intensive care unit admission, and patient mortality. The increased risk was not easily attributed to differences in alcohol consumption, driving distances, or anomalies of adverse weather. Bright sunlight is associated with an increased risk of a life-threatening motor vehicle crash. An awareness of this risk might inform driver education, trauma staffing, and safety warnings to prevent a life-threatening motor vehicle crash. Level of evidence: Epidemiologic Study, level III. PMID:28072708

  18. Successful pacing using a batteryless sunlight-powered pacemaker.

    Science.gov (United States)

    Haeberlin, Andreas; Zurbuchen, Adrian; Schaerer, Jakob; Wagner, Joerg; Walpen, Sébastien; Huber, Christoph; Haeberlin, Heinrich; Fuhrer, Juerg; Vogel, Rolf

    2014-10-01

    Today's cardiac pacemakers are powered by batteries with limited energy capacity. As the battery's lifetime ends, the pacemaker needs to be replaced. This surgical re-intervention is costly and bears the risk of complications. Thus, a pacemaker without primary batteries is desirable. The goal of this study was to test whether transcutaneous solar light could power a pacemaker. We used a three-step approach to investigate the feasibility of sunlight-powered cardiac pacing. First, the harvestable power was estimated. Theoretically, a subcutaneously implanted 1 cm(2) solar module may harvest ∼2500 µW from sunlight (3 mm implantation depth). Secondly, ex vivo measurements were performed with solar cells placed under pig skin flaps exposed to a solar simulator and real sunlight. Ex vivo measurements under real sunlight resulted in a median output power of 4941 µW/cm(2) [interquartile range (IQR) 3767-5598 µW/cm(2), median skin flap thickness 3.0 mm (IQR 2.7-3.3 mm)]. The output power strongly depended on implantation depth (ρSpearman = -0.86, P pacemaker powered by a 3.24 cm(2) solar module was implanted in vivo in a pig to measure output power and to pace. In vivo measurements showed a median output power of >3500 µW/cm(2) (skin flap thickness 2.8-3.84 mm). Successful batteryless VVI pacing using a subcutaneously implanted solar module was performed. Based on our results, we estimate that a few minutes of direct sunlight (irradiating an implanted solar module) allow powering a pacemaker for 24 h using a suitable energy storage. Thus, powering a pacemaker by sunlight is feasible and may be an alternative energy supply for tomorrow's pacemakers. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2014. For permissions please email: journals.permissions@oup.com.

  19. Reversible degradation of inverted organic solar cells by concentrated sunlight

    OpenAIRE

    Tromholt, Thomas; Manor, Assaf; Katz, Eugene A.; Frederik C. Krebs

    2011-01-01

    Concentrated sunlight was used to study the performance response of inverted P3HT:PCBM organic solar cells after exposure to high intensity sunlight. Correlations of efficiency as a function of solar intensity were established in the range of 0.5–15 suns at three different stages: for a pristine cell, after 30 min exposure at 5 suns and after 30 min of rest in the dark. High intensity exposure introduced a major performance decrease for all solar intensities, followed by a partial recovery of...

  20. Carbon nanofibers, precious commodities from sunlight & CO2 to ameliorate global warming

    CERN Document Server

    Licht, Stuart

    2015-01-01

    This study introduces the high yield, electrolytic synthesis of carbon nanofibers, CNFs, directly from carbon dioxide. Production of a precious commodity such as CNFs from atmospheric carbon dioxide provides impetus to limit this greenhouse gas and mitigate the rate of climate change. CNFs are formed at high rate using inexpensive nickel and steel electrodes in molten electrolytes. The process is demonstrated as a scaled-up stand-alone electrolytic cell, and is also shown compatible with the STEP, solar thermal electrochemical process, using concentrated sunlight at high solar to electric efficiency to provide the heat and electrical energy to drive the CNF production.

  1. [Inactivation of T4 phage in water environment using proteinase].

    Science.gov (United States)

    Lü, Wen-zhou; Yang, Qing-xiang; Zhang, Yu; Yang, Min; Zhu, Chun-fang

    2004-09-01

    The inactivation effectiveness of proteinase to viruses was investigated by using T4 phage as a model virus. The results showed that the inactivation effectiveness of proteinase to T4 phage was obvious. In the optimum conditions and 67.5 u/mL concentration, the inactivation rate of proteinase K to T4 phage in sterilized water and in sewage achieved 99.4% and 49.4% respectively in an hour, and achieved >99.9% and 81.1% in three hours. The inactivation rate of the industrial proteinase 1398 to T4 phage in sterilized water achieved 74.4% in an hour. The effects of pH and temperature on the inactivation effectiveness was not evident.

  2. Lack of sunlight exposure influence on primary glioblastoma survival.

    Science.gov (United States)

    Mutlu, Hasan; Akca, Zeki; Erden, Abdulsamet; Aslan, Tuncay; Ucar, Kadir; Kaplan, Bunyamin; Buyukcelik, Abdullah

    2014-01-01

    The prognosis of primary glioblastoma (GBM) is poor. Approximately 2/3 of primary brain tumor diagnoses are GBM, of which 95% are primary lesions. In this study, we aimed to evaluate whether more sunlight exposure has an effect on survival of patients with primary GBM. A total of 111 patients with primary GBM were enrolled from Kayseri in inner Anatolia which has a cold climate (n: 40) and Mersin in Mediterranean region with a warm climate and more sunlight exposure (n: 71). The patients with primary GBM were divided into two groups as Kayseri and Mersin and compared for progression free survival (PFS) and overall survival (OS). The PFS values were 7.0 and 4.7 months for Kayseri and Mersin groups, respectively (p=0.10) and the respective OS values were 13.3 and 9.4 months (p=0.13). We did not found any significant difference regarding age, sex, comorbidity, smoking, surgery, resurgery, adjuvant chemoradiotherapy and palliative chemotherapy between the groups. We found that more sunlight exposure had no impact on prognosis of patients with primary GBM, adding inconsistency to the literature about the relationship between sunlight and GBM.

  3. Sunlight exposure, antioxidants, and age-related macular degeneration.

    Science.gov (United States)

    Fletcher, Astrid E; Bentham, Graham C; Agnew, Maureen; Young, Ian S; Augood, Cristina; Chakravarthy, Usha; de Jong, Paulus T V M; Rahu, Mati; Seland, Johan; Soubrane, Gisele; Tomazzoli, Laura; Topouzis, Fotis; Vingerling, Johannes R; Vioque, Jesus

    2008-10-01

    To examine the association of sunlight exposure and antioxidant level with age-related macular degeneration (AMD). Four thousand seven hundred fifty-three participants aged 65 years or older in the European Eye Study underwent fundus photography, were interviewed for adult lifetime sunlight exposure, and gave blood for antioxidant analysis. Blue light exposure was estimated by combining meteorologic and questionnaire data. Data on sunlight exposure and antioxidants were available in 101 individuals with neovascular AMD, 2182 with early AMD, and 2117 controls. No association was found between blue light exposure and neovascular or early AMD. Significant associations were found between blue light exposure and neovascular AMD in individuals in the quartile of lowest antioxidant level-vitamin C, zeaxanthin, vitamin E, and dietary zinc-with an odds ratio of about 1.4 for 1 standard deviation unit increase in blue light exposure. Higher odds ratios for blue light were observed with combined low antioxidant levels, especially vitamin C, zeaxanthin, and vitamin E (odds ratio, 3.7; 95% confidence interval, 1.6-8.9), which were also associated with early stages of AMD. Although it is not possible to establish causality between sunlight exposure and neovascular AMD, our results suggest that people in the general population should use ocular protection and follow dietary recommendations for the key antioxidant nutrients.

  4. [Most common skin disorders caused by excessive exposure to sunlight].

    Science.gov (United States)

    Zitás, Éva; Mészáros, Judit

    2016-01-17

    The healing properties of sunlight has been known for millennia, however the gradual deterioration of the ozone layer and the increased use of sun tanning beds in recent decades are causing an increase in skin damaging ultraviolet exposure. In this article the most common photodermatoses and the principles of their treatments are reviewed.

  5. Reversible degradation of inverted organic solar cells by concentrated sunlight.

    Science.gov (United States)

    Tromholt, Thomas; Manor, Assaf; Katz, Eugene A; Krebs, Frederik C

    2011-06-03

    Concentrated sunlight was used to study the performance response of inverted P3HT:PCBM organic solar cells after exposure to high intensity sunlight. Correlations of efficiency as a function of solar intensity were established in the range of 0.5-15 suns at three different stages: for a pristine cell, after 30 min exposure at 5 suns and after 30 min of rest in the dark. High intensity exposure introduced a major performance decrease for all solar intensities, followed by a partial recovery of the lost performance over time: at 1 sun only 6% of the initial performance was conserved after the high intensity exposure, while after rest the performance had recovered to 60% of the initial value. The timescale of the recovery effect was studied by monitoring the cell performance at 1 sun after high intensity exposure. This showed that cell performance was almost completely restored after 180 min. The transient state is believed to be a result of the breakdown of the diode behaviour of the ZnO electron transport layer by O(2) desorption, increasing the hole conductivity. These results imply that accelerated degradation of organic solar cells by concentrated sunlight is not a straightforward process, and care has to be taken to allow for a sound accelerated lifetime assessment based on concentrated sunlight.

  6. Photochemical transformation of graphene oxide in sunlight (journal)

    Science.gov (United States)

    Graphene oxide (GO) is a graphene derivative that is more easily manufactured in large scale and used to synthesize reduced graphene oxide (rGO) with properties analogous to graphene. In this study, we investigate the photochemical fate of GO under sunlight conditions. The resu...

  7. Electricity from Sunlight: The Future of Photovoltaics. Worldwatch Paper 52.

    Science.gov (United States)

    Flavin, Christopher

    Solar photovoltaic cells have been called the ultimate energy technology, environmentally benign and without moving parts, solar cells directly convert sunlight into electricity. Photovoltaic energy conversion is fundamentally different from all other forms of electricity generation. Without turbines, generators or other mechanical equipment, it…

  8. Hydrazine inactivates bacillus spores

    Science.gov (United States)

    Schubert, Wayne; Plett, G. A.; Yavrouian, A. H.; Barengoltz, J.

    2005-01-01

    Planetary Protection places requirements on the maximum number of viable bacterial spores that may be delivered by a spacecraft to another solar system body. Therefore, for such space missions, the spores that may be found in hydrazine are of concern. A proposed change in processing procedures that eliminated a 0.2 um filtration step propmpted this study to ensure microbial contamination issue existed, especially since no information was found in the literature to substantiate bacterial spore inactivation by hydrazine.

  9. Vitamin D and Sunlight Exposure in Newly-Diagnosed Parkinson's Disease

    National Research Council Canada - National Science Library

    Wang, Juan; Yang, Deyu; Yu, Yu; Shao, Gaohai; Wang, Qunbo

    2016-01-01

    ...), while the effects of sunlight exposure have not yet been fully investigated. Therefore, we evaluated the associations between serum vitamin D, vitamin D intake, sunlight exposure, and newly-diagnosed PD patients in a Chinese population...

  10. Sunlight Exposure and Vitamin D Status in Breastfed Infants.

    Science.gov (United States)

    Meena, Pinky; Dabas, Aashima; Shah, Dheeraj; Malhotra, Rajeev Kumar; Madhu, S V; Gupta, Piyush

    2017-02-15

    To correlate the sunlight exposure in first 6 months to vitamin D status at 6 months of age in predominantly breastfed infants; and to quantify the sunlight exposure required to achieve serum 25(OH)D level >20 ng/mL, by 6 months of age. Design: Prospective cohort. Tertiary-care hospital predominantly catering to urban poor population in Delhi. 132 healthy infants, delivered at term, and predominantly breastfed were enrolled at 6-8 weeks of age. Of these, 100 infants were available for final evaluation at 6 months of age (mean (SD) follow-up: 126 (17) days). Baseline maternal vitamin D (serum 25(OH)D) levels were obtained at enrolment. The mothers were asked to maintain a daily record of duration of sunlight exposure, timing of exposure, and body surface area exposed, for the infant, on a pre-designed proforma, till the child was 6 months of age. Infant's serum 25(OH)D was measured at 6 months of age. Cumulative Sun Index was calculated as a composite measure of overall duration/time/body surface area exposed to sunlight; and correlated with the infant serum 25(OH)D after adjusting for baseline maternal serum 25(OH)D levels, season of exposure, and skin color of the infant. Sun index for exposure in morning (before 10 am) and afternoon (10 am-3 pm) were also correlated to vitamin D status. Of 100 mother-infant pairs completing the study, 90 mothers had vitamin D deficiency (serum 25(OH)D exposure of infants to sunlight was 17 min per week, on 6% of body surface area. Vitamin D levels of 67 (67%) infants at 6 months were less than 12 ng/mL and another 23% had insufficient levels (12-20 ng/mL). Cumulative sun index correlated positively to infant's serum 25(OH)D level at 6 months of age (r= 0.461, Psunlight exposure, between 10 am and 3 pm, over 40% body area (infant clothed in diapers, in prone position) for at least 16 weeks, was estimated requirement to achieve sufficient vitamin D levels (>20 ng/mL) by 6 months of age. There is a significant positive correlation

  11. Photodegradation of pharmaceuticals in the aquatic environment by sunlight and UV-A, -B and -C irradiation.

    Science.gov (United States)

    Kawabata, Kohei; Sugihara, Kazumi; Sanoh, Seigo; Kitamura, Shigeyuki; Ohta, Shigeru

    2013-01-01

    In order to investigate the effect of sunlight on the persistence and ecotoxicity of pharmaceuticals contaminating the aquatic environment, we exposed nine pharmaceuticals (acetaminophen (AA), amiodarone (AM), dapsone (DP), dexamethasone (DX), indomethacin (IM), naproxen (NP), phenytoin (PH), raloxifene (RL), and sulindac (SL)) in aqueous media to sunlight and to ultraviolet (UV) irradiation at 254, 302 or 365 nm (UV-C, UV-B or UV-A, respectively). Degradation of the pharmaceuticals was monitored by means of high-performance liquid chromatography (HPLC). Sunlight completely degraded AM, DP and DX within 6 hr, and partly degraded the other pharmaceuticals, except AA and PH, which were not degraded. Similar results were obtained with UV-B, while UV-A was less effective (both UV-A and -B are components of sunlight). All the pharmaceuticals were photodegraded by UV-C, which is used for sterilization in sewage treatment plants. Thus, the photodegradation rates of pharmaceuticals are dependent on both chemical structure and the wavelength of UV exposure. Toxicity assay using the luminescent bacteria test (ISO11348) indicated that UV irradiation reduced the toxicity of some pharmaceuticals to aquatic organisms by decreasing their amount (photodegradation) and increased the toxicity of others by generating toxic photoproduct(s). These results indicate the importance of investigating not only parent compounds, but also photoproducts in the risk assessment of pharmaceuticals in aquatic environments.

  12. Mechanisms of Escherichia coli inactivation by several disinfectants.

    Science.gov (United States)

    Cho, Min; Kim, Jaeeun; Kim, Jee Yeon; Yoon, Jeyong; Kim, Jae-Hong

    2010-06-01

    The objective of this study was to elucidate dominant mechanisms of inactivation, i.e. surface attack versus intracellular attack, during application of common water disinfectants such as ozone, chlorine dioxide, free chlorine and UV irradiation. Escherichia coli was used as a representative microorganism. During cell inactivation, protein release, lipid peroxidation, cell permeability change, damage in intracellular enzyme and morphological change were comparatively examined. For the same level of cell inactivation by chemical disinfectants, cell surface damage was more pronounced with strong oxidant such as ozone while damage in inner cell components was more apparent with weaker oxidant such as free chlorine. Chlorine dioxide showed the inactivation mechanism between these two disinfectants. The results suggest that the mechanism of cell inactivation is primarily related to the reactivity of chemical disinfectant. In contrast to chemical disinfectants, cell inactivation by UV occurred without any changes measurable with the methods employed. Understanding the differences in inactivation mechanisms presented herein is critical to identify rate-limiting steps involved in the inactivation process as well as to develop more effective disinfection strategies.

  13. Exposure time to sunlight for ultra violet light therapy

    Directory of Open Access Journals (Sweden)

    Srinivas C

    1991-01-01

    Full Text Available Exposure time to sunlight for photo or photochemotherapy is arbitrarily determined. This could lead to inadequate or over exposure. As a sequence to our initial pilot study on exposure time for PUVASOL, we have now developed a bar chart which could be used as a guide to achieve a more logical and uniform exposure time during different months. We plan to extend the study to different zones in India.

  14. Sunlight Exposure and Breast Density: A Population-Based Study

    Science.gov (United States)

    Wu, Sheng-Hui; So, Edwin; Lam, Tsz-ping; Woo, Jean; Yuen, PY; Qin, Ling; Ku, Susanna

    2013-01-01

    Purpose This study aims to assess the association of sunlight exposure with breast cancer risk, measured by the breast density assessed from Tabár's mammographic pattern in Chinese women. Methods A total of 676 premenopausal women were recruited to participate in this study, in which 650 completed a validated sunlight exposure questionnaire via telephone. The mammograms were classified according to Tabár's classification for parenchyma, and patterns IV & V and I, II & III indicated respectively high and low risk mammographic patterns for breast cancer. The odds ratios (OR) and 95% confidence intervals (CIs) for sun exposure-related variables were estimated using unconditional logistic regression with adjustment for potential confounders. Results Among 646 participants, women with high breast cancer risk (Tabár's patterns IV &V) had less hours spent in the sun than those with low risk (I, II & III) at any age stage. A higher level of sunlight exposure was associated with a significantly lower risk having high risk Tabár's pattern. Women aged 40 to 44 years who were in the highest tertile of lifetime total hours spent in the sun had a multi-adjusted OR of 0.41 (95% CI, 0.18-0.92; p for trend=0.03) compared with those in the lowest tertile (>2.19 hr/day vs. sunlight exposure is related to a lower risk of having high risk breast density pattern in premenopausal women. Our results also suggest the most relevant period of exposure is during earlier life. PMID:23843849

  15. Sunlight technologies for photochemical deactivation of organic pollutants in water

    Energy Technology Data Exchange (ETDEWEB)

    Acher, A.; Fischer, E.; Tornheim, R. [The Volcani Center, Inst. of Soils and Water, Bet Dagan (Israel); Manor, Y. [Sheba Medical Center, Central Virology Lab., Ramat Gan (Israel)

    1997-12-31

    Sensitized-photochemical oxidation methods aimed at use in water treatment technologies for deactivation of biotic (microorganisms) and/or of xenobiotic (pesticides) pollutants in water were developed using global solar radiation or concentrated sunlight (up to 250 suns). The solar global radiation was used either for detoxification of industrial waste water from a pesticide factory to allow their discharge into the urban sewer, or for disinfection of domestric effluents to be used in crop irrigation. The disinfection process was eventually carried out in an experimental pilot-scale plant, capable of disinfection up to 50 m{sup 3}/h of effluent supplied by an activated sludge sewage treatment plant located in Tel-Aviv area. The treated effluents did not show any regrowth of the microorganisms during 7 days. The solar concentrated radiation experiments performed using facilities of the Sun Tower of The Weizman Institute of Science, Rehovot. The concentrated sunlight was provided by different combination of several computer controlled heliostates, up to 8, that track the sun and focus the received sunlight onto the target situated on the roof of the sun-tower. The sunlight intensities measured on the target reached up to 200 kW/m{sup 2}. The experiments were performed either batch- or continuous-wise. The water-samples exposed to disinfection were the above effluent, filtered and supplemented with vaccine strain poliovirus or with different concentrations of an industrial potential pollutant (bromacil), MB 2 mg/L and two concentrations of dissolved oxygen (8.0 or 40.0 mg O{sub 2}/L). An exposure time of 2-3 seconds at 150 kW/m{sup 2} was decreased the microorganisms alive (counts) by five orders of magnitude. A comparison between the two above water treatment technologies is presented. (orig./SR)

  16. Novel materials and devices for sunlight concentrating systems

    Science.gov (United States)

    Hovel, H. J.

    1980-09-01

    An economic analysis of photovoltaic conversion under concentrated sunlight has been performed which demonstrates that solar cell efficiency, concentrator efficiency, and concentrator cost are the most important parameters in a concentrating photovoltaic system; solar cell cost is only of secondary importance. Six novel structures are described, including modified conventional Si cells Ga(1-x)Al(x)As/GaAs, interdigitated cells, vertical and horizontal multijunction cells and 'multicolor' devices.

  17. Effect of sunlight exposure on serum 25-hydroxyvitamin d concentration in women with vitamin d deficiency: using ambulatory lux meter and sunlight exposure questionnaire.

    Science.gov (United States)

    Lee, Sang-Hoon; Park, Soo-Jung; Kim, Kwang-Min; Lee, Duck-Joo; Kim, Woo-Jae; Park, Rae-Woong; Joo, Nam-Seok

    2012-11-01

    Vitamin D is an important factor in human health. Yet, vitamin D deficiency is very common. We aimed to confirm serum 25-hydroxyvitamin D (25OHD) concentration change after sunlight exposure and to elucidate the relationship between the amount of sunlight exposure and serum 25OHD level change by ambulatory lux meter and sunlight exposure questionnaire. Twenty healthy young women were enrolled. They were educated to obtain 20 minutes of sunlight exposure during weekdays from October to November, 2010, during which they were to wear an ambulatory lux meter on an arm. All subjects completed a one-week recall sunlight exposure questionnaire at the end of the study. Before and after sunlight exposure, serum 25OHD level was measured. Mean pre-exposure serum 25OHD concentration was 11.01 ng/mL. The mean change of pre- and post-exposure 25OHD level was -0.62 ng/mL, but it was not statistically significant. The mean personal sunlight exposure recorded by ambulatory lux meter, 292.6 lux/s, showed no significant relationship with average change of 25OHD and average weekly sunlight exposure score, 11.9, calculated by the sunlight exposure questionnaire. However, the mean change of serum 25OHD level and weekly sunlight exposure score showed significant negative correlation (r = -0.469, P = 0.037). Change of serum 25OHD concentration after four weeks of sunlight exposure was not statistically significant in women with vitamin D deficiency. However, serum 25OHD concentration change was significantly negatively correlated with the sunlight exposure score by the questionnaire.

  18. Effects of sunlight exposure on grapevine powdery mildew development.

    Science.gov (United States)

    Austin, Craig N; Wilcox, Wayne F

    2012-09-01

    Natural and artificially induced shade increased grapevine powdery mildew (Erysiphe necator) severity in the vineyard, with foliar disease severity 49 to 75% higher relative to leaves in full sun, depending on the level of natural shading experienced and the individual experiment. Cluster disease severities increased by 20 to 40% relative to those on check vines when ultraviolet (UV) radiation was filtered from sunlight reaching vines in artificial shading experiments. Surface temperatures of leaves in full sunlight averaged 5 to 8°C higher than those in natural shade, and in one experiment, filtering 80% of all wavelengths of solar radiation, including longer wavelengths responsible for heating irradiated tissues, increased disease more than filtering UV alone. In controlled environment experiments, UV-B radiation reduced germination of E. necator conidia and inhibited both colony establishment (hyphal formation and elongation) and maturity (latent period). Inhibitory effects of UV-B radiation were significantly greater at 30°C than at 20 or 25°C. Thus, sunlight appears to inhibit powdery mildew development through at least two mechanisms, i.e., (i) UV radiation's damaging effects on exposed conidia and thalli of the pathogen; and (ii) elevating temperatures of irradiated tissues to a level supraoptimal or inhibitory for pathogen development. Furthermore, these effects are synergistic at temperatures near the upper threshold for disease development.

  19. Mechanistic study of the visible-light-driven photocatalytic inactivation of bacteria by graphene oxide–zinc oxide composite

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Dan [School of Life Sciences, The Chinese University of Hong Kong, Shatin, NT, Hong Kong (China); An, Taicheng, E-mail: antc99@gig.ac.cn [State Key Laboratory of Organic Geochemistry and Guangdong Key Laboratory of Environmental Resources Utilization and Protection, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Li, Guiying [State Key Laboratory of Organic Geochemistry and Guangdong Key Laboratory of Environmental Resources Utilization and Protection, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou 510640 (China); Wang, Wei, E-mail: weiwang@hust.edu.cn [School of Life Sciences, The Chinese University of Hong Kong, Shatin, NT, Hong Kong (China); State Key Laboratory of Material Processing and Die & Mould Technology, Huazhong University of Science and Technology, Wuhan 430074 (China); Cai, Yuncheng [State Key Laboratory of Material Processing and Die & Mould Technology, Huazhong University of Science and Technology, Wuhan 430074 (China); Yip, Ho Yin [School of Life Sciences, The Chinese University of Hong Kong, Shatin, NT, Hong Kong (China); Zhao, Huijun [Centre for Clean Environment and Energy, Gold Coast Campus, Griffith University, Queensland 4222 (Australia); Wong, Po Keung, E-mail: pkwong@cuhk.edu.hk [School of Life Sciences, The Chinese University of Hong Kong, Shatin, NT, Hong Kong (China)

    2015-12-15

    Graphical abstract: - Highlights: • The GO–ZnO composites exhibited efficient VLD bacterial inactivation performance. • Strong interfacial interaction existed between GO and ZnO. • GO served as a photosensitizer in the inactivation process. • Excellent antibacterial activity by GO–ZnO composite was shown under sunlight. • An inactivation mechanism based on the GO photosensitizer induction was proposed. - Abstract: The visible-light-driven (VLD) photocatalytic activity of graphene oxide–zinc oxide (GO–ZnO) composite prepared by a simple hydrothermal method was evaluated toward the inactivation of Escherichia coli K-12. The results showed that GO–ZnO composite had excellent VLD photocatalytic bacterial inactivation activity, comparing with those of ZnO and GO, which was attributed to the strong interaction between ZnO and GO in the composite. Accordingly, an interaction induced VLD photocatalytic inactivation mechanism of the strong interaction of GO with ZnO within the GO–ZnO composite was proposed. GO served as a photosensitizer and facilitated the charge separation and transfer, thus boosted the massive production of reactive oxygen species such as ·OH{sub bulk}, which was identified as the major reactive species from conduction band of ZnO, and resulted in a remarkable enhancement of bacterial inactivation efficiency. Moreover, GO–ZnO composite showed obviously superior photocatalytic bacterial inactivation within 10 min under natural solar light irradiation, indicating that GO–ZnO composite has great potential in wastewater treatment and environmental protection.

  20. Weathering patterns of polycyclic aromatic hydrocarbons contained in submerged Deepwater Horizon oil spill residues when re-exposed to sunlight.

    Science.gov (United States)

    John, Gerald F; Han, Yuling; Clement, T Prabhakar

    2016-12-15

    The Deepwater Horizon (DWH) oil spill event released a large amount of sweet crude oil into the Gulf of Mexico (GOM). An unknown portion of this oil that arrived along the Alabama shoreline interacted with nearshore sediments and sank forming submerged oil mats (SOMs). A considerable amount of hydrocarbons, including polycyclic aromatic hydrocarbons (PAHs), were trapped within these buried SOMs. Recent studies completed using the oil spill residues collected along the Alabama shoreline have shown that several PAHs, especially higher molecular weight PAHs (four or more aromatic rings), are slowly weathering compared to the weathering levels experienced by the oil when it was floating over the GOM. In this study we have hypothesized that the weathering rates of PAHs in SOMs have slowed down because the buried oil was isolated from direct exposure to sunlight, thus hindering the photodegradation pathway. We further hypothesized that re-exposing SOMs to sunlight can reactivate various weathering reactions. Also, SOMs contain 75-95% sand (by weight) and the entrapped sand could either block direct sunlight or form large oil agglomerates with very little exposed surface area; these processes could possibly interfere with weathering reactions. To test these hypotheses, we completed controlled experiments to study the weathering patterns of PAHs in a field recovered SOM sample after re-exposing it to sunlight. Our experimental results show that the weathering levels of several higher molecular weight PAHs have slowed down primarily due to the absence of sunlight-induced photodegradation reactions. The data also show that sand particles in SOM material could potentially interfere with photodegradation reactions.

  1. Sunlight exposure is important for preventing hip fractures in patients with Alzheimer's disease, Parkinson's disease, or stroke.

    Science.gov (United States)

    Iwamoto, J; Takeda, T; Matsumoto, H

    2012-04-01

    Hypovitaminosis D as a result of malnutrition or sunlight deprivation, increased bone resorption, low bone mineral density (BMD), or an increased risk of falls may contribute to an increased risk of hip fractures in patients with neurological diseases, including Alzheimer's disease, Parkinson's disease, and stroke. The purpose of this study was to clarify the efficacy of sunlight exposure for reducing the risk of hip fractures in patients with such neurological diseases. The English literature was searched using PubMed, and randomized controlled trials evaluating the efficacy of sunlight exposure for reducing the risk of hip fractures in patients with Alzheimer's disease, Parkinson's disease, and stroke were identified. The relative risk and the 95% confidence interval were calculated for individual randomized controlled trials, and a pooled data analysis (meta-analysis) was performed. Three randomized controlled trials were identified. Sunlight exposure improved hypovitaminosis D and increased the BMD. The relative risk (95% confidence interval) of hip fractures was 0.22 (0.05, 1.01) for Alzheimer's disease, 0.27 (0.08, 0.96) for Parkinson's disease, and 0.17 (0.02, 1.36) for stroke. The relative risk (95% confidence interval) calculated for the pooled data analysis was 0.23 (0.10, 0.56) (P = 0.0012), suggesting a significant risk reduction rate of 77%. The present meta-analysis added additional evidence indicating the efficacy of sunlight exposure for reducing the risk of hip fractures in patients with Alzheimer's disease, Parkinson's disease, and stroke. © 2011 John Wiley & Sons A/S.

  2. South African university student knowledge of eye protection against sunlight

    Directory of Open Access Journals (Sweden)

    O. A. Oduntan

    2009-12-01

    Full Text Available Exposure to sunlight has been associated with several ocular conditions such as cataract, age-related macular degeneration, and conjunctival neoplasm. Knowledge of protective modalities and good behavioural practice involving eye protection is essential to prevent adverse effects of sunlight. The purpose of this study was to establish knowledge amongst randomly selected university students in South Africa, of prevention modalities against the adverse effects of sunlight. A questionnaire relating to the knowledge of preventive modalities was completed by randomly selected students from four universities selected by convenience sampling.  Questionnaires completed by one thousand, eighthundred and thirty two (N =1832 subjects were analysed with descriptive statistics using Stata version 10.  The participants’ ages ranged from 17 to 55 years (mean = 21.03 ± 3.4 years.  They included 43.7% males and 56.3% females.  They were 68.3% Blacks, 20.0% Whites, 3.4% Indians and 7.4% Coloureds. Many (82.3% of them knew that excessive exposure to sunlight can adversely affect the eyes. Only 28.5% reported that they often wore sunglasses outdoors. Only 38.5% of the participants knew that not all spectacles or contact lenses could protect eyes from ultraviolet radiation. However, many, 87.7% and 69.5% respectively knew that sunglasses and spectacles could be specifically designed to block UVR from entering the eye. Just over half (52.7% knew that contact lenses can be specifically designed to block the UVR. Many, (68.4% agreed that wearing hats with brims could protect the eyes against harmful radiation from the sun and the majority, 95.8% agreed that there was a need for awareness campaigns about the effects of the sun on the eye and against excessive exposure. Female respondents had more knowledge of preventive modalities than the males.  Knowledge of preventive modalities among the respondents varied significantly with the type of questions and was

  3. Low exposure to sunlight is a risk factor for Crohn's disease.

    Science.gov (United States)

    Nerich, V; Jantchou, P; Boutron-Ruault, M-C; Monnet, E; Weill, A; Vanbockstael, V; Auleley, G-R; Balaire, C; Dubost, P; Rican, S; Allemand, H; Carbonnel, F

    2011-04-01

    Low sunshine exposure might contribute to the pathogenesis of inflammatory bowel disease (IBD). To assess the geographic distribution of IBD incidence in relation to sunshine exposure in France to test the hypothesis that higher sun exposure is associated with lower IBD risk. Using the national health insurance database, incidence rates of Crohn's disease (CD) and ulcerative colitis (UC) were estimated for each of the 94 French administrative areas ('départements'), between 2000 and 2002. The surface UV radiation intensity was obtained by combining modelling and satellite data from Meteosat, the European meteorological satellite. Relationships between incidence rates and sun exposure were tested for significance by using a Poisson regression. We mapped smoothed relative risks (sRR) for CD and UC, using a Bayesian approach and adjusting for sun exposure, to search for geographical variations. Areas with a smoothed RR of CD incidence significantly above 1 corresponded to areas with low sunshine exposure, whereas those with high or medium sunlight exposure had smoothed RRs either lower than 1 or not significantly different from 1. There was no association between sun exposure and UC incidence. This geographic study suggests that low sunlight exposure is associated with an increased incidence of Crohn's disease. Further studies are needed to determine if this association is causal. © 2011 Blackwell Publishing Ltd.

  4. Inactivation of Microorganisms by Gamma Irradiation

    Science.gov (United States)

    2005-12-01

    L’inactivation cbimique (ex :formald6hyde) et thermique (ex :autoclave) peut atre utilis~e dans la pr6paration des antig~nes mais la structure d’antig~ne...change overtime. Due to 60Co having a half life of 5.24 years, the time required to achieve the initial central dose rate (kGy/hr) at 0.00 years from

  5. Dynamics of X Chromosome Inactivation

    NARCIS (Netherlands)

    F. Loos (Friedemann)

    2015-01-01

    markdownabstract__Abstract__ Dosage compensation evolved to account for the difference in expression of sex chromosome-linked genes. In mammals dosage compensation is achieved by inactivation of one X chromosome during early female embryogenesis in a process called X chromosome inactivation (XCI).

  6. Abiotic degradation of four phthalic acid esters in aqueous phase under natural sunlight irradiation

    Institute of Scientific and Technical Information of China (English)

    Ruttapol Lertsirisopon; Satoshi Soda; Kazunari Sei; Michihiko Ike

    2009-01-01

    Abiotic degradability of four phthalic acid esters (PAEs) in the aquatic phase was evaluated over the wide pH range (5-9). The PAE solutions in glass test tubes were placed in the dark and under natural sunlight irradiation for evaluating the degradation rate via hydrolysis and photolysis plus hydrolysis, respectively, at ambient temperature for 140 d from autumn to winter in Osaka, Japan. The efficiency of abiotic degradation of the PAEs with relatively short alkyl chain, butylbenzyl phthalate (BBP) and di-n-butyl phthalate (DBP) at neutral pH was significant less than that in the acidic or alkaline condition. Photolysis was considered to mainly contribute to total abiotic degradation at any pH. Neither hydrolysis nor photolysis of di-ethylhexyl phthalate (DEHP) proceeded significantly at any pH, especially hydrolysis at neutral pH was negligible. On the other hand, the degradation rate of di-isononyl phthalate (DINP) mainly catalyzed by photolysis was much higher compared with that of the other PAEs, and almost complete removal was observed during the experimental period at pH 5.0 and 9.0. As a whole, according to the half-life (t1/2) obtained in the experiments, the abiotic degradability of the PAEs was in the sequence, DINP (32-140 d) > DBP (50-360 d), BBP (58-480 d) > DEHP (390-1600 d) under sunlight irradiation (via photolysis plus hydrolysis). Although the abiotic degradation rate for BBP, DBP, and DEHP are much lower than their biodegradation rate reported, the photolysis rate for DINP is comparable to its biodegradation rate in the acidic or alkaline condition.

  7. Inactivation of Microorganisms

    Science.gov (United States)

    Alzamora, Stella Maris; Guerrero, Sandra N.; Schenk, Marcela; Raffellini, Silvia; López-Malo, Aurelio

    Minimal processing techniques for food preservation allow better retention of product flavor, texture, color, and nutrient content than comparable conventional treatments. A wide range of novel alternative physical factors have been intensely investigated in the last two decades. These physical factors can cause inactivation of microorganisms at ambient or sublethal temperatures (e.g., high hydrostatic pressure, pulsed electric fields, ultrasound, pulsed light, and ultraviolet light). These technologies have been reported to reduce microorganism population in foods while avoiding the deleterious effects of severe heating on quality. Among technologies, high-energy ultrasound (i.e., intensities higher than 1 W/cm2, frequencies between 18 and 100 kHz) has attracted considerable interest for food preservation applications (Mason et al., 1996; Povey and Mason, 1998).

  8. Inactivation of Lassa, Marburg, and Ebola viruses by gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Elliott, L.H.; McCormick, J.B.; Johnson, K.M.

    1982-10-01

    Because of the cumbersome conditions experienced in a maximum containment laboratory, methods for inactivating highly pathogenic viruses were investigated. The infectivity of Lassa, Marburg, and Ebola viruses was inactivated without altering the immunological activity after radiation with /sup 60/Co gamma rays. At 4 degrees C, Lassa virus was the most difficult to inactivate with a rate of 5.3 X 10(-6) log 50% tissue culture infective dose per rad of /sup 60/Co radiation, as compared with 6.8 X 10(-6) log 50% tissue culture infective dose per rad for Ebola virus and 8.4 X 10(-6) log 50% tissue culture infective dose per rad for Marburg virus. Experimental inactivation curves, as well as curves giving the total radiation needed to inactivate a given concentration of any of the three viruses, are presented. We found this method of inactivation to be superior to UV light or beta-propiolactone inactivation and now routinely use it for preparation of material for protein-chemistry studies or for preparation of immunological reagents.

  9. Inactivation of Lassa, Marburg, and Ebola viruses by gamma irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Elliott, L.H.; McCormick, J.B.; Johnson, K.M.

    1982-10-01

    Because of the cumbersome conditions experienced in a maximum containment laboratory, methods for inactivating highly pathogenic viruses were investigated. The infectivity of Lassa, Marburg, and Ebola viruses was inactivated without altering the immunological activity after radiation with /sup 60/CO gamma rays. At 4 degrees C, Lassa virus was the most difficult to inactivate with a rate of 5.3 X 10(-6) log 50% tissue culture infective dose per rad of /sup 60/CO radiation, as compared with 6.8 X 10(-6) log 50% tissue culture infective dose per rad for Ebola virus and 8.4 X 10(-6) log 50% tissue culture infective dose per rad for Marburg virus. Experimental inactivation curves, as well as curves giving the total radiation needed to inactivate a given concentration of any of the three viruses, are presented. The authors found this method of inactivation to be superior to UV light or beta-propiolactone inactivation and now routinely use it for preparation of material for protein-chemistry studies or for preparation of immunological reagents.

  10. The Seasonality of Tuberculosis, Sunlight, Vitamin D, and Household Crowding

    Science.gov (United States)

    Wingfield, Tom; Schumacher, Samuel G.; Sandhu, Gurjinder; Tovar, Marco A.; Zevallos, Karine; Baldwin, Matthew R.; Montoya, Rosario; Ramos, Eric S.; Jongkaewwattana, Chulanee; Lewis, James J.; Gilman, Robert H.; Friedland, Jon S.; Evans, Carlton A.

    2014-01-01

    Background. Unlike other respiratory infections, tuberculosis diagnoses increase in summer. We performed an ecological analysis of this paradoxical seasonality in a Peruvian shantytown over 4 years. Methods. Tuberculosis symptom-onset and diagnosis dates were recorded for 852 patients. Their tuberculosis-exposed cohabitants were tested for tuberculosis infection with the tuberculin skin test (n = 1389) and QuantiFERON assay (n = 576) and vitamin D concentrations (n = 195) quantified from randomly selected cohabitants. Crowding was calculated for all tuberculosis-affected households and daily sunlight records obtained. Results. Fifty-seven percent of vitamin D measurements revealed deficiency (<50 nmol/L). Risk of deficiency was increased 2.0-fold by female sex (P < .001) and 1.4-fold by winter (P < .05). During the weeks following peak crowding and trough sunlight, there was a midwinter peak in vitamin D deficiency (P < .02). Peak vitamin D deficiency was followed 6 weeks later by a late-winter peak in tuberculin skin test positivity and 12 weeks after that by an early-summer peak in QuantiFERON positivity (both P < .04). Twelve weeks after peak QuantiFERON positivity, there was a midsummer peak in tuberculosis symptom onset (P < .05) followed after 3 weeks by a late-summer peak in tuberculosis diagnoses (P < .001). Conclusions. The intervals from midwinter peak crowding and trough sunlight to sequential peaks in vitamin D deficiency, tuberculosis infection, symptom onset, and diagnosis may explain the enigmatic late-summer peak in tuberculosis. PMID:24596279

  11. Kinetic analysis of Legionella inactivation using ozone in wastewater.

    Science.gov (United States)

    Li, Jun; Li, Kunquan; Zhou, Yan; Li, Xuebin; Tao, Tao

    2017-02-01

    Legionella inactivation using ozone was studied in wastewater using kinetic analysis and modeling. The experimental results indicate that the relationship between the ozone concentration, germ concentration, and chemical oxygen demand (COD) can be used to predict variations in germ and COD concentrations. The ozone reaction with COD and inactivation of Legionella occurred simultaneously, but the reaction with COD likely occurred at a higher rate than the inactivation, as COD is more easily oxidized by ozone than Legionella. Higher initial COD concentrations resulted in a lower inactivation rate and higher lnN/N0. Higher temperature led to a higher inactivation efficiency. The relationship of the initial O3 concentration and Legionella inactivation rate was not linear, and thus, the Ct value required for a 99.99% reduction was not constant. The initial O3 concentration was more important than the contact time, and a reduction of the initial O3 concentration could not be compensated by increasing the contact time. The Ct values were compared over a narrow range of initial concentrations; the Ct values could only be contrasted when the initial O3 concentrations were very similar. A higher initial O3 concentration led to a higher inflection point value for the lnN/N0 vs C0t curve. Energy consumption using a plasma corona was lower than when using boron-doped diamond electrodes.

  12. Natural organic matter and sunlight accelerate the degradation of 17ss-estradiol in water

    Energy Technology Data Exchange (ETDEWEB)

    Leech, Dina M. [Institute of Marine Sciences, University of North Carolina at Chapel Hill, 3431 Arendell Street, Morehead City, NC 28557 (United States)], E-mail: dmleech@email.unc.edu; Snyder, Matthew T.; Wetzel, Robert G. [Department of Environmental Sciences and Engineering, School of Public Health, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599 (United States)

    2009-03-01

    Nanomolar concentrations of steroid hormones such as 17{beta}-estradiol can influence the reproductive development and sex ratios of invertebrate and vertebrate populations. Thus their release into surface and ground waters from wastewater facilities and agricultural applications of animal waste is of environmental concern. Many of these compounds are chromophoric and susceptible to photolytic degradation. High intensity UV-C radiation has been demonstrated to degrade some of these compounds in engineered systems. However, the degradation efficacy of natural solar radiation in shallow fresh waters is less understood. Here photolytic experiments with 17{beta}-estradiol demonstrated modest photodegradation ({approx} 26%) when exposed to simulated sunlight between 290 and 720 nm. Photodegradation significantly increased ({approx} 40-50%) in the presence of 2.0-15.0 mg/l of dissolved organic carbon (DOC) derived from humic acids of the Suwannee River, GA. However, rates of photodegradation reached a threshold at approximately 5.0 mg/l DOC. Observed suppression of photolysis in the presence of a radical inhibitor (i.e. 2-propanol) indicated that a significant proportion of the degradation was due to radicals formed from the photolysis of DOC. Although photodegradation was greatest in full sunlight containing UV-B (290-320 nm), degradation was also detected with UV-A (320-400 nm) and visible light (400-720 nm) alone.

  13. Sunlight and Skin Cancer: Lessons from the Immune System

    OpenAIRE

    Ullrich, Stephen E

    2007-01-01

    The ultraviolet (UV) radiation in sunlight induces skin cancer development. Skin cancer is the most common form of human neoplasia. Estimates suggest that in excess of 1.5 million new cases of skin cancer (www.cancer.org/statistics) will be diagnosed in the United States this year Fortunately, because of their highly visible location, skin cancers are more rapidly diagnosed and more easily treated than other types of cancer. Be that as it may, approximately 10,000 Americans a year die from sk...

  14. Sunlight and Skin Cancer: Lessons from the Immune System

    OpenAIRE

    Ullrich, Stephen E

    2007-01-01

    The ultraviolet (UV) radiation in sunlight induces skin cancer development. Skin cancer is the most common form of human neoplasia. Estimates suggest that in excess of 1.5 million new cases of skin cancer (www.cancer.org/statistics) will be diagnosed in the United States this year Fortunately, because of their highly visible location, skin cancers are more rapidly diagnosed and more easily treated than other types of cancer. Be that as it may, approximately 10,000 Americans a year die from sk...

  15. Effect of Sunlight Exposure on Bone Mineral Density in Children with Severe Disability.

    Science.gov (United States)

    Kanemura, Hideaki; Hatakeyama, Kazuo; Sano, Fumikazu; Yagasaki, Hideaki; Sugita, Kanji; Aihara, Masao

    2016-08-01

    The aim of this study was to determine the efficacy of sunlight exposure for increasing bone mineral density (BMD) in children with severe disability. The subjects were five children with severe disability, aged 6 to 8 years. BMD was measured at baseline and after 3, 6, 9, and 12 months of starting sunlight exposure. All caregivers of patients were instructed to create opportunities to stay outdoors. Daily sunlight exposure time was defined as hours of staying outdoors. Mean hours of sunbathing per day were calculated at baseline and after 3, 6, 9, and 12 months of starting sunlight exposure. Sunlight exposure tended to be longer after starting than before starting in all patients, but the difference was not significant (p = 0.052). Along with the increase in sunlight exposure, BMD increased significantly after the start of sunlight exposure in all patients (p sunlight exposure. No patients had bone fractures after the start of sunlight exposure. These results suggest that sunlight exposure increased BMD, and that this may reduce the risk of bone fracture in children with disability. Georg Thieme Verlag KG Stuttgart · New York.

  16. Porous graphitic carbon nitride synthesized via direct polymerization of urea for efficient sunlight-driven photocatalytic hydrogen production.

    Science.gov (United States)

    Zhang, Yuewei; Liu, Jinghai; Wu, Guan; Chen, Wei

    2012-09-07

    Energy captured directly from sunlight provides an attractive approach towards fulfilling the need for green energy resources on the terawatt scale with minimal environmental impact. Collecting and storing solar energy into fuel through photocatalyzed water splitting to generate hydrogen in a cost-effective way is desirable. To achieve this goal, low cost and environmentally benign urea was used to synthesize the metal-free photocatalyst graphitic carbon nitride (g-C₃N₄). A porous structure is achieved via one-step polymerization of the single precursor. The porous structure with increased BET surface area and pore volume shows a much higher hydrogen production rate under simulated sunlight irradiation than thiourea-derived and dicyanamide-derived g-C₃N₄. The presence of an oxygen atom is presumed to play a key role in adjusting the textural properties. Further improvement of the photocatalytic function can be expected with after-treatment due to its rich chemistry in functionalization.

  17. Can Skin Exposure to Sunlight Prevent Liver Inflammation?

    Directory of Open Access Journals (Sweden)

    Shelley Gorman

    2015-05-01

    Full Text Available Liver inflammation contributes towards the pathology of non-alcoholic fatty liver disease (NAFLD. Here we discuss how skin exposure to sunlight may suppress liver inflammation and the severity of NAFLD. Following exposure to sunlight-derived ultraviolet radiation (UVR, the skin releases anti-inflammatory mediators such as vitamin D and nitric oxide. Animal modeling studies suggest that exposure to UVR can prevent the development of NAFLD. Association studies also support a negative link between circulating 25-hydroxyvitamin D and NAFLD incidence or severity. Clinical trials are in their infancy and are yet to demonstrate a clear beneficial effect of vitamin D supplementation. There are a number of potentially interdependent mechanisms whereby vitamin D could dampen liver inflammation, by inhibiting hepatocyte apoptosis and liver fibrosis, modulating the gut microbiome and through altered production and transport of bile acids. While there has been a focus on vitamin D, other mediators induced by sun exposure, such as nitric oxide may also play important roles in curtailing liver inflammation.

  18. Can skin exposure to sunlight prevent liver inflammation?

    Science.gov (United States)

    Gorman, Shelley; Black, Lucinda J; Feelisch, Martin; Hart, Prue H; Weller, Richard

    2015-05-05

    Liver inflammation contributes towards the pathology of non-alcoholic fatty liver disease (NAFLD). Here we discuss how skin exposure to sunlight may suppress liver inflammation and the severity of NAFLD. Following exposure to sunlight-derived ultraviolet radiation (UVR), the skin releases anti-inflammatory mediators such as vitamin D and nitric oxide. Animal modeling studies suggest that exposure to UVR can prevent the development of NAFLD. Association studies also support a negative link between circulating 25-hydroxyvitamin D and NAFLD incidence or severity. Clinical trials are in their infancy and are yet to demonstrate a clear beneficial effect of vitamin D supplementation. There are a number of potentially interdependent mechanisms whereby vitamin D could dampen liver inflammation, by inhibiting hepatocyte apoptosis and liver fibrosis, modulating the gut microbiome and through altered production and transport of bile acids. While there has been a focus on vitamin D, other mediators induced by sun exposure, such as nitric oxide may also play important roles in curtailing liver inflammation.

  19. The impact of sunlight on high-latitude equivalent currents

    CERN Document Server

    Laundal, K M; Østgaard, N; Reistad, J P; Haaland, S; Snekvik, K; Tenfjord, P; Ohtani, S; Milan, S E

    2016-01-01

    Ground magnetic field measurements can be mathematically related to an overhead ionospheric equivalent current. In this study we look in detail at how the global equivalent current, calculated using more than 30 years of SuperMAG magnetometer data, changes with sunlight conditions. The calculations are done using spherical harmonic analysis in quasi-dipole coordinates, a technique which leads to improved accuracy compared to previous studies. Sorting the data according to the location of the sunlight terminator and orientation of the interplanetary magnetic field (IMF), we find that the equivalent current resembles ionospheric convection patterns on the sunlit side of the terminator but not on the dark side. On the dark side, with southward IMF, the current is strongly dominated by a dawn cell and the current across the polar cap has a strong dawnward component. The contrast between the sunlit and dark side increases with increasing values of the $\\mathit{F}_{10.7}$ index, showing that increasing solar EUV fl...

  20. Comparison of different inactivation methods on the stability of Indian vaccine strains of foot and mouth disease virus.

    Science.gov (United States)

    Sarkar, Arunava; Tamil Selvan, Ramasamy Periyasamy; Kishore, Subodh; Ganesh, Kondabattula; Bhanuprakash, Veerakyathappa

    2017-07-01

    In this study, the efficiency of binary ethyleneimine (BEI) in combination with formaldehyde (FA) and glutaraldehyde (GTA) in inactivating the Indian FMDV vaccine strains is compared. The acceptable safety of virus inactivation was faster and the inactivation rates were increased many-folds with combination of inactivants than BEI alone. FMDV A was inactivated rapidly than the other two serotypes with BEI + FA combination. Inactivation plots were linear for all the serotypes irrespective of inactivation process. Further, the integrity studies on 146S using serotype specific ELISA indicated no significant change in the antigenic mass of all the serotypes throughout the inactivation process. However, the loss of 146S antigen occurred in the subsequent steps of downstream processing. Further, the studies on intactness of viral RNA using real time PCR indicated the amplification of 1D gene sequences in all the preparations of timed samples irrespective of serotypes/inactivation process. Further, inactivated virus preparation (146S) was more stable at lower temperatures for all the serotypes/inactivation process. Among the combinations of inactivants, BEI + FA out performed compared to BEI + GTA and BEI in terms of inactivation rates, 146S yield and its storage stability, irrespective of the serotypes. Copyright © 2017 International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  1. Influenza Vaccine, Inactivated or Recombinant

    Science.gov (United States)

    ... die from flu, and many more are hospitalized.Flu vaccine can:keep you from getting flu, make flu ... inactivated or recombinant influenza vaccine?A dose of flu vaccine is recommended every flu season. Children 6 months ...

  2. Inactivation of pectin methylesterase by immobilized trypsins from cunner fish and bovine pancreas.

    Science.gov (United States)

    Li, Dan; Matos, Madyu; Simpson, Benjamin K

    2013-01-01

    Immobilized cunner fish trypsin was used to inactivate pectin methylesterase (PME). The effects of different reaction conditions (e.g., incubation time, PME concentration, and temperature) on PME inactivation and kinetics of inactivation were investigated. Temperature, incubation time, and PME concentration significantly affected the extent of PME inactivation. Generally, higher temperature, longer incubation time, and low PME concentration caused more PME inactivation. The immobilized fish trypsin had higher capacity to inactivate PME than immobilized bovine trypsin. The inactivation efficiency of the immobilized fish trypsin was about 20% higher than that of its bovine counterpart. However, PME inactivated by both trypsins regained partial activity during storage at 4°C, with immobilized fish trypsin-treated PME regaining more of its original activity than the immobilized bovine trypsin-treated PME. Heat-denatured PME was hydrolyzed more extensively by immobilized fish trypsin than by its bovine counterpart. The rate constants increased, whereas the D-values decreased with temperature for both immobilized fish and bovine trypsins. The inactivation rate constants of immobilized fish trypsin at all the temperatures investigated (i.e., 15-35°C) were higher than those of immobilized bovine trypsin. Furthermore, the activation energy (Ea ) of PME inactivation by immobilized fish trypsin was lower than that of immobilized bovine trypsin.

  3. A novel solar cell fabricated with spiral photo-electrode for capturing sunlight 3-dimensionally

    Institute of Scientific and Technical Information of China (English)

    LIU Yong; SHEN Hui; DENG Youjun

    2006-01-01

    A novel solar cell fabricated with spiral photo-electrode for capturing sunlight 3-dimensionally (3D-cell) is proposed in this paper. We studied its performance both in solar simulator and in nature sunlight. Spiral photo-electrode of 3D-cell can receive sunlight from all directions and therefore can track the sun passively. And it is much insensitive to solar azimuth angle and shade. In addition, it increases the area to obtain scattered sunlight and reflected light. Compared with the dye-sensitized solar cells using sandwich structure, it would be more advantageous in the sealing technique.

  4. Asteroid thermal modeling in the presence of reflected sunlight

    Science.gov (United States)

    Myhrvold, Nathan

    2016-10-01

    This study addresses thermal modeling of asteroids with a new derivation of the Near Earth Asteroid Thermal (NEATM) model which correctly accounts for the presence of reflected sunlight in short wave IR bands. Kirchhoff's law of thermal radiation applies to this case and has important implications. New insight is provided into the ???? parameter in the NEATM model and it is extended to thermal models besides NEATM. The role of surface material properties on ???? is examined using laboratory spectra of meteorites and other asteroid compositional proxies; the common assumption that emissivity ????=0.9 in asteroid thermal models may not be justified and can lead to misestimating physical parameters. In addition, indeterminacy in thermal modeling can limit its ability to uniquely determine temperature and other physical properties. A new curve-fitting approach allows thermal modeling to be done independently of visible-band observational parameters, such as the absolute magnitude ????.

  5. Spectral analysis of red scattered sunlight at sunrise

    CERN Document Server

    Zagury, F; Zagury, Frederic; Fujii, Mitsugu

    2003-01-01

    We analyze and fit visible spectra of a red horizon at sunrise. The shape of the spectra consist of a blue continuum followed by a red bump. The reddest spectra are well fitted by the product of a spectrum of extinguished sunlight (Rayleigh extinction + ozone absorption) and 1/lambda^4. The former is essentially the radiation field in the outer atmosphere, at the scattering volume location; the latter corresponds to Rayleigh scattering by the gas. Moving to higher altitudes, a second component, corresponding to the spectrum of a blue sky, must be added. The spectra we have obtained are similar to spectra of red nebulae, suggesting there may be other explanations than an emission process to the red color of some nebulae.

  6. Sustainable sunlight to biogas is via marginal organics.

    Science.gov (United States)

    Shilton, Andy; Guieysse, Benoit

    2010-06-01

    Although biogas production from algae offers higher sunlight to biomass energy conversion efficiencies its production costs simply cannot compete with terrestrial plants. Unfortunately terrestrial plant cropping for biogas production is, in its own right, neither particularly sustainable nor profitable and its ongoing application is only driven by energy security concerns resulting in taxpayer subsidies. By comparison, scavenging the organic energy residual/wastes from food production offers a far more profitable and sustainable proposition and has an energy potential that dwarfs anything biogas production from dedicated energy crops can realistically offer. Thus researchers wanting to assist the development of sustainable biogas systems with viable process economics should forget about terrestrial and algal energy cropping and focus on the realm of scavengers.

  7. Circadian clocks optimally adapt to sunlight for reliable synchronization

    CERN Document Server

    Hasegawa, Yoshihiko

    2014-01-01

    Circadian oscillation provides selection advantages through synchronization to the daylight cycle. However, a reliable clock must be designed through two conflicting properties: entrainability to properly respond to external stimuli such as sunlight, and regularity to oscillate with a precise period. These two aspects do not easily coexist because better entrainability favors higher sensitivity, which may sacrifice the regularity. To investigate conditions for satisfying the two properties, we analytically calculated the optimal phase-response curve with a variational method. Our result indicates an existence of a dead zone, i.e., a time during which external stimuli neither advance nor delay the clock. This result is independent of model details and a dead zone appears only when the input stimuli obey the time course of actual insolation. Our calculation demonstrates that every circadian clock with a dead zone is optimally adapted to the daylight cycle. Our result also explains the lack of a dead zone in osc...

  8. Sunlight-exposed biofilm microbial communities are naturally resistant to chernobyl ionizing-radiation levels.

    Science.gov (United States)

    Ragon, Marie; Restoux, Gwendal; Moreira, David; Møller, Anders Pape; López-García, Purificación

    2011-01-01

    The Chernobyl accident represents a long-term experiment on the effects of exposure to ionizing radiation at the ecosystem level. Though studies of these effects on plants and animals are abundant, the study of how Chernobyl radiation levels affect prokaryotic and eukaryotic microbial communities is practically non-existent, except for a few reports on human pathogens or soil microorganisms. Environments enduring extreme desiccation and UV radiation, such as sunlight exposed biofilms could in principle select for organisms highly resistant to ionizing radiation as well. To test this hypothesis, we explored the diversity of microorganisms belonging to the three domains of life by cultivation-independent approaches in biofilms developing on concrete walls or pillars in the Chernobyl area exposed to different levels of radiation, and we compared them with a similar biofilm from a non-irradiated site in Northern Ireland. Actinobacteria, Alphaproteobacteria, Bacteroidetes, Acidobacteria and Deinococcales were the most consistently detected bacterial groups, whereas green algae (Chlorophyta) and ascomycete fungi (Ascomycota) dominated within the eukaryotes. Close relatives to the most radio-resistant organisms known, including Rubrobacter species, Deinococcales and melanized ascomycete fungi were always detected. The diversity of bacteria and eukaryotes found in the most highly irradiated samples was comparable to that of less irradiated Chernobyl sites and Northern Ireland. However, the study of mutation frequencies in non-coding ITS regions versus SSU rRNA genes in members of a same actinobacterial operational taxonomic unit (OTU) present in Chernobyl samples and Northern Ireland showed a positive correlation between increased radiation and mutation rates. Our results show that biofilm microbial communities in the most irradiated samples are comparable to non-irradiated samples in terms of general diversity patterns, despite increased mutation levels at the single

  9. Sunlight Exposure, Pigmentation, and Incident Age-Related Macular Degeneration

    Science.gov (United States)

    Klein, Barbara E. K.; Howard, Kerri P.; Iyengar, Sudha K.; Sivakumaran, Theru A.; Meyers, Kristin J.; Cruickshanks, Karen J.; Klein, Ronald

    2014-01-01

    Purpose. Examine potential effects of sunlight exposure, hair color, eye color, and selected gene single-nucleotide polymorphisms (SNPs) on incidence of AMD. Methods. Subjects participated in up to five examinations over a 20-year period. Eye color, self-reported hair color as a teenager, and sunlight exposure were ascertained at the baseline examination. Presence and severity of AMD and its lesions were determined via fundus photographs. Genetic data were available on a subset of participants. The SNPs CFH Y402H rs1061170 and ARMS2 A69S rs10490924 were used to analyze genetic risk of AMD; OCA2 rs4778241 and HERC2 rs12913832 represented genetic determinants of eye color. Results. Incidence of early AMD was higher in blond/red-haired persons compared with brown/black-haired persons (hazard ratio [HR] 1.25, P = 0.02) and in persons with high sun exposure in their thirties (HR 1.41, P = 0.02). However, neither was significant after adjustment for multiple comparisons. Eye (HR 1.36, P = 0.006) and hair color (HR 1.42, P = 0.003) were associated with incidence of any retinal pigmentary abnormalities (RPAs). Both remained significant after adjustment for multiple comparisons. Neither presence of alleles for light-colored eyes nor those associated with high risk of late AMD altered the association of eye or hair color with early AMD. None of the characteristics studied were significantly associated with late AMD. Conclusions. Modest associations of eye color, hair color, and HERC2 genotype with any RPAs were found. Genes for AMD did not affect these associations. Eye color phenotype was more strongly associated with outcomes than HERC2 or OCA2 genotype. PMID:25125603

  10. Sunlight exposure, pigmentation, and incident age-related macular degeneration.

    Science.gov (United States)

    Klein, Barbara E K; Howard, Kerri P; Iyengar, Sudha K; Sivakumaran, Theru A; Meyers, Kristin J; Cruickshanks, Karen J; Klein, Ronald

    2014-08-14

    Examine potential effects of sunlight exposure, hair color, eye color, and selected gene single-nucleotide polymorphisms (SNPs) on incidence of AMD. Subjects participated in up to five examinations over a 20-year period. Eye color, self-reported hair color as a teenager, and sunlight exposure were ascertained at the baseline examination. Presence and severity of AMD and its lesions were determined via fundus photographs. Genetic data were available on a subset of participants. The SNPs CFH Y402H rs1061170 and ARMS2 A69S rs10490924 were used to analyze genetic risk of AMD; OCA2 rs4778241 and HERC2 rs12913832 represented genetic determinants of eye color. Incidence of early AMD was higher in blond/red-haired persons compared with brown/black-haired persons (hazard ratio [HR] 1.25, P = 0.02) and in persons with high sun exposure in their thirties (HR 1.41, P = 0.02). However, neither was significant after adjustment for multiple comparisons. Eye (HR 1.36, P = 0.006) and hair color (HR 1.42, P = 0.003) were associated with incidence of any retinal pigmentary abnormalities (RPAs). Both remained significant after adjustment for multiple comparisons. Neither presence of alleles for light-colored eyes nor those associated with high risk of late AMD altered the association of eye or hair color with early AMD. None of the characteristics studied were significantly associated with late AMD. Modest associations of eye color, hair color, and HERC2 genotype with any RPAs were found. Genes for AMD did not affect these associations. Eye color phenotype was more strongly associated with outcomes than HERC2 or OCA2 genotype. Copyright 2014 The Association for Research in Vision and Ophthalmology, Inc.

  11. Sunlight exposure and sun sensitivity associated with disability progression in multiple sclerosis

    NARCIS (Netherlands)

    D'hooghe, M. B.; Haentjens, P.; Nagels, G.; Garmyn, M.; De Keyser, J.

    2012-01-01

    Background: Sunlight and vitamin D have been inversely associated with the risk of multiple sclerosis (MS). Objective: We investigated sunlight exposure and sun sensitivity in relation to disability progression in MS. Methods: We conducted a survey among persons with MS, registered by the Flemish MS

  12. Amelioration of osteoporosis and hypovitaminosis D by sunlight exposure in Parkinson's disease.

    Science.gov (United States)

    Sato, Yoshihiro; Iwamoto, Jun; Honda, Yoshiaki

    2011-01-01

    A high incidence of fractures, particularly of the hip, represents an important problem in patients with Parkinson's disease (PD), who are prone to falls and have osteoporosis. We previously showed that 25-hydroxyvitamin D (25-OHD) deficiency due to sunlight deprivation with compensatory hyperparathyroidism causes reduced bone mineral density (BMD) in elderly patients with PD. The present study was undertaken to address the possibility that sunlight exposure may maintain BMD and reduce the incidence of hip fracture in elderly patients with PD. In a prospective study, PD patients were assigned to regular sunlight exposure (n=162) or usual lifestyle (n=162), and followed for 2 years. BMD of the second metacarpal bone was measured using a computed X-ray densitometer. Incidence of hip fracture in the two patient groups during the 2 year follow-up period was assessed. At baseline, patients of both groups showed vitamin D deficiency due to sunlight deprivation with compensatory hyperparathyroidism. The exposed group patients were exposed to sunlight (3231 min/year). BMD increased by 3.8% in the sunlight-exposed group and decreased by 2.6% in the usual lifestyle group (psunlight-exposed group. Eleven patients sustained hip fracture in the normal lifestyle group, and 3 fractures occurred among the sunlight-exposed group (p=.03; odds ratio=2.4). Sunlight exposure can increase the BMD of vitamin D deficient bone by increasing 25-OHD concentration and leads to the prevention of hip fracture. © 2010 Elsevier Ltd. All rights reserved.

  13. Effect of season and sunlight on viral kinetics during hepatitis C virus therapy

    Science.gov (United States)

    Hernández-Alvarez, Noemi; Pascasio Acevedo, Juan Manuel; Quintero, Enrique; Fernández Vázquez, Inmaculada; García-Eliz, María; de la Revilla Negro, Juan; Crespo García, Javier; Hernández-Guerra, Manuel

    2017-01-01

    Background and aims Rapid viral response (RVR) during antiviral treatment for hepatitis C virus (HCV) predicts sustained viral response (SVR). Recently, vitamin D levels have been associated with SVR. As sunlight is the most important source of vitamin D and shows seasonal variation, we evaluated the effect of season on viral kinetics during peginterferon/ribavirin-based therapy for HCV. Methods Consecutive HCV patients treated with peginterferon/ribavirin and boceprevir/ telaprevir (June 2011–July 2014) were included. Patients were grouped according to season when therapy was initiated (Season A: May–October and Season B: November–April) depending on hours of daily sunlight. Multiple logistic regression analysis included factors known to influence SVR to treatment. The dependent variables were undetectable viral load (VL) or VL ≤15 UI/mL (VL ≤15) at weeks 4, 8 and 12, end of treatment and SVR. Results The study included 930 patients (66.8% men; median 54 years) treated with telaprevir (n=537) or boceprevir, without (n=481) or with lead-in therapy of peginterferon/ribavirin. Baseline characteristics of patients in Season A (45.3%, n=421) and Season B groups were similar. Overall, a higher rate of RVR (23.5% vs 16.1%, p=0.005) and VL ≤15 (51.0% vs 38.6%, p≤0.001) was observed in patients starting treatment during Season A versus Season B. By logistic regression analysis, initiating treatment in Season A proved to be an independent predictor of RVR and VL ≤15. Conclusions In our setting, seasonality affects viral kinetics in HCV genotype 1 patients treated with peginterferon/ribavirin-based therapy. Our findings support the hypothesis that vitamin D influences viral response to peginterferon/ribavirin-based therapy.

  14. Serum 25-hydroxyvitamin-D responses to multiple UV exposures from solaria: inferences for exposure to sunlight.

    Science.gov (United States)

    McKenzie, Richard; Scragg, Robert; Liley, Ben; Johnston, Paul; Wishart, John; Stewart, Alistair; Prematunga, Roshani

    2012-07-01

    We investigate the relationship between blood serum 25-hydroxyvitamin D (25(OH)D) and UV exposure from two artificial sources. We then use the results to test the validity of the action spectrum for vitamin D production, and to infer the production from summer and winter sunlight. The results are based on a two-arm randomised clinical trial of biweekly UV exposure for 12 weeks using two different types of dermatological booths: one emitting primarily UV-A radiation, and the other emitting primarily UV-B radiation (booth A and booth B respectively). In terms of the vitamin D production per unit erythema, one of the booths mimics summer noon sunlight, while the other mimics winter noon sunlight. Blood samples were taken before and after the exposures. For all participants, the phototherapy booth treatments arrested the usual wintertime decline in 25(OH)D, and for most the treatments from either booth resulted in significant increases. The increases were highly non-linear and there was a high degree of variability in 25(OH)D and its response to UV from person to person. By the end of the 12 week period, the mean increase was >30 nmol l(-1) from a cumulative exposure of 17 SED from the UV-A booth, and twice that for the UV-B booth for which the cumulative exposure was 268 SED. Assuming a logarithmic relationship between UV and vitamin D, the results for the two booths show no obvious inconsistency in the action spectrum for pre-vitamin D production. However, further measurements with similar exposures from each booth are required to confirm its validity. A model was developed to describe the increases in serum 25(OH)D resulting from the UV exposures, which differed markedly between the two booths. The deduced initial rate of increase of 25(OH)D was approximately 5 nmol l(-1) per SED. From the large increases in 25(OH)D from each booth, along with knowledge of the spectral distribution of sunlight and assuming the currently-accepted action spectrum for photo

  15. Sunlight Exposure, Work Hours, Caffeine Consumption, and Sleep Duration in the Naval Environment.

    Science.gov (United States)

    Shattuck, Nita L; Matsangas, Panagiotis

    2017-06-01

    Sailors in the U.S. Navy are habitual shiftworkers, often experiencing circadian misalignment due to their irregular work/rest schedules. This study assessed the effect of sunlight exposure, work hours, and caffeinated beverage consumption on the daily sleep duration of crewmembers of a U.S. Navy ship during a 2-wk underway period. Working in an artificially lit area with no access to sunlight during work hours, U.S. Navy crew members (N = 91) used daily logs to report their daily activity, caffeinated beverage consumption, and exposure to sunlight while off-duty; sleep was assessed by wrist-worn actigraphy. Hours of sunlight exposure, work duration, and the amount of coffee/tea/soft drinks were statistically significant predictors of sleep duration. On average, crewmembers who reported more than one half-hour of sunlight each day slept on average ∼40 min (10%) less than their peers working the same shifts who received less than one half-hour of sunlight (on average 6.05 ± 0.90 h vs. 6.71 ± 0.91 h, respectively). Exposure to sunlight, work hours, and consumption of caffeinated beverages are important factors when planning watchstanding schedules at sea. Even though further research is needed, our results suggest that even brief exposure to sunlight may contribute to circadian misalignment that negatively affects sleep in the operational environment. Educating crewmembers about sleep hygiene, especially the important roles played by sunlight and caffeine, could potentially improve the sleep and fatigue levels of this population of maritime shiftworkers.Shattuck NL, Matsangas P. Sunlight exposure, work hours, caffeine consumption, and sleep duration in the naval environment. Aerosp Med Hum Perform. 2017; 88(6):579-585.

  16. Photocatalytic oxidation of acetonitrile in aqueous suspension of titanium dioxide irradiated by sunlight

    Energy Technology Data Exchange (ETDEWEB)

    Augugliaro, V.; Bianco Prevot, A.; Caceres Vazquez, J.; Garcia-Lopez, E.; Irico, A.; Loddo, V.; Malato Rodriguez, S.; Marci, G.; Palmisano, L.; Pramauro, E.

    2002-07-01

    The photocatalytic oxidation of acetonitrile (CH{sub 3}CN) was carried out in aqueous suspensions of polycrystalline UiO{sub 2} P25 Degussa irradiated by sunlight. A plus flow photoreactor in a total recycle loop was used for carrying out reactivity experiments in which the concentrations of acetonitrile, of its intermediate oxidation products and of not-purgeable organic carbon (NPOC) were monitored. The influence of the presence of strong oxidant species (H{sub 2}O{sub 2}, S{sub 2}O{sub 8}, CIO) on the process rate was studied. The dependence of acetonitrile photo-oxidation rate on the substrate concentration and on the catalyst amount was also investigated. The photodegradation rate of substrate and NPOC follows a first order kinetics with respect to acetonitrile and NPOC concentrations, respectively. The presence of S{sub {sup O}8}''2- and solar irradiation determines the occurrence of homogeneous degradation of acetonitrile and NPOC. In the presence of irradiated catalyst, a significant synergetic effect is observed for NPOC degradation while for the acetonitrile oxidation this effect is not evident. H{sub 2}O{sub 2} does not effect the process while CIO negatively affects the acetonitrile oxidation rate and it seems to inhibit the NPOC degradation. (Author) 20 refs.

  17. A systematic approach to determine global thermal inactivation parameters for various food pathogens

    NARCIS (Netherlands)

    Asselt, van E.D.; Zwietering, M.H.

    2006-01-01

    Thermal inactivation of pathogens has been studied extensively, which has resulted in a wide range of D- and z-values. Estimating the inactivation rate for a specific condition based on these reported values is difficult, since one has to select representative conditions, and data obtained exactly a

  18. High spacecraft potentials on ISEE-1 in sunlight

    Energy Technology Data Exchange (ETDEWEB)

    Whipple, E.C.; Olsen, R.C.

    1987-01-01

    Data from the two electric-field experiments and from the plasma-composition experiment on ISEE-1 show that the spacecraft charged to close to -70 V in sunlight at about 0700 UT on March 17, 1978. Data from the electron-spectrometer experiment show that there was a potential barrier of some -10 to -20 V about the spacecraft during this event. The potential barrier was effective in turning back emitted photoelectrons to the spacecraft. Potential barriers can be formed by differential charging on the spacecraft or by the presence of space charge. The stringent electrostatic cleanliness specifications imposed on ISEE made by the presence of differential charging seem unlikely, if these precautions were effective. Modeling of this event to determine if the barrier was produced by the presence of space charge, suggested that this could not explain the observed barrier. The angular shape of the distribution could be successfully modeled as a product of differential charging on the solar arrays. This implies that the conductive coating was not completely effective in preventing differential charging, and that differential charging did occur.

  19. Sunlight assisted photodegradation by tin oxide quantum dots

    Science.gov (United States)

    Shajira, P. S.; Prabhu, V. Ganeshchandra; Bushiri, M. Junaid

    2015-12-01

    Rutile phase of SnO2 quantum dots of average size of 2.5 nm were synthesized at a growth temperature of 70 °C and characterized with XRD, TEM, FTIR and Raman analysis. The effective strain within the lattice of SnO2 quantum dots was calculated by Williamson-Hall method. The broad peaks in XRD as well as Raman spectra and the presence of Raman bands at 569 and 432 cm-1 are due to lower crystallinity of nanoparticles. The optical band gap of SnO2 quantum dots was increased to 3.75 eV attributed to the quantum size effect. SnO2 quantum dots were annealed in air atmosphere and the crystallite size of the particles increased with annealing temperature. Sunlight assisted photodegration property of SnO2 quantum dots was investigated with vanillin as a model system and it shows the photodegradation efficiency of 87%. The photoluminescence and photodegradation efficiency of nanocrystallite SnO2 decreases with increase of crystallite size contributed to the reduction in population of defects and surface area.

  20. Occupational Sunlight Exposure and Risk of Renal Cell Carcinoma

    Science.gov (United States)

    Karami, Sara; Boffetta, Paolo; Stewart, Patricia; Rothman, Nathaniel; Hunting, Katherine L.; Dosemeci, Mustafa; Berndt, Sonja I.; Brennan, Paul; Chow, Wong-Ho; Moore, Lee E.; Zaridze, David; Mukeria, Anush; Janout, Vladimir; Kollarova, Helena; Bencko, Vladimir; Holcatova, Ivana; Navritalova, Marie; Szeszenia-Dabrowska, Neonila; Mates, Dana; Gromiec, Jan P.

    2010-01-01

    Background Recent findings indicate that vitamin D obtained from ultraviolet (UV) exposure may reduce the risk of a number of different cancers. Vitamin D is metabolized to its active form within the kidney, the major organ for vitamin D metabolism and activity. Since both the incidence of renal cell cancer and prevalence of vitamin D deficiency have increased over the past few decades, this study sought to explore whether occupational UV exposure was associated with renal cell carcinoma (RCC) risk. Methods A hospital-based case-control study of 1,097 RCC cases and 1,476 controls was conducted in four Central and Eastern European countries. Demographic and occupational information was collected to examine the association between occupational UV exposure and RCC risk. Results A significant (24%-38%) reduction in RCC risk was observed with increasing occupational UV exposure among male participants. No association between UV exposure and RCC risk was observed among female participants. When analyses were stratified by latitude as another estimate of sunlight intensity, a stronger (71%-73%) reduction in RCC risk was observed between UV exposure and cancer risk among males residing at the highest latitudes. Conclusion The results of this study suggest that among males there is an inverse association between occupational UV exposure and renal cancer risk. Replication studies are warranted to confirm these results. PMID:20213683

  1. Sunlight and skin cancer: lessons from the immune system.

    Science.gov (United States)

    Ullrich, Stephen E

    2007-08-01

    The ultraviolet (UV) radiation in sunlight induces skin cancer development. Skin cancer is the most common form of human neoplasia. Estimates suggest that in excess of 1.5 million new cases of skin cancer (www.cancer.org/statistics) will be diagnosed in the United States this year. Fortunately, because of their highly visible location, skin cancers are more rapidly diagnosed and more easily treated than other types of cancer. Be that as it may, approximately 10,000 Americans a year die from skin cancer, and the cost of treating skin cancer in the United States (both melanoma and non-melanoma skin cancer) is estimated to be in excess of $2.9 billion a year. In addition to causing skin cancer, UV radiation is also immune suppressive. In fact, data from studies with both experimental animals and biopsy proven skin cancer patients suggest that there is an association between the immune suppressive effects of UV radiation and its carcinogenic potential. Recent studies in my laboratory have focused on understanding the initial molecular events that induce immune suppression. We made two novel observations: first UV-induced keratinocyte-derived platelet activating factor plays a role in the induction of immune suppression. Second, cis-urocanic acid, a skin-derived immunosuppressive compound mediates immune suppression by binding to serotonin receptors on target cells. Recent findings suggest that blocking the binding of these compounds to their receptors not only inhibits UV-induced immune suppression but it also interferes with skin cancer induction.

  2. Photocatalytic Hydrogen Production by Direct Sunlight: A Laboratory Experiment

    Science.gov (United States)

    Koca, Atif; Sahin, Musa

    2003-11-01

    The demand for hydrogen will increase within the next decades as a result of the necessity to produce clean and environmentally and economically accepted fuels from natural and renewable energy resources. In principle, hydrogen has the potential to play an important role in future energy systems because of the diversity of its applications, the variety of ways in which it can be stored, its general environmental advantages, and especially because of the possibility of producing hydrogen by splitting water using photocatalysts and solar energy. Methods and techniques of photocatalytic reactions are covered in some detail in many undergraduate chemistry programs. However, many times in instructional settings, little attention is given to how it is used for the production of hydrogen. In the present investigation a photocatalytic hydrogen production experiment suitable for use in undergraduate chemistry laboratories is described. The experiment can be used to introduce students to the concept of a renewable and sustainable hydrogen energy system of the future, as well as its production techniques, and to demonstrate the use of a CdS/ZnS photocatalyst system for photocatalytic hydrogen production from direct sunlight.

  3. Protection against Japanese encephalitis by inactivated vaccines.

    Science.gov (United States)

    Hoke, C H; Nisalak, A; Sangawhipa, N; Jatanasen, S; Laorakapongse, T; Innis, B L; Kotchasenee, S; Gingrich, J B; Latendresse, J; Fukai, K

    1988-09-01

    Encephalitis caused by Japanese encephalitis virus occurs in annual epidemics throughout Asia, making it the principal cause of epidemic viral encephalitis in the world. No currently available vaccine has demonstrated efficacy in preventing this disease in a controlled trial. We performed a placebo-controlled, blinded, randomized trial in a northern Thai province, with two doses of monovalent (Nakayama strain) or bivalent (Nakayama plus Beijing strains) inactivated, purified Japanese encephalitis vaccine made from whole virus derived from mouse brain. We examined the effect of these vaccines on the incidence and severity of Japanese encephalitis and dengue hemorrhagic fever, a disease caused by a closely related flavivirus. Between November 1984 and March 1985, 65,224 children received two doses of monovalent Japanese encephalitis vaccine (n = 21,628), bivalent Japanese encephalitis vaccine (n = 22,080), or tetanus toxoid placebo (n = 21,516), with only minor side effects. The cumulative attack rate for encephalitis due to Japanese encephalitis virus was 51 per 100,000 in the placebo group and 5 per 100,000 in each vaccine group. The efficacy in both vaccine groups combined was 91 percent (95 percent confidence interval, 70 to 97 percent). Attack rates for dengue hemorrhagic fever declined, but not significantly. The severity of cases of dengue was also reduced. We conclude that two doses of inactivated Japanese encephalitis vaccine, either monovalent or bivalent, protect against encephalitis due to Japanese encephalitis virus and may have a limited beneficial effect on the severity of dengue hemorrhagic fever.

  4. FEF inactivation with improved optogenetic methods.

    Science.gov (United States)

    Acker, Leah; Pino, Erica N; Boyden, Edward S; Desimone, Robert

    2016-11-15

    Optogenetic methods have been highly effective for suppressing neural activity and modulating behavior in rodents, but effects have been much smaller in primates, which have much larger brains. Here, we present a suite of technologies to use optogenetics effectively in primates and apply these tools to a classic question in oculomotor control. First, we measured light absorption and heat propagation in vivo, optimized the conditions for using the red-light-shifted halorhodopsin Jaws in primates, and developed a large-volume illuminator to maximize light delivery with minimal heating and tissue displacement. Together, these advances allowed for nearly universal neuronal inactivation across more than 10 mm(3) of the cortex. Using these tools, we demonstrated large behavioral changes (i.e., up to several fold increases in error rate) with relatively low light power densities (≤100 mW/mm(2)) in the frontal eye field (FEF). Pharmacological inactivation studies have shown that the FEF is critical for executing saccades to remembered locations. FEF neurons increase their firing rate during the three epochs of the memory-guided saccade task: visual stimulus presentation, the delay interval, and motor preparation. It is unclear from earlier work, however, whether FEF activity during each epoch is necessary for memory-guided saccade execution. By harnessing the temporal specificity of optogenetics, we found that FEF contributes to memory-guided eye movements during every epoch of the memory-guided saccade task (the visual, delay, and motor periods).

  5. Episodic ataxia type 1 mutations affect fast inactivation of K+ channels by a reduction in either subunit surface expression or affinity for inactivation domain.

    Science.gov (United States)

    Imbrici, Paola; D'Adamo, Maria Cristina; Grottesi, Alessandro; Biscarini, Andrea; Pessia, Mauro

    2011-06-01

    Episodic ataxia type 1 (EA1) is an autosomal dominant disorder characterized by continuous myokymia and episodic attacks of ataxia. Mutations in the gene KCNA1 that encodes the voltage-gated potassium channel Kv1.1 are responsible for EA1. In several brain areas, Kv1.1 coassembles with Kv1.4, which confers N-type inactivating properties to heteromeric channels. It is therefore likely that the rate of inactivation will be determined by the number of Kv1.4 inactivation particles, as set by the precise subunit stoichiometry. We propose that EA1 mutations affect the rate of N-type inactivation either by reduced subunit surface expression, giving rise to a reduced number of Kv1.1 subunits in heterotetramer Kv1.1-Kv1.4 channels, or by reduced affinity for the Kv1.4 inactivation domain. To test this hypothesis, quantified amounts of mRNA for Kv1.4 or Kv1.1 containing selected EA1 mutations either in the inner vestibule of Kv1.1 on S6 or in the transmembrane regions were injected into Xenopus laevis oocytes and the relative rates of inactivation and stoichiometry were determined. The S6 mutations, V404I and V408A, which had normal surface expression, reduced the rate of inactivation by a decreased affinity for the inactivation domain while the mutations I177N in S1 and E325D in S5, which had reduced subunit surface expression, increased the rate of N-type inactivation due to a stoichiometric increase in the number of Kv1.4 subunits.

  6. The Effect of Sunlight in Parenchyma Pith Cells Diameter of Manihot esculenta

    Science.gov (United States)

    Susanti, D.; Aziz, D. N.; Astuti, W.; Nuraeni, E.

    2017-03-01

    Sunlight is one of the factors that effect on the grow of a plant. Manihot esculenta is one of the plants that easily found in Indonesia because its role as staple food. The aim of this research is to know the correlation between sunlight the grow of parenchyma pith cells diameter of Manihot esculenta. Independent variable in this research is sunlight, and dependent variable is the parenchyma pith cells diameter of Manihot esculenta. Data was collected is in qualitative and quantitative form. Qualitative data gotten gained by morphology observation. The parenchyma pith cells of Manihot esculenta that is affected by sunlight in 1310 x 10 Lux, morphologically has hexagon, cell walls thick, solid state, and regular composition. Meanwhile, the parenchyma pith cells that has less sunlight (363 x 10 Lux) has a hexagon shape, thin cell walls thin, soft state, and irregular composition. Qualitative data suported by quantitative data. The size of parenchyma pith cells diameter that is affected by sunlight in 1310 x 10 Lux 96,4 µm. While, the stem parenchyma pith cells diameter empulur that has less sunlight (363 x 10 Lux) is 129,8 µm.

  7. Formation of DNA strand breaks in peripheral lymphocytes of rats after exposure to natural sunlight.

    Science.gov (United States)

    Rodrigues-Junior, Dorival Mendes; Melo, Ana Amélia de Carvalho; da Silva, Benedito Borges; Lopes-Costa, Pedro Vitor

    2012-04-01

    This paper aims to evaluate the genotoxicity in peripheral blood lymphocytes of rats after exposure to sunlight at different time points of day in a tropical region of Brazil (5 degrees S, 42 degrees W). Thirty Wistar-Hannover rats, three months old, were randomly divided into three groups of 10 animals each: Group I [control, without exposure to ultraviolet (UV) radiation], Group II (exposed to sunlight during 08:00 a.m. to 10:00 a.m.), and Group III (exposed to sunlight during 10:00 a.m. to 12:00 a.m.). After a week of exposure, peripheral blood samples were taken from the tail of these animals to prepare smears on two slides per animal. In 24 h after exposure to sunlight in Group III, a new collection was obtained to observe the repair activity. The alkaline comet assay was used in this study to evaluate the genotoxic activity of sunlight (P exposure to sunlight in Group III showed genotoxic action in comparison to the other groups (P sunlight (UVA-B) in lymphocytes of mammals from 10:00 a.m. to 12:00 a.m., due to a higher intensity of UV in this tropical region.

  8. Vitamin D and Sunlight Exposure in Newly-Diagnosed Parkinson's Disease.

    Science.gov (United States)

    Wang, Juan; Yang, Deyu; Yu, Yu; Shao, Gaohai; Wang, Qunbo

    2016-03-04

    Circulating vitamin D has previously been found to be lower in patients with Parkinson's disease (PD), while the effects of sunlight exposure have not yet been fully investigated. Therefore, we evaluated the associations between serum vitamin D, vitamin D intake, sunlight exposure, and newly-diagnosed PD patients in a Chinese population. This case-control study measured serum 25-hydroxyvitamin D (25(OH)D) levels and sunlight exposure in 201 patients with newly-diagnosed PD and 199 controls without neurodegenerative diseases. Data on vitamin D intake and sunlight exposure were obtained using a self-report questionnaire. Multivariable logistic regressions were employed to evaluate the associations between serum 25(OH)D levels, sunlight exposure, and PD. Adjustments were made for sex, age, smoking, alcohol use, education, BMI, and vitamin D intake. There were significantly lower levels of serum 25(OH)D (20.6 ± 6.5 ng/mL), daily vitamin D intake (8.3 ± 3.7 g/day), and sunlight exposure (9.7 ± 4.1 h/week) in patients with PD compared to healthy controls (p sunlight exposure were 1 (reference), 0.809 (0.454, 1.443), 0.623 (0.345, 1.124) and 0.533 (0.294, 0.966), respectively. A significant positive correlation between serum 25(OH)D and sunlight exposure was found, but serum 25(OH)D was not correlated with daily vitamin D intake. This study indicates that lower levels of serum 25(OH)D and sunlight exposure are significantly associated with an increased risk for PD.

  9. Vitamin D and Sunlight Exposure in Newly-Diagnosed Parkinson’s Disease

    Science.gov (United States)

    Wang, Juan; Yang, Deyu; Yu, Yu; Shao, Gaohai; Wang, Qunbo

    2016-01-01

    Circulating vitamin D has previously been found to be lower in patients with Parkinson’s disease (PD), while the effects of sunlight exposure have not yet been fully investigated. Therefore, we evaluated the associations between serum vitamin D, vitamin D intake, sunlight exposure, and newly-diagnosed PD patients in a Chinese population. This case-control study measured serum 25-hydroxyvitamin D (25(OH)D) levels and sunlight exposure in 201 patients with newly-diagnosed PD and 199 controls without neurodegenerative diseases. Data on vitamin D intake and sunlight exposure were obtained using a self-report questionnaire. Multivariable logistic regressions were employed to evaluate the associations between serum 25(OH)D levels, sunlight exposure, and PD. Adjustments were made for sex, age, smoking, alcohol use, education, BMI, and vitamin D intake. There were significantly lower levels of serum 25(OH)D (20.6 ± 6.5 ng/mL), daily vitamin D intake (8.3 ± 3.7 g/day), and sunlight exposure (9.7 ± 4.1 h/week) in patients with PD compared to healthy controls (p sunlight exposure were 1 (reference), 0.809 (0.454, 1.443), 0.623 (0.345, 1.124) and 0.533 (0.294, 0.966), respectively. A significant positive correlation between serum 25(OH)D and sunlight exposure was found, but serum 25(OH)D was not correlated with daily vitamin D intake. This study indicates that lower levels of serum 25(OH)D and sunlight exposure are significantly associated with an increased risk for PD. PMID:26959053

  10. Resistance of bovine spongiform encephalopathy (BSE prions to inactivation.

    Directory of Open Access Journals (Sweden)

    Kurt Giles

    2008-11-01

    Full Text Available Distinct prion strains often exhibit different incubation periods and patterns of neuropathological lesions. Strain characteristics are generally retained upon intraspecies transmission, but may change on transmission to another species. We investigated the inactivation of two related prions strains: BSE prions from cattle and mouse-passaged BSE prions, termed 301V. Inactivation was manipulated by exposure to sodium dodecyl sulfate (SDS, variations in pH, and different temperatures. Infectivity was measured using transgenic mouse lines that are highly susceptible to either BSE or 301V prions. Bioassays demonstrated that BSE prions are up to 1,000-fold more resistant to inactivation than 301V prions while Western immunoblotting showed that short acidic SDS treatments reduced protease-resistant PrP(Sc from BSE prions and 301V prions at similar rates. Our findings argue that despite being derived from BSE prions, mouse 301V prions are not necessarily a reliable model for cattle BSE prions. Extending these comparisons to human sporadic Creutzfeldt-Jakob disease and hamster Sc237 prions, we found that BSE prions were 10- and 10(6-fold more resistant to inactivation, respectively. Our studies contend that any prion inactivation procedures must be validated by bioassay against the prion strain for which they are intended to be used.

  11. Resistance of bovine spongiform encephalopathy (BSE) prions to inactivation.

    Science.gov (United States)

    Giles, Kurt; Glidden, David V; Beckwith, Robyn; Seoanes, Rose; Peretz, David; DeArmond, Stephen J; Prusiner, Stanley B

    2008-11-01

    Distinct prion strains often exhibit different incubation periods and patterns of neuropathological lesions. Strain characteristics are generally retained upon intraspecies transmission, but may change on transmission to another species. We investigated the inactivation of two related prions strains: BSE prions from cattle and mouse-passaged BSE prions, termed 301V. Inactivation was manipulated by exposure to sodium dodecyl sulfate (SDS), variations in pH, and different temperatures. Infectivity was measured using transgenic mouse lines that are highly susceptible to either BSE or 301V prions. Bioassays demonstrated that BSE prions are up to 1,000-fold more resistant to inactivation than 301V prions while Western immunoblotting showed that short acidic SDS treatments reduced protease-resistant PrP(Sc) from BSE prions and 301V prions at similar rates. Our findings argue that despite being derived from BSE prions, mouse 301V prions are not necessarily a reliable model for cattle BSE prions. Extending these comparisons to human sporadic Creutzfeldt-Jakob disease and hamster Sc237 prions, we found that BSE prions were 10- and 10(6)-fold more resistant to inactivation, respectively. Our studies contend that any prion inactivation procedures must be validated by bioassay against the prion strain for which they are intended to be used.

  12. Photocatalytic degradation of methylene blue and inactivation of pathogenic bacteria using silver nanoparticles modified titanium dioxide thin films.

    Science.gov (United States)

    Ibrahim, Haytham M M

    2015-07-01

    Titanium dioxide (TiO2) is a well-studied photocatalyst that is known to break down organic molecules upon ultraviolet irradiation. TiO2 thin films were fabricated on glass substrates using the doctor-blade procedure, the film surface was modified with silver nanoparticles to increase its visible light response. The Ag-TiO2 films were characterized by transmission electron microscopy, scanning electron microscopy equipped with energy dispersive spectrometry and X-ray diffraction. The photocatalytic degradation of methylene blue (MB) and inactivation of Gram-negative bacteria Escherichia coli and Gram-positive bacteria Staphylococcus aureus were studied. The modified films presented enhanced photocatalytic efficiency and can decompose MB solution two-times faster than the unmodified TiO2 films, under illumination of sunlight. A nominal degradation (15 %) was observed in control MB under sunlight. The degradation efficiency of Ag-TiO2 films slightly decreased after five consecutive experiments. Ag-TiO2 films revealed very effective bactericidal activity against both E. coli and S. aureus. The photocatalytic inactivation toward E. coli and S. aureus showed a similar trend with much higher effectiveness toward E. coli under the same experimental conditions. The inactivation efficiency was maximized and reached 95 % for S. aureus and 97 % for E. coli, after 180 min incubation. These results demonstrate the potential of application of Ag-TiO2 photocatalysis as a method for treatment of diluted waste waters in textile industries.

  13. Combined ozone and ultraviolet inactivation of Escherichia coli.

    Science.gov (United States)

    Magbanua, Benjamin S; Savant, Gaurav; Truax, Dennis D

    2006-01-01

    The kinetics of Escherichia coli inactivation using ozone and ultraviolet (UV) radiation, separately and simultaneously, was evaluated at 25 degrees C in buffered (pH 6.0, 7.0 and 8.0), demand-free media. While ozone was found to be a stronger disinfectant than UV radiation, using both simultaneously was more effective than using them individually. Inactivation kinetics was pseudo first-order for the three treatment processes, while the disinfection rate was a linear function of the disinfectant dose. The synergism observed in microbial inactivation when the disinfectant processes were combined was illustrated by estimates of kinetic model parameters. This synergy was attributed to the generation of hydroxyl radicals via ozone photolysis. Subsequently, dosage calculations, as based on disinfectant level and exposure time, indicated that the simultaneous use of UV and ozone could substantially reduce their individual doses.

  14. [Progress in research of association between myopia and sunlight exposure in children].

    Science.gov (United States)

    Zhai, L L; Wu, X Y; Xu, S J; Tao, F B

    2016-11-10

    Myopia has become a major health problem on global scale due to its increasing high prevalence in the past few decades and gradual younger onset age. Accumulated epidemiological surveys have shown that decreased time of exposure to sunlight would be an inducement for the development of myopia. Increasing time spent outdoors and exposure to sunlight might be the most cost-effective and effective measure for children to prevent myopia. This paper summarizes the progress in research of the association between sunlight exposure and myopia in children and its mechanisms to provide new clues for the research on myopia prevention and control.

  15. MECHANISM OF FUSARIUM TRICINCTUM (CORDA SACC. SPORE INACTIVATION BY CHLORINE DIOXIDE

    Directory of Open Access Journals (Sweden)

    Zhao Chen

    2015-06-01

    Full Text Available The mechanism of Fusarium tricinctum (Corda Sacc. spore inactivation by chlorine dioxide (ClO2 was investigated. During F. tricinctum spore inactivation by ClO2, protein, DNA, and metal ion leakage, enzyme activity, and cell ultrastructure were examined. Protein and DNA leakages were not detected, while there were metal ion leakages of K+, Ca2+, and Mg2+, which were well-correlated with the inactivation rate. The enzyme activities of glucose-6-phosphate dehydrogenase, citrate synthase, and phosphofructokinase were inhibited and were also well-correlated with the inactivation rate. Electron micrographs showed the ultrastructural modifications of spores and demonstrated that spores were heavily distorted and collapsed from their regular structure. Spore surface damage and disruption in inner components was also severe. The metal ion leakage, the inhibition of enzyme activities, and the damage of spore structure were significant in F. tricinctum spore inactivation by ClO2.

  16. Solar disinfection of drinking water (SODIS): an investigation of the effect of UV-A dose on inactivation efficiency.

    Science.gov (United States)

    Ubomba-Jaswa, Eunice; Navntoft, Christian; Polo-López, M Inmaculada; Fernandez-Ibáñez, Pilar; McGuigan, Kevin G

    2009-05-01

    The effect of solar UV-A irradiance and solar UV-A dose on the inactivation of Escherichia coli K-12 using solar disinfection (SODIS) was studied. E. coli K-12 was seeded in natural well-water contained in borosilicate glass tubes and exposed to sunlight at different irradiances and doses of solar UV radiation. In addition, E. coli K-12 was also inoculated into poly(ethylene) terephthalate (PET) bottles and in a continuous flow system (10 L min(-1)) to determine the effect of an interrupted and uninterrupted solar dose on inactivation. Results showed that inactivation from approximately 10(6) CFU mL(-1) to below the detection level (4 CFU/mL) for E. coli K-12, is a function of the total uninterrupted dose delivered to the bacteria and that the minimum dose should be >108 kJ m(-2) for the conditions described (spectral range of 0.295-0.385 microm). For complete inactivation to below the limit of detection, this dose needs to be received regardless of the incident solar UV intensity and needs to be delivered in a continuous and uninterrupted manner. This is illustrated by a continuous flow system in which bacteria were not fully inactivated (residual viable concentration approximately 10(2) CFU/mL) even after 5 h of exposure to strong sunlight and a cumulative dose of >108 kJ m(-2). This has serious implications for attempts to scale-up solar disinfection through the use of re-circulatory continuous flow reactors.

  17. Porous graphitic carbon nitride synthesized via direct polymerization of urea for efficient sunlight-driven photocatalytic hydrogen production

    Science.gov (United States)

    Zhang, Yuewei; Liu, Jinghai; Wu, Guan; Chen, Wei

    2012-08-01

    Energy captured directly from sunlight provides an attractive approach towards fulfilling the need for green energy resources on the terawatt scale with minimal environmental impact. Collecting and storing solar energy into fuel through photocatalyzed water splitting to generate hydrogen in a cost-effective way is desirable. To achieve this goal, low cost and environmentally benign urea was used to synthesize the metal-free photocatalyst graphitic carbon nitride (g-C3N4). A porous structure is achieved via one-step polymerization of the single precursor. The porous structure with increased BET surface area and pore volume shows a much higher hydrogen production rate under simulated sunlight irradiation than thiourea-derived and dicyanamide-derived g-C3N4. The presence of an oxygen atom is presumed to play a key role in adjusting the textural properties. Further improvement of the photocatalytic function can be expected with after-treatment due to its rich chemistry in functionalization.Energy captured directly from sunlight provides an attractive approach towards fulfilling the need for green energy resources on the terawatt scale with minimal environmental impact. Collecting and storing solar energy into fuel through photocatalyzed water splitting to generate hydrogen in a cost-effective way is desirable. To achieve this goal, low cost and environmentally benign urea was used to synthesize the metal-free photocatalyst graphitic carbon nitride (g-C3N4). A porous structure is achieved via one-step polymerization of the single precursor. The porous structure with increased BET surface area and pore volume shows a much higher hydrogen production rate under simulated sunlight irradiation than thiourea-derived and dicyanamide-derived g-C3N4. The presence of an oxygen atom is presumed to play a key role in adjusting the textural properties. Further improvement of the photocatalytic function can be expected with after-treatment due to its rich chemistry in

  18. Seasonal effects on pterygium surgery outcome: implications for the role of sunlight exposure.

    Science.gov (United States)

    Sul, Sabahattin; Korkmaz, Şafak; Novruzlu, Şahin

    2014-05-01

    The aim of this study was to compare the results of pterygium surgery in patients when performed in the summer with the results of surgery performed in the winter. This retrospective study enrolled 55 eyes of 53 patients with primary pterygia who underwent a surgery between December 2011 and January 2012 (winter group, 32 eyes) or between June and July 2012 (summer group, 23 eyes). All the patients were followed up for at least 1 year. Pterygium recurrence, ocular discomfort, persistent conjunctival inflammation, and graft complications were evaluated postoperatively. There was no significant difference between the groups in terms of age or gender. All the patients were farmers in rural areas. The overall pterygium recurrence rate was 14.5% (8 of 55 eyes). The recurrence rate in the summer group was significantly higher than in the winter group (26.1% vs. 6.2%, P = 0.048). Persistent conjunctival inflammation was also significantly higher in the summer group than in the winter group (30.4% vs. 6.2%, P = 0.022). Pterygium recurrence was significantly higher in eyes with persistent conjunctival inflammation than in eyes without inflammation (66.6% vs. 4.3%, P exposure to sunlight during the summer.

  19. Degradation of the pesticide carbofuran on clay and soil surfaces upon sunlight exposure.

    Science.gov (United States)

    Mountacer, H; Atifi, A; Wong-Wah-Chung, P; Sarakha, M

    2014-03-01

    In the present study, the photolysis of carbofuran has been undertaken under sunlight conditions and at the surface of model supports such as clay films and different soils collected from two different sites in Morocco (Tirs and Dahs). In all conditions, an efficient degradation occurred owing to direct light absorption and also to photoinduced processes involving either clays or natural organic matter moities. On kaolin films, the photodegradation kinetics appears to follow a first-order process that clearly depends on the film thickness. The diffusion of carbofuran from the lower part to the illuminated surface was found to be negligible when compared to the photolysis process within the range of 20-70 μm. Thus, the photolysis rate constant at the surface of the solid support, k (0), was evaluated to be 7.0 × 10(-3) min(-1). Under these experimental conditions, the quantum yield was found equal to 2.1 × 10(-4). On soil surfaces, the disappearance rate constant was mainly attributed to photoinduced processes arising from natural organic matter. From the analytical point of view, the products were formed through (1) hydroxylation on the aromatic ring, (2) homolytic scission of the carbamate C-O bond leading to radical species formation, and (3) photohydrolysis of the carbamate C-O bond.

  20. Sunlight-Exposed Biofilm Microbial Communities Are Naturally Resistant to Chernobyl Ionizing-Radiation Levels

    Science.gov (United States)

    Ragon, Marie; Restoux, Gwendal; Moreira, David; Møller, Anders Pape; López-García, Purificación

    2011-01-01

    Background The Chernobyl accident represents a long-term experiment on the effects of exposure to ionizing radiation at the ecosystem level. Though studies of these effects on plants and animals are abundant, the study of how Chernobyl radiation levels affect prokaryotic and eukaryotic microbial communities is practically non-existent, except for a few reports on human pathogens or soil microorganisms. Environments enduring extreme desiccation and UV radiation, such as sunlight exposed biofilms could in principle select for organisms highly resistant to ionizing radiation as well. Methodology/Principal Findings To test this hypothesis, we explored the diversity of microorganisms belonging to the three domains of life by cultivation-independent approaches in biofilms developing on concrete walls or pillars in the Chernobyl area exposed to different levels of radiation, and we compared them with a similar biofilm from a non-irradiated site in Northern Ireland. Actinobacteria, Alphaproteobacteria, Bacteroidetes, Acidobacteria and Deinococcales were the most consistently detected bacterial groups, whereas green algae (Chlorophyta) and ascomycete fungi (Ascomycota) dominated within the eukaryotes. Close relatives to the most radio-resistant organisms known, including Rubrobacter species, Deinococcales and melanized ascomycete fungi were always detected. The diversity of bacteria and eukaryotes found in the most highly irradiated samples was comparable to that of less irradiated Chernobyl sites and Northern Ireland. However, the study of mutation frequencies in non-coding ITS regions versus SSU rRNA genes in members of a same actinobacterial operational taxonomic unit (OTU) present in Chernobyl samples and Northern Ireland showed a positive correlation between increased radiation and mutation rates. Conclusions/Significance Our results show that biofilm microbial communities in the most irradiated samples are comparable to non-irradiated samples in terms of general

  1. Sunlight-exposed biofilm microbial communities are naturally resistant to chernobyl ionizing-radiation levels.

    Directory of Open Access Journals (Sweden)

    Marie Ragon

    Full Text Available BACKGROUND: The Chernobyl accident represents a long-term experiment on the effects of exposure to ionizing radiation at the ecosystem level. Though studies of these effects on plants and animals are abundant, the study of how Chernobyl radiation levels affect prokaryotic and eukaryotic microbial communities is practically non-existent, except for a few reports on human pathogens or soil microorganisms. Environments enduring extreme desiccation and UV radiation, such as sunlight exposed biofilms could in principle select for organisms highly resistant to ionizing radiation as well. METHODOLOGY/PRINCIPAL FINDINGS: To test this hypothesis, we explored the diversity of microorganisms belonging to the three domains of life by cultivation-independent approaches in biofilms developing on concrete walls or pillars in the Chernobyl area exposed to different levels of radiation, and we compared them with a similar biofilm from a non-irradiated site in Northern Ireland. Actinobacteria, Alphaproteobacteria, Bacteroidetes, Acidobacteria and Deinococcales were the most consistently detected bacterial groups, whereas green algae (Chlorophyta and ascomycete fungi (Ascomycota dominated within the eukaryotes. Close relatives to the most radio-resistant organisms known, including Rubrobacter species, Deinococcales and melanized ascomycete fungi were always detected. The diversity of bacteria and eukaryotes found in the most highly irradiated samples was comparable to that of less irradiated Chernobyl sites and Northern Ireland. However, the study of mutation frequencies in non-coding ITS regions versus SSU rRNA genes in members of a same actinobacterial operational taxonomic unit (OTU present in Chernobyl samples and Northern Ireland showed a positive correlation between increased radiation and mutation rates. CONCLUSIONS/SIGNIFICANCE: Our results show that biofilm microbial communities in the most irradiated samples are comparable to non-irradiated samples in

  2. Slow motion picture of protein inactivation during single-droplet drying: a study of inactivation kinetics of L-glutamate dehydrogenase dried in an acoustic levitator.

    Science.gov (United States)

    Lorenzen, Elke; Lee, Geoffrey

    2012-06-01

    A novel technique is presented to allow measurement of the kinetics of protein inactivation during drying of an acoustically levitated single droplet. Droplets/particles are removed from the acoustic field after various times during drying, and the state of the protein within them is analyzed. The influence of drying air temperature, relative humidity, buffer concentration, and the presence of a substrate on the inactivation of glutamate dehydrogenase is described. The kinetics of inactivation showed three distinct phases. The first phase of constant drying rate demonstrated little protein inactivation in the solution droplet. After the critical point of drying, a second phase was distinguishable when the surface temperature has risen sharply, but there is still only little inactivation of the protein in the solid particle. An onset point of rapid inactivation of the protein marked the start of the third phase that proceeded with approximately first-order rate kinetics. In the case of L-glutamate dehydrogenase, the evidence suggests that the residual moisture content of the solid and not the temperature alone determines the point of onset of protein inactivation.

  3. Bacterial inactivation of the anticancer drug doxorubicin.

    Science.gov (United States)

    Westman, Erin L; Canova, Marc J; Radhi, Inas J; Koteva, Kalinka; Kireeva, Inga; Waglechner, Nicholas; Wright, Gerard D

    2012-10-26

    Microbes are exposed to compounds produced by members of their ecological niche, including molecules with antibiotic or antineoplastic activities. As a result, even bacteria that do not produce such compounds can harbor the genetic machinery to inactivate or degrade these molecules. Here, we investigated environmental actinomycetes for their ability to inactivate doxorubicin, an aminoglycosylated anthracycline anticancer drug. One strain, Streptomyces WAC04685, inactivates doxorubicin via a deglycosylation mechanism. Activity-based purification of the enzymes responsible for drug inactivation identified the NADH dehydrogenase component of respiratory electron transport complex I, which was confirmed by gene inactivation studies. A mechanism where reduction of the quinone ring of the anthracycline by NADH dehydrogenase leads to deglycosylation is proposed. This work adds anticancer drug inactivation to the enzymatic inactivation portfolio of actinomycetes and offers possibilities for novel applications in drug detoxification. Copyright © 2012 Elsevier Ltd. All rights reserved.

  4. Effect of sunlight on the survival of pathogenic E. coli in freshwater and sea water

    DEFF Research Database (Denmark)

    Surendraraj, Alagarsamy; Farvin, Sabeena; Thampuran, N.

    2011-01-01

    An enteropathogenic group of E. coli are the emerging category of pathogen of public health significance. Several recent pathogenic E. coli outbreaks are associated with drinking water. Aquaculture, the fast emerging food production sector also poses a pathogenic EHEC outbreak risk, as it regularly......) were studied for their survival under sunlight and darkness in fresh water and seawater. Effect of direct sunlight on the viable but nonculturable (VBNC) state of cultures was also studied. The results of the study indicated a distinct pattern between freshwater system and seawater system. Pathogenic E....... coli from different sources showed significantly higher level of destruction under direct sunlight than in complete darkness. A reduction of 1.1 to 5.7 log CFU was seen in fresh water after 90 to 105 min under direct sunlight and only 0.2 to 2 log reduction was observed in complete darkness in 5 to 96...

  5. Application of photoremovable protecting group for controlled release of plant growth regulators by sunlight.

    Science.gov (United States)

    Atta, Sanghamitra; Ikbal, Mohammed; Kumar, Ashutosh; Pradeep Singh, N D

    2012-06-01

    We report a novel technique for controlled release of plant growth regulators (PGRs) by sunlight using photoremovable protecting group (PRPG) as a delivery device. In the present work, carboxyl-containing PGRs of the auxin group [indoleacetic acid (IAA) and naphthoxyacetic acid (NOAA)] were chemically caged using PRPGs of coumarin derivatives. Photophysical studies showed that caged PGRs exhibited good fluorescence properties. Irradiation of caged PGRs by sunlight in both aqueous ethanol and soil media resulted in controlled release of PGRs. The results of the bioactivity experiments indicated that caged PGRs showed better enhancement in the root and shoot length growth of Cicer arietinum compared to PGRs after 10days of sunlight exposure. Our results indicated that use of PRPG as a delivery device for controlled release of PGRs by sunlight in soil holds great interest for field application since it can overcome the rapid loss of PGRs in environmental conditions.

  6. Sunlight affects aggregation and deposition of graphene oxide in the aquatic environment.

    Science.gov (United States)

    In this study, we investigate the role of simulated sunlight on the physicochemical properties, aggregation, and deposition of graphene oxide (GO) in aquatic environments. Results show that light exposure under varied environmental conditions significantly impacts the physicochem...

  7. Toxicological impact of cadmium-based quantum dots towards aquatic biota: Effect of natural sunlight exposure

    Energy Technology Data Exchange (ETDEWEB)

    Silva, B.F. [Department of Biology, Faculty of Science, University of Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal); CIIMAR, Interdisciplinary Centre of Marine and Environmental Research, Rua dos Bragas, 289, 4050-123 Porto (Portugal); Andreani, T. [Centro de Investigação em Química da Universidade do Porto, Rua do Campo Alegre, 687, 4169-007 Porto (Portugal); Department of Chemistry and Biochemistry, Faculty of Science, University of Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal); CITAB − Centre for Research and Technology of Agro-Environmental and Biological Sciences, University of Trás-os-Montes e Alto Douro, UTAD, Vila Real (Portugal); Gavina, A., E-mail: anacsgavina@gmail.com [Department of Biology, Faculty of Science, University of Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal); CIIMAR, Interdisciplinary Centre of Marine and Environmental Research, Rua dos Bragas, 289, 4050-123 Porto (Portugal); Vieira, M.N. [Department of Biology, Faculty of Science, University of Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal); CIIMAR, Interdisciplinary Centre of Marine and Environmental Research, Rua dos Bragas, 289, 4050-123 Porto (Portugal); Pereira, C.M. [Centro de Investigação em Química da Universidade do Porto, Rua do Campo Alegre, 687, 4169-007 Porto (Portugal); Department of Chemistry and Biochemistry, Faculty of Science, University of Porto, Rua do Campo Alegre, 4169-007 Porto (Portugal); Rocha-Santos, T. [Department of Chemistry and Centre for Environmental and Marine Studies (CESAM), University of Aveiro, Campus de Santiago, 3810-193 Aveiro (Portugal); and others

    2016-07-15

    Highlights: • Under sunlight exposure, all QDs form particle aggregates in the different media. • CdSeS/ZnS QDs showed lower toxic effects to V. fischeri before sunlight exposure. • Sunlight exposure decreased the toxicity of CdS 480 in all organisms. • Sunlight exposure increased the toxicity of CdS 380 QDs for D. magna. • Shell of QDs seemed to make them less harmful to aquatic organisms. - Abstract: Cadmium-based quantum dots (QDs) are increasingly applied in existent and emerging technologies, especially in biological applications due to their exceptional photophysical and functionalization properties. However, they are very toxic compounds due to the high reactive and toxic cadmium core. The present study aimed to determine the toxicity of three different QDs (CdS 380, CdS 480 and CdSeS/ZnS) before and after the exposure of suspensions to sunlight, in order to assess the effect of environmentally relevant irradiation levels in their toxicity, which will act after their release to the environment. Therefore, a battery of ecotoxicological tests was performed with organisms that cover different functional and trophic levels, such as Vibrio fischeri, Raphidocelis subcapitata, Chlorella vulgaris and Daphnia magna. The results showed that core-shell type QDs showed lower toxic effects to V. fischeri in comparison to core type QDs before sunlight exposure. However, after sunlight exposure, there was a decrease of CdS 380 and CdS 480 QD toxicity to bacterium. Also, after sunlight exposure, an effective decrease of CdSeS/ZnS and CdS 480 toxicity for D. magna and R. subcapitata, and an evident increase in CdS 380 QD toxicity, at least for D. magna, were observed. The results of this study suggest that sunlight exposure has an effect in the aggregation and precipitation reactions of larger QDs, causing the degradation of functional groups and formation of larger bulks which may be less prone to photo-oxidation due to their diminished surface area. The same

  8. Inactivated Schmallenberg virus prototype vaccines.

    Science.gov (United States)

    Wernike, Kerstin; Nikolin, Veljko M; Hechinger, Silke; Hoffmann, Bernd; Beer, Martin

    2013-08-02

    Schmallenberg virus (SBV), a novel Orthobunyavirus, is an insect-transmitted pathogen and was first described in Europe in 2011. SBV causes a mild transient disease in adult ruminants, but severe foetal malformation and stillbirth were observed after an infection of naive cows and ewes, which is responsible for considerable economic losses. The virus is now widely distributed in Europe, and no vaccines were available to stop transmission and spread. In the present study, 16 calves and 25 sheep, the major target species of SBV infection, were vaccinated twice 3 weeks apart with one of 5 newly developed, inactivated vaccine candidates. Six calves and 5 sheep were kept as unvaccinated controls. All animals were clinically, serologically and virologically examined before and after challenge infection. Immunisation with the inactivated preparations resulted in a neutralising antibody response three weeks after the second vaccination without any side effects. The number of animals that seroconverted in each group and the strength of the antibody response were dependent on the cell line used for virus growth and on the viral titre prior to inactivation. Four vaccine prototypes completely prevented RNAemia after challenge infection, a fifth candidate reduced RNAemia considerably. Although further evaluations e.g. regarding duration of immunity will be necessary, the newly developed vaccines are promising candidates for the prevention of SBV-infection and could be a valuable tool in SBV control strategies. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. Sunlight regulates the cutaneous production of vitamin D3 by causing its photodegradation

    Energy Technology Data Exchange (ETDEWEB)

    Webb, A.R.; DeCosta, B.R.; Holick, M.F.

    1989-05-01

    Exposure to sunlight initiates the formation of vitamin D3 in skin as the UV B radiation in the solar spectrum causes the photoconversion of 7-dehydrocholesterol to previtamin D3. A heat-induced isomerization then converts previtamin D3 to vitamin D3 over a period of days. A number of irradiation products of vitamin D3 are known to form upon irradiation with high intensity UV radiation, but the effect of subsequent exposures to sunlight on the vitamin D3 formed in skin is not known. To investigate this phenomenon, human skin containing vitamin D3 was exposed to sunlight in Boston. A model system of (/sup 3/H)vitamin D3 in methanol was also used to study the effects of sunlight on vitamin D3 throughout the year. Vitamin D3 proved to be exquisitely sensitive to sunlight, and once formed in the skin, exposure to sunlight resulted in its rapid photodegradation to a variety of photoproducts, including 5,6-transvitamin D3, suprasterol I, and suprasterol II.

  10. Photolysis of Antibiotics under Simulated Sunlight Irradiation: Identification of Photoproducts by High-Resolution Mass Spectrometry.

    Science.gov (United States)

    Baena-Nogueras, Rosa María; González-Mazo, Eduardo; Lara-Martín, Pablo A

    2017-02-28

    There is growing concern regarding the widespread use of antibiotics and their presence in the aqueous environment. Their removal in the water column is mediated by different types of degradation processes for which the mechanisms are still unclear. This research is focused on characterizing the photodegradation kinetics and pathways of two largely employed antibiotics families: sulfonamides (9 SDs) and fluoroquinolones (6 FQs). Degradation percentages and rates were measured in pure water exposed to simulated natural sunlight at a constant irradiance value (500 W m(-2)) during all the experiments, and the main photoproducts formed were characterized through accurate mass measurement using ultraperformance liquid chromatography-quadrupole-time-of-flight-mass spectrometry (UPLC-QToF-MS). Over 200 different phototransformation products were identified for SDs and FQs, 66% of them, to the best of our knowledge, have not been described before. Their sequential formation and disappearance over the course of the experiments reveals the existence of several pathways for the degradation of target antibiotics. Occurrence of new photoproducts derived from desulfonation and/or denitrification, as well as hydroxylation of photo-oxidized heterocyclic rings, have been identified during photodegradation of SDs, whereas a new pathway yielding oxidation of the benzene ring after the cleavage of the piperazine ring (e.g., CIP product with m/z 280) is described for FQs.

  11. The influence of short-term exposure to tropical sunlight on boar seminal characteristics

    Science.gov (United States)

    Egbunike, G. N.; Dede, T. I.

    1980-06-01

    The seminal characteristics of 4 Large White boars exposed to direct tropical sunlight 45 min daily for three days were compared to those of their mates that were maintained under shade in the barn. During the period of exposure, both respiratory rate and rectal temperature increased significantly by 276.84 and 5.13% respectively in the exposed over the unexposed boars, thus indicating a high degree of hyperthermia. Although libido, as judged from the reaction time, was unaffected, the ejaculation time appeared to be longer for the stressed than unstressed animals. Gel mass, semen volume and pH appeared to be stable inspite of the treatment, unlike sperm motility and concentration which deteriorated. Also, the dehydrogenase activity of the semen was inferior in the stressed animals. Sperm output per ejaculate dropped drastically only in the week following exposure from 58.22 to 28.42 billion sperm as compared to corresponding values of 54.83 and 47.87 by the unexposed boars. Similarly, the frequency of sperm abnormality was higher in the stressed boars in this period after which the animals appeared to have recovered.

  12. Photocatalytic degradation of phenol by iodine doped tin oxide nanoparticles under UV and sunlight irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Al-Hamdi, Abdullah M.; Sillanpää, Mika [Laboratory of Green Chemistry, Lappeenranta University of Technology, Sammonkatu 12, 50130 Mikkeli (Finland); Dutta, Joydeep, E-mail: dutta@squ.edu.om [Chair in Nanotechnology, Water Research Center, Sultan Qaboos University, P.O. Box 17, 123 Al-Khoudh (Oman)

    2015-01-05

    Highlights: • A sol–gel method used to synthesize tin oxide nanoparticles. • Nanoparticles of tin oxide doped with different iodine concentrations. • Degradation studies carried up with UV–vis, TOC, HPLC and GC instruments. • 1% iodine doped tin dioxide showed maximum photodegradation efficiency. - Abstract: Iodine doped tin oxide (SnO{sub 2}:I) nanoparticles were prepared by sol–gel synthesis and their photocatalytic activities with phenol as a test contaminant were studied. In the presence of the catalysts, phenol degradation under direct sunlight was comparable to what was achieved under laboratory conditions. Photocatalytic oxidation reactions were studied by varying the catalyst loading, light intensity, illumination time, pH of the reactant and phenol concentration. Upon UV irradiation in the presence of SnO{sub 2}:I nanoparticles, phenol degrades very rapidly within 30 min, forming carboxylic acid which turns the solution acidic. Phenol degradation rate with 1% iodine doped SnO{sub 2} nanoparticles is at least an order of magnitude higher compared to the degradation achieved through undoped SnO{sub 2} nanoparticles under similar illumination conditions.

  13. Photocatalytic degradation of five sulfonylurea herbicides in aqueous semiconductor suspensions under natural sunlight.

    Science.gov (United States)

    Fenoll, José; Hellín, Pilar; Flores, Pilar; Martínez, Carmen María; Navarro, Simón

    2012-05-01

    In the present study, the photocatalytic degradation of five sulfonylurea herbicides (chlorsulfuron, flazasulfuron, nicosulfuron, sulfosulfuron and triasulfuron) has been investigated in aqueous suspensions of zinc oxide (ZnO), tungsten (VI) oxide (WO(3)), tin (IV) oxide (SnO(2)) and zinc sulfide (ZnS) at pilot plant scale under natural sunlight. Photocatalytic experiments, especially those involving ZnO photocatalysis, showed that the addition of semiconductors in tandem with the oxidant (Na(2)S(2)O(8)) strongly enhances the degradation rate of the herbicides in comparisons carried out with photolytic tests. The degradation of the herbicides follows a first order kinetics according to the Langmuir-Hinshelwood model. In our conditions, the amount of time required for 50% of the initial pesticide concentration to dissipate (t(½)) ranged from 8 to 27 min (t(30W)=0.3-1.2 min) for sulfosulfuron and chlorsulfuron, respectively in the ZnO/Na(2)S(2)O(8) system. None of the studied herbicides was found after 120 min of illumination (except chlorsulfuron, 0.2 μg L(-1)).

  14. Polydopamine-Coated Porous Substrates as a Platform for Mineralized β-FeOOH Nanorods with Photocatalysis under Sunlight.

    Science.gov (United States)

    Zhang, Chao; Yang, Hao-Cheng; Wan, Ling-Shu; Liang, Hong-Qing; Li, Hanying; Xu, Zhi-Kang

    2015-06-03

    Immobilization of photo-Fenton catalysts on porous materials is crucial to the efficiency and stability for water purification. Here we report polydopamine (PDA)-coated porous substrates as a platform for in situ mineralizing β-FeOOH nanorods with enhanced photocatalytic performance under sunlight. The PDA coating plays multiple roles as an adhesive interface, a medium inducing mineral generation, and an electron transfer layer. The mineralized β-FeOOH nanorods perfectly wrap various porous substrates and are stable on the substrates that have a PDA coating. The immobilized β-FeOOH nanorods have been shown to be efficient for degrading dyes in water via a photo-Fenton reaction. The degradation efficiency reaches approximately 100% in 60 min when the reaction was carried out with H2O2 under visible light, and it remains higher than 90% after five cycles. We demonstrate that the PDA coating promotes electron transfer to reduce the electron-hole recombination rate. As a result, the β-FeOOH nanorods wrapped on the PDA-coated substrates show enhanced photocatalytic performance under direct sunlight in the presence of H2O2. Moreover, this versatile platform using porous materials as the substrate is useful in fabricating β-FeOOH nanorods-based membrane reactor for wastewater treatment.

  15. Comparative effects of ohmic, induction cooker, and electric stove heating on soymilk trypsin inhibitor inactivation.

    Science.gov (United States)

    Lu, Lu; Zhao, Luping; Zhang, Caimeng; Kong, Xiangzhen; Hua, Yufei; Chen, Yeming

    2015-03-01

    During thermal treatment of soymilk, a rapid incorporation of Kunitz trypsin inhibitor (KTI) into protein aggregates by covalent (disulfide bond, SS) and/or noncovalent interactions with other proteins is responsible for its fast inactivation of trypsin inhibitor activity (TIA). In contrast, the slow cleavage of a single Bowman-Birk inhibitor (BBI) peptide bond is responsible for its slow inactivation of TIA and chymotrypsin inhibitor activity (CIA). In this study, the effects of Ohmic heating (220 V, 50 Hz) on soymilk TIA and CIA inactivation were examined and compared to induction cooker and electric stove heating with similar thermal histories. It was found that: (1) TIA and CIA inactivation was slower from 0 to 3 min, and faster after 3 min as compared to induction cooker and electric stove. (2) The thiol (SH) loss rate was slower from 0 to 3 min, and similar to induction cooker and electric stove after 3 min. (3) Ohmic heating slightly increased protein aggregate formation. (4) In addition to the cleavage of one BBI peptide bond, an additional reaction might occur to enhance BBI inactivation. (5) Ohmic heating was more energy-efficient for TIA and CIA inactivation. (6) TIA and CIA inactivation was accelerated with increasing electric voltage (110, 165, and 220 V) of Ohmic heating. It is likely that the enhanced inactivation of TIA by Ohmic heating is due to its combined electrochemical and thermal effects.

  16. Effects of Glutamic Acid on C-type Inactivation of Kvl.4△N Channel

    Institute of Scientific and Technical Information of China (English)

    Cheng Ye; Xiaoyan Li; Zhouwu Shu; Xuejun Jiang

    2008-01-01

    Objectives Acidosis has an inhibitory effect on the inactivation of Kvl.4 AN channel through the position H508.So in order to show the effects of glutamic acid on the mutant Kv 1.4 channel that lacks N-type inactivation(Kvl.4A2-146),we studied in the expression system of the Xenopus oocytes.Methods The two-electrode voltage-clamp technique(TEV)was used to record the currents.Results Acidosis increased fKvl.4 △2-146 C-type inactivation.After application of glutamic acid(1 mmol/L) to Kvl.4 △2-146 increased C-type inactivation further,changed inactivation time constants from (2.02±0.39s)to(1.71±0.23 s)(P<0.05)at +50my,and shifted the steadystate inactivation curves of Kvl.4 △N to positive potential,which was from(-44.30±0.59 mV) to(-39.88±0.29 mV)(P<0.05 ).and slowed the rate of recovery from inactivation,which was from(1.64±0.19s) to (1.91±0.23 s)(P<0.05).Conclusions Together,these results suggest that 1 mmol/L glutamic acid accelerates the Ctype inactivation of Kvl.4 AN in pH 6.8.

  17. The effects of ionic strength and organic matter on virus inactivation at low temperatures: general likelihood uncertainty estimation (GLUE) as an alternative to least-squares parameter optimization for the fitting of virus inactivation models

    Science.gov (United States)

    Mayotte, Jean-Marc; Grabs, Thomas; Sutliff-Johansson, Stacy; Bishop, Kevin

    2017-06-01

    This study examined how the inactivation of bacteriophage MS2 in water was affected by ionic strength (IS) and dissolved organic carbon (DOC) using static batch inactivation experiments at 4 °C conducted over a period of 2 months. Experimental conditions were characteristic of an operational managed aquifer recharge (MAR) scheme in Uppsala, Sweden. Experimental data were fit with constant and time-dependent inactivation models using two methods: (1) traditional linear and nonlinear least-squares techniques; and (2) a Monte-Carlo based parameter estimation technique called generalized likelihood uncertainty estimation (GLUE). The least-squares and GLUE methodologies gave very similar estimates of the model parameters and their uncertainty. This demonstrates that GLUE can be used as a viable alternative to traditional least-squares parameter estimation techniques for fitting of virus inactivation models. Results showed a slight increase in constant inactivation rates following an increase in the DOC concentrations, suggesting that the presence of organic carbon enhanced the inactivation of MS2. The experiment with a high IS and a low DOC was the only experiment which showed that MS2 inactivation may have been time-dependent. However, results from the GLUE methodology indicated that models of constant inactivation were able to describe all of the experiments. This suggested that inactivation time-series longer than 2 months were needed in order to provide concrete conclusions regarding the time-dependency of MS2 inactivation at 4 °C under these experimental conditions.

  18. PRKCZ methylation is associated with sunlight exposure in a North American but not a Mediterranean population.

    Science.gov (United States)

    Aslibekyan, Stella; Dashti, Hassan S; Tanaka, Toshiko; Sha, Jin; Ferrucci, Luigi; Zhi, Degui; Bandinelli, Stefania; Borecki, Ingrid B; Absher, Devin M; Arnett, Donna K; Ordovas, Jose M

    2014-11-01

    Sunlight exposure has been shown to alter DNA methylation patterns across several human cell-types, including T-lymphocytes. Since epigenetic changes establish gene expression profiles, changes in DNA methylation induced by sunlight exposure warrant investigation. The purpose of this study was to assess the effects of sunlight exposure on CD4+ T-cell methylation patterns on an epigenome-wide scale in a North American population of European origin (n=991). In addition, we investigated the genetic contribution to epigenetic variation (methylQTL). We used linear regression to test the associations between methylation scores at 461,281 cytosine-phosphate-guanine (CpG) sites and sunlight exposure, followed by a genome-wide association analysis (methylQTL) to test for associations between methylation at the top CpG locus and common genetic variants, assuming an additive genetic model. We observed an epigenome-wide significant association between sunlight exposure and methylation status at cg26930596 (p=9.2×10(-8)), a CpG site located in protein kinase C zeta (PRKCZ), a gene previously shown to be entrained by light. MethylQTL analysis resulted in significant associations between cg26930596 and two intergenic single nucleotide polymorphisms on chromosome 3, rs4574216 (p=1.5×10(-10)) and rs4405858 (p=1.9×10(-9)). These common genetic variants reside downstream of WWTR1, a transcriptional co-activator of PRKCZ. Associations observed in the North American population, however, did not replicate in an independent Mediterranean cohort. Our preliminary results support the role of sunlight exposure in epigenetic processes, and lay the groundwork for future studies of the molecular link between sunlight and physiologic processes such as tumorigenesis and metabolism.

  19. HISTORY OF SUNLIGHT EXPOSURE IS A RISK FACTOR FOR AGE-RELATED MACULAR DEGENERATION.

    Science.gov (United States)

    Schick, Tina; Ersoy, Lebriz; Lechanteur, Yara T E; Saksens, Nicole T M; Hoyng, Carel B; den Hollander, Anneke I; Kirchhof, Bernd; Fauser, Sascha

    2016-04-01

    To evaluate effects of current and past sunlight exposure and iris color on early and late age-related macular degeneration (AMD). Of 3,701 individuals from the EUGENDA database, 752 (20.3%) showed early AMD, 1,179 (31.9%) late AMD, and 1,770 (47.8%) were controls. Information about current and past sunlight exposure, former occupation type, subdivided in indoor working and outdoor working, and iris color were obtained by standardized interviewer-assisted questionnaires. Associations between environmental factors adjusted for age, gender, and smoking and early and late AMD were performed by multivariate regression analysis. Current sunlight exposure showed no association with early AMD or late AMD, but past sunlight exposure (≥8 hours outside daily) was significantly associated with early AMD (odds ratio: 5.54, 95% confidence interval 1.25-24.58, P = 0.02) and late AMD (odds ratio: 2.77, 95% confidence interval 1.25-6.16, P = 0.01). Outside working was found to be associated with late AMD (odds ratio: 2.57, 95% confidence interval 1.89-3.48, P = 1.58 × 10). No association was observed between iris color and early or late AMD. Sunlight exposure during working life is an important risk factor for AMD, whereas sunlight exposure after retirement seems to have less influence on the disease development. Therefore, preventive measures, for example, wearing sunglasses to minimize sunlight exposure, should start early to prevent development of AMD later in life.

  20. Toxicological impact of cadmium-based quantum dots towards aquatic biota: Effect of natural sunlight exposure.

    Science.gov (United States)

    Silva, B F; Andreani, T; Gavina, A; Vieira, M N; Pereira, C M; Rocha-Santos, T; Pereira, R

    2016-07-01

    Cadmium-based quantum dots (QDs) are increasingly applied in existent and emerging technologies, especially in biological applications due to their exceptional photophysical and functionalization properties. However, they are very toxic compounds due to the high reactive and toxic cadmium core. The present study aimed to determine the toxicity of three different QDs (CdS 380, CdS 480 and CdSeS/ZnS) before and after the exposure of suspensions to sunlight, in order to assess the effect of environmentally relevant irradiation levels in their toxicity, which will act after their release to the environment. Therefore, a battery of ecotoxicological tests was performed with organisms that cover different functional and trophic levels, such as Vibrio fischeri, Raphidocelis subcapitata, Chlorella vulgaris and Daphnia magna. The results showed that core-shell type QDs showed lower toxic effects to V. fischeri in comparison to core type QDs before sunlight exposure. However, after sunlight exposure, there was a decrease of CdS 380 and CdS 480 QD toxicity to bacterium. Also, after sunlight exposure, an effective decrease of CdSeS/ZnS and CdS 480 toxicity for D. magna and R. subcapitata, and an evident increase in CdS 380 QD toxicity, at least for D. magna, were observed. The results of this study suggest that sunlight exposure has an effect in the aggregation and precipitation reactions of larger QDs, causing the degradation of functional groups and formation of larger bulks which may be less prone to photo-oxidation due to their diminished surface area. The same aggregation behaviour after sunlight exposure was observed for bare QDs. These results further emphasize that the shell of QDs seems to make them less harmful to aquatic biota, both under standard environmental conditions and after the exposure to a relevant abiotic factor like sunlight. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. Wintering birds avoid warm sunshine: predation and the costs of foraging in sunlight.

    Science.gov (United States)

    Carr, Jennie M; Lima, Steven L

    2014-03-01

    Wintering birds can gain significant thermal benefits by foraging in direct sunlight. However, exposure to bright sunlight might make birds easier to detect by predators and may also cause visual glare that can reduce a bird's ability to monitor the environment. Thus, birds likely experience a trade-off between the thermal benefits and predation-related costs of foraging in direct sunlight. To examine this possible thermoregulation-predation trade-off, we monitored the behavior of mixed-species flocks of wintering emberizid sparrows foraging in alternating strips of sunlight and shade. On average, these sparrows routinely preferred to forage in the shade, despite midday air temperatures as much as 30 °C below their thermoneutral zone. This preference for shade was strongest at relatively high temperatures when the thermal benefits of foraging in sunlight were reduced, suggesting a thermoregulation-predation trade-off. Glare could be reduced if birds faced away from the sun while feeding in direct sunlight, but we found that foraging birds tended to face southward (the direction of the sun). We speculate that other factors, such as the likely direction of predator approach, may explain this southerly orientation, particularly if predators use solar glare to their advantage during an attack. This interpretation is supported by the fact that birds had the weakest southerly orientation on cloudy days. Wintering birds may generally avoid foraging in direct sunlight to minimize their risk of predation. However, given the thermal benefits of sunshine, such birds may benefit from foraging in habitats that provide a mosaic of sunlit and shaded microhabitats.

  2. Natural sunlight shapes crude oil-degradingbacterial communities in northern Gulf of Mexico surface waters

    Directory of Open Access Journals (Sweden)

    Hernando P Bacosa

    2015-12-01

    Full Text Available Following the Deepwater Horizon (DWH spill in 2010, an enormous amount of oil was observed in the deep and surface waters of the northern Gulf of Mexico. Surface waters are characterized by intense sunlight and high temperature during summer. While the oil-degrading bacterial communities in the deep-sea plume have been widely investigated, the effect of natural sunlight on those in oil polluted surface waters remains unexplored to date. In this study, we incubated surface water from the DWH site with amendments of crude oil, Corexit dispersant, or both for 36 d under natural sunlight in the northern Gulf of Mexico. The bacterial community was analyzed over time for total abundance, density of alkane and polycyclic aromatic hydrocarbon degraders, and community composition via pyrosequencing. Our results showed that, for treatments with oil and/or Corexit, sunlight significantly reduced bacterial diversity and evenness and was a key driver of shifts in bacterial community structure. In samples containing oil or dispersant, sunlight greatly reduced abundance of the Cyanobacterium Synechococcus but increased the relative abundances of Alteromonas, Marinobacter, Labrenzia, Sandarakinotalea, Bartonella, and Halomonas. Dark samples with oil were represented by members of Thalassobius, Winogradskyella, Alcanivorax, Formosa, Pseudomonas, Eubacterium, Erythrobacter, Natronocella, and Coxiella. Both oil and Corexit inhibited the Candidatus Pelagibacter with or without sunlight exposure. For the first time, we demonstrated the effects of light in structuring microbial communities in water with oil and/or Corexit. Overall, our findings improve understanding of oil pollution in surface water, and provide unequivocal evidence that sunlight is a key factor in determining bacterial community composition and dynamics in oil polluted marine waters.

  3. Varying relationship between 25-hydroxy-vitamin D, high density lipoprotein cholesterol, and serum 7-dehydrocholesterol reductase with sunlight exposure.

    Science.gov (United States)

    Patwardhan, Vivek G; Khadilkar, Anuradha V; Chiplonkar, Shashi A; Mughal, Zulf M; Khadilkar, Vaman V

    2015-01-01

    Cholesterol and cholecalciferol are synthesized from a common substrate 7-dehydrocholesterol. 7-dehydrocholesterol is converted to cholesterol by 7-dehydrocholesterol reductase enzyme (DHCR7) and to cholecalciferol by ultraviolet B radiation from sunlight. To examine the effect of sunlight exposure and serum DHCR7 levels on cholecalciferol and cholesterol levels and studying any interrelationship. In a cross-sectional observational study, 307 apparently healthy men (aged 40-60 years) were assessed for sunlight exposure, lipid levels, serum DHCR7, 25 hydroxyvitamin D (25(OH)D), body composition, and dietary milk calcium intake. Vitamin D deficiency (25(OH)D sunlight exposure (P sunlight exposure (sunlight exposure (1-2 h/d), there was no significant association. However, with higher sunlight exposure (>2 h/d), serum 25(OH)D concentrations were significantly negatively associated with HDL-C (P sunlight exposure, an inverse significant relationship was observed between 25(OH)D and serum DHCR7 (P sunlight exposure, no significant relationship was seen. 25(OH)D seems to show a varying relationship with HDL-C and serum DHCR7 at different durations of sunlight exposure. Copyright © 2015 National Lipid Association. Published by Elsevier Inc. All rights reserved.

  4. X-chromosome inactivation and escape

    Indian Academy of Sciences (India)

    Christine M. Disteche; Joel B. Berletch

    2015-12-01

    X-chromosome inactivation, which was discovered by Mary Lyon in 1961 results in random silencing of one X chromosome in female mammals. This review is dedicated to Mary Lyon, who passed away last year. She predicted many of the features of X inactivation, for e.g., the existence of an X inactivation center, the role of L1 elements in spreading of silencing and the existence of genes that escape X inactivation. Starting from her published work here we summarize advances in the field.

  5. THE RISKS OF SUNLIGHTING CLASSROOMS. An appraisal method to assess the severity of discomfort due to sunlight penetration in classrooms. Site of study: Primary school classrooms in Constantine (ALGERIA

    Directory of Open Access Journals (Sweden)

    D SAFFIDINE-ROUAG

    2001-12-01

    Full Text Available The westerly orientations for a large number of primary school classrooms in Constantine involved a serious environmental problem provoked by uncontrolled sunlight. Under such circumstances the schoolchildren had no choice than keep sitting under incident sunlight while performing their various school tasks.  Evidence of the severity of discomfort experienced by those pupils was investigated using observational methods. The results allowed to reach substantial conclusions about the risks of sunlighting classrooms.

  6. Suicide inactivation of catechol 2,3-dioxygenase from Pseudomonas putida mt-2 by 3-halocatechols

    Energy Technology Data Exchange (ETDEWEB)

    Bartels, I.; Knackmuss, H.J.; Reineke, W.

    1984-03-01

    The inactivation of catechol 2,3-dioxygenase from Pseudomonas putida mt-2 by 3-chloro- and 3-fluorocatechol and the iron-chelating agent Tiron (catechol-3,5-disulfonate) was studied. Whereas inactivation by Tiron is an oxygen-independent and mostly reversible process, inactivation by the 3-halocatechols was only observed in the presence of oxygen and was largely irreversible. The rate constants for inactivation (K/sub 2/) were 1.62 x 10/sup -3/ sec/sup -1/ for 3-chlorocatechol and 2.38 x 10/sup -3/ sec/sup -1/ for 3-fluorocatechol. The inhibitor constants (K/sub i/) were 23 ..mu..M for 3-chlorocatechol and 17 ..mu..M for 3-fluorocatechol. The kinetic data for 3-fluorocatechol could only be obtained in the presence of 2-mercaptoethanol. Besides inactivated enzyme, some 2-hydroxyhexa-2,4-dienoic acid as the actual suicide product of meta-cleavage. A side product of 3-fluorocatechol cleavage is a yellow compound with the spectral characteristics of a 2-hydroxy-6-oxohexa-2,4-dienoci acid indicating 1,6-cleavage. Rates of inactivation by 3-fluorocatechol were reduced in the presence of superoxide dismutase, catalase, formate, and mannitol, which implies that superoxide anion, hydrogen peroxide, and hydroxyl radical exhibit additional inactivation. 64 references.

  7. Hypovitaminosis D in patients undergoing kidney transplant: the importance of sunlight exposure.

    Science.gov (United States)

    Vilarta, Cristiane F; Unger, Marianna D; Dos Reis, Luciene M; Dominguez, Wagner V; David-Neto, Elias; Moysés, Rosa M; Titan, Silvia; Custodio, Melani R; Hernandez, Mariel J; Jorgetti, Vanda

    2017-07-01

    Recent studies have shown a high prevalence of hypovitaminosis D, defined as a serum 25-hydroxyvitamin D level less than 30 ng/ml, in both healthy populations and patients with chronic kidney disease. Patients undergoing kidney transplant are at an increased risk of skin cancer and are advised to avoid sunlight exposure. Therefore, these patients might share two major risk factors for hypovitaminosis D: chronic kidney disease and low sunlight exposure. This paper describes the prevalence and clinical characteristics of hypovitaminosis D among patients undergoing kidney transplant. We evaluated 25-hydroxyvitamin D serum levels in a representative sample of patients undergoing kidney transplant. We sought to determine the prevalence of hypovitaminosis D, compare these patients with a control group, and identify factors associated with hypovitaminosis D (e.g., sunlight exposure and dietary habits). Hypovitaminosis D was found in 79% of patients undergoing kidney transplant, and the major associated factor was low sunlight exposure. These patients had higher creatinine and intact parathyroid hormone serum levels, with 25-hydroxyvitamin D being inversely correlated with intact parathyroid hormone serum levels. Compared with the control group, patients undergoing kidney transplant presented a higher prevalence of 25-hydroxyvitamin D deficiency and lower serum calcium, phosphate and albumin but higher creatinine and intact parathyroid hormone levels. Our results confirmed the high prevalence of hypovitaminosis D in patients undergoing kidney transplant. Therapeutic strategies such as moderate sunlight exposure and vitamin D supplementation should be seriously considered for this population.

  8. Analysis of daylight performance of solar light pipes influenced by size and shape of sunlight captures

    Science.gov (United States)

    Wu, Yanpeng; Jin, Rendong; Zhang, Wenming; Liu, Li; Zou, Dachao

    2009-11-01

    Experimental investigations on three different sunlight captures with diameter 150mm, 212mm, 300mm were carried out under different conditions such as sunny conditions, cloudy conditions and overcast conditions and the two different size solar light pipes with diameter 360mm and 160mm under sunny conditions. The illuminance in the middle of the sunlight capture have relationship with its size, but not linear. To improve the efficiency of the solar light pipes, the structure and the performance of the sunlight capture must be enhanced. For example, University of Science and Technology Beijing Gymnasium, Beijing 2008 Olympic events of Judo and Taekwondo, 148 solar light pipes were installed with the diameter 530mm for each light pipe. Two sunlight captures with different shape were installed and tested. From the measuring results of the illuminance on the work plane of the gymnasium, the improvement sunlight captures have better effects with the size of augmenting and the machining of the internal surface at the same time, so that the refraction increased and the efficiency of solar light pipes improved. The better effects of supplementary lighting for the gymnasium have been achieved.

  9. Treated domestic sewage: kinetics of Escherichia coli and total coliform inactivation by oxidation with hydrogen peroxide

    Directory of Open Access Journals (Sweden)

    Gean Delise L. P. Vargas

    2013-01-01

    Full Text Available Hydrogen peroxide has been used for decades in developed countries as an oxidizing agent in the treatment of water, domestic sewage and industrial effluents. This study evaluated the influence of the concentration of H2O2 and pH on the inactivation of Escherichia coli cells and the disinfection of sewage treated. The results showed that the inactivation rate increased with pH and H2O2. The presence of other contaminants dissolved in the effluent is probably the cause of these differences, because E. coli inactivation in synthetic wastewater was found to be much faster than in the real treated domestic sewage.

  10. Inactivation of Escherichia coli by photochemical reaction of ferrioxalate at slightly acidic and near-neutral pHs.

    Science.gov (United States)

    Cho, Min; Lee, Yunho; Chung, Hyenmi; Yoon, Jeyong

    2004-02-01

    Fenton chemistry, which is known to play an effective role in degrading toxic chemicals, is difficult to apply to disinfection in water treatment, since its reaction is effective only at the acidic pH of 3. The presence of oxalate ions and UV-visible light, which is known as a photoferrioxalate system, allows the Fe(III) to be dissolved at slightly acidic and near-neutral pHs and maintains the catalytic reaction of iron. This study indicates that the main oxidizing species in the photoferrioxalate system responsible for microorganism inactivation is OH radical. Escherichia coli was used as an indicator microorganism. The CT value (OH radical concentration x contact time; used to indicate the effect of the combination of the concentration of the disinfectant and the contact time on inactivation) for a 2-log inactivation of E. coli was approximately 1.5 x 10(-5) mg/liter/min, which is approximately 2,700 times lower than that of ozone as estimated by the delayed Chick-Watson model. Since the light emitted by the black light blue lamp is similar to sunlight in the specific wavelength range of 300 to 420 nm, the photoferrioxalate system, which can have a dual function, treating water for both organic pollutants and microorganisms simultaneously, shows promise for the treatment of water or wastewater in remote or rural sites. However, the photoferrioxalate disinfection system is slower in inactivating microorganisms than conventional disinfectants are.

  11. Is casual exposure to summer sunlight effective at maintaining adequate vitamin D status?

    Science.gov (United States)

    Diffey, Brian L

    2010-08-01

    The advice that an adequate vitamin D status can be achieved by short, casual exposure to summer sunlight is ubiquitous. This review will examine the value of this advice. The results of experimental studies on changes in serum 25-hydroxyvitamin D [25(OH)D] concentrations following ultraviolet exposure are interpreted in the context of human exposure to sunlight. It is shown that current advice about modest sun exposure during the summer months does little in the way of boosting overall 25(OH)D levels, while sufficient sun exposure that could achieve a worthwhile benefit would compromise skin health. Failure to understand the nature of human exposure to sunlight has led to misguided advice concerning the sun exposure necessary for an adequate vitamin D status.

  12. Effect of sunlight on the survival of pathogenic E. coli in freshwater and sea water

    DEFF Research Database (Denmark)

    Surendraraj, Alagarsamy; Farvin, Sabeena; Thampuran, N.

    2011-01-01

    An enteropathogenic group of E. coli are the emerging category of pathogen of public health significance. Several recent pathogenic E. coli outbreaks are associated with drinking water. Aquaculture, the fast emerging food production sector also poses a pathogenic EHEC outbreak risk, as it regularly...... uses cow dung, a reservoir of this organism. Hence, a experiment was set up to study the duration of survival of pathogenic E. coli under sunlight and darkness. Eight pathogenic E. coli isolates from clinical (EPEC, ETEC, EHEC, EAEC), veterinary (CTE3, CTE4) and environmental sources (ASHE3, Rao II......) were studied for their survival under sunlight and darkness in fresh water and seawater. Effect of direct sunlight on the viable but nonculturable (VBNC) state of cultures was also studied. The results of the study indicated a distinct pattern between freshwater system and seawater system. Pathogenic E...

  13. Optical modeling of sunlight by using partially coherent sources in organic solar cells.

    Science.gov (United States)

    Alaibakhsh, Hamzeh; Darvish, Ghafar

    2016-03-01

    We investigate the effects of coherent and partially coherent sources in optical modeling of organic solar cells. Two different organic solar cells are investigated: one without substrate and the other with a millimeter-sized glass substrate. The coherent light absorption is calculated with rigorous coupled-wave analysis. The result of this method is convolved with a distribution function to calculate the partially coherent light absorption. We propose a new formulation to accurately model sunlight as a set of partially coherent sources. In the structure with glass substrate, the accurate sunlight modeling results in the elimination of coherent effects in the thick substrate, but the coherency in other layers is not affected. Using partially coherent sources instead of coherent sources for simulations with sunlight results in a smoother absorption spectrum, but the change in the absorption efficiency is negligible.

  14. De Novo Assembly and Comparative Transcriptome Analyses of Red and Green Morphs of Sweet Basil Grown in Full Sunlight

    National Research Council Canada - National Science Library

    Torre, Sara; Tattini, Massimiliano; Brunetti, Cecilia; Guidi, Lucia; Gori, Antonella; Marzano, Cristina; Landi, Marco; Sebastiani, Federico

    2016-01-01

    .... The development of a reference transcriptome for sweet basil, and the analysis of differentially expressed genes in acyanic and cyanic cultivars exposed to natural sunlight irradiance, has interest...

  15. Sunlight-stimulated phenylalanine ammonia-lyase (PAL activity and anthocyanin accumulation in exocarp of ‘Mahajanaka’ mango

    Directory of Open Access Journals (Sweden)

    Kobkiat Saengnil

    2011-11-01

    Full Text Available The activity of phenylalanine ammonia-lyase (PAL required for anthocyanin synthesis was stimulated by sunlight exposure resulting in the development of red colour in ‘Mahajanaka’ mango exocarp, which occurred only on the sunlight-exposed side of the fruit. The accumulation of anthocyanin was concurrent with the increase in PAL activity in the mature stage of the fruit. The exposed side of the fruit had higher PAL activity, endogenous sugar content, and anthocyanin accumulation than the unexposed side. It is concluded that sunlight increases red colour development of the mango exocarp by inducing PAL activity. Exposure to sunlight also enhances endogenous sugar accumulation in mango fruit.

  16. Railway suicide attempts are associated with amount of sunlight in recent days.

    Science.gov (United States)

    Kadotani, Hiroshi; Nagai, Yumiko; Sozu, Takashi

    2014-01-01

    To assess the relationship between hours of sunlight and railway suicide attempts, 3-7 days before these attempts. All railway suicide attempts causing railway suspensions or delays of 30 min or more between 2002 and 2006. We used a linear probability model to assess this relationship. This study was conducted at Tokyo, Kanagawa, and Osaka prefectures in Japan. Data were collected from the railway delay incident database of the Japanese Railway Technical Research Institute and public weather database of the Japan Meteorological Agency. About 971 railway suicides attempts occurred between 2002 and 2006 in Tokyo, Kanagawa, and Osaka. Less sunlight in the 7 days leading up to the railway suicide attempts was associated with a higher proportion of attempts (p=0.0243). Sunlight over the 3 days before an attempt had a similar trend (p=0.0888). No difference was found in sunlight hours between the days with (median: 5.6 [IQR: 1.1-8.8]) and without (median: 5.7 [IQR: 1.0-8.9]) railway suicide attempts in the evening. Finally, there was no apparent correlation between the railway suicide attempts and the monthly average sunlight hours of the attempted month or those of a month before. Railway suicides were not the main suicidal methods in Japan, We observed an increased proportion of railway suicide attempts after several days without sunlight. Light exposure (blue light or bright white light) in trains may be useful in reducing railway suicides, especially when consecutive days without sunshine are forecasted. © 2013 Elsevier B.V. All rights reserved.

  17. Photodynamic inactivation of mammalian viruses and bacteriophages.

    Science.gov (United States)

    Costa, Liliana; Faustino, Maria Amparo F; Neves, Maria Graça P M S; Cunha, Angela; Almeida, Adelaide

    2012-07-01

    Photodynamic inactivation (PDI) has been used to inactivate microorganisms through the use of photosensitizers. The inactivation of mammalian viruses and bacteriophages by photosensitization has been applied with success since the first decades of the last century. Due to the fact that mammalian viruses are known to pose a threat to public health and that bacteriophages are frequently used as models of mammalian viruses, it is important to know and understand the mechanisms and photodynamic procedures involved in their photoinactivation. The aim of this review is to (i) summarize the main approaches developed until now for the photodynamic inactivation of bacteriophages and mammalian viruses and, (ii) discuss and compare the present state of the art of mammalian viruses PDI with phage photoinactivation, with special focus on the most relevant mechanisms, molecular targets and factors affecting the viral inactivation process.

  18. Photodynamic Inactivation of Mammalian Viruses and Bacteriophages

    Directory of Open Access Journals (Sweden)

    Liliana Costa

    2012-06-01

    Full Text Available Photodynamic inactivation (PDI has been used to inactivate microorganisms through the use of photosensitizers. The inactivation of mammalian viruses and bacteriophages by photosensitization has been applied with success since the first decades of the last century. Due to the fact that mammalian viruses are known to pose a threat to public health and that bacteriophages are frequently used as models of mammalian viruses, it is important to know and understand the mechanisms and photodynamic procedures involved in their photoinactivation. The aim of this review is to (i summarize the main approaches developed until now for the photodynamic inactivation of bacteriophages and mammalian viruses and, (ii discuss and compare the present state of the art of mammalian viruses PDI with phage photoinactivation, with special focus on the most relevant mechanisms, molecular targets and factors affecting the viral inactivation process.

  19. Photodynamic Inactivation of Mammalian Viruses and Bacteriophages

    Science.gov (United States)

    Costa, Liliana; Faustino, Maria Amparo F.; Neves, Maria Graça P. M. S.; Cunha, Ângela; Almeida, Adelaide

    2012-01-01

    Photodynamic inactivation (PDI) has been used to inactivate microorganisms through the use of photosensitizers. The inactivation of mammalian viruses and bacteriophages by photosensitization has been applied with success since the first decades of the last century. Due to the fact that mammalian viruses are known to pose a threat to public health and that bacteriophages are frequently used as models of mammalian viruses, it is important to know and understand the mechanisms and photodynamic procedures involved in their photoinactivation. The aim of this review is to (i) summarize the main approaches developed until now for the photodynamic inactivation of bacteriophages and mammalian viruses and, (ii) discuss and compare the present state of the art of mammalian viruses PDI with phage photoinactivation, with special focus on the most relevant mechanisms, molecular targets and factors affecting the viral inactivation process. PMID:22852040

  20. Sunlight to hydrogen conversion: Design optimization and energy management of concentrated photovoltaic (CPV-Hydrogen) system using micro genetic algorithm

    KAUST Repository

    Burhan, Muhammad

    2016-02-14

    Owing to the intermittent solar irradiance from cloud cover in the diurnal period and unavailability at night time, the practical design of a solar system requires energy backup storage for an uninterrupted supply or for off-grid operation. However, for highly efficient CPV (concentrated photovoltaic) system, the literature is lacking for energy management and optimization algorithm and tool for standalone operation. In this paper, a system with CPV and electrolyser is presented where beam irradiance of sunlight is harnessed to convert the instantaneously generated electricity into useful Hydrogen/Oxygen gas, where they can be stored and re-used for downstream applications such as the fuel cells, etc. The multi-variable design and multi-objective optimization strategies are proposed and presented for a standalone operation of the CPV-Hydrogen system as well as their system performances, particularly electrical rating of CPV based upon the real weather data of Singapore. © 2016 Elsevier Ltd.

  1. Using metal nanostructures to form hydrocarbons from carbon dioxide, water and sunlight

    Science.gov (United States)

    Wang, Cong; Shen, Mengyan; Huo, Haibin; Ren, Haizhou; Johnson, Michael

    2011-12-01

    Based on experimental results, we propose a mechanism that allows the use of metal nanostructures to synthesize hydrocarbons and carbohydrates from carbon dioxide, water and sunlight. When sunlight impinges on cobalt nanostructures in a glass chamber, its intensity is greatly enhanced around the tips of the nanostructures through surface plasmon excitations focusing effect, and it then photodissociates the water and carbon dioxide molecules through enhanced photon absorptions of ions around the tips of the nanostructures. The photodissociated molecules in excited states remain on the cobalt nanostructure surfaces and various hydrocarbons and carbohydrates then will be formed around the surfaces at temperatures much lower than 100 oC.

  2. Socioeconomic status, sunlight exposure, and risk of malignant melanoma: the Western Canada Melanoma Study.

    Science.gov (United States)

    Gallagher, R P; Elwood, J M; Threlfall, W J; Spinelli, J J; Fincham, S; Hill, G B

    1987-10-01

    In a study of 261 male melanoma patients and age-and sex-matched controls, a strong positive univariate association between socioeconomic status, as determined by usual occupation, and risk of melanoma was detected. This association, however, was substantially explained by host constitutional factors and occupational, recreational, and vacation sunlight exposure. The study demonstrated an increased risk of melanoma in draftsmen and surveyors and a reduced risk of melanoma in construction workers and individuals employed in the finance, insurance, and real estate industry even after control for the effect of host factors and sunlight exposure.

  3. Test technology on CCD anti-sunlight jamming based on complex circumstance

    Science.gov (United States)

    Shi, Sheng-bing; Chen, Zhen-xing; Han, Fu-li

    2016-09-01

    Visible-light reconnaissance device based on CCD is applied to all kinds of weapons, CCD cannot work because of saturation when it faces intense light. Sun is intense light source in nature and assignably influences CCD performance. In this paper, aim is appraising CCD anti-sunlight ability, object reflection characteristic test system is designed, based on typical background reflection characteristic including grant, sand and so on, complex circumstance is formulated and test project is optimized with orthogonal design method, problem that is without test technology on CCD anti-sunlight jamming is solved.

  4. The inactivation of Chlorella spp. with dielectric barrier discharge in gas-liquid mixture

    Science.gov (United States)

    Song, Dan; Sun, Bing; Zhu, Xiaomei; Yan, Zhiyu; Liu, Hui; Liu, Yongjun

    2013-03-01

    The inactivation of Chlorella spp. with high voltage and frequency pulsed dielectric barrier discharge in hybrid gas-liquid reactor with a suspension electrode was studied experimentally. In the hybrid gas-liquid reactor, a steel plate was used as high voltage electrode while a quartz plate as a dielectric layer, another steel plate placing in the aqueous solution worked as a whole ground electrode. A suspension electrode is installed near the surface of solution between high voltage and ground electrode to make the dielectric barrier discharge uniform and stable, the discharge gap was between the quartz plate and the surface of the water. The effect of peak voltage, treatment time, the initial concentration of Chlorella spp. and conductivity of solution on the inactivation rate of Chlorella spp. was investigated, and the inactivation mechanism of Chlorella spp. preliminarily was studied. Utilizing this system inactivation of Chlorella spp., the inactivation rate increased with increasing of peak voltage, treatment time and electric conductivity. It was found that the inactivation rate of Chlorella spp. arrived at 100% when the initial concentration was 4 × 106 cells mL-1, and the optimum operation condition required a peak voltage of 20 kV, a treatment time of 10 min and a frequency of 7 kHz. Though the increasing of initial concentration of the Chlorella spp. contributed to the addition of interaction probability between the Chlorella spp. and O3, H2O2, high-energy electrons, UV radiation and other active substances, the total inactivation number raise, but the inactivation rate of the Chlorella spp. decreased.

  5. Degradation of DEET and Caffeine under UV/Chlorine and Simulated Sunlight/Chlorine Conditions.

    Science.gov (United States)

    Sun, Peizhe; Lee, Wan-Ning; Zhang, Ruochun; Huang, Ching-Hua

    2016-12-20

    Photoactivation of aqueous chlorine could promote degradation of chlorine-resistant and photochemically stable chemicals accumulated in swimming pools. This study investigated the degradation of two such chemicals, N,N-diethyl-3-methylbenzamide (DEET) and caffeine, by low pressure ultraviolet (UV) light and simulated sunlight (SS) activated free chlorine (FC) in different water matrices. Both DEET and caffeine were rapidly degraded by UV/FC and SS/FC but exhibited different kinetic behaviors. The degradation of DEET followed pseudo-first-order kinetics, whereas the degradation of caffeine accelerated with reaction. Mechanistic study revealed that, under UV/FC, ·OH and Cl· were responsible for degradation of DEET, whereas ClO· related reactive species (ClOrrs), generated by the reaction between FC and ·OH/Cl·, played a major role in addition to ·OH and Cl· in degrading caffeine. Reaction rate constants of DEET and caffeine with the respective radical species were estimated. The imidazole moiety of caffeine was critical for the special reactivity with ClOrrs. Water matrix such as pH had a stronger impact on the UV/FC process than the SS/FC process. In saltwater matrix under UV/FC and SS/FC, the degradation of DEET was significantly inhibited, but the degradation of caffeine was much faster than that in nonsalty solutions. The interaction between Br(-) and Cl(-) may play an important role in the degradation of caffeine by UV/FC in saltwater. Reaction product analysis showed similar product patterns by UV/FC and SS/FC and minimal formation of chlorinated intermediates and disinfection byproducts.

  6. Kinetics of the Inactivation of Vibrio parahaemolyticus in Weakly Acidic Sodium Chlorite Solution.

    Science.gov (United States)

    Takahashi, Kazuhiro; Tanaka, Reiji; Fukuzaki, Satoshi

    2017-01-01

     The kinetics of the inactivation of Vibrio parahaemolyticus in sodium chlorite (NaClO2) solution was studied in the weakly acidic pH range of 4.0 to 6.5 and at various temperatures. The logarithmic reduction of the survival ratio depended on the concentration-time product, and all the inactivation curves showed a linear reduction phase. The first-order inactivation rate constant (k) increased by approximately twice for every 0.44 unit fall in pH. During the inactivation experiments, no formation of chlorine dioxide occurred. These data indicated that undissociated HClO2 was the active species governing the inactivation of V. parahaemolyticus. It was also shown that the use of weakly acidic NaClO2 solutions containing high concentrations of ionized ClO2(-) gave slower kinetics of the inactivation, whereas it could achieve the significant reduction of viable cells of more than 4-log. The k value showed an Arrhenius-type temperature dependence in the temperature range of 5 to 40℃. The apparent activation energy for the inactivation of V. parahaemolyticus was estimated to be 43.5 kJ/mol. The k value increased by approximately 1.8 times for every 10℃ rise in temperature.

  7. Investigation of Low-Pressure Ultraviolet Radiation on Inactivation of Rhabitidae Nematode from Water

    Directory of Open Access Journals (Sweden)

    Mohammad Hadi Dehghani

    2013-03-01

    Full Text Available Background: Rhabditidae is a family of free-living nematodes. Free living nematodes due to their active movement and resistance to chlorination, do not remove in conventional water treatment processes thus can be entered to distribution systems and cause adverse health effects. Ultraviolet radiation (UV can be used as a method of inactivating for these organisms. This cross sectional study was done to investigate the efficiency of ultraviolet lamp in the inactivation of free living nematode in water.Methods: The effects of radation time, turbidity, pH and temperature were invistigated in this study. Ultraviolet lamp used in this study was a 11 W lamp and intensity of this lamp was 24 µw / cm2.Results: Radiation time required to achieve 100% efficiency for larvae nematode and adults was 9 and 10 minutes respectively. There was a significant correlation between the increase in radiation time, temperature rise and turbidity reduction with inactivation efficiency of lamp (P<0.001. Increase of turbidity up 25 NTU decreased inactivation efficiency of larvae and adult nematodes from 100% to 66% and 100% to 64% respectively. Change in pH range from 6 to 9 did not affect the efficiency of inactivation. With increasing temperature inactivation rate increased. Also the effect of the lamp on inactivation of larvae nematod was mor than adults.Conclusions: It seems that with requiring the favorable conditions low-pressure ultraviolet radiation systems can be used for disinfection of water containing Rhabitidae nematode.

  8. Effect of formaldehyde inactivation on poliovirus.

    Science.gov (United States)

    Wilton, Thomas; Dunn, Glynis; Eastwood, David; Minor, Philip D; Martin, Javier

    2014-10-01

    Inactivated polio vaccines, which have been used in many countries for more than 50 years, are produced by treating live poliovirus (PV) with formaldehyde. However, the molecular mechanisms underlying virus inactivation are not well understood. Infection by PV is initiated by virus binding to specific cell receptors, which results in viral particles undergoing sequential conformational changes that generate altered structural forms (135S and 80S particles) and leads to virus cell entry. We have analyzed the ability of inactivated PV to bind to the human poliovirus receptor (hPVR) using various techniques such as ultracentrifugation, fluorescence-activated cell sorting flow cytometry and real-time reverse transcription-PCR (RT-PCR). The results showed that although retaining the ability to bind to hPVR, inactivated PV bound less efficiently in comparison to live PV. We also found that inactivated PV showed resistance to structural conversion in vitro, as judged by measuring changes in antigenicity, the ability to bind to hPVR, and viral RNA release at high temperature. Furthermore, viral RNA from inactivated PV was shown to be modified, since cDNA yields obtained by RT-PCR amplification were severely reduced and no infectious virus was recovered after RNA transfection into susceptible cells. Importance: This study represents a novel insight into the molecular mechanisms responsible for poliovirus inactivation. We show that inactivation with formaldehyde has an effect on early steps of viral replication as it reduces the ability of PV to bind to hPVR, decreases the sensitivity of PV to convert to 135S particles, and abolishes the infectivity of its viral RNA. These changes are likely responsible for the loss of infectivity shown by PV following inactivation. Techniques used in this study represent new approaches for the characterization of inactivated PV products and could be useful in developing improved methods for the production and quality control testing of

  9. Sex-differential selection and the evolution of X inactivation strategies.

    Directory of Open Access Journals (Sweden)

    Tim Connallon

    2013-04-01

    Full Text Available X inactivation--the transcriptional silencing of one X chromosome copy per female somatic cell--is universal among therian mammals, yet the choice of which X to silence exhibits considerable variation among species. X inactivation strategies can range from strict paternally inherited X inactivation (PXI, which renders females haploid for all maternally inherited alleles, to unbiased random X inactivation (RXI, which equalizes expression of maternally and paternally inherited alleles in each female tissue. However, the underlying evolutionary processes that might account for this observed diversity of X inactivation strategies remain unclear. We present a theoretical population genetic analysis of X inactivation evolution and specifically consider how conditions of dominance, linkage, recombination, and sex-differential selection each influence evolutionary trajectories of X inactivation. The results indicate that a single, critical interaction between allelic dominance and sex-differential selection can select for a broad and continuous range of X inactivation strategies, including unequal rates of inactivation between maternally and paternally inherited X chromosomes. RXI is favored over complete PXI as long as alleles deleterious to female fitness are sufficiently recessive, and the criteria for RXI evolution is considerably more restrictive when fitness variation is sexually antagonistic (i.e., alleles deleterious to females are beneficial to males relative to variation that is deleterious to both sexes. Evolutionary transitions from PXI to RXI also generally increase mean relative female fitness at the expense of decreased male fitness. These results provide a theoretical framework for predicting and interpreting the evolution of chromosome-wide expression of X-linked genes and lead to several useful predictions that could motivate future studies of allele-specific gene expression variation.

  10. HISTORY OF SUNLIGHT EXPOSURE IS A RISK FACTOR FOR AGE-RELATED MACULAR DEGENERATION

    NARCIS (Netherlands)

    Schick, T.; Ersoy, L.; Lechanteur, Y.T.; Saksens, N.T.; Hoyng, C.B.; Hollander, A.I. den; Kirchhof, B.; Fauser, S.

    2016-01-01

    PURPOSE: To evaluate effects of current and past sunlight exposure and iris color on early and late age-related macular degeneration (AMD). METHODS: Of 3,701 individuals from the EUGENDA database, 752 (20.3%) showed early AMD, 1,179 (31.9%) late AMD, and 1,770 (47.8%) were controls. Information abou

  11. Commonly recommended daily intake of vitamin D is not sufficient if sunlight exposure is limited

    DEFF Research Database (Denmark)

    Glerup, H; Mikkelsen, K; Poulsen, L

    2000-01-01

    intake analysis to estimate the oral intake of vitamin D necessary to keep a normal vitamin D status in sunlight-deprived individuals. DESIGN: Cross-sectional study amongst randomly selected Moslem women of Arab origin living in Denmark. Age-matched Danish women were included as controls. To control...

  12. [The Impact of Sunlight Exposure on the Health of Older Adults].

    Science.gov (United States)

    Lin, Tzu-Chia; Liao, Yen-Chi

    2016-08-01

    Appropriate exposure to sunlight not only contributes to the production of vitamin D, which has been associated with enhanced bone health, mood, and cognitive functions, but also regulates the secretion of melatonin, which has been associated with the mediation of circadian rhythms, improved sleep quality, and optimized physical and social activity in the elderly. However, damage to the skin, eyes, and immune system has also been widely associated with long-term exposure to sunlight. Several studies have shown that many elderly, especially those that reside in institutions, do not receive sufficient sunlight exposure. Institutionalized elderly tend to participate in indoor activities and spend significant periods of time alone and asleep in front of the television. Furthermore, factors such as poor health, environmental design, indoor/outdoor preference, and activity design may impact the access of institutionalized elderly to sunlight more than their non-institutionalized peers. Therefore, we suggest that in addition to obtaining sufficient levels of vitamin D from their diet and from supplements, the elderly should perform outdoor activities for 20-30 minutes a day for five days each week. Furthermore, we suggest that the environment of the care facility should be made be more accessible and that some activities should be held outdoors.

  13. Preventive role of lens antioxidant defense mechanism against riboflavin-mediated sunlight damaging of lens crystallins.

    Science.gov (United States)

    Anbaraki, Afrooz; Khoshaman, Kazem; Ghasemi, Younes; Yousefi, Reza

    2016-10-01

    The main components of sunlight reaching the eye lens are UVA and visible light exerting their photo-damaging effects indirectly by the aid of endogenous photosensitizer molecules such as riboflavin (RF). In this study, lens proteins solutions were incubated with RF and exposed to the sunlight. Then, gel mobility shift analysis and different spectroscopic assessments were applied to examine the structural damaging effects of solar radiation on these proteins. Exposure of lens proteins to direct sunlight, in the presence of RF, leads to marked structural crosslinking, oligomerization and proteolytic instability. These structural damages were also accompanied with reduction in the emission fluorescence of Trp and Tyr and appearance of a new absorption peak between 300 and 400nm which can be related to formation of new chromophores. Also, photo-oxidation of lens crystallins increases their oligomeric size distribution as examined by dynamic light scattering analysis. The above mentioned structural insults, as potential sources of sunlight-induced senile cataract and blindness, were significantly attenuated in the presence of ascorbic acid and glutathione which are two important components of lens antioxidant defense system. Therefore, the powerful antioxidant defense mechanism of eye lens is an important barrier against molecular photo-damaging effects of solar radiations during the life span. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Reversible degradation in ITO-containing organic photovoltaics under concentrated sunlight

    NARCIS (Netherlands)

    Galagan, Y.O.; Mescheloff, A.; Veenstra, S.C.; Andriessen, H.A.J.M.; Katz, E.A.

    2015-01-01

    Stabilities of ITO-containing and ITO-free organic solar cells were investigated under simulated AM 1.5G illumination and under concentrated natural sunlight. In both cases ITO-free devices exhibit high stability, while devices containing ITO show degradation of their photovoltaic performance. The a

  15. The relationships among birth season, sunlight exposure during infancy, and allergic disease.

    Science.gov (United States)

    Hwang, Jung Min; Oh, Se Hyun; Shin, Mee Yong

    2016-05-01

    The recent increase in the prevalence of allergic diseases is hypothetically attributed to immune dysregulation in turn caused by a reduction in exposure to sunlight. We explored relationships between birth season, sunlight exposure, exercise duration, and an allergic disease. We performed a questionnaire-based survey on allergic diseases among elementary school students. Birth time was categorized according to the season (summer and winter). The prevalence of atopic dermatitis (AD) "symptoms ever" was higher in the children born in winter than in those born in summer (adjusted odds ratio [aOR], 1.24; 95% confidence interval [CI], 1.03-1.49; P=0.024). Birth in winter was associated with an increase in the "symptoms in the past 12 months" prevalence of food allergy (FA) (aOR, 1.56; 95% CI, 1.09-2.24; P=0.015). The lifetime prevalence of allergic diseases except FA was higher in the children whose parents considered their sunlight exposure prior to 24 months of ageas inadequate than those who considered their exposure as adequate ("diagnosis ever" asthma: aOR, 1.4; 95% CI, 1.17-1.67; Psunlight exposure nor exercise duration was associated with the prevalence of an allergic disease. Birth in winter may be associated with development of AD and FA. Inadequate sunlight exposure before the age of 24 months might possibly increase the risks of development of asthma, AR, and AD.

  16. HISTORY OF SUNLIGHT EXPOSURE IS A RISK FACTOR FOR AGE-RELATED MACULAR DEGENERATION

    NARCIS (Netherlands)

    Schick, T.; Ersoy, L.; Lechanteur, Y.T.; Saksens, N.T.; Hoyng, C.B.; Hollander, A.I. den; Kirchhof, B.; Fauser, S.

    2016-01-01

    PURPOSE: To evaluate effects of current and past sunlight exposure and iris color on early and late age-related macular degeneration (AMD). METHODS: Of 3,701 individuals from the EUGENDA database, 752 (20.3%) showed early AMD, 1,179 (31.9%) late AMD, and 1,770 (47.8%) were controls. Information abou

  17. Hybrid sunlight/LED illumination and renewable solar energy saving concepts for indoor lighting.

    Science.gov (United States)

    Tsuei, Chih-Hsuan; Sun, Wen-Shing; Kuo, Chien-Cheng

    2010-11-08

    A hybrid method for using sunlight and light-emitting diode (LED) illumination powered by renewable solar energy for indoor lighting is simulated and presented in this study. We can illuminate an indoor space and collect the solar energy using an optical switching system. When the system is turned off, the full spectrum of the sunlight is concentrated by a concentrator, to be absorbed by solar photovoltaic devices that provide the electricity to power the LEDs. When the system is turned on, the sunlight collected by the concentrator is split into visible and non-visible rays by a beam splitter. The visible rays pass through the light guide into a light box where it is mixed with LED light to ultimately provide uniform illumination by a diffuser. The non-visible rays are absorbed by the solar photovoltaic devices to provide electrical power for the LEDs. Simulation results show that the efficiency of the hybrid sunlight/LED illumination with the renewable solar energy saving design is better than that of LED and traditional lighting systems.

  18. Greenhouse Effect: Temperature of a Metal Sphere Surrounded by a Glass Shell and Heated by Sunlight

    Science.gov (United States)

    Nguyen, Phuc H.; Matzner, Richard A.

    2012-01-01

    We study the greenhouse effect on a model satellite consisting of a tungsten sphere surrounded by a thin spherical, concentric glass shell, with a small gap between the sphere and the shell. The system sits in vacuum and is heated by sunlight incident along the "z"-axis. This development is a generalization of the simple treatment of the…

  19. Degradation of benzotriazole and benzothiazole in treatment wetlands and by artificial sunlight.

    Science.gov (United States)

    Felis, Ewa; Sochacki, Adam; Magiera, Sylwia

    2016-11-01

    Laboratory-scale experiments were performed using unsaturated subsurface-flow treatment wetlands and artificial sunlight (with and without TiO2) to study the efficiency of benzotriazole and benzothiazole removal and possible integration of these treatment methods. Transformation products in the effluent from the treatment wetlands and the artificial sunlight reactor were identified by high performance liquid chromatography coupled with tandem mass spectrometry. The removal of benzothiazole in the vegetated treatment wetlands was 99.7%, whereas the removal of benzotriazole was 82.8%. The vegetation positively affected only the removal of benzothiazole. The major transformation products in the effluents from the treatment wetlands were methylated and hydroxylated derivatives of benzotriazole, and hydroxylated derivatives of benzothiazole. Hydroxylation was found to be the main process governing the transformation pathway for both compounds in the artificial sunlight experiment (with and without TiO2). Benzotriazole was not found to be susceptible to photodegradation in the absence of TiO2. The integration of the sunlight-induced processes (with TiO2) with subsurface-flow treatment wetlands caused further elimination of the compounds (42% for benzotriazole and 58% for benzothiazole). This was especially significant for the elimination of benzotriazole, because the removal of this compound was 96% in the coupled processes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Very fast (and safe) inactivation of foot-and-mouth disease virus and enteroviruses by a combination of binary ethyleneimine and formaldehyde.

    Science.gov (United States)

    Barteling, S J; Cassim, N I

    2004-01-01

    For FMD vaccine production, inactivation of the FMD virus is the most critical step. Formerly, from 1940 onwards, the virus was inactivated with formaldehyde. This inactivation was relatively slow, about 0.2 - 0.3 log 10 per hour. Because formaldehyde not only reacts with the virus produced but with many other components in the medium, such as proteins and amino acids, its concentration can become rate-limiting and inactivation plots may show tailing-off, resulting in residual infectivity. Many of the bad stories of post-vaccination outbreaks date back to the use of formaldehyde-inactivated vaccines (e.g. the outbreaks in France in 1981 and in Eastern Germany causing the Danish outbreak in 1982). Much faster and safer inactivation was obtained with aziridines and in the 1980s binary ethyleneimine (BEI) was introduced in practically all vaccine production laboratories. If inactivation plots are made of every production batch, as is now required by the European Pharmacopoeia, and these plots show proper inactivation rates, vaccines can considered to be completely safe. Under optimal conditions, inactivation rates are in the range of 0.5 - 1.0 log 10 per hour. In general, the inactivation takes 40-48 hours,which will guarantee complete inactivation of all virus particles in a batch. Since formaldehyde (FA), the 'classical' inactivating agent, inactivates at a rate of 0.3 logs per hour only, a significant contribution of FA to the inactivation of BEI can hardly be expected. However, here it is shown that FA added during the BEI-inactivation process strongly augments inactivation rates with a hundred to thousand-times (to 2.5-3.5 logs per hour). This will enable inactivation during a working day or just overnight with even higher safety levels of the vaccines. Also, it is known that formaldehyde cross-links viral proteins which will stabilise the antigen. The short inactivation times will limit proteolytic destruction of 146 S antigen and increase antigen yields. It is

  1. Sunlight exposure increases vitamin D sufficiency in growing pigs fed a diet formulated to exceed requirements.

    Science.gov (United States)

    Alexander, B M; Ingold, B C; Young, J L; Fensterseifer, S R; Wechsler, P J; Austin, K J; Larson-Meyer, D E

    2017-04-01

    Traditional confinement practices limit exposure to sunlight and vitamin D synthesis, and vitamin insufficiency occurs even with dietary supplementation. The aim of this study was to determine the effect of limited sun exposure on serum concentration of vitamin D and the expression of vitamin D synthesizing enzymes in the liver and kidney of pigs on a vitamin D sufficient diet. White-pigmented grower pigs (29.7 ± 2.3 kg) fed 15% CP diet ad libitum providing >1,200 IU vitamin D3/kg of feed were exposed to sunlight for 1 h each day at solar noon for 14 d at the spring equinox (March pigs, n = 10) or summer solstice (June pigs, n = 5) and again before slaughter in June (March pigs) and September (June pigs). Blood for the analysis of 25(OH)D was collected before and after sunlight exposure. Traditionally housed pigs served as controls. After initial sun exposure, blood samples were collected from June pigs daily for 5 d and weekly for 8 wk to determine vitamin D3 and 25(OH)D decay, respectively. Kidney and liver samples were collected from the June pigs at slaughter after sun exposure for analysis of messenger RNA expression of vitamin D binding protein and synthesizing/degrading enzymes. Average daily gain (ADG) was not influenced (P > 0.5) by sunlight exposure. June pigs had fewer days on feed, lower (P = 0.003) ADG and were slaughtered at a lighter (P Exposure to sunlight increased (P sunlight exposure increased serum concentration of 25(OH)D in March pigs by 200% and June pigs by 67%. Serum concentration of vitamin D3 was decreased (P exposure. Expression of vitamin D binding protein, vitamin D synthesizing CYP2R1, CYP27A1, CYP2D25, or degrading enzyme CYP24A1 were not influenced (P ≥ 0.19) by sunlight exposure. Expression of CYP27B1 was decreased (P = 0.04) in the kidney but tended to be increased (P = 0.06) in the liver after sun exposure. These results suggest limited sun exposure can efficiently increase serum concentration of vitamin D in growing pigs

  2. IS THERE A LINK BETWEEN SUNLIGHT EXPOSURE AND 25-HYDROXYVITAMIN D DEFICIENCY IN CHRONIC KIDNEY DISEASE PATIENTS?

    Directory of Open Access Journals (Sweden)

    Angela Yee-Moon Wang

    2012-06-01

    In conclusion, our study confirmed an extremely high prevalence of vitamin D deficiency and an important association between outdoor sunlight exposure and 25(OHD deficiency in Chinese stage 3-5 CKD patients. Further study is needed to determine whether increasing daily outdoor sunlight exposure may represent a cost-free treatment for correcting nutritional 25(OHD deficiency in the CKD population.

  3. Effects of UV intensity and water turbidity on microbial indicator inactivation

    Institute of Scientific and Technical Information of China (English)

    LIU Wen-jun; ZHANG Yong-ji

    2006-01-01

    The effects of UV intensity and turbidity on selected microbial indicator inactivation were investigated. Results showed that UV disinfection was effective in killing all the selected microbial indicators, the resistance order of the microorganisms was as follows: MS-2 coliphage > Bacillus subtilis > E. coli > Staphylococcus aureus and Candida albicans. UV intensity had influence on the inactivation of all the microorganisms, high UV disinfection efficency was obtained with higher UV intensity. Turbidity had impact on the bacteria inactivation rate, but there was no evidence that turbidity had any negative contribution to MS-2 coliphage. Under the same UV dosage, higher UV intensity could overcome the negative influence of turbidity on UV performance, enhanced microorganism inactivation effect in turbidity water.

  4. Photosensitized rose Bengal-induced phototoxicity on human melanoma cell line under natural sunlight exposure.

    Science.gov (United States)

    Srivastav, Ajeet K; Mujtaba, Syed Faiz; Dwivedi, Ashish; Amar, Saroj K; Goyal, Shruti; Verma, Ankit; Kushwaha, Hari N; Chaturvedi, Rajnish K; Ray, Ratan Singh

    2016-03-01

    Rose Bengal (RB) is an anionic water-soluble xanthene dye, which used for many years to assess eye cornea and conjunctiva damage. RB showed strong absorption maxima (λmax) under visible light followed by UV-B and UV-A. RB under sunlight exposure showed a time-dependent photodegradation. Our results show that photosensitized RB generates (1)O2 via Type-II photodynamic pathway and induced DNA damage under sunlight/UV-R exposure. 2'dGuO degradation, micronuclei formation, and single- and double-strand breakage were the outcome of photogenotoxicity caused by RB. Quenching studies with NaN3 advocate the involvement of (1)O2 in RB photogenotoxicity. RB induced linoleic acid photoperoxidation, which was parallel to (1)O2-mediated DNA damage. Oxidative stress in A375 cell line (human melanoma cell line) was detected through DCF-DA assay. Photosensitized RB decreased maximum cellular viability under sunlight followed by UV-B and UV-A exposures. Apoptosis was detected as a pattern of cell death through the increased of caspase-3 activity, decreased mitochondrial membrane potential, and PS translocation through inner to outer plasma membrane. Increased cytosolic levels of Bax also advocate the apoptotic cell death. We propose a p53-mediated apoptosis via increased expression of Bax gene and protein. Thus, the exact mechanism behind RB phototoxicity was the involvement of (1)O2, which induced oxidative stress-mediated DNA and membrane damage, finally apoptotic cell death under natural sunlight exposure. The study suggests that after the use of RB, sunlight exposure may avoid to prevent from its harmful effects. Copyright © 2015. Published by Elsevier B.V.

  5. Effect of Sunlight Radiation on the Growth and Chemical Constituents of Salvia plebeia R.Br.

    Directory of Open Access Journals (Sweden)

    Hyun-Jae Jang

    2017-08-01

    Full Text Available This study investigated the chemical composition changes of Salvia plebeia R.Br. cultivated under different light sources, including florescent light and sunlight. The plants were exposed to fluorescent light for four months and sunlight and then examined for the next 5–7 months. Plants were harvested monthly during the seven months, and we examined whether the difference in light source affected the phenolic and flavonoid contents and antioxidant activity. A simple and reliable HPLC method using a PAH C18 column was applied for the quantitative analysis of two triterpenoids from the S. plebeia groups. Oleanolic acid (OA and ursolic acid (UA showed good linearity (R2 > 0.9999 within the test ranges (0.005–0.05 mg/mL, and the average percentage recoveries of the OA and UA were 95.1–104.8% and 97.2–107.1%, respectively. The intra- and inter-day relative standard deviations (RSDs were less than 2.0%. After exposure to sunlight, the phenolic contents, including rosmarinic acid, showed a reduced tendency, whereas the flavonoid contents, including homoplantaginin and luteolin 7-glucoside, were increased. The content of the triterpenoids also showed an increased tendency under sunlight irradiation, but the variance was not larger than those of the phenolic and flavonoid contents. Among experimental groups, the group harvested at six months, having been exposed to sunlight for two months, showed the most potent antioxidant activity. Therefore, these results showed that the chemical composition and antioxidant activities of S. plebeia R.Br. was affected from environmental culture conditions, such as light source. Our studies will be useful for the development of functional materials using S. plebeia R.Br.

  6. Effect of Sunlight Radiation on the Growth and Chemical Constituents of Salvia plebeia R.Br.

    Science.gov (United States)

    Jang, Hyun-Jae; Lee, Seung-Jae; Kim, Cha Young; Hwang, Joo Tae; Choi, Jung Ho; Park, Jee Hun; Lee, Seung Woong; Rho, Mun-Chual

    2017-08-01

    This study investigated the chemical composition changes of Salvia plebeia R.Br. cultivated under different light sources, including florescent light and sunlight. The plants were exposed to fluorescent light for four months and sunlight and then examined for the next 5-7 months. Plants were harvested monthly during the seven months, and we examined whether the difference in light source affected the phenolic and flavonoid contents and antioxidant activity. A simple and reliable HPLC method using a PAH C18 column was applied for the quantitative analysis of two triterpenoids from the S. plebeia groups. Oleanolic acid (OA) and ursolic acid (UA) showed good linearity (R² > 0.9999) within the test ranges (0.005-0.05 mg/mL), and the average percentage recoveries of the OA and UA were 95.1-104.8% and 97.2-107.1%, respectively. The intra- and inter-day relative standard deviations (RSDs) were less than 2.0%. After exposure to sunlight, the phenolic contents, including rosmarinic acid, showed a reduced tendency, whereas the flavonoid contents, including homoplantaginin and luteolin 7-glucoside, were increased. The content of the triterpenoids also showed an increased tendency under sunlight irradiation, but the variance was not larger than those of the phenolic and flavonoid contents. Among experimental groups, the group harvested at six months, having been exposed to sunlight for two months, showed the most potent antioxidant activity. Therefore, these results showed that the chemical composition and antioxidant activities of S. plebeia R.Br. was affected from environmental culture conditions, such as light source. Our studies will be useful for the development of functional materials using S. plebeia R.Br.

  7. An inactivated yellow fever 17DD vaccine cultivated in Vero cell cultures.

    Science.gov (United States)

    Pereira, Renata C; Silva, Andrea N M R; Souza, Marta Cristina O; Silva, Marlon V; Neves, Patrícia P C C; Silva, Andrea A M V; Matos, Denise D C S; Herrera, Miguel A O; Yamamura, Anna M Y; Freire, Marcos S; Gaspar, Luciane P; Caride, Elena

    2015-08-20

    Yellow fever is an acute infectious disease caused by prototype virus of the genus Flavivirus. It is endemic in Africa and South America where it represents a serious public health problem causing epidemics of hemorrhagic fever with mortality rates ranging from 20% to 50%. There is no available antiviral therapy and vaccination is the primary method of disease control. Although the attenuated vaccines for yellow fever show safety and efficacy it became necessary to develop a new yellow fever vaccine due to the occurrence of rare serious adverse events, which include visceral and neurotropic diseases. The new inactivated vaccine should be safer and effective as the existing attenuated one. In the present study, the immunogenicity of an inactivated 17DD vaccine in C57BL/6 mice was evaluated. The yellow fever virus was produced by cultivation of Vero cells in bioreactors, inactivated with β-propiolactone, and adsorbed to aluminum hydroxide (alum). Mice were inoculated with inactivated 17DD vaccine containing alum adjuvant and followed by intracerebral challenge with 17DD virus. The results showed that animals receiving 3 doses of the inactivated vaccine (2 μg/dose) with alum adjuvant had neutralizing antibody titers above the cut-off of PRNT50 (Plaque Reduction Neutralization Test). In addition, animals immunized with inactivated vaccine showed survival rate of 100% after the challenge as well as animals immunized with commercial attenuated 17DD vaccine.

  8. Inactivation of enzymes by organic solvents: New technique with well-defined interfacial area

    Energy Technology Data Exchange (ETDEWEB)

    Ghatorae, A.S.; Bell, G.; Halling, P.J. (Univ. of Strathclyde, Glasgow (United Kingdom))

    1994-02-20

    A liquid-liquid bubble column apparatus allows exposure of enzyme solutions to water-immiscible organic solvents with a known total interfacial area and well-defined time scales and flow. It allows clear distinction of the different classes of inactivation mechanism. With urease as a model enzyme, octan-2-one and butylbenzene act only through the effects of solvent molecules dissolved in the aqueous phase, giving first-order inactivation at 0.34 and 0.21 h[sup [minus]1], respectively. Hexane and tridecane act only through exposure to the interface. The amount of urease inactivated is proportional to the total area of interface exposed, rather than to elapsed time, and may be characterized by a rate of about 0.5 [mu]kat m[sup [minus]2]. This is consistent with the formation and inactivation of a complete adsorbed monolayer of protein. With butan-1-ol, both mechanisms contribute significantly to the observed inactivation. The presence of O[sub 2] increases the rate of interfacial inactivation, but not that by dissolved solvent.

  9. Regulation of Na(+) channel inactivation by the DIII and DIV voltage-sensing domains.

    Science.gov (United States)

    Hsu, Eric J; Zhu, Wandi; Schubert, Angela R; Voelker, Taylor; Varga, Zoltan; Silva, Jonathan R

    2017-03-06

    Functional eukaryotic voltage-gated Na(+) (NaV) channels comprise four domains (DI-DIV), each containing six membrane-spanning segments (S1-S6). Voltage sensing is accomplished by the first four membrane-spanning segments (S1-S4), which together form a voltage-sensing domain (VSD). A critical NaV channel gating process, inactivation, has previously been linked to activation of the VSDs in DIII and DIV. Here, we probe this interaction by using voltage-clamp fluorometry to observe VSD kinetics in the presence of mutations at locations that have been shown to impair NaV channel inactivation. These locations include the DIII-DIV linker, the DIII S4-S5 linker, and the DIV S4-S5 linker. Our results show that, within the 10-ms timeframe of fast inactivation, the DIV-VSD is the primary regulator of inactivation. However, after longer 100-ms pulses, the DIII-DIV linker slows DIII-VSD deactivation, and the rate of DIII deactivation correlates strongly with the rate of recovery from inactivation. Our results imply that, over the course of an action potential, DIV-VSDs regulate the onset of fast inactivation while DIII-VSDs determine its recovery.

  10. Ribosome Inactivating Proteins from Rosaceae.

    Science.gov (United States)

    Shang, Chenjing; Rougé, Pierre; Van Damme, Els J M

    2016-08-22

    Ribosome-inactivating proteins (RIPs) are widespread among higher plants of different taxonomic orders. In this study, we report on the RIP sequences found in the genome/transcriptome of several important Rosaceae species, including many economically important edible fruits such as apple, pear, peach, apricot, and strawberry. All RIP domains from Rosaceae share high sequence similarity with conserved residues in the catalytic site and the carbohydrate binding sites. The genomes of Malus domestica and Pyrus communis contain both type 1 and type 2 RIP sequences, whereas for Prunus mume, Prunus persica, Pyrus bretschneideri, and Pyrus communis a complex set of type 1 RIP sequences was retrieved. Heterologous expression and purification of the type 1 as well as the type 2 RIP from apple allowed to characterize the biological activity of the proteins. Both RIPs from Malus domestica can inhibit protein synthesis. Furthermore, molecular modelling suggests that RIPs from Rosaceae possess three-dimensional structures that are highly similar to the model proteins and can bind to RIP substrates. Screening of the recombinant type 2 RIP from apple on a glycan array revealed that this type 2 RIP interacts with terminal sialic acid residues. Our data suggest that the RIPs from Rosaceae are biologically active proteins.

  11. Population Dynamics of Viral Inactivation

    Science.gov (United States)

    Freeman, Krista; Li, Dong; Behrens, Manja; Streletzky, Kiril; Olsson, Ulf; Evilevitch, Alex

    We have investigated the population dynamics of viral inactivation in vitrousing time-resolved cryo electron microscopy combined with light and X-ray scattering techniques. Using bacteriophage λ as a model system for pressurized double-stranded DNA viruses, we found that virions incubated with their cell receptor eject their genome in a stochastic triggering process. The triggering of DNA ejection occurs in a non synchronized manner after the receptor addition, resulting in an exponential decay of the number of genome-filled viruses with time. We have explored the characteristic time constant of this triggering process at different temperatures, salt conditions, and packaged genome lengths. Furthermore, using the temperature dependence we determined an activation energy for DNA ejections. The dependences of the time constant and activation energy on internal DNA pressure, affected by salt conditions and encapsidated genome length, suggest that the triggering process is directly dependent on the conformational state of the encapsidated DNA. The results of this work provide insight into how the in vivo kinetics of the spread of viral infection are influenced by intra- and extra cellular environmental conditions. This material is based upon work supported by the National Science Foundation Graduate Research Fellowship under Grant No. DGE-1252522.

  12. Direct sunlight facility for testing and research in HCPV

    Science.gov (United States)

    Sciortino, Luisa; Agnello, Simonpietro; Barbera, Marco; Bonsignore, Gaetano; Buscemi, Alessandro; Candia, Roberto; Cannas, Marco; Collura, Alfonso; Di Cicca, Gaspare; Gelardi, Franco Mario; Cicero, Ugo Lo; Montagnino, Fabio Maria; Napoli, Gianluca; Paredes, Filippo; Spallino, Luisa; Varisco, Salvo

    2014-09-01

    A facility for testing different components for HCPV application has been developed in the framework of "Fotovoltaico ad Alta Efficienza" (FAE) project funded by the Sicilian Regional Authority (PO FESR Sicilia 2007/2013 4.1.1.1). The testing facility is equipped with an heliostat providing a wide solar beam inside the lab, an optical bench for mounting and aligning the HCPV components, electronic equipments to characterize the I-V curves of multijunction cells operated up to 2000 suns, a system to circulate a fluid in the heat sink at controlled temperature and flow-rate, a data logging system with sensors to measure temperatures in several locations and fluid pressures at the inlet and outlet of the heat sink, and a climatic chamber with large test volume to test assembled HCPV modules.

  13. Direct sunlight facility for testing and research in HCPV

    Energy Technology Data Exchange (ETDEWEB)

    Sciortino, Luisa, E-mail: luisa.sciortino@unipa.it; Agnello, Simonpietro, E-mail: luisa.sciortino@unipa.it; Bonsignore, Gaetano; Cannas, Marco; Gelardi, Franco Mario; Napoli, Gianluca; Spallino, Luisa [Dipartimento di Fisica e Chimica, Università degli Studi di Palermo, Via Archirafi 36, 90123 PA (Italy); Barbera, Marco [Dipartimento di Fisica e Chimica, Università degli Studi di Palermo, Via Archirafi 36, 90123 PA, Italy and Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Palermo G. S. Vaiana, Piazza del Parlamento 1, 90134 PA (Italy); Buscemi, Alessandro; Montagnino, Fabio Maria; Paredes, Filippo [IDEA s.r.l., Contrada Molara, Zona Industriale III Fase, 90018 Termini Imerese (Panama) (Italy); Candia, Roberto; Collura, Alfonso; Di Cicca, Gaspare; Cicero, Ugo Lo; Varisco, Salvo [Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Palermo G. S. Vaiana, Piazza del Parlamento 1, 90134 PA (Italy)

    2014-09-26

    A facility for testing different components for HCPV application has been developed in the framework of 'Fotovoltaico ad Alta Efficienza' (FAE) project funded by the Sicilian Regional Authority (PO FESR Sicilia 2007/2013 4.1.1.1). The testing facility is equipped with an heliostat providing a wide solar beam inside the lab, an optical bench for mounting and aligning the HCPV components, electronic equipments to characterize the I-V curves of multijunction cells operated up to 2000 suns, a system to circulate a fluid in the heat sink at controlled temperature and flow-rate, a data logging system with sensors to measure temperatures in several locations and fluid pressures at the inlet and outlet of the heat sink, and a climatic chamber with large test volume to test assembled HCPV modules.

  14. Behavioral inspiratory inhibition: inactivated and activated respiratory cells.

    Science.gov (United States)

    Orem, J

    1989-11-01

    1. Eleven adult cats were trained to stop inspiration in response to a conditioning stimulus. The conditioning stimuli were presented at the onset of inspiration at intervals of approximately 20-30 s. Intratracheal pressures, diaphragmatic activity, and the extracellular activity of single medullary respiratory neurons were recorded while the animals performed this response. 2. Inactivation of the diaphragm to the conditioning stimuli occurred at latencies that varied from 40 to 110 ms and averaged 74 +/- 32 (SD) ms. 3. The subjects of this report are 38 inspiratory neurons that were inactivated and 19 cells that were activated when inspiration was stopped behaviorally. These cells were located in the region of n. ambiguus and the ventrolateral n. of tractus solitarius. 4. The inspiratory cells that were inactivated behaviorally had the following characteristics: 1) Most had an augmenting inspiratory profile with (n = 14) or without (n = 9) postinspiratory activity. Other types were inspiratory throughout (n = 5), decrementing inspiratory (n = 3), tonic inspiratory (n = 4), early inspiratory (n = 2), and expiratory-inspiratory (n = 1). 2) Their mean discharge rate was 39 +/- 2.7 (SE) Hz. 3) The latency of their inactivation in response to the task averaged 81 +/- 4.9 (SE) ms, and 4) Their activity corresponded closely to breathing not only during the behavioral response but also during eupnea (eta 2 = 0.62 +/- 0.04, mean +/- SE) and respiratory acts such as sneezing, sniffing, meowing, and purring. 5. The cells that were activated when inspiration was stopped behaviorally had the following characteristics. 1) As a group, they had discharge profiles related to every phase of the respiratory cycle. 2) They were recorded in the same region as, and often simultaneously with, respiratory cells that were inactivated. 3) Their activity patterns were highly variable such that the signal strength and consistency of the respiratory component of that activity were weak (eta 2

  15. Effect of sunlight exposure on cognitive function among depressed and non-depressed participants: a REGARDS cross-sectional study.

    Science.gov (United States)

    Kent, Shia T; McClure, Leslie A; Crosson, William L; Arnett, Donna K; Wadley, Virginia G; Sathiakumar, Nalini

    2009-07-28

    Possible physiological causes for the effect of sunlight on mood are through the suprachiasmatic nuclei and evidenced by serotonin and melatonin regulation and its associations with depression. Cognitive function involved in these same pathways may potentially be affected by sunlight exposure. We evaluated whether the amount of sunlight exposure (i.e. insolation) affects cognitive function and examined the effect of season on this relationship. We obtained insolation data for residential regions of 16,800 participants from a national cohort study of blacks and whites, aged 45+. Cognitive impairment was assessed using a validated six-item screener questionnaire and depression status was assessed using the Center for Epidemiologic Studies Depression Scale. Logistic regression was used to find whether same-day or two-week average sunlight exposure was related to cognitive function and whether this relationship differed by depression status. Among depressed participants, a dose-response relationship was found between sunlight exposure and cognitive function, with lower levels of sunlight associated with impaired cognitive status (odds ratio = 2.58; 95% CI 1.43-6.69). While both season and sunlight were correlated with cognitive function, a significant relation remained between each of them and cognitive impairment after controlling for their joint effects. The study found an association between decreased exposure to sunlight and increased probability of cognitive impairment using a novel data source. We are the first to examine the effects of two-week exposure to sunlight on cognition, as well as the first to look at sunlight's effects on cognition in a large cohort study.

  16. Sunlight exposure during leisure activities and risk of prostate cancer in Montréal, Canada, 2005-2009.

    Science.gov (United States)

    Yu, Jennifer; Lavoué, Jérôme; Parent, Marie-Élise

    2014-07-28

    Prostate cancer (PCa) is the leading cause of cancer in men in many developed countries, but no modifiable risk factors have been identified. A handful of analytical studies have suggested a possible etiological role for sunlight exposure. We report here on the association between leisure-time sunlight exposure during adulthood and PCa risk in the context of a population-based case-control study. In all, 1,904 PCa cases were ascertained across Montreal French hospitals between 2005 and 2009. Concurrently, 1,962 population controls, frequency matched to cases by age (±5 years), were selected from the electoral list for French-speakers in Greater Montreal. Interviews elicited the frequency of engagement in any leisure activity during adulthood. This was used to derive cumulative sunlight exposure indices: a cumulative number of leisure activities events entailing sunlight exposure and a cumulative duration of sunlight exposure during leisure activities. Unconditional logistic regression was conducted to yield odds ratios (OR) and 95% confidence intervals (CI) for estimating the association between sunlight exposure indices and PCa risk, adjusting for age, ancestry, family history of PCa, PCa screening, education, solar protection, body mass index and physical activity. Compared with men in the upper quartile category for the number of sunlight exposure events, men never exposed during leisure time had an OR of 1.32 (95% CI: 0.82-2.14). ORs were 1.11, 0.91 and 1.00 for the first to the third quartiles of exposure, respectively. Similar results were observed for cumulative duration of exposure to sunlight, and by PCa aggressiveness. These findings provide little evidence of an association between sunlight exposure during leisure-time and PCa risk. Men with no sunlight exposure appeared at somewhat higher risks but none of the estimates achieved statistical significance.

  17. Photosensitizers mediated photodynamic inactivation against virus particles.

    Science.gov (United States)

    Sobotta, Lukasz; Skupin-Mrugalska, Paulina; Mielcarek, Jadwiga; Goslinski, Tomasz; Balzarini, Jan

    2015-01-01

    Viruses cause many diseases in humans from the rather innocent common cold to more serious or chronic, life-threatening infections. The long-term side effects, sometimes low effectiveness of standard pharmacotherapy and the emergence of drug resistance require a search for new alternative or complementary antiviral therapeutic approaches. One new approach to inactivate microorganisms is photodynamic antimicrobial chemotherapy (PACT). PACT has evolved as a potential method to inactivate viruses. The great challenge for PACT is to develop a methodology enabling the effective inactivation of viruses while leaving the host cells as untouched as possible. This review aims to provide some main directions of antiviral PACT, taking into account different photosensitizers, which have been widely investigated as potential antiviral agents. In addition, several aspects concerning PACT as a tool to assure viral inactivation in human blood products will be addressed.

  18. Inactivation of Viruses by Benzalkonium Chloride

    Science.gov (United States)

    Armstrong, J. A.; Froelich, E. J.

    1964-01-01

    Benzalkonium chloride (as Roccal or Zephiran) was found to inactivate influenza, measles, canine distemper, rabies, fowl laryngotracheitis, vaccinia, Semliki Forest, feline pneumonitis, meningopneumonitis, and herpes simplex viruses after 10 min of exposure at 30 C or at room temperature. Poliovirus and encephalomyocarditis virus were not inactivated under the same conditions. It was concluded that all viruses tested were sensitive except members of the picorna group. The literature was reviewed. PMID:4288740

  19. Inactivated properties of activated carbon-supported TiO2 nanoparticles for bacteria and kinetic study.

    Science.gov (United States)

    Li, Youji; Ma, Mingyuan; Wang, Xiaohu; Wang, Xiaohua

    2008-01-01

    The activated carbon-supported TiO2 nanoparticles (TiO2/AC) were prepared by a properly controlled sol-gel method. The effects of activated carbons (AC) support on inactivated properties of TiO2 nanoparticles were evaluated by photocatalytic inactivation experiments of Escherichia coli. The key factors affecting the inactivation efficiency were investigated, including electric power of lamp, temperature, and pH values. The results show that the TiO2/AC composites have high inactivation properties of E. coli in comparison with pure TiO2 powder. The kinetics of photocatalytic inactivation of E. coli was found to follow a pseudo-first order rate law for TiO2/AC composites, and kinetic behavior could be described in terms of a modified Langmuir-Hinshelwood model. The values of the adsorption equilibrium constants for the bacteria, K(c), and for the rate constants, k(r), were certainly depended on TiO2 content. At 47 wt.% TiO2 coatings with the highest rate constant, the K(c) and k(r) were 1.17 x 10(-8) L/cfu and 1.43 x 10(6) cfu/(L x min), respectively. The variety of parameters shows significant effects on inactivation rate. The outer layer of bacteria decomposed first resulting in inactivation of cell, and with further illumination, the cells nearly decomposed.

  20. Inactivation of Salmonella during cocoa roasting and chocolate conching.

    Science.gov (United States)

    Nascimento, Maristela da Silva do; Brum, Daniela Merlo; Pena, Pamela Oliveira; Berto, Maria Isabel; Efraim, Priscilla

    2012-10-15

    The high heat resistance of Salmonella in foods with low water activity raises particular issues for food safety, especially chocolate, where outbreak investigations indicate that few colony-forming units are necessary to cause salmonellosis. This study evaluated the efficiency of cocoa roasting and milk chocolate conching in the inactivation of Salmonella 5-strain suspension. Thermal resistance of Salmonella was greater in nibs compared to cocoa beans upon exposure at 110 to 130°C. The D-values in nibs were 1.8, 2.2 and 1.5-fold higher than those calculated for cocoa beans at 110, 120 and 130°C. There was no significant difference (p>0.05) between the matrices only at 140°C. Since in the conching of milk chocolate the inactivation curves showed rapid death in the first 180 min followed by a lower inactivation rate, and two D-values were calculated. For the first time interval (0-180 min) the D-values were 216.87, 102.27 and 50.99 min at 50, 60 and 70°C, respectively. The other D-values were determined from the second time interval (180-1440 min), 1076.76 min at 50°C, 481.94 min at 60°C and 702.23 min at 70°C. The results demonstrated that the type of matrix, the process temperature and the initial count influenced the Salmonella resistance.

  1. Effect of intracellular Ca2+ and action potential duration on L-type Ca2+ channel inactivation and recovery from inactivation in rabbit cardiac myocytes.

    Science.gov (United States)

    Altamirano, Julio; Bers, Donald M

    2007-07-01

    Ca(2+) current (I(Ca)) recovery from inactivation is necessary for normal cardiac excitation-contraction coupling. In normal hearts, increased stimulation frequency increases force, but in heart failure (HF) this force-frequency relationship (FFR) is often flattened or reversed. Although reduced sarcoplasmic reticulum Ca(2+)-ATPase function may be involved, decreased I(Ca) availability may also contribute. Longer action potential duration (APD), slower intracellular Ca(2+) concentration ([Ca(2+)](i)) decline, and higher diastolic [Ca(2+)](i) in HF could all slow I(Ca) recovery from inactivation, thereby decreasing I(Ca) availability. We measured the effect of different diastolic [Ca(2+)](i) on I(Ca) inactivation and recovery from inactivation in rabbit cardiac myocytes. Both I(Ca) and Ba(2+) current (I(Ba)) were measured. I(Ca) decay was accelerated only at high diastolic [Ca(2+)](i) (600 nM). I(Ba) inactivation was slower but insensitive to [Ca(2+)](i). Membrane potential dependence of I(Ca) or I(Ba) availability was not affected by [Ca(2+)](i) <600 nM. Recovery from inactivation was slowed by both depolarization and high [Ca(2+)](i). We also used perforated patch with action potential (AP)-clamp and normal Ca(2+) transients, using various APDs as conditioning pulses for different frequencies (and to simulate HF APD). Recovery of I(Ca) following longer APD was increasingly incomplete, decreasing I(Ca) availability. Trains of long APs caused a larger I(Ca) decrease than short APD at the same frequency. This effect on I(Ca) availability was exacerbated by slowing twitch [Ca(2+)](i) decline by approximately 50%. We conclude that long APD and slower [Ca(2+)](i) decline lead to cumulative inactivation limiting I(Ca) at high heart rates and might contribute to the negative FFR in HF, independent of altered Ca(2+) channel properties.

  2. The use of chlorine dioxide for the inactivation of copepod zooplankton in drinking water treatment.

    Science.gov (United States)

    Lin, Tao; Chen, Wei; Cai, Bo

    2014-01-01

    The presence of zooplankton in drinking water treatment system may cause a negative effect on the aesthetic value of drinking water and may also increase the threat to human health due to they being the carriers of bacteria. Very little research has been done on the effects of copepod inactivation and the mechanisms involved in this process. In a series of bench-scale experiments we used a response surface method to assess the sensitivity of copepod to inactivation when chlorine dioxide (ClO₂) was used as a disinfectant. We also assessed the effects of the ClO₂dosage, exposure time, organic matter concentration and temperature. Results indicated that the inactivation rate improved with increasing dosage, exposure time and temperature, whereas it decreased with increasing organic matter concentration. Copepod inactivation was more sensitive to the ClO₂dose than that to the exposure time, while being maintained at the same Ct-value conditions. The activation energy at different temperatures revealed that the inactivation of copepods with ClO₂was temperature-dependent. The presence of organic matter resulted in a lower available dose as well as a shorter available exposure time, which resulted in a decrease in inactivation efficiency.

  3. Bacteria and fungi inactivation by photocatalysis under UVA irradiation: liquid and gas phase.

    Science.gov (United States)

    Rodrigues-Silva, Caio; Miranda, Sandra M; Lopes, Filipe V S; Silva, Mário; Dezotti, Márcia; Silva, Adrián M T; Faria, Joaquim L; Boaventura, Rui A R; Vilar, Vítor J P; Pinto, Eugénia

    2017-03-01

    In the last decade, environmental risks associated with wastewater treatment plants (WWTPs) have become a concern in the scientific community due to the absence of specific legislation governing the occupational exposure limits (OEL) for microorganisms present in indoor air. Thus, it is necessary to develop techniques to effectively inactivate microorganisms present in the air of WWTPs facilities. In the present work, ultraviolet light A radiation was used as inactivation tool. The microbial population was not visibly reduced in the bioaerosol by ultraviolet light A (UVA) photolysis. The UVA photocatalytic process for the inactivation of microorganisms (bacteria and fungi, ATCC strains and isolates from indoor air samples of a WWTP) using titanium dioxide (TiO2 P25) and zinc oxide (ZnO) was tested in both liquid-phase and airborne conditions. In the slurry conditions at liquid phase, P25 showed a better performance in inactivation. For this reason, gas-phase assays were performed in a tubular photoreactor packed with cellulose acetate monolithic structures coated with P25. The survival rate of microorganisms under study decreased with the catalyst load and the UVA exposure time. Inactivation of fungi was slower than resistant bacteria, followed by Gram-positive bacteria and Gram-negative bacteria. Graphical abstract Inactivation of fungi and bacteria in gas phase by photocatalitic process performed in a tubular photoreactor packed with cellulose acetate monolith structures coated with TiO2.

  4. Inactivation of pathogenic bacteria in food matrices: high pressure processing, photodynamic inactivation and pressure-assisted photodynamic inactivation

    Science.gov (United States)

    Cunha, A.; Couceiro, J.; Bonifácio, D.; Martins, C.; Almeida, A.; Neves, M. G. P. M. S.; Faustino, M. A. F.; Saraiva, J. A.

    2017-09-01

    Traditional food processing methods frequently depend on the application of high temperature. However, heat may cause undesirable changes in food properties and often has a negative impact on nutritional value and organoleptic characteristics. Therefore, reducing the microbial load without compromising the desirable properties of food products is still a technological challenge. High-pressure processing (HPP) can be classified as a cold pasteurization technique, since it is a non-thermal food preservation method that uses hydrostatic pressure to inactivate spoilage microorganisms. At the same time, it increases shelf life and retains the original features of food. Photodynamic inactivation (PDI) is also regarded as promising approach for the decontamination of food matrices. In this case, the inactivation of bacterial cells is achieved by the cytotoxic effects of reactive oxygens species (ROS) produced from the combined interaction of a photosensitizer molecule, light and oxygen. This short review examines some recent developments on the application of HPP and PDI with food-grade photosensitizers for the inactivation of listeriae, taken as a food pathogen model. The results of a proof-of-concept trial of the use of high-pressure as a coadjutant to increase the efficiency of photodynamic inactivation of bacterial endospores is also addressed.

  5. Inactivated properties of activated carbon-supported TiO2 nanoparticles for bacteria and kinetic study

    Institute of Scientific and Technical Information of China (English)

    LI Youji; MA Mingyuan; WANG Xiaohu; WANG Xiaohua

    2008-01-01

    The activated carbon-supported TiO2 nanoparticles (TiO2/AC) were prepared by a properly controlled sol-gel method. The effects of activated carbons (AC) support on inactivated properties of TiO2 nanoparticles were evaluated by photocatalytic inactivation experiments ofEscherichia coli. The key factors affecting the inactivation efficiency were investigated, including electric power of lamp, temperature, and pH values. The results show that the TiO2/AC composites have high inactivation properties of E. coli in comparison with pure TiO2 powder. The kinetics of photocatalytic inactivation of E. coli was found to follow a pseudo-first order rate law for TiO2/AC composites, and kinetic behavior could be described in terms of a modified Langmuir-Hinshelwood model. The values of the adsorption equilibrium constants for the bacteria, Kc, and for the rate constants, kr, were certainly depended on TiO2 content. At 47 variety of parameters shows significant effects on inactivation rate. The outer layer of bacteria decomposed first resulting in inactivation of cell, and with further illumination, the cells nearly decomposed.

  6. Enhanced sunlight photocatalytic activity of Ag3PO4 decorated novel combustion synthesis derived TiO2 nanobelts for dye and bacterial degradation.

    Science.gov (United States)

    Eswar, Neerugatti KrishnaRao; Ramamurthy, Praveen Chandrashekarapura; Madras, Giridhar

    2015-07-01

    This study demonstrates the synthesis of TiO2 nanobelts using solution combustion derived TiO2 with enhanced photocatalytic activity for dye degradation and bacterial inactivation. Hydrothermal treatment of combustion synthesized TiO2 resulted in unique partially etched TiO2 nanobelts and Ag3PO4 was decorated using the co-precipitation method. The catalyst particles were characterized using X-ray diffraction analysis, BET surface area analysis, diffuse reflectance and electron microscopy. The photocatalytic properties of the composites of Ag3PO4 with pristine combustion synthesized TiO2 and commercial TiO2 under sunlight were compared. Therefore the studies conducted proved that the novel Ag3PO4/unique combustion synthesis derived TiO2 nanobelt composites exhibited extended light absorption, better charge transfer mechanism and higher generation of hydroxyl and hole radicals. These properties resulted in enhanced photodegradation of dyes and bacteria when compared to the commercial TiO2 nanocomposite. These findings have important implications in designing new photocatalysts for water purification.

  7. A critical role for the S4-S5 intracellular loop in domain IV of the sodium channel alpha-subunit in fast inactivation.

    Science.gov (United States)

    McPhee, J C; Ragsdale, D S; Scheuer, T; Catterall, W A

    1998-01-09

    Na+ channel fast inactivation is thought to involve the closure of an intracellular inactivation gate over the channel pore. Previous studies have implicated the intracellular loop connecting domains III and IV and a critical IFM motif within it as the inactivation gate, but amino acid residues at the intracellular mouth of the pore required for gate closure and binding have not been positively identified. The short intracellular loops connecting the S4 and S5 segments in each domain of the Na+ channel alpha-subunit are good candidates for this role in the Na+ channel inactivation process. In this study, we used scanning mutagenesis to examine the role of the IVS4-S5 region in fast inactivation. Mutations F1651A, near the middle of the loop, and L1660A and N1662A, near the COOH-terminal end, substantially disrupted Na+ channel fast inactivation. The mutant F1651A conducted Na+ currents that decayed very slowly, while L1660A and N1662A had large sustained Na+ currents at the end of 30-ms depolarizing pulses. Inactivation of macroscopic Na+ currents was nearly abolished by the N1662A mutation and the combination of the F1651A/L1660A mutations. Single channel analysis revealed frequent reopenings for all three mutants during 40-ms depolarizing pulses, indicating a substantial impairment of the stability of the inactivated state compared with wild type (WT). The F1651A and N1662A mutants also had increased mean open times relative to WT, indicating a slowed rate of entry into the inactivated state. In addition to these effects on inactivation of open Na+ channels, mutants F1651A, L1660A, and N1662A also impaired fast inactivation of closed Na+ channels, as assessed from measurements of the maximum open probability of single channels. The peptide KIFMK mimics the IFM motif of the inactivation gate and provides a test of the effect of mutations on the hydrophobic interaction of this motif with the inactivation gate receptor. KIFMK restores fast inactivation of open

  8. Formation of Silicon Carbide Using Volcanic Ash as Starting Material and Concentrated Sunlight as Energy Resource

    Directory of Open Access Journals (Sweden)

    Kensuke Nishioka

    2015-01-01

    Full Text Available SiC was formed using volcanic ash as starting material and concentrated sunlight as energy resource. The solar furnace was composed of two parts: Fresnel lens and reacting furnace. The reacting furnace was composed of a cylindrical vacuum chamber and quartz glass plate functioning to guide the concentrated sunlight into the furnace and was placed at the focal point of the Fresnel lens. The sample was made from the mixture of silica formed from volcanic ash and graphite and placed in the carbon crucible inside the reacting furnace. The temperature in the carbon crucible reached more than 1500°C. After the reaction using concentrated light, β-SiC was formed. The weight % of formed SiC was 90.5%.

  9. Sensitized photoelectrolysis of water with sunlight. Final report, June 1, 1977-December 31, 1978

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, A.K.; Maruska, H.P.

    1978-12-01

    A study was made of solar driven water photoelectrolysis cells employing semiconductor electrodes. An extensive review of the literature was undertaken, and the three major problem areas for these devices were identified: corrosion, poor sunlight absorption, and external bias requirement. Although many semiconductors had been tested, none had proven free of all three defects. Two approaches were thus followed for the experimental studies: impurity sensitization of wide band gap stable oxides, and heterostructure formation between unstable sunlight absorbers and corrosion resistant oxides. Water decomposition was achieved with visible light excitation of Cr-doped TiO/sub 2/. Transport properties were studies for TiO/sub 2/ and SrTiO/sub 3/ electrodes doped with V, Cr, Mn, Fe, Co, and Ni. The correlation between bias requirement and electron affinity of oxides was identified. Performance of heterostructure electrodes was shown to be limited either by pin hole problems or by potential barriers between the valence bands.

  10. Sunlight-activated AlFeO3/TiO2 photocatalyst

    Institute of Scientific and Technical Information of China (English)

    YUAN; Zhihao; WANG; Yuhong; SUN; Yongchang; WANG; Jing; BIE; Lijian; DUAN; Yueqing

    2006-01-01

    A nanocomposite photocatalyst composed of AlFeO3 and TiO2 is prepared, and characterized through X-ray diffraction. Application of the nanocomposite for the photodegradations of eosin dye and methyl orange gives an improved photoactivity compared with TiO2-only nanomaterials. The optimal concentration of AlFeO3 in the composite is about 1.0 wt% under UV excitation, and 9.0 wt% under sunlight excitation for the improved photoactivity. Furthermore, this nanocomposite is more active for eosin photodegradation if natural sunlight rather than UV is used. This may be due to the reason that adding AlFeO3 nanoparticles into TiO2 matrix can promote the separation of photogenerated charge carriers, and extend the photoresponse of TiO2 toward visible region, which results in an increase in the solar energy utilization efficiency.

  11. Comparative study of the gating motif and C-type inactivation in prokaryotic voltage-gated sodium channels.

    Science.gov (United States)

    Irie, Katsumasa; Kitagawa, Kazuya; Nagura, Hitoshi; Imai, Tomoya; Shimomura, Takushi; Fujiyoshi, Yoshinori

    2010-02-05

    Prokaryotic voltage-gated sodium channels (Na(V)s) are homotetramers and are thought to inactivate through a single mechanism, named C-type inactivation. Here we report the voltage dependence and inactivation rate of the NaChBac channel from Bacillus halodurans, the first identified prokaryotic Na(V), as well as of three new homologues cloned from Bacillus licheniformis (Na(V)BacL), Shewanella putrefaciens (Na(V)SheP), and Roseobacter denitrificans (Na(V)RosD). We found that, although activated by a lower membrane potential, Na(V)BacL inactivates as slowly as NaChBac. Na(V)SheP and Na(V)RosD inactivate faster than NaChBac. Mutational analysis of helix S6 showed that residues corresponding to the "glycine hinge" and "PXP motif" in voltage-gated potassium channels are not obligatory for channel gating in these prokaryotic Na(V)s, but mutations in the regions changed the inactivation rates. Mutation of the region corresponding to the glycine hinge in Na(V)BacL (A214G), Na(V)SheP (A216G), and NaChBac (G219A) accelerated inactivation in these channels, whereas mutation of glycine to alanine in the lower part of helix S6 in NaChBac (G229A), Na(V)BacL (G224A), and Na(V)RosD (G217A) reduced the inactivation rate. These results imply that activation gating in prokaryotic Na(V)s does not require gating motifs and that the residues of helix S6 affect C-type inactivation rates in these channels.

  12. The impact of dose, irradiance and growth conditions on Aspergillus niger (renamed A. brasiliensis) spores low-pressure (LP) UV inactivation.

    Science.gov (United States)

    Taylor-Edmonds, Lizbeth; Lichi, Tovit; Rotstein-Mayer, Adi; Mamane, Hadas

    2015-01-01

    The use of Aspergillus niger (A. niger) fungal spores as challenge organism for UV reactor validation studies is attractive due to their high UV-resistance and non-pathogenic nature. However A. niger spores UV dose-response was dependent upon sporulation conditions and did not follow the Bunsen-Roscoe Principle of time-dose reciprocity. Exposure to 8 h of natural sunlight for 10 consecutive days increased UV resistance when compared to spores grown solely in dark conditions. Application of 250 mJ cm(-2) at high irradiance (0.11 mW cm(-2)) resulted in a 2-log inactivation; however, at low irradiance (0.022 mW cm(-2)) a 1-log inactivation was achieved. In addition, surface electron microscopy (SEM) images revealed morphological changes between the control and UV exposed spores in contrast to other well accepted UV calibrated test organisms, which show no morphological difference with UV exposure.

  13. Pathogen inactivation during passage of stormwater through a constructed reedbed and aquifer transfer, storage and recovery.

    Science.gov (United States)

    Sidhu, J P S; Toze, S; Hodgers, L; Shackelton, M; Barry, K; Page, D; Dillon, P

    2010-01-01

    A study was undertaken to determine the potential inactivation rates of selected enteric microorganisms in captured urban stormwater within a constructed reedbed and in tertiary carbonated aquifer during an Aquifer Storage, Transfer and Recovery (ASTR) scheme. The study was undertaken in-situ in the constructed reedbed and aquifer using diffusion chambers. The results showed that all tested bacteria had one log(10) reduction time of less than 6 and 2.5 days respectively in constructed reedbeds and aquifer, which suggests that presence of enteric bacteria in the recovered water is unlikely. However, adenovirus and Cryptosporidium oocysts showed lower inactivation rates with one log(10) reduction times of more than 33 days in the constructed reedbeds. This means that the constructed reedbed with a mean residence time 10 days cannot be relied upon as an efficient treatment barrier for virus and protozoa. Storage of stormwater in aquifer with brackish water resulted in slow inactivation of enteric viruses over the 35 day incubation period with adenovirus and rotavirus showing slowest inactivation times (extrapolated T(90) of >100 days). Cryptosporidium oocysts showed similar inactivation rate in the constructed reedbed and aquifer.

  14. Power Output Improvement of PV Module for Agricultural Use by Using Inexpensive Sunlight Concentrator

    Institute of Scientific and Technical Information of China (English)

    NISHIMURA Ryo

    2010-01-01

    PV modules are used as stand alone power sources for agricultural equipments such as lifting pumps in farms,where the power infrastructure is not yet improved.In order to expand the agricultural use of PV module,the cost of PV generation should be reduced.In this paper,the power output performance of a commercial PV module was improved by using a sunlight concentrator that could be assembled inexpensively and a simple sun-tracking method.

  15. Attitude of future healthcare provider towards vitamin D significance in relation to sunlight exposure.

    Science.gov (United States)

    Qureshi, Aysha Zia; Zia, Zubia; Gitay, Mehnaz Nuruddin; Khan, Muhammad Umair; Khan, Muhammad Saad

    2015-10-01

    Nature is the kindest of all to provide man with all the necessary components for a healthy life at easily accessible lengths. The deprivation arises with unawareness and lack of correct measures to extract the benefits. Medical education makes the youth aware of the numerous disorders and diseases, as well as their preventions and treatments. This awareness needs to be realized and implemented in the society, and it is not possible without the advisers acting on the same lines. Since doctors are the most trusted and their advice is adopted without much thought, it is extremely inevitable to analyze the attitude of medical students of various levels to understand the cause of their negligence toward their own deficiencies, the focus for this study being vitamin D (VD). A cross sectional descriptive study was done on undergraduate medical students of health profession from different universities of Pakistan to access the awareness regarding VD deficiency associated with sunlight. Informed consent was duly signed by each participant after which self-constructed questionnaire was provided to them and data are collected. SPSS 17 was used for Statistical analysis. Final students are well aware of VD significance, take food rich in VD but still suffer from fatigue and muscular pain. No treatment was taken for fatigue and muscular pain by majority of these sufferers and those who took treatment were VD supplement. The health sufferers were mostly those who avoided sunlight highlighting the role of VD in maintaining an active lifestyle as well as the significance of sunlight in maintaining VD levels. It can be concluded that in spite of awareness, the role of sunlight exposure and the proper time and duration of exposure cannot be ignored to create a healthy and active society.

  16. Calculation of the optimum thickness of thermo-insulation for collectors of sunlight installations

    Directory of Open Access Journals (Sweden)

    Ermuratskii V.V.

    2005-12-01

    Full Text Available In the work the task of calculation of the optimum thickness of thermo-insulation for collectors of sunlight and accumulators of the heat is considered. The simplified model of calculation and the technique based on an estimation of efficiency of investment projects is offered. It is shown, that at calculation on the simplified model which are not taking into account financial streams, the overestimated values of thickness thermo-insulation turn out.

  17. Photo-induced toxicity of titanium dioxide nanoparticles to Daphnia magna under natural sunlight.

    Science.gov (United States)

    Mansfield, C M; Alloy, M M; Hamilton, J; Verbeck, G F; Newton, K; Klaine, S J; Roberts, A P

    2015-02-01

    Titanium dioxide nanoparticles (TiO2 NP) are one of the most abundantly utilized nanoparticles in the world. Studies have demonstrated the ability of the anatase crystal of TiO2 NP to produce reactive oxygen species (ROS) in the presence of ultraviolet radiation (UVR), a co-exposure likely to occur in aquatic ecosystems. The goal of this study was to examine the photo-induced toxicity of anatase TiO2 NP under natural sunlight to Daphnia magna. D. magna were exposed to a range of UVR intensities and anatase TiO2 concentrations in an outdoor exposure system using the sun as the source of UVR. Different UVR intensities were achieved using UVR opaque and transparent plastics. AnataseTiO2-NP demonstrated the reciprocal relationship seen in other phototoxic compounds such as polycyclic aromatic hydrocarbons (PAHs) at higher UVR treatments. The calculated 8h LC50 of anatase TiO2 NP was 139 ppb under full intensity ambient natural sunlight, 778 ppb under 50% natural sunlight, and >500 ppm under 10% natural sunlight. Mortality was also compared between animals allowed to accumulate a body burden of anatase TiO2 for 1h and organisms whose first exposure to anatase TiO2 aqueous suspensions occurred under UVR. A significantly greater toxic effect was observed in aqueous, low body burden suspensions than that of TiO2 1h body burdens, which is dissimilar from the model presented in PAHs. Anatase TiO2 presents a unique photo-induced toxic model that is different than that of established phototoxic compounds.

  18. Multiple scattering of polarized light in planetary atmospheres. II - Sunlight reflected by terrestrial water clouds.

    Science.gov (United States)

    Hansen, J. E.

    1971-01-01

    The intensity and polarization of sunlight reflected by terrestrial water clouds are computed with the doubling method. The calculations illustrate that this method can be effectively used in problems involving strongly anisotropic phase matrices. The method can, therefore, be used to derive information about planetary clouds, including those of the earth, from polarimetric observations. The results of the computations indicate that the polarization is more sensitive than the intensity to cloud microstructure, such as particle size and shape.

  19. Highly Branched Sn-Doped ZnO Nanostructures for Sunlight Driven Photocatalytic Reactions

    Directory of Open Access Journals (Sweden)

    Yangyang Liu

    2014-01-01

    Full Text Available Ultralong, highly branched Sn-doped zinc oxide (ZnO nanostructures were fabricated using a simple substrate-free chemical vapor deposition (CVD method. The nanostructures exhibited efficient photocatalytic activities in degradation of methylene blue (MB under natural sunlight. 100% of MB with the concentration of 10 mg/L could be completely removed within 36 minutes. Possible reasons for the enhanced photocatalytic effect were analyzed.

  20. Highly Branched Sn-Doped ZnO Nanostructures for Sunlight Driven Photocatalytic Reactions

    OpenAIRE

    2014-01-01

    Ultralong, highly branched Sn-doped zinc oxide (ZnO) nanostructures were fabricated using a simple substrate-free chemical vapor deposition (CVD) method. The nanostructures exhibited efficient photocatalytic activities in degradation of methylene blue (MB) under natural sunlight. 100% of MB with the concentration of 10 mg/L could be completely removed within 36 minutes. Possible reasons for the enhanced photocatalytic effect were analyzed.

  1. The Photocatalytic Activity of TiO2-Zeolite Composite for Degradation of Dye Using Synthetic UV and Jeddah Sunlight

    Directory of Open Access Journals (Sweden)

    Laila M. Al-Harbi

    2015-01-01

    Full Text Available In this research different composites of impregnated TiO2 with LTA or FAU zeolites were used as different weight% ratio for photodegradation of organic dye. Normal laboratory UV-lamps were used as a source of UV irradiation. In addition a setup of system of mirrors was used to collect real Jeddah sunlight. A comparison of UV and real sunlight photodegradation activity showed that the real sunlight enhances new centers of active sites exhibiting higher catalytic activity than that of UV irradiated samples.

  2. Sunlight-induced photochemical decay of oxidants in natural waters: implications in ballast water treatment.

    Science.gov (United States)

    Cooper, William J; Jones, Adam C; Whitehead, Robert F; Zika, Rod G

    2007-05-15

    The transport and discharge of ship ballast water has been recognized as a major vector for the introduction of invasive species. Chemical oxidants, long used in drinking water and wastewater treatment, are alternative treatment methods for the control of invasive species currently being tested for use on ships. One concern when a ballasted vessel arrives in port is the adverse effects of residual oxidant in the treated water. The most common oxidants include chlorine (HOCl/OCl-), bromine (HOBr/OBr-), ozone (03), hydrogen peroxide (H2O2), chlorine dioxide (ClO2), and monochloramine (NH2Cl). The present study was undertaken to evaluate the sunlight-mediated photochemical decomposition of these oxidants. Sunlight photodecomposition was measured at various pH using either distilled water or oligotrophic Gulf Stream water for specific oxidants. For selected oxidants, quantum yields at specific wavelengths were obtained. An environmental photochemical model, GCSOLAR, also provided predictions of the fate (sunlight photolysis half-lives) of HOCI/OCl-, HOBr/OBr-, ClO2, and NH2Cl for two different seasons at latitude 40 degrees and in water with two different concentrations of chromophoric dissolved organic matter. These data are useful in assessing the environmental fate of ballast water treatment oxidants if they were to be discharged in port.

  3. Spore sensitivity to sunlight and freezing can restrict dispersal in wood-decay fungi.

    Science.gov (United States)

    Norros, Veera; Karhu, Elina; Nordén, Jenni; Vähätalo, Anssi V; Ovaskainen, Otso

    2015-08-01

    Assessment of the costs and benefits of dispersal is central to understanding species' life-history strategies as well as explaining and predicting spatial population dynamics in the changing world. While mortality during active movement has received much attention, few have studied the costs of passive movement such as the airborne transport of fungal spores. Here, we examine the potential of extreme environmental conditions to cause dispersal mortality in wood-decay fungi. These fungi play a key role as decomposers and habitat creators in forest ecosystems and the populations of many species have declined due to habitat loss and fragmentation. We measured the effect of simulated solar radiation (including ultraviolet A and B) and freezing at -25°C on the spore germinability of 17 species. Both treatments but especially sunlight markedly reduced spore germinability in most species, and species with thin-walled spores were particularly light sensitive. Extrapolating the species' laboratory responses to natural irradiance conditions, we predict that sunlight is a relevant source of dispersal mortality at least at larger spatial scales. In addition, we found a positive effect of spore size on spore germinability, suggesting a trade-off between dispersal distance and establishment. We conclude that freezing and particularly sunlight can be important sources of dispersal mortality in wood-decay fungi which can make it difficult for some species to colonize isolated habitat patches and habitat edges.

  4. Bait Formulations of Chlorophyllin against Infected/Uninfected Lymnaea acuminata in Red and Sunlight

    Directory of Open Access Journals (Sweden)

    Navneet Kumar

    2015-01-01

    Full Text Available Control of snail population is an important tool in fasciolosis control programme. In order to achive this objective the method of bait formulation containing an attractant and a molluscicide is an appropriate approach to ensure the death of host snail. Chlorophyllin bait pellets were prepared by addition of attractants starch (10 mM/serine (20 mM and Chlorophyllin 2% agar solution. These baits were used against host snail Lymnaea acuminata. The behavioral response of snail against attractant (starch/serine and chlorophyllin was examined in red and sunlight. The fraction of snail that was in contact with chlorophyllin bait in zone-3 was used as measure of attraction process. Infected snails were more attracted with red light+starch (57.7%. Uninfected snails were more attracted by red light+serine (58.0%. The molluscicidal activity of chlorophyllin against infected snails in red light (96h LC50-1.88% chlorophyllin in bait and sunlight (96h LC50-2.40% chlorophyllin in bait was more pronounced than uninfected snail in red light (96h LC50-1.76% Chlorophyllin in bait and sunlight (96h LC50-3.62% chlorophyllin in bait.

  5. Perfluorooctanoic acid degradation in the presence of Fe(III) under natural sunlight

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Dandan [Beijing Key Laboratory of Water Resource and Environmental Engineering, China University of Geosciences, Beijing 100083 (China); Xiu, Zongming [Department of Civil and Environmental Engineering, Rice University, Houston, TX 77005 (United States); Liu, Fei [Beijing Key Laboratory of Water Resource and Environmental Engineering, China University of Geosciences, Beijing 100083 (China); Wu, Gang [Division of Hematology, Department of Internal Medicine, University of Texas-Medical School at Houston, Houston, TX 77030 (United States); Adamson, Dave; Newell, Charles [GSI Environmental Inc., Houston, TX 77098 (United States); Vikesland, Peter [Department of Civil and Environmental Engineering, Virginia Polytechnic Institute and State University, Blacksburg, VA 24061 (United States); Tsai, Ah-Lim [Division of Hematology, Department of Internal Medicine, University of Texas-Medical School at Houston, Houston, TX 77030 (United States); Alvarez, Pedro J., E-mail: alvarez@rice.edu [Department of Civil and Environmental Engineering, Rice University, Houston, TX 77005 (United States)

    2013-11-15

    Highlights: • PFOA was photo-chemically decomposed in the presence of Fe(III) and natural sunlight. • An alternative reaction pathway involves hydroxyl radical as confirmed by EPR. • Common oxidant-persulfate increased PFOA defluorination extent. -- Abstract: Due to the high bond dissociation energy (BDE) of C-F bonds (116 kcal/mol), perfluorooctanoic acid (PFOA) is a highly recalcitrant pollutant. Herein, we demonstrate a novel method to decompose PFOA in the presence of sunlight and ferric iron (Fe(III)). Under such conditions, 97.8 ± 1.7% of 50 μM PFOA decomposed within 28 days into shorter-chain intermediates and fluoride (F{sup −}), with an overall defluorination extent of 12.7 ± 0.5%. No PFOA was removed under visible light, indicating that UV radiation is required for PFOA decomposition. Spectroscopic analysis indicates that the decomposition reaction is likely initiated by electron-transfer from PFOA to Fe(III), forming Fe(II) and an unstable organic carboxyl radical. An alternative mechanism for the formation of this organic radical involves hydroxyl radicals, detected by electron paramagnetic resonance (EPR). The observation that PFOA can be degraded by Fe(III) under solar irradiation provides mechanistic insight into a possibly overlooked natural attenuation process. Because Fe(III) is abundant in natural waters and sunlight is essentially free, this work represents a potentially important step toward the development of simple and inexpensive remediation strategies for PFOA-contaminated water.

  6. Colour Changes Evaluation of Freshly Cut Alder Veneers Under the Influence of Indoor Sunlight

    Directory of Open Access Journals (Sweden)

    Emilia Adela SALCA

    2011-03-01

    Full Text Available The paper presents an experimental study concerning the colour changes occurred on the surfaces ofblack alder veneers (Alnus glutinosa, obtained from a freshly cut (not treated log, after their exposure tosunlight and darkness, for 1 and 3 months, under indoor conditions.A Chroma Meter Konika Minolta CR-410 device was used for colour measurement.The colorimetric coordinates were recorded before and after the exposure, according to ISO 7724-2.The results highlight a significant decrease of colour lightness, right after the first month of sunlight exposure.The a* and b* colour coordinates showed an increasing tendency with increasing exposure time, whichsignifies a colour darkening under sunlight radiation that penetrates the window glass. Colour differenceswere noticed right after the first month of sunlight exposure, while under darkness conditions, a relativecolour constancy was noticed, the colour changes being less pronounced, but yet perceptible by the humaneye.The study results complete the colorimetric database of veneers used in furniture industry, but theyalso contribute to the rehabilitation of black alder as a wood species with a real potential of use in furnitureindustry.

  7. Modified optical fiber daylighting system with sunlight transportation in free space.

    Science.gov (United States)

    Vu, Ngoc-Hai; Pham, Thanh-Tuan; Shin, Seoyong

    2016-12-26

    We present the design, optical simulation, and experiment of a modified optical fiber daylighting system (M-OFDS) for indoor lighting. The M-OFDS is comprised of three sub-systems: concentration, collimation, and distribution. The concentration part is formed by coupling a Fresnel lens with a large-core plastic optical fiber. The sunlight collected by the concentration sub-system is propagated in a plastic optical fiber and then collimated by the collimator, which is a combination of a parabolic mirror and a convex lens. The collimated beam of sunlight travels in free space and is guided to the interior by directing flat mirrors, where it is diffused uniformly by a distributor. All parameters of the system are calculated theoretically. Based on the designed system, our simulation results demonstrated a maximum optical efficiency of 71%. The simulation results also showed that sunlight could be delivered to the illumination destination at distance of 30 m. A prototype of the M-OFDS was fabricated, and preliminary experiments were performed outdoors. The simulation results and experimental results confirmed that the M-OFDS was designed effectively. A large-scale system constructed by several M-OFDSs is also proposed. The results showed that the presented optical fiber daylighting system is a strong candidate for an inexpensive and highly efficient application of solar energy in buildings.

  8. Improved Flexible Transparent Conductive Electrodes based on Silver Nanowire Networks by a Simple Sunlight Illumination Approach

    Science.gov (United States)

    Kou, Pengfei; Yang, Liu; Chang, Cheng; He, Sailing

    2017-01-01

    Silver nanowire (Ag NW) networks have attracted wide attention as transparent electrodes for emerging flexible optoelectronics. However, the sheet resistance is greatly limited by large wire-to-wire contact resistances. Here, we propose a simple sunlight illumination approach to remarkably improve their electrical conductivity without any significant degradation of the light transmittance. Because the power density is extremely low (0.1 W/cm2, 1-Sun), only slight welding between Ag NWs has been observed. Despite this, a sheet resistance of <20 Ω/sq and transmittance of ~87% at wavelength of 550 nm as well as excellent mechanical flexibility have still been achieved for Ag NW networks after sunlight illumination for 1 hour or longer, which are significant upgrades over those of ITO. Slight plasmonic welding together with the associated self-limiting effect has been investigated by numerical simulations and further verified experimentally through varied solar concentrations. Due to the reduced resistance, high-performance transparent film heaters as well as efficient defrosters have been demonstrated, which are superior to the previously-reported Ag NW based film heaters. Since the sunlight is environmentally friendly and easily available, sophisticated or expensive facilities are not necessary. Our findings are particularly meaningful and show enormous potential for outdoor applications. PMID:28169343

  9. An MFC capable of regenerating the cathodic electron acceptor under sunlight

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A renewable MFC (microbial fuel cell) cathode was used in this study because the iodide ion could react with oxygen to generate triiodide under natural sunlight.The feasibility of the regeneration of triiodide ion under natural sunlight and the effect of the regenerated triiodide ion concentration on the MFC performance were studied.The results showed that the power density of the MFC using triiodide ion as cathodic electron acceptor was significantly higher than that of using ferricyanate,and that the iodide ion can be oxidized to triiodide ion by oxygen in air at the expense of natural sunlight.In addition,it was obvious from the experimental results that the MFC performance was improved with the increase of the triiodide concentration,indicating that the concentration of triiodide ion had a critical effect on the MFC performance.The linear sweep voltammetry (LSV) curves for the electro-reduction of triiodide ion on the carbon paper were obtained and the results suggested that the diffusion process of triiodide ions to cathode was the control factor for the MFC performance.

  10. Photolysis of brominated flame retardants in textiles exposed to natural sunlight.

    Science.gov (United States)

    Kajiwara, Natsuko; Desborough, Jennifer; Harrad, Stuart; Takigami, Hidetaka

    2013-03-01

    Photolytic transformation profiles of technical hexabromocyclododecane (HBCD) and technical decabromodiphenyl ether (DecaBDE) in flame-retarded textiles exposed to natural sunlight were compared. Textiles that contained approximately 4% HBCDs by weight showed no substantial loss of any of the HBCD diastereomers during the entire exposure period (371 days), indicating that they were resistant to sunlight, that is, that debromination and isomerization of HBCD diastereomers did not occur under the experimental conditions. Exposure of a textile treated with technical DecaBDE resulted in the formation of polybrominated dibenzofurans (PBDFs) as products of photodecomposition of polybrominated diphenyl ethers present in the technical DecaBDE. After 329 days of exposure, the total PBDF concentration reached a maximum of 27 000 ng g(-1), which was approximately 10 times the initial concentration. During the experiment, di- to hexa-BDF congener concentrations increased continuously. Although the concentrations of PBDFs in the textiles were 4–5 orders of magnitude lower than the concentrations of polybrominated diphenyl ethers, it is important to note that PBDFs were formed as a result of sunlight exposure during normal use of products treated with technical DecaBDE.

  11. Spectroscopic properties of Er doped and Er, Nd codoped fluoride glasses under simulated sunlight illumination

    Science.gov (United States)

    Mizuno, Shintaro; Ito, Hiroshi; Hasegawa, Kazuo; Kawai, Hiroyuki; Nasu, Hiroyuki; Hughes, Mark A.; Suzuki, Takenobu; Ohishi, Yasutake

    2011-10-01

    We investigated the fluorescence characteristics of Er codoped Nd doped ZBLAN glasses proposed for solar pumped fiber laser (SPFL) under simulated sunlight. Er is used as a sensitizer because it absorbs a part of the ultraviolet and visible light where is no absorption of Nd. Under simulated sunlight illumination, Er singly doped fluoride glass displayed four emission bands with peaks at 550, 848, 977 and 1533 nm attributed to the 4S 3/2- 4I 15/2, 4S 3/2- 4I 13/2, 4I 11/2- 4I 15/2 and 4I 13/2- 4I 15/2 electronic transitions of Er, respectively. The quantum efficiency measurement was carried out using an integrating sphere and under the simulated sunlight excitation showed a maximum of 73% for 0.5 mol.% of ErF 3 in ZBLAN glass. In Nd, Er codoped fluoride glass, the 1.05 μm emission of Nd was observed under 380 nm excitation what supposes the energy transfer from Er to Nd in ZBLAN glasses as Nd has no absorption at the wavelength. Er, Nd codoped fluoride glasses are promising as a sensitized laser media for solar pumped fiber lasers.

  12. Genes that escape from X inactivation.

    Science.gov (United States)

    Berletch, Joel B; Yang, Fan; Xu, Jun; Carrel, Laura; Disteche, Christine M

    2011-08-01

    To achieve a balanced gene expression dosage between males (XY) and females (XX), mammals have evolved a compensatory mechanism to randomly inactivate one of the female X chromosomes. Despite this chromosome-wide silencing, a number of genes escape X inactivation: in women about 15% of X-linked genes are bi-allelically expressed and in mice, about 3%. Expression from the inactive X allele varies from a few percent of that from the active allele to near equal expression. While most genes have a stable inactivation pattern, a subset of genes exhibit tissue-specific differences in escape from X inactivation. Escape genes appear to be protected from the repressive chromatin modifications associated with X inactivation. Differences in the identity and distribution of escape genes between species and tissues suggest a role for these genes in the evolution of sex differences in specific phenotypes. The higher expression of escape genes in females than in males implies that they may have female-specific roles and may be responsible for some of the phenotypes observed in X aneuploidy.

  13. Inactivation of certain insect pathogens by ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Krieg, A.; Groener, A.; Huber, J.; Zimmermann, G.

    1981-01-01

    The UV-sensitivity of two baculoviruses (granulosis virus, nuclear polyhedrosis virus) and two entomopathogenic microorganisms (Bacillus thuringiensis, Beauveria bassiana) was determined by radiation tests. In the far UV (254 nm) the stability, measured at an inactivation rate of 99%, was in declining order: nuclear polyhedra >= conidia of B. bassiana > granula > spores of B. thuringiensis >= vegetative cells of B. thuringiensis. In the near UV (285-380 nm) the following order could be found: conidia of B. bassiana >= nuclear polyhedra > spores of B. thuringiensis >= granula > vegetative cells of B. thuringiensis. Far UV had a much higher germicidal effect for all pathogens tested than near UV.

  14. Calicivirus Inactivation by Nonionizing (253.7-Nanometer-Wavelength [UV]) and Ionizing (Gamma) Radiation

    Science.gov (United States)

    de Roda Husman, Ana Maria; Bijkerk, Paul; Lodder, Willemijn; van den Berg, Harold; Pribil, Walter; Cabaj, Alexander; Gehringer, Peter; Sommer, Regina; Duizer, Erwin

    2004-01-01

    Noroviruses (previously Norwalk-like viruses) are the most common viral agents associated with food- and waterborne outbreaks of gastroenteritis. In the absence of culture methods for noroviruses, animal caliciviruses were used as model viruses to study inactivation by nonionizing (253.7-nm-wavelength [UV]) and ionizing (gamma) radiation. Here, we studied the respiratory feline calicivirus (FeCV) and the presumed enteric canine calicivirus (CaCV) and compared them with the well-studied bacteriophage MS2. When UV irradiation was used, a 3-log10 reduction was observed at a fluence of 120 J/m2 in the FeCV suspension and at a fluence of 200 J/m2 for CaCV; for the more resistant phage MS2 there was a 3-log10 reduction at a fluence of 650 J/m2. Few or no differences were observed between levels of UV inactivation in high- and low-protein-content virus stocks. In contrast, ionizing radiation could readily inactivate MS2 in water, and there was a 3-log10 reduction at a dose of 100 Gy, although this did not occur when the phage was diluted in high-protein-content stocks of CaCV or FeCV. The low-protein-content stocks showed 3-log10 reductions at a dose of 500 Gy for FeCV and at a dose of 300 for CaCV. The inactivation rates for both caliciviruses with ionizing and nonionizing radiation were comparable but different from the inactivation rates for MS2. Although most FeCV and CaCV characteristics, such as overall particle and genome size and structure, are similar, the capsid sequences differ significantly, making it difficult to predict human norovirus inactivation. Adequate management of UV and gamma radiation processes for virus inactivation should limit public health risks. PMID:15345386

  15. Sunlight creates oxygenated species in water-soluble fractions of Deepwater horizon oil

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Phoebe Z. [Department of Chemistry, University of New Orleans, New Orleans, LA 70148 (United States); Chen, Huan [National High Magnetic Field Laboratory, Florida State University, 1800 East Paul Dirac Drive, Tallahassee, FL 32310-4005 (United States); Podgorski, David C. [National High Magnetic Field Laboratory, Florida State University, 1800 East Paul Dirac Drive, Tallahassee, FL 32310-4005 (United States); Future Fuels Institute, Florida State University, 1800 East Paul Dirac Drive, Tallahassee, FL 32310-4005 (United States); McKenna, Amy M. [National High Magnetic Field Laboratory, Florida State University, 1800 East Paul Dirac Drive, Tallahassee, FL 32310-4005 (United States); Tarr, Matthew A., E-mail: mtarr@uno.edu [Department of Chemistry, University of New Orleans, New Orleans, LA 70148 (United States)

    2014-09-15

    Graphical abstract: Sunlight oxygenates petroleum. - Highlights: • Oxidation seen in water-soluble oil fraction after exposure to simulated sunlight. • Oxygen addition occurred across a wide range of carbon number and DBE. • Oil compounds were susceptible to addition of multiple oxygens to each molecule. • Results provide understanding of fate of oil on water after exposure to sunlight. - Abstract: In order to assess the impact of sunlight on oil fate, Macondo well oil from the Deepwater Horizon (DWH) rig was mixed with pure water and irradiated with simulated sunlight. After irradiation, the water-soluble organics (WSO) from the dark and irradiated samples were extracted and characterized by ultrahigh resolution Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). Liquid–liquid extraction yielded two fractions from dark and irradiated water/oil mixtures: acidic WSOs (negative-ion electrospray (ESI)), and base/neutral WSOs (positive-ion ESI) coupled to FT-ICR MS to catalog molecular-level transformations that occur to Macondo-derived WSOs after solar irradiation. Such direct measure of oil phototransformation has not been previously reported. The most abundant heteroatom class detected in the irradiated WSO acid fractions correspond to molecules that contain five oxygens (O{sub 5}), while the most abundant acids in the dark samples contain two oxygen atoms per molecule (O{sub 2}). Higher-order oxygen classes (O{sub 5}–O{sub 9}) were abundant in the irradiated samples, but <1.5% relative abundance in the dark sample. The increased abundance of higher-order oxygen classes in the irradiated samples relative to the dark samples indicates that photooxidized components of the Macondo crude oil become water-soluble after irradiation. The base/neutral fraction showed decreased abundance of pyridinic nitrogen (N{sub 1}) concurrent with an increased abundance of N{sub 1}O{sub x} classes after irradiation. The predominance of higher

  16. A comprehensive investigation of tetragonal Gd-doped BiVO{sub 4} with enhanced photocatalytic performance under sun-light

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Yangyang; Tan, Guoqiang, E-mail: tan3114@163.com; Dong, Guohua; Ren, Huijun; Xia, Ao

    2016-02-28

    Graphical abstract: - Highlights: • Tetragonal Gd-BiVO{sub 4} with enhanced photocatalytic activity was synthesized. • Gd doping can induce the phase transition from monoclinic to tetragonal BiVO{sub 4}. • GdVO{sub 4} seeds as crystal nucleus dominate the formation of tetragonal Gd-BiVO{sub 4}. • Tetragonal Gd-BiVO{sub 4} exhibits the excellent separation of electrons and holes. • The contribution of high photocatalytic activity under sun-light is from UV-light. - Abstract: Tetragonal Gd-doped BiVO{sub 4} having enhanced photocatalytic activity have been synthesized by a facile microwave hydrothermal method. The structural analysis indicates that Gd doping can induce the phase transition from monoclinic to tetragonal BiVO{sub 4}. The reaction results in precursor solutions imply that tetragonal GdVO{sub 4} seeds as crystal nucleus are the original and determined incentives to force the formation of tetragonal Gd-BiVO{sub 4}. The influences of the surface defect, band structure, and BET surface area on the improved photocatalytic activities of tetragonal Gd-doped BiVO{sub 4} are investigated systematically. The results demonstrate that the more surface oxygen deficiencies as active sites and the excellent mobility and separation of photogenerated electrons and holes are beneficial to the enhancement of the photocatalytic performance of tetragonal Gd-BiVO{sub 4}. The RhB photodegradation experiments indicate that the contribution of high photocatalytic activities under simulated sun-light is mainly from UV-light region due to the tetragonal structure feature. The best photocatalytic performance is obtained for tetragonal 10 at% Gd-BiVO{sub 4}, of which the RhB degradation rate can reach to 96% after 120 min simulated sun-light irradiation. The stable tetragonal Gd-BiVO{sub 4} with efficient mineralization will be a promising photocatalytic material applied in water purification.

  17. Facile synthesis of direct sunlight-driven anatase TiO{sub 2} nanoparticles by in situ modification with trifluoroacetic acid

    Energy Technology Data Exchange (ETDEWEB)

    Meng Xiangfu [Capital Normal University, Department of Chemistry (China); Qi Lin [Chinese Academy of Sciences, Beijing National Laboratory for Molecular Sciences Key Laboratory of Engineering Plastics, Institute of Chemistry (China); Xiao Zhichang; Gong Shuyan; Wei Qingli; Liu Yiqi [Capital Normal University, Department of Chemistry (China); Yang Mingshu; Wang Feng, E-mail: wangfeng0822@iccas.ac.cn [Chinese Academy of Sciences, Beijing National Laboratory for Molecular Sciences Key Laboratory of Engineering Plastics, Institute of Chemistry (China)

    2012-10-15

    Anatase TiO{sub 2} nanoparticles with direct sunlight-driven photocatalytic activity have been synthesized via hydrolysis of titanium precursor, tetrabutyl titanate in trifluoroacetic acid (TFA) followed by sol-gel conversion to xerogel and further hydrothermal treatment at low temperature. The structure and morphology of the as-prepared anatase TiO{sub 2} were characterized using X-ray diffraction, X-ray photoelectron spectroscopy, fourier transform infrared spectra, transmission electron microscopy, UV-visible diffuse reflectance spectrophotometer, and photoluminescence spectra. The results showed that TFA was chemically bonded on anatase TiO{sub 2} during the sol-gel process and the size of TFA-modified anatase TiO{sub 2} nanoparticle was about 7 nm. In situ modification of anatase TiO{sub 2} with TFA endowed the photocatalyst with direct sunlight-driven photocatalytic activity. The photodegradation of rhodamine B under direct sunlight irradiation showed that the photodegradation rate constant of TFA-modified anatase TiO{sub 2} was about threefold higher than that of Degussa P25. The higher photocatalytic activity might be attributed to the in situ surface modification with TFA. On one hand, surface modification with TFA extended the light absorption of anatase TiO{sub 2} to the visible light regime. On the other hand, the strong electron-withdrawing effect of CF{sub 3} group can reduce the recombination of photo-generated electron and holes and enhanced the transfer and transport of charge carriers, and thus a higher visible light responding photocatalytic activity was achieved.

  18. Why We Need More Nature at Work: Effects of Natural Elements and Sunlight on Employee Mental Health and Work Attitudes.

    Directory of Open Access Journals (Sweden)

    Mihyang An

    Full Text Available This study investigated the effects of natural elements and direct and indirect sunlight exposure on employee mental health and work attitudes. We recruited participants via an online panel from the United States and India, and analyzed data from 444 employees. Natural elements and sunlight exposure related positively to job satisfaction and organizational commitment, and negatively to depressed mood and anxiety. Direct sunlight was a dominant predictor of anxiety; indirect sunlight was a dominant predictor of depressed mood, job satisfaction, and organizational commitment. Natural elements buffered the relationship between role stressors and job satisfaction, depressed mood, and anxiety. We also found that depressed mood partially mediated the relationship between natural elements and job satisfaction. We discuss scientific and policy implications of these findings.

  19. Interacting effects of sunlight, agriculturally derived dissolved organic matter and reactive oxygen species on fecal indicator bacteria growth dynamics

    Science.gov (United States)

    Bacterial survival in agriculturally impacted surface waters is dependent on resource availability and also on potential resource transformations, mediated by biotic and abiotic processes. In this study, we focused on the effect of sunlight irradiated cattle fecal extract (CFE) a...

  20. ZnO/ZnAl2O4异质结光催化剂的光催化降解和杀灭大肠杆菌性能%Photocatalytic degradation and inactivation of Escherichia coli by ZnO/ZnAl2O4 with heteronanostructures

    Institute of Scientific and Technical Information of China (English)

    张丽; 阎建辉; 周民杰; 余艳萍; 刘晔; 刘又年

    2014-01-01

    通过共沉淀法制备ZnO/ZnAl2O4纳米异质结光催化剂,利用HRTEM、TEM、XRD、BET、TG-DTA和UV-Vis DRS 测试方法对样品进行表征。在模拟太阳光照射下,通过测定甲基橙溶液的光催化降解率和对大肠杆菌的杀灭率来评价样品的光催化活性。研究催化剂的组成、焙烧温度、催化剂的用量和不同光源对样品光催化活性的影响。结果表明,当原料中Zn与Al摩尔比为1:1.5时,在600°C焙烧所得的催化剂具有最佳光催化活性。在模拟太阳光照射下,在50 min内1.0 g/L光催化剂对甲基橙的降解率达98.5%;在60 min内,在相同条件下对大肠杆菌(106 CFU/mL)的杀菌率达到99.8%。%ZnO/ZnAl2O4 nanocomposites with heteronanostructures were successfully prepared by co-precipitation method. The as-prepared samples were characterized by HRTEM, TEM, XRD, BET, TG-DTA, and UV-Vis spectra techniques. The photocatalytic activities of the as-prepared samples were evaluated by the photocatalytic degradation of methyl orange and inactivation of Escherichia coli in suspension under the irradiation of the simulated sunlight. The effects of compositions, calcination temperatures, concentration of photocatalysts and light source on the photocatalytic activities were systematically studied. The results show that when the concentration of ZnO/ZnAl2O4 photocatalyst with the starting Zn to Al molar ratio of 1:1.5 calcined at 600 °C is 1.0 g/L, the maximum photocatalytic degradation rate of 98.5% can be obtained in 50 min under the irradiation of the simulated sunlight. Under the same conditions, an inactivation rate of 99.8%for E.coli is achieved in 60 min.

  1. Removal of chlortetracycline from spiked municipal wastewater using a photoelectrocatalytic process operated under sunlight irradiations

    Energy Technology Data Exchange (ETDEWEB)

    Daghrir, Rimeh, E-mail: rimeh.daghrir@ete.inrs.ca [Institut National de la Recherche Scientifique, Centre Eau, Terre et Environnement, 490 rue de la Couronne, Québec, Qc G1K 9A9 (Canada); Drogui, Patrick, E-mail: patrick.drogui@ete.inrs.ca [Institut National de la Recherche Scientifique, Centre Eau, Terre et Environnement, 490 rue de la Couronne, Québec, Qc G1K 9A9 (Canada); Delegan, Nazar, E-mail: delegan@emt.inrs.ca [Institut National de la Recherche Scientifique, INRS-Énergie, Matériaux et Télécommunications, 1650 Blvd. Lionel-Boulet, Varennes, Qc J3X 1S2 (Canada); El Khakani, My Ali, E-mail: elkhakani@emt.inrs.ca [Institut National de la Recherche Scientifique, INRS-Énergie, Matériaux et Télécommunications, 1650 Blvd. Lionel-Boulet, Varennes, Qc J3X 1S2 (Canada)

    2014-01-01

    The degradation of chlortetracycline in synthetic solution and in municipal effluent was investigated using a photoelectrocatalytic oxidation process under visible irradiation. The N-doped TiO{sub 2} used as photoanode with 3.4 at.% of nitrogen content was prepared by means of a radiofrequency magnetron sputtering (RF-MS) process. Under visible irradiation, higher photoelectrocatalytic removal efficiency of CTC was recorded using N-doped TiO{sub 2} compared to the conventional electrochemical oxidation, direct photolysis and photocatalysis processes. The photoelectrocatalytic process operated at 0.6 A of current intensity during 180 min of treatment time promotes the degradation of 99.1 ± 0.1% of CTC. Under these conditions, removal rates of 85.4 ± 3.6%, 87.4 ± 3.1% and 55.7 ± 2.9% of TOC, TN and NH{sub 4}{sup +} have been recorded. During the treatment, CTC was mainly transformed into CO{sub 2} and H{sub 2}O. The process was also found to be effective in removing indicator of pathogens such as fecal coliform (log-inactivation was higher than 1.2 units). - Highlights: •PECO process is a feasible technology for the treatment of MWW contaminated by CTC. •99.1% ± 0.1% of CTC was degraded by PECO using N-doped TiO{sub 2}. •85.4% ± 3.6% of TOC removal and 97.5% ± 1.2% of COD removal were achieved. •87.4% ± 3.1% of TN removal and 55.7% ± 2.9% of NH{sub 4}{sup +} removal were recorded. •More than 94% of fecal coliform was removed (abatement > 1.2-log units)

  2. Sunlight exposure or vitamin D supplementation for vitamin D-deficient non-western immigrants: a randomized clinical trial.

    Science.gov (United States)

    Wicherts, I S; Boeke, A J P; van der Meer, I M; van Schoor, N M; Knol, D L; Lips, P

    2011-03-01

    Vitamin D deficiency is very common in non-western immigrants. In this randomized clinical trial, vitamin D 800 IU/day or 100,000 IU/3 months were compared with advised sunlight exposure. Vitamin D supplementation was more effective than advised sunlight exposure in improving vitamin D status and lowering parathyroid hormone levels. Vitamin D deficiency (25-hydroxyvitamin D [25(OH)D] sunlight exposure. To determine whether the effect of vitamin D(3) supplementation (daily 800 IU or 100,000 IU/3 months) or sunlight exposure advice is similar with regard to serum 25(OH)D and parathyroid hormone (PTH) concentrations. Randomized clinical trial in 11 general practices in The Netherlands. Non-western immigrants, aged 18-65 years (n = 232) and serum 25(OH)D sunlight exposure for 6 months (March-September). Blood samples were collected at baseline, during treatment (3 months, 6 months), and at follow-up (12 months). Statistical analysis was performed with multilevel regression modelling. The intention-to-treat analysis included 211 persons. Baseline serum 25(OH)D was 22.5 ± 11.1 nmol/l. After 6 months, mean serum 25(OH)D increased to 53 nmol/l with 800 IU/day, to 50.5 nmol/l with 100,000 IU/3 months, and to 29.1 nmol/l with advised sunlight exposure (supplementation vs sunshine p sunlight group (p sunlight exposure for treating vitamin D deficiency in non-western immigrants.

  3. Sunlight-stimulated phenylalanine ammonia-lyase (PAL) activity and anthocyanin accumulation in exocarp of ‘Mahajanaka’ mango

    OpenAIRE

    Kobkiat Saengnil

    2011-01-01

    The activity of phenylalanine ammonia-lyase (PAL) required for anthocyanin synthesis was stimulated by sunlight exposure resulting in the development of red colour in ‘Mahajanaka’ mango exocarp, which occurred only on the sunlight-exposed side of the fruit. The accumulation of anthocyanin was concurrent with the increase in PAL activity in the mature stage of the fruit. The exposed side of the fruit had higher PAL activity, endogenous sugar content, and anthocyanin accumulation than the unexp...

  4. [Immune response to one booster dose of inactivated hepatitis A vaccine in college students].

    Science.gov (United States)

    Liao, Z; Feng, X W; Liu, X E; Zhou, Y S; Wen, H R; Peng, S H; Zhang, Y X; Xu, B; Zhuang, H; Chen, H Y

    2017-05-10

    Objective: To evaluate the safety and immunogenicity of one booster dose of inactivated hepatitis A vaccine in young adults. Methods: The subjects were selected from participants in the clinical trial of immunogenicity of inactivated and attenuated live hepatitis A vaccine in young adults. Eligible subjects were those who had received one dose of inactivated or attenuated hepatitis A vaccine, could be contacted and were sero-negative before primary vaccination. All qualified subjects were immunized with one booster dose of inactivated hepatitis A vaccine. The blood samples were collected before booster dose vaccination and 28 days after the immunization. Anti-HAV antibody titer ≥20 mIU/ml was considered to be sero-protected against hepatitis A virus. Results: The GMCs in the inactivated HAV vaccine group and attenuated live vaccine group before booster dose vaccination were 70.80 mIU/ml and 50.12 mIU/ml, respectively, and the sero-protection rates were 94.7% and 65.0%, respectively. After the vaccination of the booster dose, the sero-protection rates in both groups were 100.0%, and the GMCs were 2 816.09 mIU/ml and 2 654.55 mIU/ml, respectively. Conclusion: The GMCs and sero-protection rates of anti-HAV antibody in young adults declined after three years of the primary vaccination. However, the higher GMC and sero-protection rate were observed in the inactivated vaccine group than in the attenuated live vaccine group. Significant increases of GMC levels were observed in both groups after one booster dose vaccination.

  5. Inactivation of Penicillium digitatum Spores by a High-Density Ground-State Atomic Oxygen-Radical Source Employing an Atmospheric-Pressure Plasma

    Science.gov (United States)

    Iseki, Sachiko; Hashizume, Hiroshi; Jia, Fengdong; Takeda, Keigo; Ishikawa, Kenji; Ohta, Takayuki; Ito, Masafumi; Hori, Masaru

    2011-11-01

    Penicillium digitatum spores were inactivated using an oxygen-radical source that supplies only neutral oxygen radicals. Vacuum ultraviolet absorption spectroscopy was used to measure the ground-state atomic oxygen [O (3Pj)] densities and they were estimated to be in the range of 1014-1015 cm-3. The inactivation rate of P. digitatum spores was correlated with the O (3Pj) density. The result indicates that O (3Pj) is the dominant species in the inactivation. The inactivation rate constant of P. digitatum spores by O (3Pj) was estimated to be on the order of 10-17 cm3 s-1 from the measured O (3Pj) densities and inactivation rates.

  6. A sunlight-induced method for rapid biosynthesis of silver nanoparticles using an Andrachnea chordifolia ethanol extract

    Science.gov (United States)

    Karimi Zarchi, A. A.; Mokhtari, N.; Arfan, M.; Rehman, T.; Ali, M.; Amini, M.; Faridi Majidi, R.; Shahverdi, A. R.

    2011-05-01

    In this study a sunlight-induced method for rapid synthesis of silver nanoparticles using an ethanol extract of Andrachnea chordifolia is described. The silver nitrate solutions (1 mM) containing the ethanol extract of Andrachnea chordifolia were irradiated by both sunlight radiation and by sunlight radiation passed through different colored filters (red, yellow or green). The smallest size of silver nanoparticles was obtained when a silver ion solution was irradiated for 5 minutes by direct sunlight radiation. Further examination of the shape and size and of the surface chemistry of these biogenic silver nanoparticles, which were prepared under sunlight radiation, was carried out using transmission electron microscopy and infrared spectroscopy, respectively. Transmission electron microscopy images show spherical particles with an average size of 3.4 nm. Hydroxyl residues were also detected on the surface of these biogenic silver nanoparticles fabricated using plant extract of Andrachnea chordifolia under sunlight radiation. Our study on the reduction of silver ions by this plant extract in darkness shows that the synthesis process can take place under dark conditions at much longer incubations (48 hours). Larger silver polydispersed nanoparticles ranging in size from 3 to 30 nm were obtained when the silver ions were treated with the ethanol extract of Andrachnea chordifolia under dark conditions for 48 hours.

  7. Development and validation of sunlight exposure measurement questionnaire (SEM-Q) for use in adult population residing in Pakistan.

    Science.gov (United States)

    Humayun, Quratulain; Iqbal, Romaina; Azam, Iqbal; Khan, Aysha Habib; Siddiqui, Amna Rehana; Baig-Ansari, Naila

    2012-06-08

    Vitamin D deficiency has been identified as a major public health problem worldwide. Sunlight is the main source of vitamin D and its measurement using dosimeters is expensive and difficult for use in population-based studies. Hence, the aim of this study was to develop and validate questionnaires to assess sunlight exposure in healthy individuals residing in Karachi, Pakistan. Two questionnaires with seven important items for sunlight exposure assessment were developed. Fifty four healthy adults were enrolled based on their reported sunlight exposure (high = 17, moderate = 18, low = 19) from Aga Khan University, Karachi. Over four days, study participants were asked to wear a dosimeter between sunrise and sunset and report time spent and activities undertaken in the sun for questionnaire validation. Algorithm for item weightage was created as an average score based on ultraviolet B percentage received. Blood samples were obtained for serum vitamin D. The mean time (minutes) spent in sun over 4 days (±SD) was 69.5 (±32) for low, 83.5 (±29.7) for moderate and 329 (±115) for high exposure group. The correlation between average time (minutes) spent in sun over 4 days and mean change in absorbance of UV dosimeters for 4 days was 0.60 (p sunlight exposure measurement questionnaires were valid tools for use in large epidemiological studies to quantify sunlight exposure.

  8. A sunlight-induced method for rapid biosynthesis of silver nanoparticles using an Andrachnea chordifolia ethanol extract

    Energy Technology Data Exchange (ETDEWEB)

    Karimi Zarchi, A.A.; Faridi Majidi, R. [Tehran University of Medical Sciences, Department of Nanomedicine, School of Advanced Medical Technologies, Tehran (Iran, Islamic Republic of); Mokhtari, N.; Shahverdi, A.R. [Tehran University of Medical Sciences, Department of Pharmaceutical Biotechnology and Medicinal Plants Research Center, Faculty of Pharmacy, Tehran (Iran, Islamic Republic of); Arfan, M.; Rehman, T.; Ali, M. [University of Peshawar, Institute of Chemical Sciences, Peshawar, Khyber Pakhtoonkhwa (Pakistan); Amini, M. [Tehran University of Medical Sciences, Department of Medicinal Chemistry, Faculty of Pharmacy, Tehran (Iran, Islamic Republic of)

    2011-05-15

    In this study a sunlight-induced method for rapid synthesis of silver nanoparticles using an ethanol extract of Andrachnea chordifolia is described. The silver nitrate solutions (1 mM) containing the ethanol extract of Andrachnea chordifolia were irradiated by both sunlight radiation and by sunlight radiation passed through different colored filters (red, yellow or green). The smallest size of silver nanoparticles was obtained when a silver ion solution was irradiated for 5 minutes by direct sunlight radiation. Further examination of the shape and size and of the surface chemistry of these biogenic silver nanoparticles, which were prepared under sunlight radiation, was carried out using transmission electron microscopy and infrared spectroscopy, respectively. Transmission electron microscopy images show spherical particles with an average size of 3.4 nm. Hydroxyl residues were also detected on the surface of these biogenic silver nanoparticles fabricated using plant extract of Andrachnea chordifolia under sunlight radiation. Our study on the reduction of silver ions by this plant extract in darkness shows that the synthesis process can take place under dark conditions at much longer incubations (48 hours). Larger silver polydispersed nanoparticles ranging in size from 3 to 30 nm were obtained when the silver ions were treated with the ethanol extract of Andrachnea chordifolia under dark conditions for 48 hours. (orig.)

  9. Modifiable risk factors including sunlight exposure and fish consumption are associated with risk of hypertension in a large representative population from Macau.

    Science.gov (United States)

    Ke, Liang; Ho, Jacky; Feng, Jianzhang; Mpofu, Elias; Dibley, Michael J; Feng, Xiuhua; Van, Florance; Leong, Sokman; Lau, Winne; Lueng, Petra; Kowk, Carrie; Li, Yan; Mason, Rebecca S; Brock, Kaye E

    2014-10-01

    Chinese populations are known to be at risk for vitamin D deficiency, with some evidence that this is due to lack of exposure to sunlight. Vitamin D deficiency and/or low sun exposure have been associated with higher incidence of hypertension in Caucasians. Thus, we investigated these associations in a Chinese population with a high rate of hypertension. From a random household survey of 1410 residents aged ≥18 years, height, weight and blood pressure were measured and demographic, exercise and dietary data were collected, as well as estimated hours of sunlight exposure on weekdays and weekends (in winter and summer). Modifiable predictors of hypertension in these data were lack of sunlight exposure and low intake of fish as well as smoking, obesity and lack of exercise. When investigated in a linear model, sunlight exposure was negatively associated with hypertension (β=-0.072, pexposure per day compared to none was associated with less hypertension (OR=0.6, 95% CI: 0.4-0.8). Similarly, consuming either oily fish or seafood more than four times per week compared to less was also associated with less hypertension (oily fish (OR=0.4, 95% CI: 0.3-0.5); seafood consumption (OR=0.8, 95% CI: 0.7-0.9)). Having daily moderate physical activity compared to none was also associated with a lower risk of hypertension (OR=0.8, 95% CI: 0.7-0.9). In contrast, being obese compared to normal weight and having more than five pack-years of smoking compared to none were associated with a higher risk of hypertension (OR=4.6, 95% CI: 3.7-5.7; OR=1.4, 95% CI: 1.0-1.8, respectively). The major new findings of this study are that more sun exposure and high weekly fish consumption (especially oily fish) may be potentially modifiable independent factors for protecting against risk of hypertension in this population. This article is part of a Special Issue entitled '16th Vitamin D Workshop'. Copyright © 2013 Elsevier Ltd. All rights reserved.

  10. Derivation of Hodgkin-Huxley equations for a Na+ channel from a master equation for coupled activation and inactivation

    CERN Document Server

    Vaccaro, S R

    2016-01-01

    The Na+ current in nerve and muscle membranes may be described in terms of the activation variable m(t) and the inactivation variable h(t), which are dependent on the transitions of S4 sensors in each of the ion channel domains DI to DIV. The time-dependence of the Na+ current and the rate equations satisfied by m(t) and h(t) may be derived from the solution to a master equation which describes the coupling between two activation sensors regulating the Na+ channel conductance and a two stage inactivation process. The voltage dependence of the rate functions for inactivation and recovery from inactivation are consistent with the empirically determined Hodgkin-Huxley expressions, and exhibit saturation for both depolarized and hyperpolarized clamp potentials.

  11. Effects of Three Types of Inactivation Agents on the Antibody Response and Immune Protection of Inactivated IHNV Vaccine in Rainbow Trout.

    Science.gov (United States)

    Tang, Lijie; Kang, Haiyan; Duan, Kexin; Guo, Mengting; Lian, Gaihong; Wu, Yang; Li, Yijing; Gao, Shuai; Jiang, Yanping; Yin, Jiyuan; Liu, Min

    2016-09-01

    Infectious hematopoietic necrosis virus (IHNV) infects salmonid fish, resulting in high mortality and serious economic losses to salmonid aquaculture. Therefore, an effective IHNV vaccine is urgently needed. To select an inactivation agent for the preparation of an effective IHNV vaccine, rainbow trout were immunized with mineral oil emulsions of IHNV vaccines inactivated by formaldehyde, binary ethylenimine (BEI), or β-propiolactone (BPL). The fish were challenged 8 weeks after vaccination, and their IgM antibody response and relative percent survival (RPS) were evaluated. The results show that formaldehyde, BEI, and BPL abolished IHNV HLJ-09 infectivity within 24, 48, and 24 h at final concentrations of 0.2%, 0.02%, and 0.01%, respectively. The mean levels of specific IgM, both in serum and mucus (collected from the skin surface and gills), for the three immunized groups (from high to low) ranked as follows: the BPL group, BEI group, and formaldehyde group. From weeks 5 to 9, the mean log2 serum titers of IgM in the BPL group were significantly higher compared with those of the other groups (p vaccination (immunized at weeks 0 and6). Mucus OD490 values of the BPL group were significantly higher compared with those of the other groups (p  0.05). The BPL-inactivated whole-virus vaccine had the greatest protective effect on the rainbow trout after challenge by an intraperitoneal injection of live IHNV, with an RPS rate of 91.67%, which was significantly higher compared with the BEI (83.33%) and formaldehyde (79.17%) groups. These results indicate that the BPL-inactivated IHNV oil-adjuvant vaccine was more effective than the formaldehyde- or BEI-inactivated vaccines. The results of this study provide an important foundation for further studies on inactivated IHNV vaccines.

  12. An Environmentally Friendly Method for Testing Photocatalytic Inactivation of Cyanobacterial Propagation on a Hybrid Ag-TiO2 Photocatalyst under Solar Illumination

    Directory of Open Access Journals (Sweden)

    Shu-Yu Chang

    2015-12-01

    Full Text Available Cyanobacteria were inactivated under sunlight using mixed phase silver (Ag and deposited titanium dioxide (TiO2 coated on the surface of diatomite (DM as a hybrid photocatalyst (Ag-TiO2/DM. The endpoints of dose-response experiments were chlorophyll a, photosynthetic efficiency, and flow cytometry measurements. In vitro experiments revealed that axenic cultures of planktonic cyanobacteria lost their photosynthetic activity following photocatalyzed exposure to sunlight for more than 24 h. Nearly 92% of Microcystis aeruginosa cells lost their photosynthetic activity, and their cell morphology was severely damaged within 24 h of the reaction. Preliminary carbon-14 (14CO3−2 results suggest that the complete inactivation of cyanobacteria arises from damage to cell wall components (peroxidation. A small concomitant increase in cell wall disorder and a consequent decrease in cell wall functional groups increase the cell wall fluidity prior to cell lysis. A high dosage of Ag-TiO2/DM during photocatalysis increased the concentration of extracellular polymeric substances (EPSs in the Microcystis aeruginosa suspension by up to approximately 260%. However, photocatalytic treatment had a small effect on the disinfection by-product (DBP precursor, as revealed by only a slight increase in the formation of trihalomethanes (THMs and haloacetic acids (HAAs.

  13. Pulmonary decontamination for photodynamic inactivation with extracorporeal illumination

    Science.gov (United States)

    Geralde, Mariana C.; Leite, Ilaiáli S.; Inada, Natalia M.; Grecco, Clóvis; Medeiros, Alexandra I.; Kurachi, Cristina; Bagnato, Vanderlei S.

    2014-03-01

    Infectious pneumonia is a major cause of morbidity and mortality, despite advances in diagnostics and therapeutics in pulmonary infections. One of the major difficulties associated with the infection comes from the high rate of antibiotic resistant microorganisms, claiming for the use of alternative techniques with high efficiency and low cost. The photodynamic inactivation (PDI) is emerging as one of the great possibilities in this area, once its action is oxidative, not allowing microorganism develops resistance against the treatment. PDI for decontamination pulmonary has potential for treatment or creating better conditions for the action of antibiotics. In this study, we are developing a device to implement PDI for the treatment of lung diseases with extracorporeal illumination. To validate our theory, we performed measurements in liquid phantom to simulate light penetration in biological tissues at various fluency rates, the temperature was monitored in a body of hairless mice and the measurements of light transmittance in this same animal model. A diode laser emitting at 810 nm in continuous mode was used. Our results show 70% of leakage at 0.5 mm of thickness in phantom model. The mouse body temperature variation was 5.4 °C and was observed light transmittance through its chest. These results are suggesting the possible application of the extracorporeal illumination using infrared light source. Based on these findings, further studies about photodynamic inactivation will be performed in animal model using indocyanine green and bacteriochlorin as photosensitizers. The pulmonary infection will be induced with Streptococcus pneumoniae and Klebsiella pneumoniae.

  14. Pathogen inactivation of human serum facilitates its clinical use for islet cell culture and subsequent transplantation.

    Science.gov (United States)

    Ståhle, Magnus U; Brandhorst, Daniel; Korsgren, Olle; Knutson, Folke

    2011-01-01

    Serum is regarded as an essential supplement to promote survival and growth of cells during culture. However, the potential risk of transmitting diseases disqualifies the use of serum for clinical cell therapy in most countries. Hence, most clinical cell therapy programs have replaced human serum with human serum albumin, which can result in inferior quality of released cell products. Photochemical treatment of different blood products utilizing Intercept® technology has been shown to inactivate a broad variety of pathogens of RNA and DNA origin. The present study assesses the feasibility of using pathogen-inactivated, blood group-compatible serum for use in human pancreatic islet culture. Isolated human islets were cultured at 37°C for 3-4 days in CMRL 1066 supplemented with 10% of either pathogen-inactivated or nontreated human serum. Islet quality assessment included glucose-stimulated insulin release (perifusion), ADP/ATP ratio, cytokine expression, and posttransplant function in diabetic nude mice. No differences were found between islets cultured in pathogen-inactivated or control serum regarding stimulated insulin release, intracellular insulin content, and ADP/ATP ratio. Whether media was supplemented with treated or nontreated serum, islet expression of IL-6, IL-8, MCP-1, or tissue factor was not affected. The final diabetes-reversal rate of mice receiving islets cultured in pathogen-inactivated or nontreated serum was 78% and 87%, respectively (NS). As reported here, pathogen-inactivated human serum does not affect viability or functional integrity of cultured human islets. The implementation of this technology for RNA- and DNA-based pathogen inactivation should enable reintroduction of human serum for clinical cell therapy.

  15. Inactivation of Bacillus atrophaeus by OH radicals

    Science.gov (United States)

    Ono, Ryo; Yonetamari, Kenta; Tokumitsu, Yusuke; Yonemori, Seiya; Yasuda, Hachiro; Mizuno, Akira

    2016-08-01

    The inactivation of Bacillus atrophaeus by OH radicals is measured. This study aims to evaluate the bactericidal effects of OH radicals produced by atmospheric-pressure nonthermal plasma widely used for plasma medicine; however, in this study, OH radicals are produced by vacuum ultraviolet (VUV) photolysis of water vapor instead of plasma to allow the production of OH radicals with almost no other reactive species. A 172 nm VUV light from a Xe2 excimer lamp irradiates a He-H2O mixture flowing in a quartz tube to photodissociate H2O to produce OH, H, O, HO2, H2O2, and O3. The produced reactive oxygen species (ROS) flow out of the quartz tube nozzle to the bacteria on an agar plate and cause inactivation. The inactivation by OH radicals among the six ROS is observed by properly setting the experimental conditions with the help of simulations calculating the ROS densities. A 30 s treatment with approximately 0.1 ppm OH radicals causes visible inactivation.

  16. Pulsed electric field inactivation in a microreactor

    NARCIS (Netherlands)

    Fox, M.B.

    2006-01-01

    Pulsed electric fields (PEF) is a novel, non-thermal pasteurization method which uses short, high electric field pulses to inactivate microorganisms. The advantage of a pasteurization method like PEF compared to regular heat pasteurization is that the taste, flavour, texture and nutritional value ar

  17. Inactivation of Effector Caspases through Nondegradative Polyubiquitylation

    DEFF Research Database (Denmark)

    Ditzel, Mark; Broemer, Meike; Tenev, Tencho;

    2008-01-01

    Ubiquitin-mediated inactivation of caspases has long been postulated to contribute to the regulation of apoptosis. However, detailed mechanisms and functional consequences of caspase ubiquitylation have not been demonstrated. Here we show that the Drosophila Inhibitor of Apoptosis 1, DIAP1, block...

  18. Inactivation of prion infectivity by ionizing rays

    Science.gov (United States)

    Gominet, M.; Vadrot, C.; Austruy, G.; Darbord, J. C.

    2007-11-01

    Inactivation of prion deposits on medical devices or prion contamination in pharmaceutical raw materials is considered as impossible by using gamma irradiation. Early, the guideline WHO/CDS/CSR/APH/2000 has described irradiation as an ineffective process. But, in 2003, S. Miekka et al. noted radiation inactivation of prions in a particular application to purify human albumin, shown by the physical denaturation of the infectious protein (PrP). The aim of our study was to determine the inactivation of prions with a scrapie model (strain C506M3) by irradiating standardised preparations. Results: Gamma irradiation was partially effective, showing a 4-5 log reduction on exposure to 50 kGy. A characteristic effect-dose curve was not observed (25, 50 and 100 kGy), only an increase in the incubation period of the murine disease (229 days with 25 kGy to 290 days with 100 kGy) compared with 170 days without irradiation. Since the inactivation was not a total one, the observed effect is significant. It is proposed that further work be undertaken with the model to investigate the application of gamma radiation known levels of prion contamination.

  19. Temperature Tolerance and Inactivation of Chikungunya Virus.

    Science.gov (United States)

    Huang, Yan-Jang S; Hsu, Wei-Wen; Higgs, Stephen; Vanlandingham, Dana L

    2015-11-01

    In late 2013, chikungunya virus (CHIKV) was introduced to the New World and large outbreaks occurred in the Caribbean islands causing over a million suspected and over 20,000 laboratory-confirmed cases. Serological analysis is an essential component for the diagnosis of CHIKV infection together with virus isolation and detection of viral nucleic acid. Demonstrating virus neutralizing by serum antibodies in a plaque reduction neutralization test (PRNT) is the gold standard of all serological diagnostic assays. Prior to the testing, heat inactivation of serum at 56°C for 30 min is required for the inactivation of complement activity and adventitious viruses. The presence of adventitious contaminating viruses may interfere with the results by leading to a higher number of plaques on the monolayers and subsequent false-negative results. This procedure is widely accepted for the inactivation of flaviviruses and alphaviruses. In this study, the thermostability of CHIKV was evaluated. Heat inactivation at 56°C for 30 min was demonstrated to be insufficient for the complete removal of infectious CHIKV virions present in the samples. This thermotolerance of CHIKV could compromise the accuracy of serum tests, and therefore longer treatment for greater than 120 min is recommended.

  20. Female meiotic sex chromosome inactivation in chicken

    NARCIS (Netherlands)

    S. Schoenmakers (Sam); E. Wassenaar (Evelyne); J.W. Hoogerbrugge (Jos); J.S.E. Laven (Joop); J.A. Grootegoed (Anton); W.M. Baarends (Willy)

    2009-01-01

    textabstractDuring meiotic prophase in male mammals, the heterologous X and Y chromosomes remain largely unsynapsed, and meiotic sex chromosome inactivation (MSCI) leads to formation of the transcriptionally silenced XY body. In birds, the heterogametic sex is female, carrying Z and W chromosomes (Z

  1. Inactivation of prion infectivity by ionizing rays

    Energy Technology Data Exchange (ETDEWEB)

    Gominet, M. [Ionisos, ZI les Chatinieres, F01120 Dagneux (France); Vadrot, C.; Austruy, G. [Paris V University, Central Pharmacy of Hospitals, 4 avenue de l' Observatoire, F-75006, Paris (France); Darbord, J.C. [Paris V University, Central Pharmacy of Hospitals, 4 avenue de l' Observatoire, F-75006, Paris (France)], E-mail: darbord@pharmacie.univ-paris5.fr

    2007-11-15

    Inactivation of prion deposits on medical devices or prion contamination in pharmaceutical raw materials is considered as impossible by using gamma irradiation. Early, the guideline WHO/CDS/CSR/APH/2000 has described irradiation as an ineffective process. But, in 2003, S. Miekka et al. noted radiation inactivation of prions in a particular application to purify human albumin, shown by the physical denaturation of the infectious protein (PrP). The aim of our study was to determine the inactivation of prions with a scrapie model (strain C506M3) by irradiating standardised preparations. Results: Gamma irradiation was partially effective, showing a 4-5 log reduction on exposure to 50 kGy. A characteristic effect-dose curve was not observed (25, 50 and 100 kGy), only an increase in the incubation period of the murine disease (229 days with 25 kGy to 290 days with 100 kGy) compared with 170 days without irradiation. Since the inactivation was not a total one, the observed effect is significant. It is proposed that further work be undertaken with the model to investigate the application of gamma radiation known levels of prion contamination.

  2. Sex chromosome inactivation in the male.

    Science.gov (United States)

    Yan, Wei; McCarrey, John R

    2009-10-01

    Mammalian females have two X chromosomes, while males have only one X plus a Y chromosome. In order to balance X-linked gene dosage between the sexes, one X chromosome undergoes inactivation during development of female embryos. This process has been termed X-chromosome inactivation (XCI). Inactivation of the single X chromosome also occurs in the male, but is transient and is confined to the late stages of first meiotic prophase during spermatogenesis. This phenomenon has been termed meiotic sex chromosome inactivation (MSCI). A substantial portion ( approximately 15-25%) of X-linked mRNA-encoding genes escapes XCI in female somatic cells. While no mRNA genes are known to escape MSCI in males, approximately 80% of X-linked miRNA genes have been shown to escape this process. Recent results have led to the proposal that the RNA interference mechanism may be involved in regulating XCI in female cells. We suggest that some MSCI-escaping miRNAs may play a similar role in regulating MSCI in male germ cells.

  3. High Pressure Inactivation of HAV within Mussels

    Science.gov (United States)

    The potential of hepatitis A virus (HAV) to be inactivated within Mediterranean mussels (Mytilus galloprovincialis) and blue mussels (Mytilus edulis) by high pressure processing was evaluated. HAV was bioaccumulated within mussels to approximately 6-log10 PFU by exposure of mussels to HAV-contamina...

  4. The Position of the Fast-Inactivation Gate during Lidocaine Block of Voltage-gated Na+ Channels

    OpenAIRE

    Vedantham, Vasanth; Cannon, Stephen C.

    1999-01-01

    Lidocaine produces voltage- and use-dependent inhibition of voltage-gated Na+ channels through preferential binding to channel conformations that are normally populated at depolarized potentials and by slowing the rate of Na+ channel repriming after depolarizations. It has been proposed that the fast-inactivation mechanism plays a crucial role in these processes. However, the precise role of fast inactivation in lidocaine action has been difficult to probe because gating of drug-bound channel...

  5. Radiation-induced inactivation of enzymes - Molecular mechanism based on inactivation of dehydrogenases

    Science.gov (United States)

    Rodacka, Aleksandra; Gerszon, Joanna; Puchala, Mieczyslaw; Bartosz, Grzegorz

    2016-11-01

    Proteins, which have enzymatic activities play a fundamental role in the cell due to participation in most of biological processes. Oxidative-induced damage of enzymes often have marked effects on cellular processes, which in consequence determine cell functioning and survival. In this review, we focused on the radiation-induced inactivation of enzymes with particular emphasis on the inactivation of dehydrogenases. For a better understanding of this issue, the efficiency of products of water radiolysis (•OH, O2•- and H2O2) in enzyme inactivation has been analysed. Reactions of reactive oxygen species (ROS) with amino acids present in the active site of enzymes appear to have the greatest impact on enzyme inactivation.

  6. Formation of rutile fasciculate zone induced by sunlight irradiation at room temperature and its hemocompatibility

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Xuan-Hui; Zheng, Xiang; Cheng, Yuan [School of Chemical Engineering and Materials Science, Zhejiang University of Technology, Hangzhou 310014 (China); Li, Guo-Hua, E-mail: nanozjut@zjut.edu.cn [School of Chemical Engineering and Materials Science, Zhejiang University of Technology, Hangzhou 310014 (China); State Key Laboratory Breeding Base of Green Chemistry Synthesis Technology, Zhejiang University of Technology, Hangzhou 310014 (China); Research Center of Nanoscience and Technology, Zhejiang University of Technology, Hangzhou 310014 (China); Chen, Xiao-Ping, E-mail: chxp@zjut.edu.cn [School of Biological and Environmental Engineering, Zhejiang University of Technology, Hangzhou 310014 (China); Zheng, Jian-Hui [School of Biological and Environmental Engineering, Zhejiang University of Technology, Hangzhou 310014 (China)

    2013-08-01

    The fasciculate zone of phase pure rutile was fabricated under sunlight irradiation at room temperature, using titanium tetrachloride as a sole precursor. The crystal phase, morphology and microstructure, and optical absorption behavior of the samples were characterized by X-ray Diffraction, High-Resolution Transmission Electron Microscope (HRTEM) and UV–vis Diffuse Reflectance Spectra (DRS), respectively. XRD results show that the crystal phase of the sample is composed of rutile only, and a lattice distortion displays in the crystallite of the sample. HRTEM results show that the morphology of rutile particle is fasciculate zone constituted of nanoparticles with a diameter of 4–7 nm, and these particles grow one by one and step by step. The pattern of the selected area electron diffraction of the sample is Kikuchi type, which can be attributed to the predominant orientation growth of rutile nanoparticles along [001] induced by sunlight irradiation. DRS results show that the absorption threshold of the sample is 415 nm, corresponding to the band gap energy of 2.99 eV, which is lower than the band gap energy of rutile, 3.03 eV. Blood compatibility measurement shows that the sample has no remarkable effect on hemolytic and coagulation activity. The percent hemolysis of red blood cells is less than 5% even treated with a big dosage of the fasciculate rutile and under UV irradiation, and there are no obvious changes of plasma recalcification time after the rutile treatment. Thus, the novel structure of rutile fasciculate has low potential toxicity for blood and is hemocompatibility safe. Highlights: • A novel approach to fabricate the fasciculate zone of phase pure rutile • The fasciculate grows from a particle to nanorod and to fasciculate, step by step. • A preferred orientation growth induced by sunlight irradiation in the fasciculate • The rutile fasciculate is low toxicity for blood and is hemocompatibility safe.

  7. Technoeconomic analysis of different options for the production of hydrogen from sunlight, wind, and biomass

    Energy Technology Data Exchange (ETDEWEB)

    Mann, M.K.; Spath, P.L.; Amos, W.A. [National Renewable Energy Lab., Golden, CO (United States)

    1998-08-01

    To determine their technical and economic viability and to provide insight into where each technology is in its development cycle, different options to produce hydrogen from sunlight, wind, and biomass were studied. Additionally, costs for storing and transporting hydrogen were determined for different hydrogen quantities and storage times. The analysis of hydrogen from sunlight examined the selling price of hydrogen from two technologies: direct photoelectrochemical (PEC) conversion of sunlight and photovoltaic (PV)-generated electricity production followed by electrolysis. The wind analysis was based on wind-generated electricity production followed by electrolysis. In addition to the base case analyses, which assume that hydrogen is the sole product, three alternative scenarios explore the economic impact of integrating the PV- and wind-based systems with the electric utility grid. Results show that PEC hydrogen production has the potential to be economically feasible. Additionally, the economics of the PV and wind electrolysis systems are improved by interaction with the grid. The analysis of hydrogen from biomass focused on three gasification technologies. The systems are: low pressure, indirectly-heated gasification followed by steam reforming; high pressure, oxygen-blown gasification followed by steam reforming; and pyrolysis followed by partial oxidation. For each of the systems studied, the downstream process steps include shift conversion followed by hydrogen purification. Only the low pressure system produces hydrogen within the range of the current industry selling prices (typically $0.7--$2/kg, or $5--14/GJ on a HHV basis). A sensitivity analysis showed that, for the other two systems, in order to bring the hydrogen selling price down to $2/kg, negative-priced feedstocks would be required.

  8. Photoreactivity of carboxylated single-walled carbon nanotubes in sunlight: reactive oxygen species production in water.

    Science.gov (United States)

    Chen, Chia-Ying; Jafvert, Chad T

    2010-09-01

    Very limited information exists on transformation processes of carbon nanotubes in the natural aquatic environment. Because the conjugated pi-bond structure of these materials is efficient in absorbing sunlight, photochemical transformations are a potential fate process with reactivity predicted to vary with their diameter, chirality, number and type of defects, functionalization, residual metal catalyst and amorphous carbon content, and with the composition of the water, including the type and composition of materials that act to disperse them into the aqueous environment. In this study, the photochemical reactions involving colloidal dispersions of carboxylated single-walled carbon nanotubes (SWNT-COOH) in sunlight were examined. Production of reactive oxygen species (ROS) during irradiation occurs and is evidence for potential further phototransformation and may be significant in assessing their overall environmental impacts. In aerated samples exposed to sunlight or to lamps that emit light only within the solar spectrum, the probe compounds, furfuryl alcohol (FFA), tetrazolium salts (NBT2+ and XTT), and p-chlorobenzoic acid (pCBA), were used to indicate production of 1O2, O2.-, and .OH, respectively. All three ROS were produced in the presence of SWNT-COOH and molecular oxygen (3O2). 1O2 production was confirmed by observing enhanced FFA decay in deuterium oxide, attenuated decay of FFA in the presence of azide ion, and the lack of decay of FFA in deoxygenated solutions. Photogeneration of O2.- and .OH was confirmed by applying superoxide dismutase (SOD) and tert-butanol assays, respectively. In air-equilibrated suspensions, the loss of 0.2 mM FFA in 10 mg/L SWNT-COOH was approximately 85% after 74 h. Production of 1O2 was not dependent on pH from 7 to 11; however photoinduced aggregation was observed at pH 3.

  9. The ability of periorbitally applied antiglare products to improve contrast sensitivity in conditions of sunlight exposure.

    Science.gov (United States)

    DeBroff, Brian M; Pahk, Patricia J

    2003-07-01

    Sun glare decreases athletes' contrast sensitivity and impairs their ability to distinguish objects from background. Many commercial products claim to reduce glare but have not been proven effective in clinical studies. To determine whether glare-reducing products such as eye black grease and antiglare stickers reduce glare and improve contrast sensitivity during sunlight exposure. We tested 46 subjects for contrast sensitivity using a Pelli-Robson contrast chart. Each subject served as an internal control and then was randomized to either application of eye black grease, antiglare stickers, or petroleum jelly at the infraorbital rim. All testing was performed in conditions of unobstructed sunlight. Analysis of variance revealed a significant difference between eye black grease (mean +/- SD, Pelli-Robson value, 1.87 +/- 0.09 logMAR units) and antiglare stickers (1.75 +/- 0.14 logMAR units) in binocular testing (P =.02). No statistical difference was found between the groups in right eyes, left eyes, or in combined data from the right and left eyes. Paired t tests demonstrated a significant difference between control (mean +/- SD, 1.77 +/- 0.14 logMAR units) and eye black grease (1.87 +/- 0.09 logMAR units) in binocular testing (P =.04). There was also a significant difference between control (mean +/- SD, 1.65 +/- 0.05 logMAR units) and eye black grease (1.67 +/- 0.06 logMAR units) in combined data from the right and left eyes (P =.02). Eye black grease reduces glare and improves contrast sensitivity in conditions of sunlight exposure compared with the control and antiglare stickers in binocular testing.

  10. Simulation of Na channel inactivation by thiazine dyes

    OpenAIRE

    1982-01-01

    Some dyes of the methylene blue family serve as artificial inactivators of the sodium channels when present inside squid axons at a concentration of approximately 0.1 mM. The dyes restore a semblance of inactivation after normal inactivation has been destroyed by pronase. In fibers that inactivate normally, the dyes hasten the decay of sodium current. Many dye-blocked channels conduct transiently on exit of the dye molecule after repolarization to the holding potential. In contrast, normally ...

  11. Cortical inactivation by cooling in small animals

    Directory of Open Access Journals (Sweden)

    Ben eCoomber

    2011-06-01

    Full Text Available Reversible inactivation of the cortex by surface cooling is a powerful method for studying the function of a particular area. Implanted cooling cryoloops have been used to study the role of individual cortical areas in auditory processing of awake-behaving cats. Cryoloops have also been used in rodents for reversible inactivation of the cortex, but recently there has been a concern that the cryoloop may also cool non-cortical structures either directly or via the perfusion of blood, cooled as it passed close to the cooling loop. In this study we have confirmed that the loop can inactivate most of the auditory cortex without causing a significant reduction in temperature of the auditory thalamus or other sub-cortical structures. We placed a cryoloop on the surface of the guinea pig cortex, cooled it to 2°C and measured thermal gradients across the neocortical surface. We found that the temperature dropped to 20-24°C among cells within a radius of about 2.5mm away from the loop. This temperature drop was sufficient to reduce activity of most cortical cells and led to the inactivation of almost the entire auditory region. When the temperature of thalamus, midbrain, and middle ear were measured directly during cortical cooling, there was a small drop in temperature (about 4°C but this was not sufficient to directly reduce neural activity. In an effort to visualise the extent of neural inactivation we measured the uptake of thallium ions following an intravenous injection. This confirmed that there was a large reduction of activity across much of the ipsilateral cortex and only a small reduction in subcortical structures.

  12. Assessing Photocatalytic Oxidation Using Modified TiO 2 Nanomaterials for Virus Inactivation in Drinking Water: Mechanisms and Application

    Science.gov (United States)

    Liga, Michael Vincent

    Photocatalytic oxidation is an alternative water treatment method under consideration for disinfecting water. Chlorine disinfection can form harmful byproducts, and some viruses (e.g. adenoviruses) are resistant to other alternative disinfection methods. Photocatalytic oxidation using nano-sized photocatalytic particles (e.g. TiO2, fullerene) holds promise; however, it is limited by its low efficiency and long required treatment times. This research focuses on improving virus inactivation by photocatalytic oxidation by modifying catalysts for improved activity, by analyzing virus inactivation kinetics, and by elucidating the inactivation mechanisms of adenovirus serotype 2 (AdV2) and bacteriophage MS2. Modifying TiO2 with silver (nAg/TiO2) or silica (SiO2-TiO2) improves the inactivation kinetics of bacteriophage MS2 by a factor of 3-10. nAg/ TiO2 increases hydroxyl radical (HO·) production while SiO2 increases the adsorption of MS2 to TiO 2. These results suggest that modifying the photocatalyst surface to increase contaminant adsorption is an important improvement strategy along with increasing HO· production. The inactivation kinetics of AdV2 by P25 TiO2 is much slower than the MS2 inactivation kinetics and displays a strong shoulder, which is not present in the MS2 kinetics. nAg/TiO2 initially improves the inactivation rate of AdV2. SiO2-TiO2 reduces the AdV2 inactivation kinetics since adsorption is not significantly enhanced, as it is with MS2. Amino-C60 is highly effective for AdV2 inactivation under visible light irradiation, making it a good material for use in solar disinfection systems. The efficacy of amino-fullerene also demonstrates that singlet oxygen is effective for AdV2 inactivation. When exposed to irradiated TiO2, AdV2 hexon proteins are heavily damaged resulting in the release of DNA. DNA damage is also present but may occur after capsids break. With MS2, the host interaction protein is rapidly damaged, but not the coat protein. The kinetics

  13. Effects of pulsed electric fields on inactivation kinetics of Listeria innocua

    NARCIS (Netherlands)

    Wouters, P.C.; Dutreux, N.; Smelt, J.P.P.M.; Lelieveld, H.L.M.

    1999-01-01

    The effects of pulsed electric field (PEF) treatment and processing factors on the inactivation kinetics of Listeria innocua NCTC 11289 were investigated by using a pilot plant PEF unit with a flow rate of 200 liters/h. The electric field strength, pulse length, number of pulses, and inlet temperatu

  14. Bacteriophage PRD1 batch experiments to study attachment, detachment and inactivation processes

    NARCIS (Netherlands)

    Sadeghi, G.; Schijven, J.F.; Behrends, T.; Hassanizadeh, S.M.; van Genuchten, M.T.

    2013-01-01

    Knowledge of virus removal in subsurface environments is pivotal for assessing the risk of viral contamination of water resources and developing appropriate protection measures. Columns packed with sand are frequently used to quantify attachment, detachment and inactivation rates of viruses. Since

  15. Inactivation by ionizing radiation of Salmonella enteritidis serotype montevideo grown in composed sewage sludge

    Energy Technology Data Exchange (ETDEWEB)

    Brandon, J.R.; Burge, W.D.; Enkiri, N.K.

    1977-04-01

    S. enteritidis ser. montevideo were grown in composted sewage sludge to levels of approximately 10/sup 9//g. These bacteria were found to be inactivated by ionizing radiation (with Co/sub 60/) at approximately the same rate (30 krads/log) as Salmonella species in liquid digested sludge.

  16. Dispersed single-phase-step Michelson interferometer for Doppler imaging using sunlight.

    Science.gov (United States)

    Wan, Xiaoke; Ge, Jian

    2012-09-15

    A Michelson interferometer is dispersed with a fiber array-fed spectrograph, providing 59 Doppler sensing channels using sunlight in the 510-570 nm wavelength region. The interferometer operates at a single-phase-step mode, which is particularly advantageous in multiplexing and data processing compared to the phase-stepping mode of other interferometer spectrometer instruments. Spectral templates are prepared using a standard solar spectrum and simulated interferometer modulations, such that the correlation function with a measured 1D spectrum determines the Doppler shift. Doppler imaging of a rotating cylinder is demonstrated. The average Doppler sensitivity is ~12 m/s, with some channels reaching ~5 m/s.

  17. On the origin of the coherence of sunlight on the earth.

    Science.gov (United States)

    Sundaram, Sriram; Panigrahi, Prasanta K

    2016-09-15

    It is shown that the observed far-field behavior of sunlight on the earth's surface, located in the near-field region, is due to the small angular width it subtends at the center of the sun. The investigation of the angular behavior of the cross-spectral density function explicitly leads to Bessel-like far-zone behavior for a small angle without any restriction on the value of l. Our general analysis for the spherical source can be easily extended to other geometries.

  18. Influence of Sound Wave Stimulation on the Growth of Strawberry in Sunlight Greenhouse

    Science.gov (United States)

    Qi, Lirong; Teng, Guanghui; Hou, Tianzhen; Zhu, Baoying; Liu, Xiaona

    In this paper, we adopt the QGWA-03 plant audio apparatus to investigate the sound effects on strawberry in the leaf area, the photosynthetic characteristics and other physiological indexes. It was found that when there were no significant differences between the circumstances of the two sunlight greenhouses, the strawberry after the sound wave stimulation grew stronger than in the control and its leaf were deeper green, and shifted to an earlier time about one week to blossom and bear fruit. It was also found that the resistance of strawberry against disease and insect pest were enhanced. The experiment results show that sound wave stimulation can certainly promote the growth of plants.

  19. Sunlight-Induced Photochemical Degradation of Methylene Blue by Water-Soluble Carbon Nanorods

    Directory of Open Access Journals (Sweden)

    Anshu Bhati

    2016-01-01

    Full Text Available Water-soluble graphitic hollow carbon nanorods (wsCNRs are exploited for their light-driven photochemical activities under outdoor sunlight. wsCNRs were synthesized by a simple pyrolysis method from castor seed oil, without using any metal catalyst or template. wsCNRs exhibited the light-induced photochemical degradation of methylene blue used as a model pollutant by the generation of singlet oxygen species. Herein, we described a possible degradation mechanism of methylene blue under the irradiation of visible photons via the singlet oxygen-superoxide anion pathway.

  20. Bacterial growth in humic waters exposed to UV-radiation and simulated sunlight

    DEFF Research Database (Denmark)

    Corin, N.; Backlund, P.; Wiklund, T.

    1998-01-01

    Sterile filtered (0.45 mu m) humic lake water was exposed to simulated sunlight (300-800 nm) or W-radiation (254 run)for various periods of times and the dissolved organic carbon content, absorbance at 254 and 460 nm and PH were recorded. The irradiated water was inoculated with a natural bacterial...... in an increased availability of the dissolved organic material as bacterial substrate. No inhibitory effect on the bacterial growth, due to the presence of toxic organic reaction products, was observed. (C) 1998 Published by Elsevier Science Ltd....

  1. Sunlight simulators-the key to understanding the physiological effects of the sun

    CSIR Research Space (South Africa)

    Singh, A

    2006-07-01

    Full Text Available simulator Slide 4 © CSIR 2006 www.csir.co.za ۞ Benefits of natural sunlight ۞ Restrictions of lifestyles ۞ Common misconceptions ۞ Experimental setups Slide 5 © CSIR 2006 www.csir.co.za Cancer Males... Females Cases Deaths Cases Deaths Oral cavity 175,916 80,736 98,373 46,723 Esophagus 315,394 261,162 146,723 124,730 Stomach 603,419 446,052 330,518 254,297 Colon/rectum 550,465 278,446 472,687 250,532 Liver 442,119 416,882 184...

  2. Sunlight effects on the 3D polar current system determined from low Earth orbit measurements

    DEFF Research Database (Denmark)

    Laundal, Karl M.; Finlay, Chris; Olsen, Nils

    2016-01-01

    analyzed together. In this paper, we present estimates of the average global Birkeland currents and horizontal ionospheric currents from the same set of magnetic field measurements. The magnetic field measurements, from the low Earth orbiting Swarm and CHAMP satellites, are used to co-estimate poloidal...... show that the Birkeland currents vary with the conductivity, which depends most strongly on solar EUV emissions on the dayside and on particle precipitation at pre-midnight magnetic local times. In sunlight, the horizontal equivalent current flows in two cells, resembling an opposite ionospheric...

  3. Derivation of Hodgkin-Huxley equations for a Na+ channel from a master equation for coupled activation and inactivation

    Science.gov (United States)

    Vaccaro, S. R.

    2016-11-01

    The Na+ current in nerve and muscle membranes may be described in terms of the activation variable m (t ) and the inactivation variable h (t ) , which are dependent on the transitions of S4 sensors of each of the Na+ channel domains DI to DIV. The time-dependence of the Na+ current and the rate equations satisfied by m (t ) and h (t ) may be derived from the solution to a master equation that describes the coupling between two or three activation sensors regulating the Na+ channel conductance and a two-stage inactivation process. If the inactivation rate from the closed or open states increases as the S4 sensors activate, a more general form of the Hodgkin-Huxley expression for the open-state probability may be derived where m (t ) is dependent on both activation and inactivation processes. The voltage dependence of the rate functions for inactivation and recovery from inactivation are consistent with the empirically determined expressions and exhibit saturation for both depolarized and hyperpolarized clamp potentials.

  4. Derivation of Hodgkin-Huxley equations for a Na^{+} channel from a master equation for coupled activation and inactivation.

    Science.gov (United States)

    Vaccaro, S R

    2016-11-01

    The Na^{+} current in nerve and muscle membranes may be described in terms of the activation variable m(t) and the inactivation variable h(t), which are dependent on the transitions of S4 sensors of each of the Na^{+} channel domains DI to DIV. The time-dependence of the Na^{+} current and the rate equations satisfied by m(t) and h(t) may be derived from the solution to a master equation that describes the coupling between two or three activation sensors regulating the Na^{+} channel conductance and a two-stage inactivation process. If the inactivation rate from the closed or open states increases as the S4 sensors activate, a more general form of the Hodgkin-Huxley expression for the open-state probability may be derived where m(t) is dependent on both activation and inactivation processes. The voltage dependence of the rate functions for inactivation and recovery from inactivation are consistent with the empirically determined expressions and exhibit saturation for both depolarized and hyperpolarized clamp potentials.

  5. Bacterial inactivation using atmospheric pressure single pin electrode microplasma jet with a ground ring

    Science.gov (United States)

    Kim, Sun Ja; Chung, T. H.; Bae, S. H.; Leem, S. H.

    2009-04-01

    Bacterial inactivation experiment was performed using atmospheric pressure microplasma jets driven by radio-frequency wave of 13.56 MHz and by low frequency wave of several kilohertz. With addition of a ground ring electrode, the discharge current, the optical emission intensities from reactive radicals, and the sterilization efficiency were enhanced significantly. When oxygen gas was added to helium at the flow rate of 5 SCCM, the sterilization efficiency was enhanced. From the survival curve of Escherichia coli, the primary role in the inactivation was played by reactive species with minor aid from heat, UV photons, charged particles, and electric fields.

  6. Comparison of Inactivation and Unfolding of Calf Intestinal Alkaline Phosphatase in Guanidinium Chloride Solution

    Institute of Scientific and Technical Information of China (English)

    张英侠; 闫淑莲; 刘永利; 席宏伟; 周海梦

    2002-01-01

    The changes in activity and unfolding of calf intestinal alkaline phosphatase (CIP) during denaturation in guanidinium chloride solutions of different concentrations were investigated using ultraviolet difference absorption spectra and fluorescence emission spectra. Unfolding and inactivation rate constants were measured and compared. The inactivation course is much faster than that of unfolding, which suggests that the active site of CIP containing two zinc ions and one magnesium ion is situated in a limited and flexible region of the enzyme molecule, which is more fragile to the denaturant than the protein as a whole.

  7. Inactivation of Escherichia coli phage by pulsed electric field treatment and analysis of inactivation mechanism

    Science.gov (United States)

    Tanino, Takanori; Yoshida, Tomoki; Sakai, Kazuki; Ohshima, Takayuki

    2013-03-01

    Inactivation of bacteriophage by pulsed electric field (PEF) treatment, one of the effective procedures for bacteria nonthermal inactivation, was studied. Model phage particles Escherichia coli bacteriophages M13mp18 and λ phage, were successfully inactivated by PEF treatment. The survival ratios of both bacteriophages decreased depending on the PEF treatment time when applied peak voltage was 5 or 7 kV, and the survival ratios after 12 min PEF treatment were 10-4 - 10-5. Electrophoresis analyses of biological molecules of inactivated λ phage detected no degradation of total protein and genomic DNA. These results suggested that the factor of phage inactivation by PEF treatment was not based on the degradation of protein or DNA, but on the destruction of phage particle structure. Sensitivity of E. coli phage to PEF treatment was compared with that of E. coli cell. Phage and MV1184 cell were treated with same condition PEF at 5 kV, respectively. After 12 min treatment, the survival ration of λ phage and MV1184 were 4.0 × 10-5 and 1.7 × 10-3, respectively. The survival ratio of phage was lower than that of MV1184. E. coli cell is more tolerant to inactivation with PEF treatment than coli phage.

  8. Numerical evaluation of lactoperoxidase inactivation during continuous pulsed electric field processing.

    Science.gov (United States)

    Buckow, Roman; Semrau, Julius; Sui, Qian; Wan, Jason; Knoerzer, Kai

    2012-01-01

    A computational fluid dynamics (CFD) model describing the flow, electric field and temperature distribution of a laboratory-scale pulsed electric field (PEF) treatment chamber with co-field electrode configuration was developed. The predicted temperature increase was validated by means of integral temperature studies using thermocouples at the outlet of each flow cell for grape juice and salt solutions. Simulations of PEF treatments revealed intensity peaks of the electric field and laminar flow conditions in the treatment chamber causing local temperature hot spots near the chamber walls. Furthermore, thermal inactivation kinetics of lactoperoxidase (LPO) dissolved in simulated milk ultrafiltrate were determined with a glass capillary method at temperatures ranging from 65 to 80 °C. Temperature dependence of first order inactivation rate constants was accurately described by the Arrhenius equation yielding an activation energy of 597.1 kJ mol(-1). The thermal impact of different PEF processes on LPO activity was estimated by coupling the derived Arrhenius model with the CFD model and the predicted enzyme inactivation was compared to experimental measurements. Results indicated that LPO inactivation during combined PEF/thermal treatments was largely due to thermal effects, but 5-12% enzyme inactivation may be related to other electro-chemical effects occurring during PEF treatments.

  9. Mechanism-based inactivation of serine transhydroxymethylases by D-fluoroalanine and related amino acids.

    Science.gov (United States)

    Wang, E A; Kallen, R; Walsh, C

    1981-07-10

    Serine transhydroxymethylase, from lamb or rabbit liver, is known to catalyze slow transamination of D-alanine, but not of L-amino acids, in a tetrahydrofolate-independent reaction. Both enzymes will process the D-isomer of beta-fluoroalanine for alpha, beta-elimination of HF to yield an aminoacrylate-pyridoxal-P-enzyme intermediate. This intermediate partitions between harmless hydrolysis to pyruvate, NH4+, and active enzyme-pyridoxal-P (catalytic turnover) and suicidal enzyme alkylation by covalent modification with an average partition ratio of 40-60 turnovers/inactivation event/monomer unit of this tetrameric enzyme. Enzyme inactivation occurs with stoichiometric incorporation of radioactive label from D-[1,2-14C]fluoroalanine. Titration of enzymic cysteinyl --SH groups with 5,5'-dithiobis(2-nitrobenzoate) indicates loss of 1 --SH group on inactivation. Acid hydrolysis of radioactive-inactive enzyme confirms cysteine residue modification. Treatment of inactive enzyme with 6 M urea, then KBH4, followed by acid hydrolysis yields two radioactive compounds, lanthionine and S-carboxyhydroxyethylcysteine, in about equal amounts. The addition of tetrahydrofolate stimulates both pyruvate production and inactivation to equal extents with about a 200-fold rate acceleration at 0.5 mM tetrahydrofolate to turnover numbers of approximately 120 min-1. The Km for D-fluoroalanine is high, 10-60 mM, and this low substrate affinity suggests D-fluoroalanine will not be a useful in vivo agent for selective inactivation of liver cell serine transhydroxymethylases.

  10. Inactivation of bacteria and yeast using high-frequency ultrasound treatment.

    Science.gov (United States)

    Gao, Shengpu; Hemar, Yacine; Ashokkumar, Muthupandian; Paturel, Sara; Lewis, Gillian D

    2014-09-01

    High-frequency (850 kHz) ultrasound was used to inactivate bacteria and yeast at different growth phases under controlled temperature conditions. Three species of bacteria, Enterobacter aerogenes, Bacillus subtilis and Staphylococcus epidermidis as well as a yeast, Aureobasidium pullulans were considered. The study shows that high-frequency ultrasound is highly efficient in inactivating the bacteria in both their exponential and stationary growth phases, and inactivation rates of more than 99% were achieved. TEM observation suggests that the mechanism of bacteria inactivation is mainly due to acoustic cavitation generated free radicals and H2O2. The rod-shaped bacterium B. subtilis was also found to be sensitive to the mechanical effects of acoustic cavitation. The study showed that the inactivation process continued even after ultrasonic processing cessed due to the presence of H2O2, generated during acoustic cavitation. Compared to bacteria, the yeast A. pullulans was found to be more resistant to high-frequency ultrasound treatment.

  11. Inactivation of Herpesvirus hominis types 1 and 2 by silver nitrate in vitro and in vivo.

    Science.gov (United States)

    Coleman, V R; Wilkie, J; Levinson, W E; Stevens, T; Jawetz, E

    1973-09-01

    Herpes simplex virus (HSV) types 1 and 2 (two strains each) were inactivated at different rates in vitro by 40 muM AgNO(3). The inactivation of HSV type 1 strains was virtually complete in 10 to 15 min, whereas almost half of the infectivity of HSV type 2 strains survived this exposure. One strain of type 1 inoculated into rabbit eyes was almost completely inactivated by 1% AgNO(3) solution dropped into the eye 20 min later, so that there was markedly reduced viral replication and less corneal herpetic disease. One strain of HSV type 2 in the rabbit eye was not effectively inactivated by 1% AgNO(3). From these results, it seems likely that AgNO(3) instillation into the eyes of a newborn who has passed through a birth canal infected with HSV might prevent eye infection with HSV type 1 but not with type 2. The greater resistance of HSV type 2 strains to chemical inactivation in vitro and in vivo may be of medical concern.

  12. Recommendations for the performance rating of flat plate terrestrial photovoltaic solar panels

    Science.gov (United States)

    Treble, F. C.

    1976-01-01

    A review of recommendations for standardizing the performance rating of flat plate terrestrial solar panels is given to develop an international standard code of practice for performance rating. Required data to characterize the performance of a solar panel are listed. Other items discussed are: (1) basic measurement procedures; (2) performance measurement in natural sunlight and simulated sunlight; (3) standard solar cells; (4) the normal incidence method; (5) global method and (6) definition of peak power.

  13. Mutation spectrum in sunlight-exposed mouse skin epidermis: small but appreciable contribution of oxidative stress-mediated mutagenesis

    Energy Technology Data Exchange (ETDEWEB)

    Ikehata, Hironobu [Department of Cell Biology, Graduate School of Medicine, Tohoku University, Sendai 980-8575 (Japan)]. E-mail: ikehata@mail.tains.tohoku.ac.jp; Nakamura, Shingo [Department of Cell Biology, Graduate School of Medicine, Tohoku University, Sendai 980-8575 (Japan); Department of Radiobiology, Institute for Environmental Sciences, Aomori 039-3212 (Japan); Asamura, Takaaki [Department of Cell Biology, Graduate School of Medicine, Tohoku University, Sendai 980-8575 (Japan); Ono, Tetsuya [Department of Cell Biology, Graduate School of Medicine, Tohoku University, Sendai 980-8575 (Japan)

    2004-11-22

    We studied the mutations induced in skin by sunlight using transgenic Muta{sup TM} mice. Noon sunlight during summer at Sendai, Japan induced mutations efficiently in both epidermis and dermis. The mutant frequency (MF) in epidermis reached nearly 0.5% during the first 40 min irradiation but became saturated at this level with the appearance of skin inflammation after further irradiation. At the equivalent inflammatory dose, sunlight was twice as genotoxic as 313 nm-peak UVB. The 81 mutations detected in 80 lacZ transgene mutants isolated from the sunlight-exposed epidermis were dominated by C {yields} T transitions (89%), occurring exclusively at dipyrimidine sites, and also included a CC {yields} TT tandem substitution. Thus, the sunlight-induced mutation spectrum is highly UV-specific, quite similar to that induced by UVB but significantly different from that induced by UVA. Although oxidative damage-related C {yields} A transversions were detected only in five mutants (6%), their frequency was elevated to at least 15 times the background level, suggesting that the contribution of UVA-mediated oxidative stress is comparatively small but considerable. An analysis of bases adjacent to the mutated cytosines revealed that the sunlight-induced mutations prefer 5'-TC-3' dipyrimidine sites to 5'-CC-3' and 5'-CT-3'. The distribution of the frequent C {yields} T transition sites in the transgene was well associated with the CpG motif, which is known to be completely methylated in the gene, and quite similar to that induced by UVB rather than that by UVA. Thus, the UVB component contributes to the sunlight-induced mutations in the mammalian skin much more than the UVA component, whose influence through reactive oxygen species (ROS)-mediated mutagenesis is still appreciable.

  14. Degradation of emerging contaminants from water under natural sunlight: The effect of season, pH, humic acids and nitrate and identification of photodegradation by-products.

    Science.gov (United States)

    Koumaki, Elena; Mamais, Daniel; Noutsopoulos, Constantinos; Nika, Maria-Christina; Bletsou, Anna A; Thomaidis, Nikolaos S; Eftaxias, Alexander; Stratogianni, Georgia

    2015-11-01

    Both photodegradation and hydrolysis of non-steroidal anti-inflammatory drugs (NSAIDs) and endocrine disrupting chemicals (EDCs) were investigated in order to evaluate their photochemical fate in aquatic environment and to assess the effect of season and specific characteristics of water (pH, humic acids and nitrate concentration) on the removal of target EDCs and NSAIDs through photodegradation. An additional objective was the identification of the photodegradation by-products of specific NSAIDs and their dependence on irradiation time. Selected compounds' transformation was investigated under natural sunlight radiation while control experiments were conducted in the dark. As expected, most of compounds' degradation rate decreased with decreasing light intensity between two different experimental periods. Most of the tested compounds exhibited different rates of degradation during direct and indirect photolysis. The degradation rate of the selected compounds increased in the presence of NO3(-) and the photodegradation rate was higher for some compounds in alkaline than in acidic solution. The effect of humic acids' presence in the water depends on the absorbance spectrum of the compound and the produced photosensitizers. More specifically, humic acids act as inner filter toward most of the selected NSAIDs and as photosensitizers toward most of the EDCs. The results of the irradiation experiments in the presence of both humic acids and NO3(-), indicate that the direct photolysis is much more efficient than indirect photochemical processes. Finally, several degradation by-products of ketoprofen and diclofenac were identified in the samples, exposed to sunlight. The dependence of these by-products on radiation time is also demonstrated. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Dynamical characterization of inactivation path in voltage-gated Na(+) ion channel by non-equilibrium response spectroscopy.

    Science.gov (United States)

    Pal, Krishnendu; Gangopadhyay, Gautam

    2016-11-01

    Inactivation path of voltage gated sodium channel has been studied here under various voltage protocols as it is the main governing factor for the periodic occurrence and shape of the action potential. These voltage protocols actually serve as non-equilibrium response spectroscopic tools to study the ion channel in non-equilibrium environment. In contrast to a lot of effort in finding the crystal structure based molecular mechanism of closed-state(CSI) and open-state inactivation(OSI); here our approach is to understand the dynamical characterization of inactivation. The kinetic flux as well as energetic contribution of the closed and open- state inactivation path is compared here for voltage protocols, namely constant, pulsed and oscillating. The non-equilibrium thermodynamic quantities used in response to these voltage protocols serve as improved characterization tools for theoretical understanding which not only agrees with the previously known kinetic measurements but also predict the energetically optimum processes to sustain the auto-regulatory mechanism of action potential and the consequent inactivation steps needed. The time dependent voltage pattern governs the population of the conformational states which when couple with characteristic rate parameters, the CSI and OSI selectivity arise dynamically to control the inactivation path. Using constant, pulsed and continuous oscillating voltage protocols we have shown that during depolarization the OSI path is more favored path of inactivation however, in the hyper-polarized situation the CSI is favored. It is also shown that the re-factorisation of inactivated sodium channel to resting state occurs via CSI path. Here we have shown how the subtle energetic and entropic cost due to the change in the depolarization magnitude determines the optimum path of inactivation. It is shown that an efficient CSI and OSI dynamical profile in principle can characterize the open-state drug blocking phenomena.

  16. The position of the fast-inactivation gate during lidocaine block of voltage-gated Na+ channels.

    Science.gov (United States)

    Vedantham, V; Cannon, S C

    1999-01-01

    Lidocaine produces voltage- and use-dependent inhibition of voltage-gated Na+ channels through preferential binding to channel conformations that are normally populated at depolarized potentials and by slowing the rate of Na+ channel repriming after depolarizations. It has been proposed that the fast-inactivation mechanism plays a crucial role in these processes. However, the precise role of fast inactivation in lidocaine action has been difficult to probe because gating of drug-bound channels does not involve changes in ionic current. For that reason, we employed a conformational marker for the fast-inactivation gate, the reactivity of a cysteine substituted at phenylalanine 1304 in the rat adult skeletal muscle sodium channel alpha subunit (rSkM1) with [2-(trimethylammonium)ethyl]methanethiosulfonate (MTS-ET), to determine the position of the fast-inactivation gate during lidocaine block. We found that lidocaine does not compete with fast-inactivation. Rather, it favors closure of the fast-inactivation gate in a voltage-dependent manner, causing a hyperpolarizing shift in the voltage dependence of site 1304 accessibility that parallels a shift in the steady state availability curve measured for ionic currents. More significantly, we found that the lidocaine-induced slowing of sodium channel repriming does not result from a slowing of recovery of the fast-inactivation gate, and thus that use-dependent block does not involve an accumulation of fast-inactivated channels. Based on these data, we propose a model in which transitions along the activation pathway, rather than transitions to inactivated states, play a crucial role in the mechanism of lidocaine action.

  17. Effects of Bacterial Inactivation Methods on Downstream Proteomic Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Andy; Merkley, Eric D.; Clowers, Brian H.; Hutchison, Janine R.; Kreuzer, Helen W.

    2015-05-01

    Inactivation of pathogenic microbial samples is often necessary for the protection of researchers and to comply with local and federal regulations. By its nature, biological inactivation causes changes to microbial samples, potentially affecting observed experimental results. While inactivation induced damage to materials such as DNA has been evaluated, the effect of various inactivation strategies on proteomic data, to our knowledge, has not been discussed. To this end, we inactivated samples of Yersinia pestis and Escherichia coli by autoclave, ethanol, or irradiation treatment to determine how inactivation changes liquid chromatography tandem mass spectrometry data quality as well as apparent protein content of cells. Proteomic datasets obtained from aliquots of samples inactivated by different methods were highly similar, with Pearson correlation coefficients ranging from 0.822 to 0.985 and 0.816 to 0.985 for E. coli and Y. pestis, respectively, suggesting that inactivation had only slight impacts on the set of proteins identified. In addition, spectral quality metrics such as distributions of various database search algorithm scores remained constant across inactivation methods, indicating that inactivation does not appreciably degrade spectral quality. Though overall changes resulting from inactivation were small, there were detectable trends. For example, one-sided Fischer exact tests determined that periplasmic proteins decrease in observed abundance after sample inactivation by autoclaving (α = 1.71x10-2 for E. coli, α = 4.97x10-4 for Y. pestis) and irradiation (α = 9.43x10-7 for E. coli, α = 1.21x10-5 for Y. pestis) when compared to controls that were not inactivated. Based on our data, if sample inactivation is necessary, we recommend inactivation with ethanol treatment with secondary preference given to irradiation.

  18. Sunlight exposure and sun sensitivity associated with disability progression in multiple sclerosis.

    Science.gov (United States)

    D'hooghe, M B; Haentjens, P; Nagels, G; Garmyn, M; De Keyser, J

    2012-04-01

    Sunlight and vitamin D have been inversely associated with the risk of multiple sclerosis (MS). We investigated sunlight exposure and sun sensitivity in relation to disability progression in MS. We conducted a survey among persons with MS, registered by the Flemish MS society, Belgium, and stratified data according to relapsing-onset and progressive-onset MS. We used Kaplan-Meier survival and Cox proportional hazard regression analyses with time to Expanded Disability Status Scale (EDSS) 6 as outcome measure. Hazard ratios for the time from onset and from birth were calculated for the potentially predictive variables, adjusting for age at onset, gender and immunomodulatory treatment. 704 (51.3%) of the 1372 respondents had reached EDSS 6. In relapsing-onset MS, respondents reporting equal or higher levels of sun exposure than persons of the same age in the last 10 years had a decreased risk of reaching EDSS 6. In progressive-onset MS, increased sun sensitivity was associated with an increased hazard of reaching EDSS 6. The association of higher sun exposure with a better outcome in relapsing-onset MS may be explained by either a protective effect or reverse causality. Mechanisms underlying sun sensitivity might influence progression in progressive-onset MS.

  19. Factors influencing adherence with therapeutic sunlight exposure in older people in intermediate care facilities.

    Science.gov (United States)

    Durvasula, Seeta; Sambrook, Philip N; Cameron, Ian D

    2012-01-01

    The purpose of this study was to investigate the factors influencing low adherence with therapeutic sunlight exposure in a randomized controlled trial conducted with older people living in intermediate care facilities. The study involved participants in the FREEDOM (Falls Risk Epidemiology: Effect of vitamin D on skeletal Outcomes and other Measures) study, a randomized controlled trial of therapeutic sun exposure to reduce falls in older people in intermediate care facilities. Semi-structured interviews were conducted with thirty participants in the FREEDOM trial, and with ten sunlight officers who were employed to facilitate the sun exposure. Two focus groups involving 10 participants in the FREEDOM trial were also held at the end of the intervention period. Common themes were derived from the interview and focus group transcripts. The study showed that the perceived health benefits did not influence adherence with the sun exposure. Factors such as socializing with others and being outdoors were more important in encouraging attendance. The main barriers to adherence included the perceived inflexibility and regimentation of daily attendance, clash with other activities, unsuitable timing and heat discomfort. This study showed that providing greater flexibility and autonomy to older people in how and when they receive sun exposure is likely to improve adherence. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  20. Years of sunlight exposure and cataract: a case-control study in a Mediterranean population

    Science.gov (United States)

    Pastor-Valero, María; Fletcher, Astrid E; de Stavola, Bianca L; Chaqués-Alepúz, Vicente

    2007-01-01

    Background We aimed to investigate the relation between sunlight exposure and risk of cataract. Methods We carried out a frequency-matched case-control study of 343 cases and 334 controls attending an ophthalmology outpatient clinic at a primary health-care center in a small town near Valencia, Spain. All cases were diagnosed as having a cataract in at least one eye based on the Lens Opacification Classification system (LOCS II). Controls had no opacities in either eye. All cases and controls were interviewed for information on outdoor exposure, "usual" diet, history of severe episodes of diarrhea illness, life-style factors and medical and socio-demographic variables. Blood antioxidant vitamin levels were also analyzed. We used logistic regression models to estimate sex and age-adjusted odds ratios (ORs) by quintiles of years of occupational outdoor exposure, adjusting for potential confounders such as smoking, alcohol consumption, serum antioxidants and education. Results No association was found between years of outdoor exposure and risk of cataract. However, exploratory analyses suggested a positive association between years of outdoor exposure at younger ages and risk of nuclear cataract later in life. Conclusion Our study does not support an association with cataract and sunlight exposure over adult life. PMID:18039367

  1. Sunlight triggers cutaneous lupus through a CSF-1-dependent mechanism in MRL-Fas(lpr) mice.

    Science.gov (United States)

    Menke, Julia; Hsu, Mei-Yu; Byrne, Katelyn T; Lucas, Julie A; Rabacal, Whitney A; Croker, Byron P; Zong, Xiao-Hua; Stanley, E Richard; Kelley, Vicki R

    2008-11-15

    Sunlight (UVB) triggers cutaneous lupus erythematosus (CLE) and systemic lupus through an unknown mechanism. We tested the hypothesis that UVB triggers CLE through a CSF-1-dependent, macrophage (Mø)-mediated mechanism in MRL-Fas(lpr) mice. By constructing mutant MRL-Fas(lpr) strains expressing varying levels of CSF-1 (high, intermediate, none), and use of an ex vivo gene transfer to deliver CSF-1 intradermally, we determined that CSF-1 induces CLE in lupus-susceptible MRL-Fas(lpr) mice, but not in lupus-resistant BALB/c mice. UVB incites an increase in Møs, apoptosis in the skin, and CLE in MRL-Fas(lpr), but not in CSF-1-deficient MRL-Fas(lpr) mice. Furthermore, UVB did not induce CLE in BALB/c mice. Probing further, UVB stimulates CSF-1 expression by keratinocytes leading to recruitment and activation of Møs that, in turn, release mediators, which induce apoptosis in keratinocytes. Thus, sunlight triggers a CSF-1-dependent, Mø-mediated destructive inflammation in the skin leading to CLE in lupus-susceptible MRL-Fas(lpr) but not lupus-resistant BALB/c mice. Taken together, CSF-1 is envisioned as the match and lupus susceptibility as the tinder leading to CLE.

  2. Dose-Response Effect of Sunlight on Vitamin D2 Production in Agaricus bisporus Mushrooms

    DEFF Research Database (Denmark)

    Urbain, Paul; Jakobsen, Jette

    2015-01-01

    The dose response effect of UV-B irradiation from sunlight on vitamin D2 content of sliced Agaricus bisporus (white button mushroom) during the process of sun-drying was investigated.Real-time UV-B and UV-A data were obtained using a high-performance spectroradiometer. During the first hour...... of sunlight exposure, the vitamin D2 content of the mushrooms increased in a linear manner, with concentrations increasing from 0.1 μg/g up to 3.9 ± 0.8 μg/g dry weight (DW). At the subsequent two measurements one and 3 h later, respectively, a plateau was reached. Two hours of additional exposure triggered...... a significant decline in vitamin D2 content. After just 15 min of sun exposure and an UV-B dose of 0.13 J/cm(2), the vitamin D2 content increased significantly to 2.2 ± 0.5 μg/g DW (P vitamin D2 per 100 g of fresh mushrooms and comparable to levels found...

  3. Surface exposure to sunlight stimulates CO2 release from permafrost soil carbon in the Arctic.

    Science.gov (United States)

    Cory, Rose M; Crump, Byron C; Dobkowski, Jason A; Kling, George W

    2013-02-26

    Recent climate change has increased arctic soil temperatures and thawed large areas of permafrost, allowing for microbial respiration of previously frozen C. Furthermore, soil destabilization from melting ice has caused an increase in thermokarst failures that expose buried C and release dissolved organic C (DOC) to surface waters. Once exposed, the fate of this C is unknown but will depend on its reactivity to sunlight and microbial attack, and the light available at the surface. In this study we manipulated water released from areas of thermokarst activity to show that newly exposed DOC is >40% more susceptible to microbial conversion to CO(2) when exposed to UV light than when kept dark. When integrated over the water column of receiving rivers, this susceptibility translates to the light-stimulated bacterial activity being on average from 11% to 40% of the total areal activity in turbid versus DOC-colored rivers, respectively. The range of DOC lability to microbes seems to depend on prior light exposure, implying that sunlight may act as an amplification factor in the conversion of frozen C stores to C gases in the atmosphere.

  4. Terrestrial photovoltaic power systems with sunlight concentration. Annual progress report, January 1, 1975--December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Backus, C.E.

    1976-01-31

    This annual report is for the second year of a program to investigate the characteristics of the components and the total system using sunlight concentrated onto solar cells. The second year was primarily to experimentally investigate the conclusions of the first year of analytical studies. Cells have been fabricated that are designed for different intensities. Typically the efficiency of a cell will increase from its 11 percent at AM1 peak to efficiency at the designed concentration level and return to its initial efficiency at about 3 times its designed concentration level. The developed cells have been tested under high intensity simulators and in concentrated sunlight and have shown to have the predicted response. The experimental testing of passive cooling limitations for cooling cells with just finned arrangements in the back of the cell has been completed in the controlled environment of a wind tunnel. These experiments have confirmed the heat transfer coefficients that had been used in the analytical studies. Testing was done to collect heat transfer coefficients for actual wind conditions and these data show good agreement with the controlled wind tunnel data. Four photovoltaic/concentrator system experiments have been started with CR of about 3, 10, 25, and 100. System analysis has indicated that photovoltaic concentration systems may be attractive in low solar irradiation areas such as Cleveland.

  5. A full-sunlight-driven photocatalyst with super long-persistent energy storage ability.

    Science.gov (United States)

    Li, Jie; Liu, Yuan; Zhu, Zhijian; Zhang, Guozhu; Zou, Tao; Zou, Zhijun; Zhang, Shunping; Zeng, Dawen; Xie, Changsheng

    2013-01-01

    A major drawback of traditional photocatalysts like TiO2 is that they can only work under illumination, and the light has to be UV. As a solution for this limitation, visible-light-driven energy storage photocatalysts have been developed in recent years. However, energy storage photocatalysts that are full-sunlight-driven (UV-visible-NIR) and possess long-lasting energy storage ability are lacking. Here we report, a Pt-loaded and hydrogen-treated WO3 that exhibits a strong absorption at full-sunlight spectrum (300-1,000 nm), and with a super-long energy storage time of more than 300 h to have formaldehyde degraded in dark. In this new material system, the hydrogen treated WO3 functions as the light harvesting material and energy storage material simultaneously, while Pt mainly acts as the cocatalyst to have the energy storage effect displayed. The extraordinary full-spectrum absorption effect and long persistent energy storage ability make the material a potential solar-energy storage and an effective photocatalyst in practice.

  6. Years of sunlight exposure and cataract: a case-control study in a Mediterranean population

    Directory of Open Access Journals (Sweden)

    de Stavola Bianca L

    2007-11-01

    Full Text Available Abstract Background We aimed to investigate the relation between sunlight exposure and risk of cataract. Methods We carried out a frequency-matched case-control study of 343 cases and 334 controls attending an ophthalmology outpatient clinic at a primary health-care center in a small town near Valencia, Spain. All cases were diagnosed as having a cataract in at least one eye based on the Lens Opacification Classification system (LOCS II. Controls had no opacities in either eye. All cases and controls were interviewed for information on outdoor exposure, "usual" diet, history of severe episodes of diarrhea illness, life-style factors and medical and socio-demographic variables. Blood antioxidant vitamin levels were also analyzed. We used logistic regression models to estimate sex and age-adjusted odds ratios (ORs by quintiles of years of occupational outdoor exposure, adjusting for potential confounders such as smoking, alcohol consumption, serum antioxidants and education. Results No association was found between years of outdoor exposure and risk of cataract. However, exploratory analyses suggested a positive association between years of outdoor exposure at younger ages and risk of nuclear cataract later in life. Conclusion Our study does not support an association with cataract and sunlight exposure over adult life.

  7. Dose-Response Effect of Sunlight on Vitamin D2 Production in Agaricus bisporus Mushrooms.

    Science.gov (United States)

    Urbain, Paul; Jakobsen, Jette

    2015-09-23

    The dose response effect of UV-B irradiation from sunlight on vitamin D2 content of sliced Agaricus bisporus (white button mushroom) during the process of sun-drying was investigated.Real-time UV-B and UV-A data were obtained using a high-performance spectroradiometer. During the first hour of sunlight exposure, the vitamin D2 content of the mushrooms increased in a linear manner, with concentrations increasing from 0.1 μg/g up to 3.9 ± 0.8 μg/g dry weight (DW). At the subsequent two measurements one and 3 h later, respectively, a plateau was reached. Two hours of additional exposure triggered a significant decline in vitamin D2 content. After just 15 min of sun exposure and an UV-B dose of 0.13 J/cm(2), the vitamin D2 content increased significantly to 2.2 ± 0.5 μg/g DW (P < 0.0001), which is equivalent to 17.6 μg (704 IU) vitamin D2 per 100 g of fresh mushrooms and comparable to levels found in fatty fish like the Atlantic salmon.

  8. Chloroplast avoidance movement is not functional in plants grown under strong sunlight.

    Science.gov (United States)

    Higa, Takeshi; Wada, Masamitsu

    2016-04-01

    Chloroplast movement in nine climbing plant species was investigated. It is thought that chloroplasts generally escape from strong light to avoid photodamage but accumulate towards weak light to perform photosynthesis effectively. Unexpectedly, however, the leaves of climbing plants grown under strong sunlight showed very low or no chloroplast photorelocation responses to either weak or strong blue light when detected by red light transmittance through leaves. Direct observations of Cayratia japonica leaves, for example, revealed that the average number of chloroplasts in upper periclinal walls of palisade tissue cells was only 1.2 after weak blue-light irradiation and almost all of the chloroplasts remained at the anticlinal wall, the state of chloroplast avoidance response. The leaves grown under strong light have thin and columnar palisade tissue cells comparing with the leaves grown under low light. Depending on our analyses and our schematic model, the thinner cells in a unit leaf area have a wider total plasma membrane area, such that more chloroplasts can exist on the plasma membrane in the thinner cells than in the thicker cells in a unit leaf-area basis. The same strategy might be used in other plant leaves grown under direct sunlight.

  9. Improving the sunlight-to-biomass conversion efficiency in microalgal biofactories.

    Science.gov (United States)

    Wobbe, Lutz; Remacle, Claire

    2015-05-10

    Microalgae represent promising organisms for the sustainable production of commodities, chemicals or fuels. Future use of such systems, however, requires increased productivity of microalgal mass cultures in order to reach an economic viability for microalgae-based production schemes. The efficiency of sunlight-to-biomass conversion that can be observed in bulk cultures is generally far lower (35-80%) than the theoretical maximum, because energy losses occur at multiple steps during the light-driven conversion of carbon dioxide to organic carbon. The light-harvesting system is a major source of energy losses and thus a prime target for strain engineering. Truncation of the light-harvesting antenna in the algal model organism Chlamydomonas reinhardtii was shown to be an effective way of increasing culture productivity at least under saturating light conditions. Furthermore engineering of the Calvin-Benson cycle or the creation of photorespiratory bypasses in A. thaliana proved to be successful in terms of achieving higher biomass productivities. An efficient generation of novel microalgal strains with improved sunlight conversion efficiencies by targeted engineering in the future will require an expanded molecular toolkit. In the meantime random mutagenesis coupled to high-throughput screening for desired phenotypes can be used to provide engineered microalgae. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Control of aerosol contaminants in indoor air: combining the particle concentration reduction with microbial inactivation.

    Science.gov (United States)

    Grinshpun, Sergey A; Adhikari, Atin; Honda, Takeshi; Kim, Ki Youn; Toivola, Mika; Rao, K S Ramchander; Reponen, Tiina

    2007-01-15

    An indoor air purification technique, which combines unipolar ion emission and photocatalytic oxidation (promoted by a specially designed RCI cell), was investigated in two test chambers, 2.75 m3 and 24.3 m3, using nonbiological and biological challenge aerosols. The reduction in particle concentration was measured size selectively in real-time, and the Air Cleaning Factor and the Clean Air Delivery Rate (CADR) were determined. While testing with virions and bacteria, bioaerosol samples were collected and analyzed, and the microorganism survival rate was determined as a function of exposure time. We observed that the aerosol concentration decreased approximately 10 to approximately 100 times more rapidly when the purifier operated as compared to the natural decay. The data suggest that the tested portable unit operating in approximately 25 m3 non-ventilated room is capable to provide CADR-values more than twice as great than the conventional closed-loop HVAC system with a rating 8 filter. The particle removal occurred due to unipolar ion emission, while the inactivation of viable airborne microorganisms was associated with photocatalytic oxidation. Approximately 90% of initially viable MS2 viruses were inactivated resulting from 10 to 60 min exposure to the photocatalytic oxidation. Approximately 75% of viable B. subtilis spores were inactivated in 10 min, and about 90% or greater after 30 min. The biological and chemical mechanisms that led to the inactivation of stress-resistant airborne viruses and bacterial spores were reviewed.

  11. Enhanced photocatalytic inactivation of bacteria on Fe-containing TiO2 nanoparticles under fluorescent light.

    Science.gov (United States)

    Yadav, Hemraj M; Kolekar, Tanaji V; Pawar, Shivaji H; Kim, Jung-Sik

    2016-03-01

    In this paper, the photocatalytic activity of Fe-TiO2 nanoparticles (NPs) under fluorescent light was studied using Escherichia coli and Staphylococcus aureus. Fe-TiO2 NPs were synthesized using a sol-gel method and characterized with X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), UV-visible diffuse reflectance spectroscopy (UV-vis DRS) and transmission electron microscopy. The efficiency of photocatalytic inactivation towards E. coli was studied under different physicochemical parameters. The photocatalytic inactivation rate increased with increasing Fe content in TiO2 NPs and the highest inactivation was achieved for 3.0 mol% Fe-TiO2 NPs under fluorescent light. These results demonstrate that the presence of an optimum concentration of Fe in TiO2 matrix enhances the photocatalytic inactivation of TiO2 NPs under fluorescent light.

  12. Recommended summer sunlight exposure amounts fail to produce sufficient vitamin D status in UK adults of South Asian origin.

    Science.gov (United States)

    Farrar, Mark D; Kift, Richard; Felton, Sarah J; Berry, Jacqueline L; Durkin, Marie T; Allan, Donald; Vail, Andy; Webb, Ann R; Rhodes, Lesley E

    2011-11-01

    The cutaneous synthesis of vitamin D is dependent on UVB from sunlight, but melanin reduces the penetration of UVB and thus contributes to vitamin D insufficiency in individuals with darker skin. The national guidance provided on amounts of sunlight exposure in the United Kingdom is for the light-skinned population, and in the absence of dedicated information, darker-skinned people may attempt to follow this guidance. We determined the relative effect of a simulation of UK recommendations of summer sunlight exposure on the vitamin D status of individuals of South Asian ethnicity compared with that of whites. In a prospective cohort study, simulated summer sunlight exposures were provided under rigorous dosimetric conditions to 15 adults (aged 20-60 y) of South Asian ethnicity, and serum 25-hydroxyvitamin D [25(OH)D] was measured weekly. Dietary vitamin D intake was estimated. Outcomes were compared with those of 109 whites (aged 20-60 y) treated with the identical UV-radiation exposure protocol. At baseline (winter trough), all South Asians were vitamin D-insufficient [25(OH)D concentrations Sunlight-exposure recommendations are inappropriate for individuals of South Asian ethnicity who live at the UK latitude. More guidance is required to meet the vitamin D requirements of this sector of the population. This study was registered at www.isrctn.org as ISRCTN 07565297.

  13. Female meiotic sex chromosome inactivation in chicken.

    Science.gov (United States)

    Schoenmakers, Sam; Wassenaar, Evelyne; Hoogerbrugge, Jos W; Laven, Joop S E; Grootegoed, J Anton; Baarends, Willy M

    2009-05-01

    During meiotic prophase in male mammals, the heterologous X and Y chromosomes remain largely unsynapsed, and meiotic sex chromosome inactivation (MSCI) leads to formation of the transcriptionally silenced XY body. In birds, the heterogametic sex is female, carrying Z and W chromosomes (ZW), whereas males have the homogametic ZZ constitution. During chicken oogenesis, the heterologous ZW pair reaches a state of complete heterologous synapsis, and this might enable maintenance of transcription of Z- and W chromosomal genes during meiotic prophase. Herein, we show that the ZW pair is transiently silenced, from early pachytene to early diplotene using immunocytochemistry and gene expression analyses. We propose that ZW inactivation is most likely achieved via spreading of heterochromatin from the W on the Z chromosome. Also, persistent meiotic DNA double-strand breaks (DSBs) may contribute to silencing of Z. Surprisingly, gammaH2AX, a marker of DSBs, and also the earliest histone modification that is associated with XY body formation in mammalian and marsupial spermatocytes, does not cover the ZW during the synapsed stage. However, when the ZW pair starts to desynapse, a second wave of gammaH2AX accumulates on the unsynapsed regions of Z, which also show a reappearance of the DSB repair protein RAD51. This indicates that repair of meiotic DSBs on the heterologous part of Z is postponed until late pachytene/diplotene, possibly to avoid recombination with regions on the heterologously synapsed W chromosome. Two days after entering diplotene, the Z looses gammaH2AX and shows reactivation. This is the first report of meiotic sex chromosome inactivation in a species with female heterogamety, providing evidence that this mechanism is not specific to spermatogenesis. It also indicates the presence of an evolutionary force that drives meiotic sex chromosome inactivation independent of the final achievement of synapsis.

  14. Inactivating CUX1 mutations promote tumorigenesis

    OpenAIRE

    2013-01-01

    A major challenge for cancer genetics is to determine which low frequency somatic mutations are drivers of tumorigenesis. Here we interrogate the genomes of 7,651 diverse human cancers to identify novel drivers and find inactivating mutations in the homeodomain transcription factor CUX1 (cut-like homeobox 1) in ~1-5% of tumors. Meta-analysis of CUX1 mutational status in 2,519 cases of myeloid malignancies reveals disruptive mutations associated with poor survival, highlighting the clinical si...

  15. Female meiotic sex chromosome inactivation in chicken.

    Directory of Open Access Journals (Sweden)

    Sam Schoenmakers

    2009-05-01

    Full Text Available During meiotic prophase in male mammals, the heterologous X and Y chromosomes remain largely unsynapsed, and meiotic sex chromosome inactivation (MSCI leads to formation of the transcriptionally silenced XY body. In birds, the heterogametic sex is female, carrying Z and W chromosomes (ZW, whereas males have the homogametic ZZ constitution. During chicken oogenesis, the heterologous ZW pair reaches a state of complete heterologous synapsis, and this might enable maintenance of transcription of Z- and W chromosomal genes during meiotic prophase. Herein, we show that the ZW pair is transiently silenced, from early pachytene to early diplotene using immunocytochemistry and gene expression analyses. We propose that ZW inactivation is most likely achieved via spreading of heterochromatin from the W on the Z chromosome. Also, persistent meiotic DNA double-strand breaks (DSBs may contribute to silencing of Z. Surprisingly, gammaH2AX, a marker of DSBs, and also the earliest histone modification that is associated with XY body formation in mammalian and marsupial spermatocytes, does not cover the ZW during the synapsed stage. However, when the ZW pair starts to desynapse, a second wave of gammaH2AX accumulates on the unsynapsed regions of Z, which also show a reappearance of the DSB repair protein RAD51. This indicates that repair of meiotic DSBs on the heterologous part of Z is postponed until late pachytene/diplotene, possibly to avoid recombination with regions on the heterologously synapsed W chromosome. Two days after entering diplotene, the Z looses gammaH2AX and shows reactivation. This is the first report of meiotic sex chromosome inactivation in a species with female heterogamety, providing evidence that this mechanism is not specific to spermatogenesis. It also indicates the presence of an evolutionary force that drives meiotic sex chromosome inactivation independent of the final achievement of synapsis.

  16. Nanostructured CdS sensitized CdWO4 nanorods for hydrogen generation from hydrogen sulfide and dye degradation under sunlight.

    Science.gov (United States)

    Sethi, Yogesh A; Panmand, Rajendra P; Kadam, Sunil R; Kulkarni, Aniruddha K; Apte, Sanjay K; Naik, Sonali D; Munirathnam, N; Kulkarni, Milind V; Kale, Bharat B

    2017-02-01

    In this report, CdS nanoparticles have been grown on the surface of CdWO4 nanorods via an in-situ approach and their high photocatalytic ability toward dye degradation and H2 evolution from H2S splitting under visible light has been demonstrated. The structural and optical properties as well as morphologies with varying amount of CdS to form CdS@CdWO4 have been investigated. Elemental mapping and high resolution transmission electron microscopy (HRTEM) analysis proved the sensitization of CdWO4 nanorods by CdS nanoparticles. A decrease in the PL emission of CdWO4 was observed with increasing amount of CdS nanoparticles loading possibly due to the formation of trap states. Considering the band gap in visible region, the photocatalytic study has been performed for H2 production from H2S and dye degradation under natural sunlight. The steady evolution of H2 was observed from an aqueous H2S solution even without noble metal. Moreover, the rate of photocatalytic H2 evolution over CdS modified CdWO4 is ca. 5.6 times higher than that of sole CdWO4 under visible light. CdS modified CdWO4 showed a good ability toward the photo-degradation of methylene Blue. The rate of dye degradation over CdS modified CdWO4 is ca. 7.4 times higher than that of pristine CdWO4 under natural sunlight. With increase in amount of CdS nanoparticle loading on CdWO4 nanorods the hydrogen generation was observed to be decreased where as dye degradation rate is increased. Such nano-heterostructures may have potential in other photocatalytic reactions. Copyright © 2016. Published by Elsevier Inc.

  17. Rapid inactivation of SARS-like coronaviruses.

    Energy Technology Data Exchange (ETDEWEB)

    Kapil, Sanjay (Kansas State University, Manhattan, KS); Oberst, R. D. (Kansas State University, Manhattan, KS); Bieker, Jill Marie; Tucker, Mark David; Souza, Caroline Ann; Williams, Cecelia Victoria

    2004-03-01

    Chemical disinfection and inactivation of viruses is largely understudied, but is very important especially in the case of highly infectious viruses. The purpose of this LDRD was to determine the efficacy of the Sandia National Laboratories developed decontamination formulations against Bovine Coronavirus (BCV) as a surrogate for the coronavirus that causes Severe Acute Respiratory Syndrome (SARS) in humans. The outbreak of SARS in late 2002 resulted from a highly infectious virus that was able to survive and remain infectious for extended periods. For this study, preliminary testing with Escherichia coli MS-2 (MS-2) and Escherichia coli T4 (T4) bacteriophages was conducted to develop virucidal methodology for verifying the inactivation after treatment with the test formulations following AOAC germicidal methodologies. After the determination of various experimental parameters (i.e. exposure, concentration) of the formulations, final testing was conducted on BCV. All experiments were conducted with various organic challenges (horse serum, bovine feces, compost) for results that more accurately represent field use condition. The MS-2 and T4 were slightly more resistant than BCV and required a 2 minute exposure while BCV was completely inactivated after a 1 minute exposure. These results were also consistent for the testing conducted in the presence of the various organic challenges indicating that the test formulations are highly effective for real world application.

  18. Developmental regulation of X-chromosome inactivation.

    Science.gov (United States)

    Payer, Bernhard

    2016-08-01

    With the emergence of sex-determination by sex chromosomes, which differ in composition and number between males and females, appeared the need to equalize X-chromosomal gene dosage between the sexes. Mammals have devised the strategy of X-chromosome inactivation (XCI), in which one of the two X-chromosomes is rendered transcriptionally silent in females. In the mouse, the best-studied model organism with respect to XCI, this inactivation process occurs in different forms, imprinted and random, interspersed by periods of X-chromosome reactivation (XCR), which is needed to switch between the different modes of XCI. In this review, I describe the recent advances with respect to the developmental control of XCI and XCR and in particular their link to differentiation and pluripotency. Furthermore, I review the mechanisms, which influence the timing and choice, with which one of the two X-chromosomes is chosen for inactivation during random XCI. This has an impact on how females are mosaics with regard to which X-chromosome is active in different cells, which has implications on the severity of diseases caused by X-linked mutations.

  19. Quantification of ultraviolet radiation-induced DNA damage in the urine of Swedish adults and children following exposure to sunlight.

    Science.gov (United States)

    Liljendahl, Tove Sandberg; Kotova, Natalia; Segerbäck, Dan

    2012-11-01

    DNA damage following exposure to ultraviolet radiation (UVR) is important in skin cancer development. The predominant photoproduct, cyclobutane thymine dimer (T=T), is repaired and excreted in the urine, where it provides a biomarker of exposure. To quantify urinary T=T levels after recreational sunlight exposure in adults and children. Average UVR doses were measured with personal dosimeters. Urinary T=T was analysed with (32)P-postlabelling. Background levels of T=T increased significantly following exposure to sunlight. Amounts of T=T in urine of children and adults were not significantly different after adjusting for area of skin exposed and physiological differences. UVR dose and amounts of T=T correlated for both adults and children. Recreational exposure to sunlight in Sweden induces levels of DNA damage, clearly detectable in urine.

  20. Photocatalytic Synthesis of Phenol by Direct Hydroxylation of Benzene by a Modified Nanoporous Silica (LUS-1) under Sunlight

    Institute of Scientific and Technical Information of China (English)

    Ghasem SHIRAVAND; Alireza BADIEI; Ghodsi Mohammadi ZIARANI; Morteza JAFARABADI; Majid HAMZEHLOO

    2012-01-01

    Fe-g-C3N4-LUS-1was prepared by the thermal decomposition of dicyandiamide inside the pores of LUS-1under an inert atmosphere.It was used as a photocatalyst for the hydroxylation of benzene to phenol in sunlight.The catalysts were characterized by Fourier transform infrared spectroscopy,N2 adsorption-desorption,X-ray diffraction,and scanning electron microscopy.In Fe-g-C3N4-LUS-1,a single layer of graphitic carbon nitride (g-C3N4) was formed on the surface of LUS-1.The photocatalytic activity of the iron containing g-C3N4based catalysts was investigated,and the catalytic activity was remarkably enhanced when the reaction condition was changed from dark to sunlight.The best result was obtained with 20%Fe-g-C3N4-LUS-1 in sunlight.

  1. Azo dyes degradation using TiO2-Pt/graphene oxide and TiO2-Pt/reduced graphene oxide photocatalysts under UV and natural sunlight irradiation

    Science.gov (United States)

    Rosu, Marcela-Corina; Coros, Maria; Pogacean, Florina; Magerusan, Lidia; Socaci, Crina; Turza, Alexandru; Pruneanu, Stela

    2017-08-01

    The photocatalytic degradation of azo dyes with different structures (amaranth, sunset yellow and tartrazine) using TiO2-Pt nanoparticles (TPt), TiO2-Pt/graphene oxide (TPt-GO) and TiO2-Pt/reduced graphene oxide (TPt-rGO) composites were investigated in the presence of UV and natural sunlight irradiation. The composites were prepared by a combined chemical-thermal method and characterized by Transmission Electron Microscopy (TEM), X-ray powder diffraction (XRD), Infrared (FTIR) and UV-Vis spectroscopy. The modification of TiO2-Pt with graphene oxide shifted its optical absorption edge towards the visible region and increased its photocatalytic activity under UV and natural sunlight irradiation. The efficiency of catalysts on azo dyes degradation (in similar conditions) reached high values (above 99%) under sunlight conditions, proving the remarkable photocatalytic activities of obtained composites. TPt-GO nanocomposite exhibited higher photoactivity than TPt or TPt-rGO, demonstrating degradation efficiencies of 99.56% for amaranth, 99.15% for sunset yellow and 96.23% for tartrazine. The dye photodegradation process follows a pseudo-first-order kinetic with respect to the Langmuir-Hinshelwood reaction mechanism. A direct dependence between azo dyes degradation rate and chemical structure of dyes has been observed.

  2. High hydrostatic pressure treatment for the inactivation of Staphylococcus aureus in human blood plasma.

    Science.gov (United States)

    Rivalain, Nolwennig; Roquain, Jean; Boiron, Jean-Michel; Maurel, Jean-Paul; Largeteau, Alain; Ivanovic, Zoran; Demazeau, Gérard

    2012-02-15

    For the past 30years, pressure inactivation of microorganisms has been developed in biosciences, in particular for foods and more recently for biological products, including pharmaceutical ones. In many past studies, the effect of high hydrostatic pressure (HHP) processes on pathogens focused mainly on the effect of an increase of the pressure value. To assure the safety of pharmaceutical products containing fragile therapeutic components, development of new decontamination processes at the lowest pressure value is needed to maintain their therapeutic properties. The aim of this study was therefore to evaluate the impact of the process parameters characterizing high-pressure treatments [such as the pressurization rate (PR) and the application mode (AM)] on the inactivation of pathogens, in particular to determine how these parameters values could help decrease the pressure value necessary to reach the same inactivation level. The effect of these physical parameters was evaluated on the inactivation of Staphylococcus aureus ATCC 6538 which is an opportunistic pathogen of important relevance in the medical, pharmaceutical and food domains. Human blood plasma was chosen as the suspension medium because of its physiological importance in the transfusion field. It was shown that the optimization of all the selected parameters could lead to a high inactivation level (≈5log(10) decrease of the initial bacterial load) at a pressure level as low as 200MPa, underlining some synergistic effects among these parameters. Complete inactivation of the initial bacterial population was achieved for the following conditions: PR=50MPas(-1), AM=5×2min, T≈-5°C and P=300MPa.

  3. Inactivation of Pseudomonas putida by pulsed electric field treatment: a study on the correlation of treatment parameters and inactivation efficiency in the short-pulse range.

    Science.gov (United States)

    Frey, Wolfgang; Gusbeth, Christian; Schwartz, Thomas

    2013-10-01

    An important issue for an economic application of the pulsed electric field treatment for bacterial decontamination of wastewater is the specific treatment energy needed for effective reduction of bacterial populations. The present experimental study performed in a field amplitude range of 40 > E > 200 kV/cm and for a suspension conductivity of 0.01 = κ(e) > 0.2 S/m focusses on the application of short pulses, 25 ns > T > 10 μs, of rectangular, bipolar and exponential shape and was made on Pseudomonas putida, which is a typical and widespread wastewater microorganism. The comparison of inactivation results with calculations of the temporal and azimuthal membrane charging dynamics using the model of Pauly and Schwan revealed that for efficient inactivation, membrane segments at the cell equator have to be charged quickly and to a sufficiently high value, on the order of 0.5 V. After fulfilling this basic condition by an appropriate choice of pulse field strength and duration, the log rate of inactivation for a given suspension conductivity of 0.2 S/m was found to be independent of the duration of individual pulses for constant treatment energy expenditure. Moreover, experimental results suggest that even pulse shape plays a minor role in inactivation efficiency. The variation of the suspension conductivity resulted in comparable inactivation performance of identical pulse parameters if the product of pulse duration and number of pulses was the same, i.e., required treatment energy can be linearly downscaled for lower conductivities, provided that pulse amplitude and duration are selected for entire membrane surface permeabilization.

  4. One dimensional CdS nanowire@TiO2 nanoparticles core-shell as high performance photocatalyst for fast degradation of dye pollutants under visible and sunlight irradiation.

    Science.gov (United States)

    Arabzadeh, Abbas; Salimi, Abdollah

    2016-10-01

    In this study, one-dimensional CdS nanowires@TiO2 nanoparticles core-shell structures (1D CdS NWs@TiO2 NPs) were synthesized by a facile wet chemical-solvothermal method. The different aspects of the properties of CdS NWs@TiO2 NPs were surveyed by using a comprehensive range of characterization techniques including X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), UV-vis spectroscopy, scanning electron microscopy (SEM), fluorescence spectroscopy, energy dispersive X-ray spectroscopy (EDX), Cyclic Voltammetry (CV) and amperometry. The as-prepared nanostructure was applied as an effective photocatalyst for degradation of methyl orange (MO), methylene blue (MB) and rhodamine B (Rh B) under visible and sunlight irradiation. The results indicated significantly enhanced photocatalytic activity of CdS NWs@TiO2 NPs for degradation of MO, MB and Rh B compared to CdS NWs. The enhanced photocatalytic activity could be attributed to the enhanced sunlight absorbance and the efficient charge separation of the formed heterostructure between CdS NWs and TiO2. The results showed that MO, Rh B and MB were almost completely degraded after 2, 2 and 3min of exposure to sunlight, respectively; while under visible light irradiation (3W blue LED lamp) the dyes were decomposed with less half degradation rate. The catalytic activity was retained even after three degradation cycles of organic dyes, demonstrating that the proposed nanocomposite can be effectively used as efficient photocatalyst for removal of environmental pollutions caused by organic dyes under sunlight irradiation and it could be an important addition to the field of wastewater treatment. We hope the present study may open a new window of such 1-D semiconductor nanocomposites to be used as visible light photocatalysts in the promising field of organic dyes degradation.

  5. Selective inactivation of rat liver cytochromes P-450 by 21-chlorinated steroids.

    Science.gov (United States)

    Halpert, J; Jaw, J Y; Cornfield, L J; Balfour, C; Mash, E A

    1989-01-01

    The inactivation by 21-chlorinated steroids of rat liver cytochromes P-450 involved in the hydroxylation of progesterone and androstenedione has been investigated. Preincubation of intact liver microsomes from phenobarbital-treated rats with 21-chloropregnenolone, 21,21-dichloropregnenolone, or 21,21-dichloroprogesterone in the presence of NADPH caused a time-dependent decrease in progesterone 21-hydroxylase and in progesterone or androstenedione 6 beta-hydroxylase activity but had negligible or only minor effects on five other steroid hydroxylases. The compounds differed, however, with regard to the relative rate constants for inactivation of the 21- and 6 beta-hydroxylases. For example, 21,21-dichloroprogesterone and 21,21-dichloropregnenolone inactivated the progesterone 6 beta-hydroxylase at similar rates, but the dichloroprogesterone was a more effective inactivator of the 21-hydroxylase. The results indicate that the introduction of a dichloromethyl group into a substrate bearing a methyl group normally hydroxylated by only one or a few isozymes of cytochrome P-450 may be a rational means of designing isozyme-selective inhibitors but that target and nontarget enzymes may not totally retain the regioselectivity they exhibit towards the underivatized substrate.

  6. Enhanced Photocatalytic Performance of the Graphene-V2O5 Nanocomposite in the Degradation of Methylene Blue Dye under Direct Sunlight.

    Science.gov (United States)

    Shanmugam, Mahalingam; Alsalme, Ali; Alghamdi, Abdulaziz; Jayavel, Ramasamy

    2015-07-15

    A simple and efficient solution mixing method has been developed for the synthesis of the G-V2O5 nanocomposite. By this method, one-dimensional V2O5 rods are decorated onto the two-dimensional graphene sheets. The synthesized nanocomposites are characterized by XRD, SEM with elemental mapping, TEM, FT-IR, Raman, BET, and XPS analyses. The photocatalytic activity of the G-V2O5 nanocomposite studied with methylene blue dye shows strong degradation efficiency with direct sunlight irradiation compared to UV and visible light sources. The mechanism of methylene blue dye degradation by the G-V2O5 nanocomposite has been elucidated through the kinetics of the degradation process by calculating the rate constant and half-life time of the degradation process.

  7. Preparation of K-doped TiO2 nanostructures by wet corrosion and their sunlight-driven photocatalytic performance

    Science.gov (United States)

    Shin, Eunhye; Jin, Saera; Kim, Jiyoon; Chang, Sung-Jin; Jun, Byung-Hyuk; Park, Kwang-Won; Hong, Jongin

    2016-08-01

    K-doped TiO2 nanowire networks were prepared by the corrosion reaction of Ti nanoparticles in an alkaline (potassium hydroxide: KOH) solution. The prepared nanostructures were characterized by scanning electron microscopy (SEM), Brunauer-Emmett-Teller (BET) analysis, X-ray photoelectron spectroscopy (XPS), Raman spectroscopy, X-ray diffraction (XRD) and photoluminescence (PL) spectra. Their sunlight-driven photocatalytic activity was also investigated with differently charged dye molecules, such as methylene blue, rhodamine B and methyl orange. The adsorption of the dye molecules on the photocatalyst surface would play a critical role in their selective photodegradation under sunlight illumination.

  8. Bacterial inactivation by solar ultraviolet radiation compared with sensitivity to 254 nm radiation.

    Science.gov (United States)

    Coohill, Thomas P; Sagripanti, Jose-Luis

    2009-01-01

    Our goal was to derive a quantitative factor that would allow us to predict the solar sensitivity of vegetative bacterial cells to natural solar radiation from the wealth of data collected for cells exposed to UVC (254 nm) radiation. We constructed a solar effectiveness spectrum for inactivation of vegetative bacterial cells by combining the available action spectra for vegetative cell killing in the solar range with the natural sunlight spectrum that reaches the ground. We then analyzed previous studies reporting the effects of solar radiation on vegetative bacterial cells and on bacterial spores. Although UVC-sensitive cells were also more sensitive to solar radiation, we found no absolute numerical correlation between the relative solar sensitivity of vegetative cells and their sensitivity to 254 nm radiation. The sensitivity of bacterial spores to solar exposure during both summer and winter correlated closely to their UVC sensitivity. The estimates presented here should make it possible to reasonably predict the time it would take for natural solar UV to kill bacterial spores or with a lesser degree of accuracy, vegetative bacterial cells after dispersion from an infected host or after an accidental or intentional release.

  9. Iron (III) aquacomplexes as catalysts for pesticides mineralisation by sunlight irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Catastini, C.; Mailhot, G.; Malato, S.; Sarakha, M.

    2002-07-01

    The experimental results of the photo catalytic degradation of the pesticide asulam (4-amino-benzosulfonyl-methylcarbamate) in aqueous solutions using iron (III) aquacomplexes as photo inducer and sunlight as irradiation source are reported. The experiments were conducted in a compound parabolic collector reactor (CPC) of Plataforma solar de Almeria. In the early stages of the irradiation, the degradation is clearly due to the photo redox process involving the most photoactive species of iron (III) (Fe(OH)''2+). The degradation was also shown to proceed when iron (II) was used as a photo inducer in aerated aqueous solutions. In both cases, the complete degradation of the substrate to CO{sub 2} in aerated aqueous solutions needed exposition to solar light of about 13-14 hours. A catalytic process involving iron (III), iron (II), oxygen and light is proposed. (Author) 24 refs.

  10. Design and fabrication of light-guiding plate for a photobioreactor that utilizes sunlight

    Science.gov (United States)

    Lim, Hyon-Chol; Kim, Hun; Jang, Kyungmin; Kim, Jae-Young; Baek, Joon-Hyuck; Yang, Seung-Jin; Jeong, Sang-Hwa; Park, Jong-Rak

    2015-10-01

    We present the results of the optical design and fabrication of a light-guiding plate (LGP) that utilizes sunlight to be adopted as an illumination system for photobioreactors. A solar daylighting system was employed as the light source for the LGP. We modeled the light sources (optical fiber exit ports of the solar daylighting system), a reflection film, and LGP patterns. An LGP (1000 mm × 500 mm × 10 mm) was designed and fabricated using a computerized numerical control machine. It was optimized for the average deviation of the illuminance distribution by varying the maximum pattern spacing, minimum pattern spacing, and spacing constant of the pattern spacing function expressed in the form of an exponential function. Average illuminance and uniformity of the illuminance distribution of the fabricated LGP were measured to be 8174 lx (photon flux density: 122.0 μΕ m-2 s-1) and 90.0 %, respectively.

  11. Graphene-SnO2 composites for highly efficient photocatalytic degradation of methylene blue under sunlight.

    Science.gov (United States)

    Seema, Humaira; Christian Kemp, K; Chandra, Vimlesh; Kim, Kwang S

    2012-09-07

    Graphene sheets decorated with SnO(2) nanoparticles (RGO-SnO(2)) were prepared via a redox reaction between graphene oxide (GO) and SnCl(2). Graphene oxide (GO) was reduced to graphene (RGO) and Sn(2+) was oxidized to SnO(2) during the redox reaction, leading to a homogeneous distribution of SnO(2) nanoparticles on RGO sheets. The scanning electron microscopy (SEM) and transmission electron microscopy (TEM) images show uniform distribution of the nanoparticles on the RGO surface and high-resolution transmission electron microscopy (HRTEM) shows an average particle size of 3-5 nm. The RGO-SnO(2) composite showed an enhanced photocatalytic degradation activity for the organic dye methylene blue under sunlight compared to bare SnO(2) nanoparticles. This result leads us to believe that the RGO-SnO(2) composite could be used in catalytic photodegradation of other organic dyes.

  12. Natural sunlight irradiated flower-like CuS synthesized from DMF solvothermal treatment

    Science.gov (United States)

    Zhao, Wei; Wang, Zihao; Zhou, Lei; Liu, Nianqi; Wang, Hongxing

    2016-09-01

    Three-dimensional CuS hierarchical crystals with high catalytic activity had been successfully fabricated using a facile solvothermal process. The CuS microparticles showed different flower-like morphology and good dispersion by optimizing reaction conditions. It was found that using N,N-dimethylformamide (DMF) as the solvent reagent in the proper temperature conditions was favorable for the growth of hierarchically structured CuS. The hexagonal flower-like CuS synthesized at 170°C for 60 min displayed broad-spectrum photocatalytic properties under ultraviolet (UV) and visible irradiation. The as-prepared CuS crystals exhibited good performance to decolorize methylene blue (MB) solution under visible light irradiation. The total organic carbon (TOC) removal of rhodamine B (RhB) solution was nearly 60% after 5 h of the natural sunlight irradiation, and the property was stable after testing over four recycles, demonstrating a potential application in waster water treatment.

  13. Assessment of oxidative deterioration of soybean oil at ambient and sunlight storage

    Directory of Open Access Journals (Sweden)

    Ijaz Hussain, Abdullah

    2007-12-01

    Full Text Available This study was carried out in order to probe the extent of oxidative alterations in soybean oil (SBO, subjected to ambient and sunlight storage, over a period of 180 days. The magnitude of oxidative changes was monitored by the periodical measurement of peroxide value (PV, color, free fatty acid (FFA contents, refractive index (RI, p-anisidine-, conjugated dienes-, conjugated trienes-, and iodine- values. At the end of storage period (180 days, the initial contents of FFA (0.02 % as oleic acid and PV (0.02 meq/kg of oil of the SBO samples subjected to ambient and sunlight storage reached the level of 1.77, 2.90 % and 20.52, 41.89 meq/kg of oil, respectively. The initial values of RI (40°C (1.4630, panisidine (1.10, conjugated dienes (0.08 and conjugated trienes (0.04 rose to the point of 1.4647, 1.4659; 36.13, 50.40; 23.97, 41.49 and 13.81, 19.35, respectively. Whereas, the iodine value (g of I /100 g of oil decreased from 138.00 to 126.18 and 118.04, respectively. At the end of storage period, the overall order, indicative of the oxidative changes in RI, FFA, IV, color (red + yellow, PV, P-anisidine, conjugated dienes and conjugated trienes of the SBO subjected to ambient and sunlight storage was as follows: 1.001:1.002, 1.00:1.65, 0.91:0.86, 0.80:0.60 + 0.75:0.50, 1.00:2.04, 1.00:1.39, 1.00:1.73 and 1.00:1.40, respectively. The results of various parameters investigated in the present study demonstrated the magnitude of oxidative deterioration of the SBO samples exposed to sunlight to be significantly (P Se lleva a cabo un estudio para conocer las diferencias en la oxidación del aceite de soja conservado a temperatura ambiente y a la luz solar durante un periodo de 180 días. Los cambios en la oxidación fueron evaluados mediante medidas periódicas del índice de peroxidos, color, acidez libre, índice de refracción (RI, índice de p-anisidina, dienos conjugados e índice de yodo. Al final del periodo de almacenamiento, los niveles de

  14. Sunlight effects on the 3D polar current system determined from low Earth orbit measurements

    CERN Document Server

    Laundal, Karl M; Olsen, Nils

    2016-01-01

    Interaction between the solar wind and the Earth's magnetosphere is associated with large-scale currents in the ionosphere at polar latitudes that flow along magnetic field lines (Birkeland currents) and horizontally. These current systems are tightly linked, but their global behaviors are rarely analyzed together. In this paper, we present estimates of the average global Birkeland currents and horizontal ionospheric currents from the same set of magnetic field measurements. The magnetic field measurements, from the low Earth orbiting $\\textit{Swarm}$ and CHAMP satellites, are used to co-estimate poloidal and toroidal parts of the magnetic disturbance field, represented in magnetic apex coordinates. The use of apex coordinates reduces effects of longitudinal and hemispheric variations in the Earth's main field. We present global currents from both hemispheres during different sunlight conditions. The results show that the Birkeland currents vary with the conductivity, which depends most strongly on solar EUV ...

  15. Sunlight driven photocatalytic water splitting using nanostructured bismuth tungstate (Bi2WO6)

    Science.gov (United States)

    Radha, R.; Sakar, M.; Bharathkumar, S.; Balakumar, S.

    2017-05-01

    Sunlight driven photocatalytic water splitting properties of nanosized Bi2WO6 have been demonstrated. Upon the structural confirmation using XRD and Raman studies, the band edge offset deduced from UV-DRS spectra showed that the energy band structure of Bi2WO6 is manifested due to electronic transition in the hybridized orbital of Bi6s and O2p to the W5d orbital. The observed Bi2WO6 nanoparticulates-assisted H2 generation from glycerol-water mixture may be attributed to the following two competitive phenomena: (i) the photocatalytic degradation of glycerol and (ii) photocatalytic splitting of water molecules, where glycerol acts as a sacrificial agent. This study sheds lights on the photocatalytic reformation of contaminated aqueous ecosystems as a green resource to produce hydrogen energy.

  16. Retrieval of stratospheric aerosol size information from OSIRIS limb scattered sunlight spectra

    Directory of Open Access Journals (Sweden)

    A. E. Bourassa

    2008-02-01

    Full Text Available Recent work has shown that the retrieval of stratospheric aerosol vertical profiles is possible using limb scattered sunlight measurements at optical wavelengths. The aerosol number density profile is retrieved for an assumed particle size distribution and composition. This result can be used to derive the extinction at the measured wavelength. However, large systematic error can result from the uncertainty in the assumed size distribution when the result is used to estimate the extinction at other wavelengths. It is shown in this work that the addition of information obtained from the near infrared limb radiance profile at 1530 nm measured by the imaging module of the OSIRIS instrument yields an indication of the aerosol size distribution profile that can be used to improve the fidelity of the retrievals. A comparison of the estimated extinction profile at 1020 nm with coincident occultation measurements demonstrates agreement to within approximately 15% from 12 to 27 km altitude.

  17. Sunlight-induced changes in chromophores and fluorophores of wastewater-derived organic matter in receiving waters--the role of salinity.

    Science.gov (United States)

    Yang, Xiaofang; Meng, Fangang; Huang, Guocheng; Sun, Li; Lin, Zheng

    2014-10-01

    Wastewater-derived organic matter (WOM) is an important constituent of discharge to urban rivers and is suspected of altering the naturally occurring dissolved organic matter (DOM) in water systems. This study investigated sunlight-induced changes in chromophores and fluorophores of WOM with different salinities (S = 0, 10, 20 and 30) that were collected from two wastewater treatment plants (WWTP-A and WWTP-B). The results showed that exposure to sunlight for 5.3 × 10(5) J/m(2) caused significant decreases in UV254-absorbing WOM (45-59% loss) compared to gross dissolved organic carbon (<15% loss). An increase in salinity accelerated the overall photo-degradation rates of the UV254-absorbing chromophores from both WOM and natural DOM. In addition, irradiated WOM at a higher salinity had a larger molecular size than that at a lower salinity. However, natural DOM did not display such behavior. Parallel factor analysis of the excitation-emission matrix determined the presence of two humic-like components (C1 and C2) and two protein-like components (C3 and C4). All the components in WOM followed second-order kinetics, except for the C4 component in WWTP-A, which fit zero-order photoreaction kinetics. The photo-degradation of the C1 component in both WWTPs appeared to be independent of salinity; however, the photo-degradation rates of the C2 and C3 components in both WWTPs and C4 in WWTP-B increased significantly with increasing salinity. In comparison, the photo-degradation of the C1 component was significantly facilitated by increased salinity in natural DOM, fitting first-order photoreaction kinetics. As such, the current knowledge concerning the photo-degradation of naturally occurring DOM cannot be extrapolated for the understanding of WOM photo-degradation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Inactivation of urease by catechol: Kinetics and structure.

    Science.gov (United States)

    Mazzei, Luca; Cianci, Michele; Musiani, Francesco; Lente, Gábor; Palombo, Marta; Ciurli, Stefano

    2017-01-01

    Urease is a Ni(II)-containing enzyme that catalyzes the hydrolysis of urea to yield ammonia and carbamate at a rate 10(15) times higher than the uncatalyzed reaction. Urease is a virulence factor of several human pathogens, in addition to decreasing the efficiency of soil organic nitrogen fertilization. Therefore, efficient urease inhibitors are actively sought. In this study, we describe a molecular characterization of the interaction between urease from Sporosarcina pasteurii (SPU) and Canavalia ensiformis (jack bean, JBU) with catechol, a model polyphenol. In particular, catechol irreversibly inactivates both SPU and JBU with a complex radical-based autocatalytic multistep mechanism. The crystal structure of the SPU-catechol complex, determined at 1.50Å resolution, reveals the structural details of the enzyme inhibition.

  19. Analysis of Environmental Effects on Leaf Temperature under Sunlight, High Pressure Sodium and Light Emitting Diodes.

    Directory of Open Access Journals (Sweden)

    Jacob A Nelson

    Full Text Available The use of LED technology is commonly assumed to result in significantly cooler leaf temperatures than high pressure sodium technology. To evaluate the magnitude of this effect, we measured radiation incident to and absorbed by a leaf under four radiation sources: clear sky sunlight in the field, sunlight in a glass greenhouse, and indoor plants under either high pressure sodium or light emitting diodes. We then applied a common mechanistic energy-balance model to compare leaf to air temperature difference among the radiation sources and environments. At equal photosynthetic photon flux, our results indicate that the effect of plant water status and leaf evaporative cooling is much larger than the effect of radiation source. If plants are not water stressed, leaves in all four radiation sources were typically within 2°C of air temperature. Under clear sky conditions, cool sky temperatures mean that leaves in the field are always cooler than greenhouse or indoor plants-when photosynthetic photon flux, stomatal conductance, wind speed, vapor pressure deficit, and leaf size are equivalent. As water stress increases and cooling via transpiration decreases, leaf temperatures can increase well above air temperature. In a near-worst case scenario of water stress and low wind, our model indicates that leaves would increase 6°, 8°, 10°, and 12°C above air temperature under field, LED, greenhouse, and HPS scenarios, respectively. Because LED fixtures emit much of their heat through convection rather than radiative cooling, they result in slightly cooler leaf temperatures than leaves in greenhouses and under HPS fixtures, but the effect of LED technology on leaf temperature is smaller than is often assumed. Quantifying the thermodynamic outputs of these lamps, and their physiological consequences, will allow both researchers and the horticulture industry to make informed decisions when employing these technologies.

  20. The relationship between long-term sunlight radiation and cognitive decline in the REGARDS cohort study

    Science.gov (United States)

    Kent, Shia T.; Kabagambe, Edmond K.; Wadley, Virginia G.; Howard, Virginia J.; Crosson, William L.; Al-Hamdan, Mohammad Z.; Judd, Suzanne E.; Peace, Fredrick; McClure, Leslie A.

    2014-04-01

    Sunlight may be related to cognitive function through vitamin D metabolism or circadian rhythm regulation. The analysis presented here sought to test whether ground and satellite measures of solar radiation are associated with cognitive decline. The study used a 15-year residential history merged with satellite and ground monitor data to determine sunlight (solar radiation) and air temperature exposure for a cohort of 19,896 cognitively intact black and white participants aged 45+ from the 48 contiguous United States. Exposures of 15, 10, 5, 2, and 1-year were used to predict cognitive status at the most recent assessment in logistic regression models; 1-year insolation and maximum temperatures were chosen as exposure measures. Solar radiation interacted with temperature, age, and gender in its relationships with incident cognitive impairment. After adjustment for covariates, the odds ratio (OR) of cognitive decline for solar radiation exposure below the median vs above the median in the 3rd tertile of maximum temperatures was 1.88 (95 % CI: 1.24, 2.85), that in the 2nd tertile was 1.33 (95 % CI: 1.09, 1.62), and that in the 1st tertile was 1.22 (95 % CI: 0.92, 1.60). We also found that participants under 60 years old had an OR = 1.63 (95 % CI: 1.20, 2.22), those 60-80 years old had an OR = 1.18 (95 % CI: 1.02, 1.36), and those over 80 years old had an OR = 1.05 (0.80, 1.37). Lastly, we found that males had an OR = 1.43 (95 % CI: 1.22, 1.69), and females had an OR = 1.02 (0.87, 1.20). We found that lower levels of solar radiation were associated with increased odds of incident cognitive impairment.

  1. The effect of sunlight exposure on interleukin-6 levels in depressive and non-depressive subjects.

    Science.gov (United States)

    Levandovski, Rosa; Pfaffenseller, Bianca; Carissimi, Alicia; Gama, Clarissa S; Hidalgo, Maria Paz Loayza

    2013-03-05

    The objective of this epidemiological study was to evaluate the effect of length of sunlight exposure on interleukin 6 (IL-6) levels in depressive and non-depressive subjects. This was a cross-sectional study with 154 subjects (54 males, mean age: 43.5 ± 12.8 years) who were living in a rural area in south Brazil. Chronobiological and light parameters were assessed using the Munich Chronotype Questionnaire. Sleep quality was evaluated using the Pittsburgh Sleep Quality Index. Depressive symptoms were assessed with the Beck Depression Inventory. Plasma levels of inflammatory cytokines (IL-2, IL-4, IL-6, IL-10, tumor necrosis factor-α, and interferon) were collected during the daytime and measured. IL-6 levels showed a positive correlation with light exposure (r = 0.257; p exposure was an independent factor for predicting IL-6 levels (ß = 0.26; p = 0.002). In non-depressed subjects, exposure to a different intensity of light did not affect IL-6 levels (t = -1.6; p = 0.1). However, when the two depressive groups with low and high light exposure were compared, the low light exposure group had lower levels of IL-6 compared with the high light exposure group (t = -2.19 and p = 0.0037). The amount of time that participants are exposed to sunlight is directly related to their IL-6 levels. Additionally, depressed subjects differ in their IL-6 levels if they are exposed to light for differing amounts of time.

  2. Recovery of hexavalent chromium from water using photoactive TiO2-montmorillonite under sunlight

    Directory of Open Access Journals (Sweden)

    Ridha Djellabi

    2016-04-01

    Full Text Available Hexavalent chromium was removed from water under sunlight using a synthesized TiO2-montmorillonite (TiO2-M employing tartaric acid as a hole scavenger. Cr(VI species was then reduced to Cr(III species by electrons arising from TiO2 particles. After that, the produced Cr(III species  was transferred to montmorillonite  due to electrostatic attractions leading to  set free TiO2 particles for a further Cr(VI species reduction. Furthermore, produced Cr(III, after Cr(VI reduction, does not  penetrate into the solution. The results indicate that no dark adsorption of Cr(VI species on TiO2-M is present, however, the reduction of Cr(VI species under sunlight increased strongly as a function of tartaric acid concentration up to 60 ppm, for which the extent of reduction is maximum within 3 h. On the other hand, the reduction extent of Cr(VI species is maximum with an initial concentration of Cr(VI species lower than 30 ppm by the use of 0.2 g/L of TiO2-M. Nevertheless, the increase of the Cr(VI initial concentration led to increase the amount of Cr(VI species reduced (capacity of reduction until a Cr(VI concentration of 75 and 100 ppm, for which  it remained constant at around 221 mg/g. For comparison, the increase of Cr(VI species concentration in the case of the commercial TiO2 P25 under the same conditions exhibited its deactivation when the reduced amount decreased from 198.1 to 157.6 mg/g as the concentration increased from 75 to 100 ppm.

  3. Sensitivity Studies for Space-based Measurement of Atmospheric Total Column Carbon Dioxide Using Reflected Sunlight

    Science.gov (United States)

    Mao, Jianping; Kawa, S. Randolph

    2003-01-01

    A series of sensitivity studies is carried out to explore the feasibility of space-based global carbon dioxide (CO2) measurements for global and regional carbon cycle studies. The detection method uses absorption of reflected sunlight in the CO2 vibration-rotation band at 1.58 microns. The sensitivities of the detected radiances are calculated using the line-by-line model (LBLRTM), implemented with the DISORT (Discrete Ordinates Radiative Transfer) model to include atmospheric scattering in this band. The results indicate that (a) the small (approx.1%) changes in CO2 near the Earth's surface are detectable in this CO2 band provided adequate sensor signal-to-noise ratio and spectral resolution are achievable; (b) the radiance signal or sensitivity to CO2 change near the surface is not significantly diminished even in the presence of aerosols and/or thin cirrus clouds in the atmosphere; (c) the modification of sunlight path length by scattering of aerosols and cirrus clouds could lead to large systematic errors in the retrieval; therefore, ancillary aerosol/cirrus cloud data are important to reduce retrieval errors; (d) CO2 retrieval requires good knowledge of the atmospheric temperature profile, e.g. approximately 1K RMS error in layer temperature; (e) the atmospheric path length, over which the CO2 absorption occurs, must be known in order to correctly interpret horizontal gradients of CO2 from the total column CO2 measurement; thus an additional sensor for surface pressure measurement needs to be attached for a complete measurement package.

  4. Mg-doped ZnO nanoparticles for efficient sunlight-driven photocatalysis.

    Science.gov (United States)

    Etacheri, Vinodkumar; Roshan, Roshith; Kumar, Vishwanathan

    2012-05-01

    Magnesium-doped ZnO (ZMO) nanoparticles were synthesized through an oxalate coprecipitation method. Crystallization of ZMO upon thermal decomposition of the oxalate precursors was investigated using differential scanning calorimetry (DSC) and X-ray diffraction (XRD) techniques. XRD studies point toward a significant c-axis compression and reduced crystallite sizes for ZMO samples in contrast to undoped ZnO, which was further confirmed by HRSEM studies. X-ray photoelectron spectroscopy (XPS), UV/vis spectroscopy and photoluminescence (PL) spectroscopy were employed to establish the electronic and optical properties of these nanoparticles. (XPS) studies confirmed the substitution of Zn(2+) by Mg(2+), crystallization of MgO secondary phase, and increased Zn-O bond strengths in Mg-doped ZnO samples. Textural properties of these ZMO samples obtained at various calcination temperatures were superior in comparison to the undoped ZnO. In addition to this, ZMO samples exhibited a blue-shift in the near band edge photoluminescence (PL) emission, decrease of PL intensities and superior sunlight-induced photocatalytic decomposition of methylene blue in contrast to undoped ZnO. The most active photocatalyst 0.1-MgZnO obtained after calcination at 600 °C showed a 2-fold increase in photocatalytic activity compared to the undoped ZnO. Band gap widening, superior textural properties and efficient electron-hole separation were identified as the factors responsible for the enhanced sunlight-driven photocatalytic activities of Mg-doped ZnO nanoparticles.

  5. Modeling of integrated sunlight velocity measurements: The effect of surface darkening by magnetic fields

    Science.gov (United States)

    Ulrich, R. K.; Henney, C. J.; Schimpf, S.; Fossat, E.; Gelly, B.; Grec, G.; Loudagh, S.; Schmider, F.-X; Palle, P.; Regulo, C.

    1993-01-01

    It has been known since the work by Claverie et al. (1982) that integrated-sunlight velocities measured with the resonance scattering technique show variations with time scales of weeks to months. The cause can be understood in terms of the effects of solar activity as was pointed out by Edmunds & Gough (1983) and Andersen & Maltby (1983). The latter authors included a model calculation based on sunspot areas which showed good promise of being able to quantitatively reproduce the observed velocity shifts. We discuss in this paper a new modeling effort based on daily magnetograms obtained at the 150-ft tower on Mt. Wilson. This type of database is more quantitative than sunspot area. Similar maps of magnetically sensitive quantities will be measured on a continuous time base as part of several planned helioseismology experiments (from space with the Solar Oscillations Imagery/Michelson Doppler Imager (SOI/MDI) experiment on the Solar and Heliospheric Observatory (SOHO), see Scherrer et al. (1991) or with ground-based networks, see Hill & Leibacher (1991)). We discuss the correlations between various magnetically sensitive quantities and develop a new model for the effects of magnetic field on line profiles and surface brightness. From these correlations we integrate the line profile changes over the solar surface using observed magnetic field strengths measured at lambda 5250.2. The final output is a new model for the effects of magnetic fields on integrated sunlight velocities which we compare with daily offset velocities derived from the International Research on the Interior of the Sun (IRIS)-T instrument at the Observatorio del Teide.

  6. Rapid synthesis of nanocrystalline magnesium chromite and ferrite ceramics with concentrated sunlight

    Energy Technology Data Exchange (ETDEWEB)

    Michalsky, Ronald, E-mail: michalskyr@ethz.ch; Peterson, Brian A.; Pfromm, Peter H.

    2014-04-01

    Highlights: • Refractory ceramics are produced via rapid solar-thermal processing. • The formed chromite and ferrite spinels have a high specific surface area. • The presence of transition metal oxides enables reduction of Mg cations. • Dinitrogen is reduced only by chromium. • The spinels are stable in reducing environments and in the presence of solar radiation. - Abstract: High-temperature refractory ceramics and catalysts such as MgM{sub 2}O{sub 4} (M = Cr, Fe) are produced conventionally via energy-intensive solid-state syntheses (using 0.44–10 GJ electricity for sintering per ton oxide, equivalent to combustion of 48–1088 kg coal per ton oxide). This article reports rapid production of 17 ± 2 mol% MgFe{sub 2}O{sub 4} and 8.6 ± 0.9 mol% MgCr{sub 2}O{sub 4} after 30 min at 1200 °C employing 0.82 kW m{sup −2} sunlight concentrated at a geometric ratio of about 900 m{sup 2} m{sup −2} using a Fresnel lens. Solar radiation promotes the diffusion-limited ferrite formation (42 ± 5 μmol MgFe{sub 2}O{sub 4} per mol Fe{sub 2}O{sub 3} s{sup −1} vs. 26 ± 3 μmol mol{sup −1} s{sup −1} in absence of sunlight) while the transition metals promote the reduction of Mg{sup 2+}. The nanocrystalline and macroporous spinel has a specific surface area of 9.7–11.9 m{sup 2} g{sup −1} (in the order of sol–gel synthesis methods) and is stable under extreme conditions, i.e., high temperature, solar radiation, and reducing agents.

  7. Inactivation of Escherichia coli, Listeria monocytogenes and Yersinia enterocolitica in fermented sausages during maturation/storage.

    Science.gov (United States)

    Lindqvist, Roland; Lindblad, Mats

    2009-01-31

    The purpose of this study was to evaluate maturation and storage conditions as a way to increase the safety of non-heat treated fermented sausages. The specific objectives were to investigate the effects of storage time and temperature on the levels of Escherichia coli, Listeria monocytogenes and Yersinia enterocolitica in fermented sausages and in broth, and to validate how well the broth experiments and some published models can predict inactivation in sausage. One strain each of E. coli, L. monocytogenes and Y. enterocolitica with induced acid tolerance was inoculated into sausage batters representing a typical Swedish recipe for cold-smoked sausages. The sausages were fermented at 27 degrees C for 39 or 48 h and then stored at different temperatures (8, 15, or 20-22 degrees C) for up to 44 days. The levels of the experimental strains, lactic acid bacteria, and pH, a(w), and lactic acid was measured during the maturation/storage period. Inactivation in BHI broths adjusted to pH 4.4 or 4.6, water activity of 0.93, and with 1, 1.3 or 2% lactic acid added was also studied. For all strains inactivation rates increased with temperature in both broths and sausages. At 8 degrees C the storage time required for a one-log reduction in sausage ranged from 21 days for E. coli, >16 days for L. monocytogenes, to 18 days for Y. enterocolitica. At temperatures of 20 degrees C or more, the storage time needed for a one log reduction was shorter: between 7 to 11 days for E. coli, 4 to 7 days for L. monocytogenes, and 1 to 4 days for Y. enterocolitica. A published model based on temperature only yielded a good prediction of E. coli inactivation in sausage. A linear model based on the rate estimated in broth yielded a fair prediction of L. monocytogenes inactivation. The performance of other inactivation models validated was unsatisfactory. Significant E. coli growth which occurred in batters without salt during initial phases of fermentation resulted in a subsequent increased

  8. Chlorine inactivation of Tubifex tubifex in drinking water and the synergistic effect of sequential inactivation with UV irradiation and chlorine.

    Science.gov (United States)

    Nie, Xiao-Bao; Li, Zhi-Hong; Long, Yuan-Nan; He, Pan-Pan; Xu, Chao

    2017-06-01

    The inactivation of Tubifex tubifex is important to prevent contamination of drinking water. Chlorine is a widely-used disinfectant and the key factor in the inactivation of T. tubifex. This study investigated the inactivation kinetics of chlorine on T. tubifex and the synergistic effect of the sequential use of chlorine and UV irradiation. The experimental results indicated that the Ct (concentration × timereaction) concept could be used to evaluate the inactivation kinetics of T. tubifex with chlorine, thus allowing for the use of a simpler Ct approach for the assessment of T. tubifex chlorine inactivation requirements. The inactivation kinetics of T. tubifex by chlorine was found to be well-fitted to a delayed pseudo first-order Chick-Watson expression. Sequential experiments revealed that UV irradiation and chlorine worked synergistically to effectively inactivate T. tubifex as a result of the decreased activation energy, Ea, induced by primary UV irradiation. Furthermore, the inactivation effectiveness of T. tubifex by chlorine was found to be affected by several drinking water quality parameters including pH, turbidity, and chemical oxygen demand with potassium permanganate (CODMn) concentration. High pH exhibited pronounced inactivation effectiveness and the decrease in turbidity and CODMn concentrations contributed to the inactivation of T. tubifex.

  9. A model of thrombin inactivation in heparinized and nonheparinized tubes with consequences for thrombus formation.

    Science.gov (United States)

    Basmadjian, D; Sefton, M V

    1986-01-01

    The role of flow and mass transport in determining procoagulant concentration at the wall of synthetic and natural cylindrical blood vessels is analyzed theoretically. The model assumes steady laminar flow and considers, in addition to the fluid dynamic parameters, three rate-determining steps: production of procoagulant (thrombin) and its inactivation at the wall, as well as inactivation in the fluid bulk. The ratio of thrombin wall concentration to production rate Cw/N emerges as a critical parameter in characterizing the behavior of the tube wall. With a wall-inactivation rate typical of heparinized materials, Cw/N = 11.1 s/cm, independent of flow (shear rate) and axial position. This is significantly less than the range of Cw/N (50-500 s/cm) for which the thrombin concentration is high enough to result in significant fibrin formation and thrombosis. Hence little fibrin formation and a high degree of thromboresistance is expected for heparinized materials. Nonheparinized materials have Cw/N values above this range, which are only weakly dependent on shear rate and diameter, suggesting that flow-induced dispersion of thrombin (or other procoagulants) has limited impact on the thrombin wall concentration. These latter results appear to refute the conventional wisdom that attributes the relative patency of large-diameter vessels and differences between venous and arterial thrombi to such flow effects. It is likely that additional factors such as flow pulsatility and wall geometry must be considered to account for these observations.

  10. Virus inactivation by protein denaturants used in affinity chromatography.

    Science.gov (United States)

    Roberts, Peter L; Lloyd, David

    2007-10-01

    Virus inactivation by a number of protein denaturants commonly used in gel affinity chromatography for protein elution and gel recycling has been investigated. The enveloped viruses Sindbis, herpes simplex-1 and vaccinia, and the non-enveloped virus polio-1 were effectively inactivated by 0.5 M sodium hydroxide, 6 M guanidinium thiocyanate, 8 M urea and 70% ethanol. However, pH 2.6, 3 M sodium thiocyanate, 6 M guanidinium chloride and 20% ethanol, while effectively inactivating the enveloped viruses, did not inactivate polio-1. These studies demonstrate that protein denaturants are generally effective for virus inactivation but with the limitation that only some may inactivate non-enveloped viruses. The use of protein denaturants, together with virus reduction steps in the manufacturing process should ensure that viral cross contamination between manufacturing batches of therapeutic biological products is prevented and the safety of the product ensured.

  11. X Inactivation and Progenitor Cancer Cells

    Directory of Open Access Journals (Sweden)

    Ruben Agrelo

    2011-04-01

    Full Text Available In mammals, silencing of one of the two X chromosomes is necessary to achieve dosage compensation. The 17 kb non-coding RNA called Xist triggers X inactivation. Gene silencing by Xist can only be achieved in certain contexts such as in cells of the early embryo and in certain hematopoietic progenitors where silencing factors are present. Moreover, these epigenetic contexts are maintained in cancer progenitors in which SATB1 has been identified as a factor related to Xist-mediated chromosome silencing.

  12. Inactivation effects of neutral reactive-oxygen species on Penicillium digitatum spores using non-equilibrium atmospheric-pressure oxygen radical source

    Science.gov (United States)

    Hashizume, Hiroshi; Ohta, Takayuki; Fengdong, Jia; Takeda, Keigo; Ishikawa, Kenji; Hori, Masaru; Ito, Masafumi

    2013-10-01

    The effectiveness of atomic and excited molecular oxygen species at inactivating Penicillium digitatum spores was quantitatively investigated by measuring these species and evaluating the spore inactivation rate. To avoid the effects of ultraviolet light and charged species, a non-equilibrium atmospheric-pressure radical source, which supplies only neutral radicals, was employed. Ground-state atomic oxygen (O(3Pj)) and excited molecular oxygen (O2(1Δg)) species were measured using vacuum ultraviolet absorption spectroscopy. The inactivation rate of spores was evaluated using the colony count method. The lifetimes of O(3Pj) and O2(1Δg) in an argon gas ambient at atmospheric pressure were found to be about 0.5 ms and much more than tens of ms, and their spore inactivation rates were about 10-17 cm3 s-1 and much lower than 10-21 cm3 s-1, respectively.

  13. Dynamic Model of Heat Inactivation Kinetics for Bacterial Adaptation▿

    Science.gov (United States)

    Corradini, Maria G.; Peleg, Micha

    2009-01-01

    The Weibullian-log logistic (WeLL) inactivation model was modified to account for heat adaptation by introducing a logistic adaptation factor, which rendered its “rate parameter” a function of both temperature and heating rate. The resulting model is consistent with the observation that adaptation is primarily noticeable in slow heat processes in which the cells are exposed to sublethal temperatures for a sufficiently long time. Dynamic survival patterns generated with the proposed model were in general agreement with those of Escherichia coli and Listeria monocytogenes as reported in the literature. Although the modified model's rate equation has a cumbersome appearance, especially for thermal processes having a variable heating rate, it can be solved numerically with commercial mathematical software. The dynamic model has five survival/adaptation parameters whose determination will require a large experimental database. However, with assumed or estimated parameter values, the model can simulate survival patterns of adapting pathogens in cooked foods that can be used in risk assessment and the establishment of safe preparation conditions. PMID:19201963

  14. Serum levels of vitamin D, sunlight exposure, and knee cartilage loss in older adults: the Tasmanian older adult cohort study.

    Science.gov (United States)

    Ding, Changhai; Cicuttini, Flavia; Parameswaran, Venkat; Burgess, John; Quinn, Steve; Jones, Graeme

    2009-05-01

    To determine the associations between serum levels of vitamin D, sunlight exposure, and knee cartilage loss cross-sectionally and longitudinally in older adults. A total of 880 randomly selected subjects (mean age 61 years [range 51-79 years], 50% women) were studied at baseline, and 353 of these subjects were studied 2.9 years later. Serum levels of 25-hydroxyvitamin D (25[OH]D) were assessed by radioimmunoassay, and sunlight exposure was assessed by questionnaire. T1-weighted fat-suppressed magnetic resonance imaging (MRI) of the right knee was performed to determine knee cartilage volume and defects. Knee radiographic osteoarthritis (OA) and knee pain were also assessed. The mean 25(OH)D serum level was 52.8 nmoles/liter at baseline (range 13-119 nmoles/liter). Winter sunlight exposure and serum 25(OH)D level were both positively associated with medial and lateral tibial cartilage volume, and a serum 25(OH)D levelSunlight exposure and serum 25(OH)D levels are both associated with decreased knee cartilage loss (assessed by radiograph or MRI). This is best observed using the whole range of 25(OH)D levels rather than predefined cut points and implies that achieving vitamin D sufficiency may prevent and/or retard cartilage loss in knee OA.

  15. No indications for an ultraviolet B radiation induced decline of immunological parameters after sunlight exposure among HIV infected homosexual men

    NARCIS (Netherlands)

    Maas J; Termorshuizen F; Geskus RB; Coutinho RA; Loveren H van; GG&GD Amsterdam; LPI

    2000-01-01

    Whether sunlight (especially ultraviolet B radiation: UVB) exposure is harmful to the cellular immunity of HIV infected individuals and whether it is associated with an accelerated progression toward AIDS is still under debate. Among HIV+ homosexual participants of the Amsterdam Cohort Study, the de

  16. Photocatalytic degradation of humic substances in aqueous solution using Cu-doped ZnO nanoparticles under natural sunlight irradiation.

    Science.gov (United States)

    Maleki, Afshin; Safari, Mahdi; Shahmoradi, Behzad; Zandsalimi, Yahya; Daraei, Hiua; Gharibi, Fardin

    2015-11-01

    In this study, Cu-doped ZnO nanoparticles were investigated as an efficient synthesized catalyst for photodegradation of humic substances in aqueous solution under natural sunlight irradiation. Cu-doped ZnO nanocatalyst was prepared through mild hydrothermal method and was characterized using FT-IR, powder XRD and SEM techniques. The effect of operating parameters such as doping ratio, initial pH, catalyst dosage, initial concentrations of humic substances and sunlight illuminance were studied on humic substances degradation efficiency. The results of characterization analyses of samples confirmed the proper synthesis of Cu-doped ZnO nanocatalyst. The experimental results indicated the highest degradation efficiency of HS (99.2%) observed using 1.5% Cu-doped ZnO nanoparticles at reaction time of 120 min. Photocatalytic degradation efficiency of HS in a neutral and acidic pH was much higher than that at alkaline pH. Photocatalytic degradation of HS was enhanced with increasing the catalyst dosage and sunlight illuminance, while increasing the initial HS concentration led to decrease in the degradation efficiency of HS. Conclusively, Cu-doped ZnO nanoparticles can be used as a promising and efficient catalyst for degradation of HS under natural sunlight irradiation.

  17. Diffused sunlight driven highly synergistic pathway for complete mineralization of organic contaminants using reduced graphene oxide supported photocatalyst.

    Science.gov (United States)

    Babu, Sundaram Ganesh; Ramalingam Vinoth; Neppolian, Bernaurdshaw; Dionysiou, Dionysios D; Ashokkumar, Muthupandian

    2015-06-30

    Diffused sunlight is found to be an effective light source for the efficient degradation and mineralization of organic pollutant (methyl orange as a probe) by sono-photocatalytic degradation using reduced graphene oxide (rGO) supported CuO-TiO2 photocatalyst. The prepared catalysts are characterized by XRD, XPS, UV-vis DRS, PL, photoelectrochemical, SEM-EDS and TEM. A 10 fold synergy is achieved for the first time by combining sonochemical and photocatalytic degradation under diffused sunlight. rGO loading augments the activity of bare CuO-TiO2 more than two fold. The ability of rGO in storing, transferring, and shuttling electrons at the heterojunction between TiO2 and CuO facilitates the separation of photogenerated electron-hole pairs, as evidenced by the photoluminescence results. The complete mineralization of MO and the by-products within a short span of time is confirmed by TOC analysis. Further, hydroxyl radical mediated degradation under diffused sunlight is confirmed by LC-MS. This system shows similar activity for the degradation of methylene blue and 4-chlorophenol indicating the versatility of the catalyst for the degradation of various pollutants. This investigation is likely to open new possibilities for the development of highly efficient diffused sunlight driven TiO2 based photocatalysts for the complete mineralization of organic contaminants.

  18. No indications for an ultraviolet B radiation induced decline of immunological parameters after sunlight exposure among HIV infected homosexual men

    NARCIS (Netherlands)

    Maas J; Termorshuizen F; Geskus RB; Coutinho RA; Loveren H van; GG&GD Amsterdam; LPI

    2000-01-01

    Whether sunlight (especially ultraviolet B radiation: UVB) exposure is harmful to the cellular immunity of HIV infected individuals and whether it is associated with an accelerated progression toward AIDS is still under debate. Among HIV+ homosexual participants of the Amsterdam Cohort Study, the de

  19. Effect of Natural Sunlight on Bacterial Activity and Differential Sensitivity of Natural Bacterioplankton Groups in Northwestern Mediterranean Coastal Waters

    Science.gov (United States)

    Alonso-Sáez, Laura; Gasol, Josep M.; Lefort, Thomas; Hofer, Julia; Sommaruga, Ruben

    2006-01-01

    We studied the effects of natural sunlight on heterotrophic marine bacterioplankton in short-term experiments. We used a single-cell level approach involving flow cytometry combined with physiological probes and microautoradiography to determine sunlight effects on the activity and integrity of the cells. After 4 h of sunlight exposure, most bacterial cells maintained membrane integrity and viability as assessed by the simultaneous staining with propidium iodide and SYBR green I. In contrast, a significant inhibition of heterotrophic bacterial activity was detected, measured by 5-cyano-2,3 ditolyl tetrazolium chloride reduction and leucine incorporation. We applied microautoradiography combined with catalyzed reporter deposition-fluorescence in situ hybridization to test the sensitivity of the different bacterial groups naturally occurring in the Northwestern Mediterranean to sunlight. Members of the Gammaproteobacteria and Bacteroidetes groups appeared to be highly resistant to solar radiation, with small changes in activity after exposure. On the contrary, Alphaproteobacteria bacteria were more sensitive to radiation as measured by the cell-specific incorporation of labeled amino acids, leucine, and ATP. Within Alphaproteobacteria, bacteria belonging to the Roseobacter group showed higher resistance than members of the SAR11 cluster. The activity of Roseobacter was stimulated by exposure to photosynthetic available radiation compared to the dark treatment. Our results suggest that UV radiation can significantly affect the in situ single-cell activity of bacterioplankton and that naturally dominating phylogenetic bacterial groups have different sensitivity to natural levels of incident solar radiation. PMID:16957198

  20. Degradation of methyl and ethyl mercury by singlet oxygen generated from sea water exposed to sunlight or ultraviolet light.

    Science.gov (United States)

    Suda, I; Suda, M; Hirayama, K

    1993-01-01

    Photodegradation of methyl mercury (MeHg) and ethyl Hg (EtHg) in sea water was studied by sunlight or ultraviolet (UV) light exposure, and by determining inorganic Hg produced by degradation. Sea water containing 1 microM MeHg or EtHg was exposed to sunlight or UV light. N-Acetyl-L-cysteine was added to the solution for preventing Hg loss during the light exposure. MeHg and EtHg in sea water were degraded by sunlight (> 280 nm), UV light A (320-400 nm) and UV light B (280-320 nm), though the amounts of inorganic Hg produced from MeHg were 1/6th to 1/12th those from EtHg. Inorganic Hg production was greater with increasing concentration of sea water. Degradation of MeHg and EtHg by the UV light A exposure was inhibited by singlet oxygen (1O2) trappers such as NaN3, 1,4-diazabicyclo[2,2,2]octane, histidine, methionine and 2,5-dimethylfuran. On the other hand, inhibitors or scavengers of superoxide anion, hydrogen peroxide or hydroxyl radical did not inhibit the photodegradation of alkyl Hg. These results suggested that 1O2 generated from sea water exposed to sunlight, UV light A or UV light B was the reactive oxygen species mainly responsible for the degradation of MeHg and EtHg.

  1. A simple relationship between the sunlight concentration factor and the thermal conductance in a class of photothermal engines

    Energy Technology Data Exchange (ETDEWEB)

    Rocha-Martinez, J.A.; Navarrete-Gonzalez, T.D. [Area de Fisica, Dept. de Ciencias Basicas, Universidad Autonoma Metropolitana Azcapotzalco, Mexico (Mexico); Angulo-Brown, F. [Departaamento de Fisica, Escuela Superior de Fisica y Matematicas, Instituto Politecnico Nacional, Mexico (Mexico)

    1998-07-21

    In this brief paper we present an addendum to a recently published analysis of a photothermal engine model. Here, we numerically demonstrate that the design parameters, the sunlight concentration factor and the thermal conductances of materials employed as thermal conductors are linked by a simple relationship, if one wishes to obtain the maximization of the power output of the photothermal engine. (author)

  2. Inactivation of virus in solution by cold atmospheric pressure plasma: identification of chemical inactivation pathways

    Science.gov (United States)

    Aboubakr, Hamada A.; Gangal, Urvashi; Youssef, Mohammed M.; Goyal, Sagar M.; Bruggeman, Peter J.

    2016-05-01

    Cold atmospheric pressure plasma (CAP) inactivates bacteria and virus through in situ production of reactive oxygen and nitrogen species (RONS). While the bactericidal and virucidal efficiency of plasmas is well established, there is limited knowledge about the chemistry leading to the pathogen inactivation. This article describes a chemical analysis of the CAP reactive chemistry involved in the inactivation of feline calicivirus. We used a remote radio frequency CAP produced in varying gas mixtures leading to different plasma-induced chemistries. A study of the effects of selected scavengers complemented with positive control measurements of relevant RONS reveal two distinctive pathways based on singlet oxygen and peroxynitrous acid. The first mechanism is favored in the presence of oxygen and the second in the presence of air when a significant pH reduction is induced in the solution by the plasma. Additionally, smaller effects of the H2O2, O3 and \\text{NO}2- produced were also found. Identification of singlet oxygen-mediated 2-imidazolone/2-oxo-His (His  +14 Da)—an oxidative modification of His 262 comprising the capsid protein of feline calicivirus links the plasma induced singlet oxygen chemistry to viral inactivation.

  3. Environmentally relevant impacts of nano-TiO2 on abiotic degradation of bisphenol A under sunlight irradiation.

    Science.gov (United States)

    Wu, Wei; Shan, Guoqiang; Wang, Shanfeng; Zhu, Lingyan; Yue, Longfei; Xiang, Qian; Zhang, Yinqing; Li, Zhuo

    2016-09-01

    Understanding the effects of nano-TiO2 particles on the environmental behaviors of organic pollutants in natural aquatic environments is of paramount importance considering that large amount of nano-TiO2 is being released in the environment. In this study, the effect of nano-TiO2 on the degradation of bisphenol A (BPA) in water was investigated under simulated solar light irradiation. The results indicated that nano-TiO2 at environmentally relevant concentration (1 mg/L) could significantly facilitate the abiotic degradation of BPA (also at low concentration) under mild solar light irradiation, with the pseudo first-order rate constant (kobs) for BPA degradation raised by 1-2 orders of magnitude. As reflected by the inhibition experiments, hydroxyl radicals (OHs) and superoxide radical species were the predominant active species responsible for BPA degradation. The reaction was affected by water pH, and the degradation rate was higher at acidic or alkaline conditions than that at neutral condition. Humic acid (HA) also affected the reaction rate, depending on its concentration. At lower concentration (the mass ratio of HA/nano-TiO2 was 0.1:1), HA improved the dispersion and stability of nano-TiO2 in aquatic environment. As a result, the yield of OHs by nano-TiO2 under sunlight irradiation increased and BPA degradation was facilitated. When the HA concentration increased, a coating of HA formed on the surface of nano-TiO2. Although nano-TiO2 became more stable, the light absorption by nano-TiO2 was significantly reduced due to the strong light absorption of the HA coated on the surface. As a consequence, the yield of OH decreased and BPA degradation was depressed. The results imply that nano-TiO2 at low concentration may distinctly mediate BPA degradation, and can contribute to the natural attenuation of some organic pollutants in aquatic environment with low level of HA. However, this process would be significantly reduced in the presence of high level of HA.

  4. Modeling the pressure inactivation dynamics of Escherichia coli

    Directory of Open Access Journals (Sweden)

    Yamamoto K.

    2005-01-01

    Full Text Available Escherichia coli, as a model microorganism, was treated in phosphate-buffered saline under high hydrostatic pressure between 100 and 300 MPa, and the inactivation dynamics was investigated from the viewpoint of predictive microbiology. Inactivation data were curve fitted by typical predictive models: logistic, Gompertz and Weibull functions. Weibull function described the inactivation curve the best. Two parameters of Weibull function were calculated for each holding pressure and their dependence on holding pressure was obtained by interpolation. With the interpolated parameters, inactivation curves were simulated and compared with the experimental data sets.

  5. Development of an Inactivated Iridovirus Vaccine Against Turbot Viral Reddish Body Syndrome

    Institute of Scientific and Technical Information of China (English)

    FAN Tingjun; HU Xiuzhong; WANG Liyan; GENG Xiaofen; JIANG Guojian; YANG Xiuxia; YU Miaomiao

    2012-01-01

    Turbot (Scophthalmus maximus L.) reddish body iridovirus (TRBIV) was propagated in turbot fin cells (TF cells) and inactivated as the TRBIV vaccine with its protection efficiency evaluated in this study.TF cells were cultured in 10% bovine calf serum (BCS)-containing MEM medium (pH7.0) at 22 ℃,in which TRBIV propagated to a titer as high as 105.6 TCID50 mL-1.The TRBIV was inactivated with 0.1% formalin and formulated with 0.5% aluminum hydroxide.The inactivated vaccine caused neither cytopathogenic effect (CPE) on TF cells nor pathogenic effect on turbots.After being administered with the vaccine twice via muscle injection,the turbot developed high-tittered TRBIV neutralizing antibodies in a dose-dependent manner.The vaccine protected the turbot from dying with an immunoprotection rate of 83.3% as was determined via subcutaneous vaccination in the laboratory and 90.5% via bath vaccination in turbot farms,respectively.The inactivated vaccine was very immunogenic,efficiently preventing turbot from death.It holds the potential of being applied in aquaculture.

  6. Development of an inactivated iridovirus vaccine against turbot viral reddish body syndrome

    Science.gov (United States)

    Fan, Tingjun; Hu, Xiuzhong; Wang, Liyan; Geng, Xiaofen; Jiang, Guojian; Yang, Xiuxia; Yu, Miaomiao

    2012-03-01

    Turbot ( Scophthalmus maximus L.) reddish body iridovirus (TRBIV) was propagated in turbot fin cells (TF cells) and inactivated as the TRBIV vaccine with its protection efficiency evaluated in this study. TF cells were cultured in 10% bovine calf serum (BCS)-containing MEM medium (pH7.0) at 22°C, in which TRBIV propagated to a titer as high as 105.6 TCID50 mL-1. The TRBIV was inactivated with 0.1% formalin and formulated with 0.5% aluminum hydroxide. The inactivated vaccine caused neither cytopathogenic effect (CPE) on TF cells nor pathogenic effect on turbots. After being administered with the vaccine twice via muscle injection, the turbot developed high-tittered TRBIV neutralizing antibodies in a dose-dependent manner. The vaccine protected the turbot from dying with an immunoprotection rate of 83.3% as was determined via subcutaneous vaccination in the laboratory and 90.5% via bath vaccination in turbot farms, respectively. The inactivated vaccine was very immunogenic, efficiently preventing turbot from death. It holds the potential of being applied in aquaculture.

  7. Validation of γ-radiation and ultraviolet as a new inactivators for foot and mouth disease virus in comparison with the traditional methods

    Directory of Open Access Journals (Sweden)

    Safy El din Mahdy

    2015-09-01

    Full Text Available Aim: The present work deals with different methods for foot and mouth disease virus (FMDV inactivation for serotypes O/pan Asia, A/Iran05, and SAT-2/2012 by heat, gamma radiation, and ultraviolet (UV in comparison with the traditional methods and their effects on the antigenicity of viruses for production of inactivated vaccines. Materials and Methods: FMDV types O/pan Asia, A/Iran05, and SAT-2/2012 were propagated in baby hamster kidney 21 (BHK21 and titrated then divided into five parts; the first part inactivated with heat, the second part inactivated with gamma radiation, the third part inactivated with UV light, the fourth part inactivated with binary ethylamine, and the last part inactivated with combination of binary ethylamine and formaldehyde (BEI+FA. Evaluate the method of inactivation via inoculation in BHK21, inoculation in suckling baby mice and complement fixation test then formulate vaccine using different methods of inactivation then applying the quality control tests to evaluate each formulated vaccine. Results: The effect of heat, gamma radiation, and UV on the ability of replication of FMDV "O/pan Asia, A/Iran05, and SAT-2/2012" was determined through BHK cell line passage. Each of the 9 virus aliquots titer 108 TCID50 (3 for each strain were exposed to 37, 57, and 77°C for 15, 30, and 45 min. Similarly, another 15 aliquots (5 for each strain contain 1 mm depth of the exposed samples in petri-dish was exposed to UV light (252.7 nm wavelength: One foot distance for 15, 30, 45, 60, and 65 min. Different doses of gamma radiation (10, 20, 25, 30, 35, 40, 45, 50, 55, and 60 KGy were applied in a dose rate 0.551 Gy/s for each strain and repeated 6 times for each dose. FMDV (O/pan Asia, A/Iran05, and SAT-2/2012 were inactivated when exposed to heat ≥57°C for 15 min. The UV inactivation of FMDV (O/pan Asia and SAT-2 was obtained within 60 min and 65 min for type A/Iran05. The ideal dose for inactivation of FMDV (O/pan Asia, A

  8. Photocatalytic degradation of phenol in natural seawater using visible light active carbon modified (CM)-n-TiO2 nanoparticles under UV light and natural sunlight illuminations.

    Science.gov (United States)

    Shaban, Yasser A; El Sayed, Mohamed A; El Maradny, Amr A; Al Farawati, Radwan Kh; Al Zobidi, Mousa I

    2013-04-01

    The photocatalytic degradation of phenol in seawater was investigated under UV and natural sunlight using visible light active carbon modified (CM)-n-TiO2 nanoparticles, synthesized via a sol-gel method. Carbon modification of n-TiO2 was performed using titanium butoxide, carbon-containing precursor, as a source of both carbon and titanium. For comparison, unmodified n-TiO2 was also synthesized by hydrolysis and oxidation of titanium trichloride in the absence of any carbon source. The presence of carbon in CM-n-TiO2 nanoparticles was confirmed by energy dispersive spectroscopy (EDS) analysis. Carbon modification was found to be responsible for lowering the bandgap energy from 3.14eV for n-TiO2 to 1.86eV for CM-n-TiO2 which in turn enhanced the photocatalytic activity of CM-n-TiO2 towards the degradation of phenol in seawater under illumination of UV light as well as natural sunlight. This enhanced photoresponse of CM-n-TiO2 is in agreement with the UV-Vis spectroscopic results that showed higher absorption of light in both UV and visible regions. The effects of catalyst dose, initial concentration of phenol, and pH were studied. The highest degradation rate was obtained at pH 3 and catalyst dose of 1.0gL(-1). The data photocatalytic degradation of phenol in seawater using CM-n-TiO2 were successfully fitted to Langmuir-Hinshelwood model, and can be described by pseudo-first order kinetics.

  9. Sunlight exposure and cardiovascular risk factors in the REGARDS study: a cross-sectional split-sample analysis.

    Science.gov (United States)

    Kent, Shia T; Cushman, Mary; Howard, George; Judd, Suzanne E; Crosson, William L; Al-Hamdan, Mohammad Z; McClure, Leslie A

    2014-06-19

    Previous research has suggested that vitamin D and sunlight are related to cardiovascular outcomes, but associations between sunlight and risk factors have not been investigated. We examined whether increased sunlight exposure was related to improved cardiovascular risk factor status. Residential histories merged with satellite, ground monitor, and model reanalysis data were used to determine previous-year sunlight radiation exposure for 17,773 black and white participants aged 45+ from the US. Exploratory and confirmatory analyses were performed by randomly dividing the sample into halves. Logistic regression models were used to examine relationships with cardiovascular risk factors. The lowest, compared to the highest quartile of insolation exposure was associated with lower high-density lipoprotein levels in adjusted exploratory (-2.7 mg/dL [95% confidence interval: -4.2, -1.2]) and confirmatory (-1.5 mg/dL [95% confidence interval: -3.0, -0.1]) models. The lowest, compared to the highest quartile of insolation exposure was associated with higher systolic blood pressure levels in unadjusted exploratory and confirmatory, as well as the adjusted exploratory model (2.3 mmHg [95% confidence interval: 0.8, 3.8]), but not the adjusted confirmatory model (1.6 mg/dL [95% confidence interval: -0.5, 3.7]). The results of this study suggest that lower long-term sunlight exposure has an association with lower high-density lipoprotein levels. However, all associations were weak, thus it is not known if insolation may affect cardiovascular outcomes through these risk factors.

  10. Is sunlight exposure a risk factor for age-related macular degeneration? A systematic review and meta-analysis.

    Science.gov (United States)

    Sui, Guo-Yuan; Liu, Guang-Cong; Liu, Guang-Ying; Gao, Yan-Yan; Deng, Yan; Wang, Wen-Ying; Tong, Shu-Hui; Wang, Lie

    2013-04-01

    Epidemiologists have recently investigated sunlight exposure as a risk factor for age-related macular degeneration (AMD), but there remains an ongoing dispute over this association due to insufficient evidence and unreliable data. To analyse comprehensively the epidemiological literature concerning the association between AMD and sunlight exposure. We systematically reviewed the epidemiological literature concerning the association between AMD and sunlight exposure. An electronic search was performed of PubMed, Web of Science and CNKI, which was supplemented by hand searching. The selection of studies, data abstraction and quality assessment were performed independently by three reviewers. After these steps, we performed a random-effects meta-analysis, followed by subgroup analysis and sensitivity analysis, including a random-effects meta-regression for study-specific covariates. Fourteen studies were identified. Twelve studies identified an increasing risk of AMD with greater sunlight exposure, six of which reported significant risks. The pooled OR was 1.379 (95% CI 1.091 to 1.745). The subgroup of non-population-based studies revealed a significant risk (OR 2.018, 1.248 to 3.265, p=0.004). We identified the gross domestic product (GDP) per capita (p=0.048), but not the latitude (p=0.21), as a factor that led to heterogeneity according to the meta-regression. The epidemiological literature published to date indicates that individuals with more sunlight exposure are at a significantly increased risk of AMD. The OR significantly decreased with increasing GDP per capita.

  11. Mitochondrial tolerance to single and repeat exposure to simulated sunlight in human epidermal and dermal skin cells.

    Science.gov (United States)

    Kelly, J; Murphy, J E J

    2016-12-01

    Sunlight represents the primary threat to mitochondrial integrity in skin given the unique nature of the mitochondrial genome and its proximity to the electron transport chain. The accumulation of mitochondrial DNA (mtDNA) mutations is a key factor in many human pathologies and this is linked to key roles of mitochondrial function in terms of energy production and cell regulation. The main objective of this study was to evaluate solar radiation induced changes in mitochondrial integrity, function and dynamics in human skin cells using a Q-Sun solar simulator to deliver a close match to the intensity of summer sunlight. Spontaneously immortalised human skin epidermal keratinocytes (HaCaT) and Human Dermal Fibroblasts (HDFn) were divided into two groups. Group A were irradiated once and Group B twice 7days apart and evaluated using cell survival, viability and mitochondrial membrane potential (MMP) and mass at 1, 4 and 7days post one exposure for Group A and 1, 4, 7 and 14days post second exposure for Group B. Viability and survival of HaCaT and HDFn cells decreased after repeat exposure to Simulated Sunlight Irradiation (SSI) with no recovery. HDFn cells showed no loss in MMP after one or two exposures to SSI compared to HaCaT cells which showed a periodic loss of MMP after one exposure with a repeat exposure causing a dramatic decrease from which cells did not recover. Mitochondrial Mass in exposed HDFn cells was consistent with control after one or two exposures to SSI; however mitochondrial mass was significantly decreased in HaCaT cells. Data presented here suggests that mitochondria in epidermal cells are more sensitive to sunlight damage compared to mitochondria in dermal cells, despite their origin, confirming a skin layer specific sensitivity to sunlight, but not as expected. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Diffused sunlight driven highly synergistic pathway for complete mineralization of organic contaminants using reduced graphene oxide supported photocatalyst

    Energy Technology Data Exchange (ETDEWEB)

    Babu, Sundaram Ganesh; Ramalingam Vinoth [SRM Research Institute, SRM University, Kattankulathur 603203, Chennai, Tamilnadu (India); Neppolian, Bernaurdshaw, E-mail: neppolian.b@res.srmuniv.ac.in [SRM Research Institute, SRM University, Kattankulathur 603203, Chennai, Tamilnadu (India); Dionysiou, Dionysios D. [Environmental Engineering and Science Program, Department of Biomedical, Chemical and Environmental Engineering, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Ashokkumar, Muthupandian [The School of Chemistry, University of Melbourne, Parkville, Melbourne, Victoria 3010 (Australia)

    2015-06-30

    Highlights: • Diffused sunlight is firstly used as an effective source for the degradation of organics. • More than 10 fold synergistic effect is achieved by sono-photocatalysis. • rGO enhances the degradation efficiency up to 54% as compared with CuO–TiO{sub 2} alone. • Plausible mechanism and intermediates formed are supported with experimental studies. - Abstract: Diffused sunlight is found to be an effective light source for the efficient degradation and mineralization of organic pollutant (methyl orange as a probe) by sono-photocatalytic degradation using reduced graphene oxide (rGO) supported CuO–TiO{sub 2} photocatalyst. The prepared catalysts are characterized by XRD, XPS, UV–vis DRS, PL, photoelectrochemical, SEM-EDS and TEM. A 10 fold synergy is achieved for the first time by combining sonochemical and photocatalytic degradation under diffused sunlight. rGO loading augments the activity of bare CuO–TiO{sub 2} more than two fold. The ability of rGO in storing, transferring, and shuttling electrons at the heterojunction between TiO{sub 2} and CuO facilitates the separation of photogenerated electron–hole pairs, as evidenced by the photoluminescence results. The complete mineralization of MO and the by-products within a short span of time is confirmed by TOC analysis. Further, hydroxyl radical mediated degradation under diffused sunlight is confirmed by LC–MS. This system shows similar activity for the degradation of methylene blue and 4-chlorophenol indicating the versatility of the catalyst for the degradation of various pollutants. This investigation is likely to open new possibilities for the development of highly efficient diffused sunlight driven TiO{sub 2} based photocatalysts for the complete mineralization of organic contaminants.

  13. Ribosome Inactivating Proteins from Plants Inhibiting Viruses

    Institute of Scientific and Technical Information of China (English)

    Inderdeep Kaur; R C Gupta; Munish Puri

    2011-01-01

    Many plants contain ribosome inactivating proteins (RIPs) with N-glycosidase activity,which depurinate large ribosomal RNA and arrest protein synthesis.RIPs so far tested inhibit replication of mRNA as well as DNA viruses and these proteins,isolated from plants,are found to be effective against a broad range of viruses such as human immunodeficiency virus (HIV),hepatitis B virus (HBV) and herpes simplex virus (HSV).Most of the research work related to RIPs has been focused on antiviral activity against HIV; however,the exact mechanism of antiviral activity is still not clear.The mechanism of antiviral activity was thought to follow inactivation of the host cell ribosome,leading to inhibition of viral protein translation and host cell death.Enzymatic activity of RIPs is not hmited to depurination of the large rRNA,in addition they can depurinate viral DNA as well as RNA.Recently,Phase Ⅰ/Ⅱ clinical trials have demonstrated the potential use of RIPs for treating patients with HIV disease.The aim of this review is to focus on various RIPs from plants associated with anti-HIV activity.

  14. Inactivation of Staphylococcus aureus in raw salmon with supercritical CO2 using experimental design

    Directory of Open Access Journals (Sweden)

    Mônica CUPPINI

    2016-01-01

    Full Text Available Abstract Considering the microbial safety of consumption of raw foods (Asian food, this study aimed to explore the inactivation S. aureus in raw salmon by supercritical CO2 treatment (SC-CO2. For this purpose, experimental design methodology was employed as a tool to evaluate the effects of pressure (120-220 bar, the depressurization rate (10 to 100 bar.min–1 and the salmon:CO2 mass relation (1:0.2 to 1:1.0. It was observed that the pressure and the depressurization rate was statistically significant, i.e. the higher the system pressure and depressurization rate, the greater the microbial inactivation. The salmon: CO2 mass relation did not influence the S. aureus inactivation in raw salmon. There was a total reduction in S. aureus with 225 bar, a depressurizing rate of 100 bar.min–1, a salmon: CO2 mass relation of 1:0.6, for 2 hours at 33 °C.

  15. The assessment of efficacy of porcine reproductive respiratory syndrome virus inactivated vaccine based on the viral quantity and inactivation methods

    National Research Council Canada - National Science Library

    Kim, Hyunil; Kim, Hye Kwon; Jung, Jung Ho; Choi, Yoo Jung; Kim, Jiho; Um, Chang Gyu; Hyun, Su Bin; Shin, Sungho; Lee, Byeongchun; Jang, Goo; Kang, Bo Kyu; Moon, Hyoung Joon; Song, Dae Sub

    2011-01-01

    ...). Although inactivated PRRSV vaccines are preferred for their safety, they are weak at inducing humoral immune responses and controlling field PRRSV infection, especially when heterologous viruses are involved...

  16. Role in fast inactivation of the IV/S4-S5 loop of the human muscle Na+ channel probed by cysteine mutagenesis.

    Science.gov (United States)

    Lerche, H; Peter, W; Fleischhauer, R; Pika-Hartlaub, U; Malina, T; Mitrovic, N; Lehmann-Horn, F

    1997-12-01

    1. In order to investigate the role in fast inactivation of the cytoplasmic S4-S5 loop of the fourth domain (IV/S4-S5) within the alpha-subunit of the adult human muscle Na+ channel, every single amino acid from R1469 to G1486 was substituted by a cysteine and the mutants were studied by functional expression in human embryonic kidney cells (tsA201) using whole-cell patch clamping. Effects following intracellular application of the sulfhydryl reagents MTSET and MTSES on the mutants were investigated. 2. Sixteen of eighteen mutants resulted in the formation of functional channels. For P1480C and N1484C, no Na+ currents could be detected in transfected cells. In the absence of sulfhydryl reagents, F1473C and A1481C slowed fast Na+ channel inactivation by 2- and 1.5-fold, respectively, and L1482C induced a steady-state Na+ current (Iss) of 3% of peak current (Ipeak) (1% for wild-type). 3. Upon application of MTSET and MTSES, changes in fast inactivation gating occurred for most of the mutants. The most dramatic destabilizing effects on fast inactivation were observed for M1476C (9-fold slowing of inactivation; Iss/Ipeak, 3.6%; +15 mV shift in steady-state inactivation; 2- to 3-fold acceleration of recovery from inactivation), A1481C (3-fold; 14%; +20 mV; no change) and F1473C (2.5-fold; 2.4%; +8 mV; 1.5-fold). Less pronounced destabilizing effects were observed for M1477C and L1479C. Strongly stabilizing effects on the inactivated state, that is a 20-30 mV hyperpolarizing shift of the inactivation curve associated with a 3- to 4-fold decrease in the rate of recovery from inactivation, occurred for T1470C, L1471C and A1474C. Almost all effects were independent of the membrane potential; however, A1474C only reacted when cells were depolarized. Significant effects on activation were not observed. 4. We conclude that the IV/S4-S5 loop plays an important role in fast inactivation of the muscle Na+ channel and may contribute to the formation of a receptor for the putative

  17. Lactococcus lactis Thioredoxin Reductase Is Sensitive to Light Inactivation

    DEFF Research Database (Denmark)

    Björnberg, Olof; Viennet, Thibault; Skjoldager, Nicklas;

    2015-01-01

    R. The rate of light inactivation under standardized conditions (λmax = 460 nm and 4 °C) was reduced at lowered oxygen concentrations and in the presence of iodide. Inactivation was accompanied by a distinct spectral shift of the flavin adenine dinucleotide (FAD) that remained firmly bound. High......-resolution mass spectrometric analysis of heat-extracted FAD from light-damaged TrxR revealed a mass increment of 13.979 Da, relative to that of unmodified FAD, corresponding to the addition of one oxygen atom and the loss of two hydrogen atoms. Tandem mass spectrometry confined the increase in mass...... of the isoalloxazine ring, and the extracted modified cofactor reacted with dinitrophenyl hydrazine, indicating the presence of an aldehyde. We hypothesize that a methyl group of FAD is oxidized to a formyl group. The significance of this not previously reported oxidation and the exceptionally high rate of oxygen...

  18. Exposure to sunlight reduces the risk of myopia in rhesus monkeys.

    Science.gov (United States)

    Wang, Yong; Ding, Hui; Stell, William K; Liu, Liangping; Li, Saiqun; Liu, Hongshan; Zhong, Xingwu

    2015-01-01

    Exposure to sunlight has recently been postulated as responsible for the effect that more time spent outdoors protects children from myopia, while early life exposure to natural light was reported to be possibly related to onset of myopia during childhood. In this study, we had two aims: to determine whether increasing natural light exposure has a protective effect on hyperopic defocus-induced myopia, and to observe whether early postnatal exposure to natural light causes increased risk of refractive error in adolescence. Eight rhesus monkeys (aged 20-30 days) were treated monocularly with hyperopic-defocus (-3.0D lens) and divided randomly into two groups: AL group (n=4), reared under Artificial (indoor) Lighting (08:00-20:00); and NL group (n=4), exposed to Natural (outdoor) Light for 3 hours per day (11:00-14:00), and to indoor lighting for the rest of the light phase. After being reared with lenses for ca. 190 days, all monkeys were returned to unrestricted vision until the age of 3 years. Another eight age-matched monkeys, reared with unrestricted vision under artificial lighting since birth, were employed as controls. The ocular refraction, corneal curvature and axial dimensions were measured before lens-wearing (at 23±3 days of age), monthly during the light phase, and at the age of puberty (at 1185+3 days of age). During the lens-wearing treatment, infant monkeys in the NL group were more hyperopic than those in the AL group (F=5.726, P=0.032). Furthermore, the two eyes of most NL monkeys remained isometropic, whereas 3 of 4 AL monkeys developed myopic anisometropia more than -2.0D. At adolescence, eyes of AL monkeys showed significant myopic anisometropia compared with eyes of NL monkeys (AL vs NL: -1.66±0.87D vs -0.22±0.44D; P=0.002) and controls (AL vs Control: -1.66±0.87D vs -0.05±0.85D; Pexposure to natural outdoor light might have an effect to reduced hyperopic defocus-induced myopia. Also, the data imply that early life exposure to sunlight may

  19. Platelet-Derived Short-Chain Polyphosphates Enhance the Inactivation of Tissue Factor Pathway Inhibitor by Activated Coagulation Factor XI

    Science.gov (United States)

    Puy, Cristina; Tucker, Erik I.; Ivanov, Ivan S.; Gailani, David; Smith, Stephanie A.; Morrissey, James H.; Gruber, András; McCarty, Owen J. T.

    2016-01-01

    Introduction Factor (F) XI supports both normal human hemostasis and pathological thrombosis. Activated FXI (FXIa) promotes thrombin generation by enzymatic activation of FXI, FIX, FX, and FV, and inactivation of alpha tissue factor pathway inhibitor (TFPIα), in vitro. Some of these reactions are now known to be enhanced by short-chain polyphosphates (SCP) derived from activated platelets. These SCPs act as a cofactor for the activation of FXI and FV by thrombin and FXIa, respectively. Since SCPs have been shown to inhibit the anticoagulant function of TFPIα, we herein investigated whether SCPs could serve as cofactors for the proteolytic inactivation of TFPIα by FXIa, further promoting the efficiency of the extrinsic pathway of coagulation to generate thrombin. Methods and Results Purified soluble SCP was prepared by size-fractionation of sodium polyphosphate. TFPIα proteolysis was analyzed by western blot. TFPIα activity was measured as inhibition of FX activation and activity in coagulation and chromogenic assays. SCPs significantly accelerated the rate of inactivation of TFPIα by FXIa in both purified systems and in recalcified plasma. Moreover, platelet-derived SCP accelerated the rate of inactivation of platelet-derived TFPIα by FXIa. TFPIα activity was not affected by SCP in recalcified FXI-depleted plasma. Conclusions Our data suggest that SCP is a cofactor for TFPIα inactivation by FXIa, thus, expanding the range of hemostatic FXIa substrates that may be affected by the cofactor functions of platelet-derived SCP. PMID:27764259

  20. Effects of metastable species in helium and argon atmospheric pressure plasma jets (APPJs) on inactivation of periodontopathogenic bacteria

    Science.gov (United States)

    Yoon, Sung-Young; Kim, Kyoung-Hwa; Seol, Yang-Jo; Kim, Su-Jeong; Bae, Byeongjun; Huh, Sung-Ryul; Kim, Gon-Ho

    2016-05-01

    The helium and argon have been widely used as discharge gases in atmospheric pressure plasma jets (APPJs) for bacteria inactivation. The APPJs show apparent different in bullet propagation speed and bacteria inactivation rate apparently vary with discharge gas species. This work shows that these two distinctive features of APPJs can be linked through one factor, the metastable energy level. The effects of helium and argon metastable species on APPJ discharge mechanism for reactive oxygen nitrogen species (RONS) generation in APPJs are investigated by experiments and numerical estimation. The discharge mechanism is investigated by using the bullet velocity from the electric field which is obtained with laser induced fluorescence (LIF) measurement. The measured electric field also applied on the estimation of RONS generation, as electron energy source term in numerical particle reaction. The estimated RONS number is verified by comparing NO and OH densities to the inactivation rate of periodontitis bacteria. The characteristic time for bacteria inactivation of the helium-APPJ was found to be 1.63 min., which is significantly less than that of the argon-APPJ, 12.1 min. In argon-APPJ, the argon metastable preserve the energy due to the lack of the Penning ionization. Thus the surface temperature increase is significantly higher than helium-APPJ case. It implies that the metastable energy plays important role in both of APPJ bullet propagation and bacteria inactivation mechanism.

  1. Estimating the non-thermal inactivation of Listeria monocytogenes in fermented sausages relative to temperature, pH and water activity.

    Science.gov (United States)

    Mataragas, M; Rantsioua, K; Alessandria, V; Cocolin, L

    2015-02-01

    Data relative to in situ Listeria monocytogenes inactivation in fermented sausages were collected from 13 individual studies found in the literature. Inactivation rates were extrapolated and used to develop a predictive model to evaluate the relative effects of pH, water activity (a(w)) and temperature on L. monocytogenes fate during fermentation and ripening. Temperature explained ca. 60% of the data variability, while pH and a(w) only a small part. Temperature alone may not be sufficient to cause pathogen's inactivation, but inactivation rate is dominated by temperature when pH and a(w) are in the range which prevent L. monocytogenes growth. A predictive model based on two Arrhenius equations (ln[inactivation rate]=-25.71-[-0.6829 / (8.314 × T)] for fermentation; and ln[inactivation rate]=-44.86-[-1.219/(8.314 × T)] for ripening)was developed. The model can be used to quantify the effect of temperature and/or time changes on fermented sausage safety. The advantages and limitations of the model are discussed.

  2. Comparison of thermal inactivation kinetics of E. coli K12 in apple cider using conventional glass tubes, aluminum thermal-death-time disks, and a pilot-scale pasteurizer

    Science.gov (United States)

    To estimate thermal inactivation rates of microorganisms in food, heating apparatuses of bench-top scale such as glass tubes, capillary tubes, and aluminum disks have been developed and tested. However, little work has been done on comparing the thermal inactivation of microorganisms obtained by ben...

  3. Scale down of the inactivated polio vaccine production process

    NARCIS (Netherlands)

    Thomassen, Y.E.; Oever, van 't R.; Vinke, C.M.; Spiekstra, A.; Wijffels, R.H.; Pol, van der L.A.; Bakker, W.A.M.

    2013-01-01

    The anticipated increase in the demand for inactivated polio vaccines resulting from the success in the polio eradication program requires an increase in production capacity and cost price reduction of the current inactivated polio vaccine production processes. Improvement of existing production pro

  4. Scale down of the inactivated polio vaccine production process

    NARCIS (Netherlands)

    Thomassen, Y.E.; Oever, van 't R.; Vinke, C.M.; Spiekstra, A.; Wijffels, R.H.; Pol, van der L.A.; Bakker, W.A.M.

    2013-01-01

    The anticipated increase in the demand for inactivated polio vaccines resulting from the success in the polio eradication program requires an increase in production capacity and cost price reduction of the current inactivated polio vaccine production processes. Improvement of existing production pro

  5. Scale down of the inactivated polio vaccine production process

    NARCIS (Netherlands)

    Thomassen, Y.E.; Oever, van 't R.; Vinke, C.M.; Spiekstra, A.; Wijffels, R.H.; Pol, van der L.A.; Bakker, W.A.M.

    2013-01-01

    The anticipated increase in the demand for inactivated polio vaccines resulting from the success in the polio eradication program requires an increase in production capacity and cost price reduction of the current inactivated polio vaccine production processes. Improvement of existing production

  6. Differential effects of parietal and frontal inactivations on reaction times distributions in a visual search task

    Directory of Open Access Journals (Sweden)

    Claire eWardak

    2012-06-01

    Full Text Available The posterior parietal cortex participates to numerous cognitive functions, from perceptual to attentional and decisional processes. However, the same functions have also been attributed to the frontal cortex. We previously conducted a series of reversible inactivations of the lateral intraparietal area (LIP and of the frontal eye field (FEF in the monkey which showed impairments in covert visual search performance, characterized mainly by an increase in the mean reaction time (RT necessary to detect a contralesional target. Only subtle differences were observed between the inactivation effects in both areas. In particular, the magnitude of the deficit was dependant of search task difficulty for LIP, but not for FEF.In the present study, we re-examine these data in order to try to dissociate the specific involvement of these two regions, by considering the entire RT distribution instead of mean RT. We use the LATER model to help us interpret the effects of the inactivations with regard to information accumulation rate and decision processes. We show that: 1 different search strategies can be used by monkeys to perform visual search, either by processing the visual scene in parallel, or by combining parallel and serial processes; 2 LIP and FEF inactivations have very different effects on the RT distributions in the two monkeys. Although our results are not conclusive with regards to the exact functional mechanisms affected by the inactivations, the effects we observe on RT distributions could be accounted by an involvement of LIP in saliency representation or decision-making, and an involvement of FEF in attentional shifts and perception. Finally, we observe that the use of the LATER model is limited in the context of a visual search as it cannot fit all the behavioural strategies encountered. We propose that the diversity in search strategies observed in our monkeys also exists in individual human subjects and should be considered in future

  7. Inactivation of Coprinus cinereus peroxidase by 4-chloroaniline during turnover: comparison with horseradish peroxidase and bovine lactoperoxidase.

    Science.gov (United States)

    Chang, H C; Holland, R D; Bumpus, J A; Churchwell, M I; Doerge, D R

    1999-12-15

    The peroxidase from Coprinus cinereus (CPX) catalyzed oxidative oligomerization of 4-chloroaniline (4-CA) forming several products: N-(4-chlorophenyl)-benzoquinone monoamine (dimer D), 4,4'-dichloroazobenzene (dimer E); 2-(4-chloroanilino)-N-(4-chlorophenyl)-benzoquinone (trimer F); 2-amino-5-chlorobenzoquinone-di-4-chloroanil (trimer G); 2-(4-chloroanilino)-5-hydroxybenzoquinone-di-4-chloroanil (tetramer H) and 2-amino-5-(-4-chlroanilino)-benzoquinone-di-4-chloroanil (tetramer 1). In the presence of 4-CA and H2O2, CPX was irreversibly inactivated within 10 min. Inactivation of CPX in the presence of H2O2 was a time-dependent, first-order process when the concentration of 4-CA was varied between 0 and 2.5 mM. The apparent dissociation constant (Ki) for CPX and 4-CA was 0.71 mM. The pseudo-first order rate constant for inactivation (k(inact)), was 1.15 x 10(-2) s(-1). Covalent incorporation of 20 mole 14C-4-CA per mole of inactivated CPX was observed. The partition ratio was about 2200 when either 4-CA or H2O2 was used as the limiting substrate. These results show that 4-CA is a metabolically activated inactivator (i.e. a suicide substrate). Unmodified heme and hydroxymethyl heme were isolated from native, 4-CA-inactivated and H2O2-incubated CPX. Inactivation resulted in significant losses in both heme contents. Analysis of tryptic peptides from 4-CA-inactivated CPX by MALDI-TOF/ MS and UV-VIS spectrophotometry suggested that trimer G and tetramer H were the major 4-CA derivatives that were covalently bound, including to a peptide (MGDAGF-SPDEVVDLLAAHSLASQEGLNSAIFR) containing the heme binding site. These studies show that heme destruction and covalent modification of the polypeptide chain are both important for the inactivation of CPX. These results were compared with similar studies on 4-CA-inactivated horseradish peroxidase (HRP) and bovine lactoperoxidase (LPO) during the oxidation of 4-CA.

  8. Pulsed Discharge Effects on Bacteria Inactivation in Low-Pressure Radio-Frequency Oxygen Plasma

    Science.gov (United States)

    Vicoveanu, Dragos; Ohtsu, Yasunori; Fujita, Hiroharu

    2008-02-01

    The sporicidal effects of low-pressure radio frequency (RF) discharges in oxygen, produced by the application of continuous and pulsed RF power, were evaluated. For all cases, the survival curves showed a biphasic evolution. The maximum efficiency for bacteria sterilization was obtained when the RF power was injected in the continuous wave mode, while in the pulsed mode the lowest treatment temperature was ensured. The inactivation rates were calculated from the microorganism survival curves and their dependencies on the pulse characteristics (i.e., pulse frequency and duty cycle) were compared with those of the plasma parameters. The results indicated that the inactivation rate corresponding to the first phase of the survival curves is related to the time-averaged intensity of the light emission by the excited neutral atoms in the pulsed plasma, whereas the inactivation rate calculated from the second slope of the survival curves and the time-averaged plasma density have similar behaviors, when the pulse parameters were modified.

  9. New photocatalyst based on graphene oxide/chitin for degradation of dyes under sunlight.

    Science.gov (United States)

    Wang, Yuntao; Pei, Yaqiong; Xiong, Wenfei; Liu, Tingguo; Li, Jing; Liu, Shilin; Li, Bin

    2015-11-01

    Sunlight photocatalyst was fabricated by in situ synthesis of Cu2O in the regenerated chitin (RC)/graphene oxide (GO) composite film, where the porous chitin film was used as the microreactor for the formation of nano Cu2O. Nano Cu2O was immobilized and evenly distributed in the matrix and Cu2O tended to grow on the GO sheets. Cu2O inside the matrix excite and generate free photoelectrons and electron holes, which was responsible for the degradation of dyes, while GO transferred the yielded photoelectrons to prevent the generation of local high potential zone and induce the chain degradation at more points. So it was found that the porous chitin film could load Cu2O and graphene at the same time, controlling the size of Cu2O and leading to easy recycle and reuse of the photocatalyst. Moreover, the introduction of GO has dramatically improved the photocatalytic activity of Cu2O in the Cu2O/GO/RC film, showing great potential application in wastewater treatment utilizing solar energy.

  10. Mycorrhiza symbiosis increases the surface for sunlight capture in Medicago truncatula for better photosynthetic production.

    Directory of Open Access Journals (Sweden)

    Lisa Adolfsson

    Full Text Available Arbuscular mycorrhizal (AM fungi play a prominent role in plant nutrition by supplying mineral nutrients, particularly inorganic phosphate (Pi, and also constitute an important carbon sink. AM stimulates plant growth and development, but the underlying mechanisms are not well understood. In this study, Medicago truncatula plants were grown with Rhizophagus irregularis BEG141 inoculum (AM, mock inoculum (control or with P(i fertilization. We hypothesized that AM stimulates plant growth through either modifications of leaf anatomy or photosynthetic activity per leaf area. We investigated whether these effects are shared with P(i fertilization, and also assessed the relationship between levels of AM colonization and these effects. We found that increased P(i supply by either mycorrhization or fertilization led to improved shoot growth associated with increased nitrogen uptake and carbon assimilation. Both mycorrhized and P(i-fertilized plants had more and longer branches with larger and thicker leaves than the control plants, resulting in an increased photosynthetically active area. AM-specific effects were earlier appearance of the first growth axes and increased number of chloroplasts per cell section, since they were not induced by P(i fertilization. Photosynthetic activity per leaf area remained the same regardless of type of treatment. In conclusion, the increase in growth of mycorrhized and P(i-fertilized Medicago truncatula plants is linked to an increase in the surface for sunlight capture, hence increasing their photosynthetic production, rather than to an increase in the photosynthetic activity per leaf area.

  11. Effect of preadmission sunlight exposure on intensive care unit-acquired delirium: a multicenter study.

    Science.gov (United States)

    Simons, Koen S; Workum, Jessica D; Slooter, Arjen J C; van den Boogaard, Mark; van der Hoeven, Johannes G; Pickkers, Peter

    2014-04-01

    It is assumed that there is a relation between light exposure and delirium incidence. The aim of our study was to determine the effect of prehospital light exposure on the incidence of intensive care unit (ICU)-acquired delirium. Data from 3 ICUs in the Netherlands were analyzed retrospectively. Delirium was assessed with the Confusion Assessment Method for the ICU. Daily light intensity data were obtained from meteorological stations in the vicinity of the 3 hospitals. The association between light intensity and delirium incidence was analyzed using logistic regression analysis adjusting for known covariates for delirium. Data of 3198 patients, aged (mean ± SD) 61.9 ± 15.3 years with Acute Physiology and Chronic Health Evaluation II score 16.4 ± 6.6 were analyzed. Delirium incidence was 31.2% and did not vary significantly throughout the year. Twenty-eight-day preadmission photoperiod was highest in spring and lowest in winter; however, no association between light exposure and delirium incidence was found (odds ratio, 1.00; 95% confidence interval, 0.99-1.00; P = 0.72). Furthermore, delirium was significantly associated with age, infection, use of sedatives, Acute Physiology and Chronic Health Evaluation II score, and diagnosis of neurological disease or trauma. The incidence of delirium does not differ per season and prior sunlight exposure does not play a role of importance in the development of ICU-acquired delirium. Copyright © 2014 Elsevier Inc. All rights reserved.

  12. First field-based atmospheric observation of the reduction of reactive mercury driven by sunlight

    Science.gov (United States)

    de Foy, Benjamin; Tong, Yindong; Yin, Xiufeng; Zhang, Wei; Kang, Shichang; Zhang, Qianggong; Zhang, Guoshuai; Wang, Xuejun; Schauer, James J.

    2016-06-01

    Hourly speciated measurements of atmospheric mercury made in a remote, high-altitude site in the Tibetan Plateau revealed the first field observations of the reduction of reactive mercury in the presence of sunlight in the atmosphere. Measurements were collected over four winter months on the shore of Nam Co Lake in the inland Tibetan Plateau. The data was analyzed to identify sources and atmospheric transformations of the speciated mercury compounds. The absence of local anthropogenic sources provided a unique opportunity to examine chemical transformations of mercury. An optimization algorithm was used to determine the parameters of a chemical box model that would match the measured reactive mercury concentrations. This required the presence of a photolytic reduction reaction previously observed in laboratory studies and in power plant plumes. In addition, the model estimated the role of vertical mixing in diluting reactive gaseous mercury during the day, and the role of bromine chemistry in oxidizing gaseous elemental mercury to produce reactive gaseous mercury. This work provides further evidence of the need to add the photolytic reduction reaction of oxidized mercury into atmospheric transport models in order to better simulate mercury deposition.

  13. On identifying the specular reflection of sunlight in earth-monitoring satellite data.

    Energy Technology Data Exchange (ETDEWEB)

    Nelsen, James M., Jr.; Hohlfelder, Robert James; Jackson, Dale Clayton; Longenbaugh, Randolph S.

    2009-03-01

    Among the background signals commonly seen by Earth-monitoring satellites is the specular reflection of sunlight off of Earth's surface, commonly referred to as a glint. This phenomenon, involving liquid or ice surfaces, can result in the brief, intense illumination of satellite sensors appearing from the satellite perspective to be of terrestrial origin. These glints are important background signals to be able to identify with confidence, particularly in the context of analyzing data from satellites monitoring for transient surface or atmospheric events. Here we describe methods for identifying glints based on the physical processes involved in their production, including spectral fitting and polarization measurements. We then describe a tool that, using the WGS84 spheroidal Earth model, finds the latitude and longitude on Earth where a reflection of this type could be produced, given input Sun and satellite coordinates. This tool enables the user to determine if the surface at the solution latitude and longitude is in fact reflective, thus identifying the sensor response as a true glint or an event requiring further analysis.

  14. Sunlight activated lanthanide complex for luminescent solar collector applications: effect of waveguide matrix

    Science.gov (United States)

    Shahi, Praveen Kumar; Singh, Priyam; Bahadur Rai, Shyam

    2017-02-01

    The performance of Eu(DBM)3Phen complex (EDP) dispersed in PMMA poly-(methyl methacrylate) polymer matrix, as simple planner luminescent solar collectors (LSCs) is demonstrated using spectroscopic and photovoltaic (PV) measurements. The organic ligands absorb ultra-violet-blue (UV-blue) radiation (220–450 nm) very efficiently and transfer its energy to the Eu3+ ion, which gives an intense red emission even in sunlight exposure. The excellent optical properties of EDP in PMMA permit its coating on the front surface of c-Si solar cell (10  ×  10 cm2) for PV measurements. The PV characterizations reveal the improvement in the short circuit current density (J sc) of PV cell and maximum improvement is found to be 4.6% for 2.5 wt% EDP concentration in PMMA matrix. The efficiency of solar cell increases from 17.22% to 18.33% for bare and 2.5% EDP in PMMA. At a higher concentration of EDP, the thin film starts losing its transparency and hence PV efficiency decreases. These results illustrate that a EDP complex combined with a PV cell could work as a prototype of a new generation solar cell.

  15. Degradation of triclosan in the presence of p-aminobenzoic acid under simulated sunlight irradiation.

    Science.gov (United States)

    Zhai, Pingping; Chen, Xuan; Dong, Wenbo; Li, Hongjing; Chovelon, Jean-Marc

    2017-01-01

    This study aimed to investigate the degradation of triclosan (TCS) in the presence of p-aminobenzoic acid (PABA) under simulated sunlight irradiation (λ ≥ 290 nm). The effect of PABA concentration, pH, dissolved organic matter (DOM), and DOM-hydrolytic Fe(III) species complexes on the photodegradation of TCS in the presence of PABA (TCS-PABA) was also studied. The photolysis of TCS-PABA obeyed pseudo-first-order kinetics well, and the degradation of TCS-PABA enhanced with increasing solution pH (from 3.0 to 11.0). The presence of PABA inhibited the degradation of TCS-PABA, and the weakest inhibitory effect was observed while the concentration of PABA was 5 mg L(-1). The addition of DOM (Suwannee River fulvic acid standard I [SRFA], Suwannee River HA standard II [SRHA], and Suwannee River natural organic matter [SRNOM]) showed different inhibition effects on TCS-PABA degradation. However, higher Fe(III) concentration at the DOM concentration of 5 mg L(-1) could favor the formation of DOM-hydrolytic Fe(III) species complexes, further accelerating the degradation of TCS-PABA. In comparison with deionized water (DI water), TCS-PABA could be better photodegraded in river water nearby the effluent of a wastewater treatment plant. This study provides useful information for understanding the natural behavior of TCS in the presence of other organic contaminants.

  16. Photodegradation of malachite green under natural sunlight irradiation: kinetic and toxicity of the transformation products.

    Science.gov (United States)

    Pérez-Estrada, L A; Agüera, A; Hernando, M D; Malato, S; Fernández-Alba, A R

    2008-02-01

    This article describes the photolytic degradation of malachite green (MG), a cationic triphenylmethane dye used worldwide as a fungicide and antiseptic in the aquaculture industry. Photolysis experiments were performed by direct exposure of a solution of MG in water to natural sunlight. The main transformation products (TPs) generated during the process were identified by liquid chromatography time-of-flight mass spectrometry (LC-TOF-MS) and gas chromatography mass spectrometry (GC-MS). The 28 TPs identified with this strategy indicate that MG undergoes three main reactions, N-demethylation, hydroxylation and cleavage of the conjugated structure forming benzophenone derivatives. These processes involve hydroxyl radical attack on the phenyl ring, the N,N-dimethylamine group and the central carbon atom. The Vibrio fischeri acute toxicity test showed that the solution remains toxic after MG has completely disappeared. This toxicity could be assigned, at least in part, to the formation of 4-(dimethylamine)benzophenone, which has an EC(50,30 min) of 0.061 mg l(-1), and is considered "very toxic to aquatic organisms" by current EU legislation.

  17. Sunlight-Driven Hydrogen Formation by Membrane-Supported Photoelectrochemical Water Splitting

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Nathan S. [California Institute of Technology

    2014-03-26

    This report describes the significant advances in the development of the polymer-supported photoelectrochemical water-splitting system that was proposed under DOE grant number DE-FG02-05ER15754. We developed Si microwire-array photoelectrodes, demonstrated control over the material and light-absorption properties of the microwire-array photoelectrodes, developed inexpensive processes for synthesizing the arrays, and doped the arrays p-type for use as photocathodes. We also developed techniques for depositing metal-nanoparticle catalysts of the hydrogen-evolution reaction (HER) on the wire arrays, investigated the stability and catalytic performance of the nanoparticles, and demonstrated that Ni-Mo alloys are promising earth-abundant catalysts of the HER. We also developed methods that allow reuse of the single-crystalline Si substrates used for microwire growth and methods of embedding the microwire photocathodes in plastic to enable large-scale processing and deployment of the technology. Furthermore we developed techniques for controlling the structure of WO3 films, and demonstrated that structural control can improve the quantum yield of photoanodes. Thus, by the conclusion of this project, we demonstrated significant advances in the development of all components of a sunlight-driven membrane-supported photoelectrochemical water-splitting system. This final report provides descriptions of some of the scientific accomplishments that were achieved under the support of this project and also provides references to the peer-reviewed publications that resulted from this effort.

  18. The sensitivity to polarization in stratospheric aerosol retrievals from limb scattered sunlight measurements

    Science.gov (United States)

    Elash, B. J.; Bourassa, A. E.; Rieger, L. A.; Dueck, S. R.; Zawada, D. J.; Degenstein, D. A.

    2017-03-01

    Satellite measurements of limb scattered sunlight at visible and near infrared wavelengths have been used successfully for several years to retrieve the vertical profile of stratospheric aerosol extinction coefficient. The existing satellite measurements are of the total radiance, with very little knowledge or impact of the polarization state of the limb radiance. Recently proposed instrument concepts for stratospheric aerosol profiling have been designed to measure the linearly polarized radiance. Yet, to date, the impact of the polarized measurement on the retrievals has not been systematically studied. Here we use a fully spherical, multiple scattering radiative transfer model to perform a sensitivity study on the effects of the polarized measurement on stratospheric aerosol extinction retrievals through specific investigations of the aerosol signal fraction in polarized measurements, potential retrieval bias, and achievable precision. In this study,we simulate both total and linearly polarized measurements, for a wide range of limb viewing geometries that are encountered in typical low earth orbits and for various aerosol loading scenarios. The orientation of the linear polarization with respect to the horizon is also studied. Taking into account instrument signal to noise levels it is found that in general, the linear polarization can be used as effectively as the total radiance measurement, with consideration of instrument signal to noise capabilities; however the horizontal polarization is more promising in terms of signal magnitude.

  19. Mycorrhiza symbiosis increases the surface for sunlight capture in Medicago truncatula for better photosynthetic production.

    Science.gov (United States)

    Adolfsson, Lisa; Solymosi, Katalin; Andersson, Mats X; Keresztes, Áron; Uddling, Johan; Schoefs, Benoît; Spetea, Cornelia

    2015-01-01

    Arbuscular mycorrhizal (AM) fungi play a prominent role in plant nutrition by supplying mineral nutrients, particularly inorganic phosphate (Pi), and also constitute an important carbon sink. AM stimulates plant growth and development, but the underlying mechanisms are not well understood. In this study, Medicago truncatula plants were grown with Rhizophagus irregularis BEG141 inoculum (AM), mock inoculum (control) or with P(i) fertilization. We hypothesized that AM stimulates plant growth through either modifications of leaf anatomy or photosynthetic activity per leaf area. We investigated whether these effects are shared with P(i) fertilization, and also assessed the relationship between levels of AM colonization and these effects. We found that increased P(i) supply by either mycorrhization or fertilization led to improved shoot growth associated with increased nitrogen uptake and carbon assimilation. Both mycorrhized and P(i)-fertilized plants had more and longer branches with larger and thicker leaves than the control plants, resulting in an increased photosynthetically active area. AM-specific effects were earlier appearance of the first growth axes and increased number of chloroplasts per cell section, since they were not induced by P(i) fertilization. Photosynthetic activity per leaf area remained the same regardless of type of treatment. In conclusion, the increase in growth of mycorrhized and P(i)-fertilized Medicago truncatula plants is linked to an increase in the surface for sunlight capture, hence increasing their photosynthetic production, rather than to an increase in the photosynthetic activity per leaf area.

  20. Sunlight and Vitamin D: The Bone and Cancer Connections (invited paper)

    Energy Technology Data Exchange (ETDEWEB)

    Holick, M.F

    2000-07-01

    Vitamin D plays an essential role for calcium metabolism and bone health. It has been estimated that 90 to 95% of our vitamin D requirement comes from casual exposure to sunlight. There is a wide variety of factors that strongly influence the cutaneous production of vitamin D. These include melanin pigmentation, latitude, time of day, sunscreen use, and aging. There is an association with increased risk and mortality to breast, colon, and prostrate cancer. There is evidence that 25-hydroxyvitamin D, the major circulating form of vitamin D, is directly metabolised in prostate, breast, colon, and skin cells to its active form 1,25-dihydroxyvitamin D. 1,25-Dihydroxyvitamin D{sub 3} has the capacity to regulate cell proliferation and differentiation. Therefore, it may be that an increase in the cutaneous synthesis of vitamin D results in the increase in the production of 1,25(OH){sub 2}D in tissues not related to calcium metabolism that results in a decrease in malignancy. (author)

  1. Nanostructured photosystems for the generation of electricity and fuels from sunlight

    Science.gov (United States)

    Grätzel, Michael

    2013-03-01

    Learning from the concepts used by green plants photosynthesis, we have developed nanostructured systems affording efficient solar light harvesting and conversion to electricity and fuels. Solar cells using dyes or semiconducting nanoparticles as light harvesters supported by mesoscopic oxide films have emerged as credible contenders to conventional p-n junction photovoltaic devices. Separating light absorption from charge carrier transport dye sensitized mesoscopic solar cells (DSCs) were the first to use a three-dimensional nanocrystalline junction for solar electricity production. The standard AM 1.5 solar to electric power conversion efficiency (PCE) has reached 12.9% for laboratory cells and 9.9% for PV modules. Even higher efficiencies are attained under ambient and indoor light conditions. These features along with excellent long-term stability have fostered first commercial applications, the industrial production of DSC's attaining presently the MW/year scale. Very exciting results have recently been obtained with perovskites and quantum dot particles as light harvesters in mesoscopic solar cells. Striking advances in the direct generation of fuels such as hydrogen from water and sunlight have been achieved by the judicious design of photosystems composed of nanostructured Fe2O3 or Cu2O films.

  2. Psychosocial aspects associated with use of sunscreen, natural sunlight exposure, and artificial tanning.

    Science.gov (United States)

    Ventenilla, Jessica; França, Katlein; Lotti, Torello; Keri, Jonette

    2017-02-08

    Natural and artificial tanning have become very popular in Western culture, yet at the same time, there is still a psychodermatology concern for this activity. Not much has been examined with the psychological aspects of tanning and sunscreen use. The purpose of this study is to examine the psychosocial effects associated with sun protection, natural, and artificial tanning among individuals 18 years old or older visiting the University of Miami Dermatology Outpatient Clinic. We distributed a survey on tanning and sunscreen use to 150 dermatology outpatients, hospital employees, and hospital visitors for three weeks during June/July 2015 asking about how often they tan, use sunscreen, and how they feel about this topic. Demographics, such as gender, ethnicity, and education were taken into consideration to examine the different responses in each category. Our results suggest that people's perception to tanning and sunscreen use have evolved over time. Most people in South Florida nowadays feel guilty when exposed to natural sunlight without sunscreen and do not tan frequently. The majority of the people, specifically women, utilize the recommended amount of sunscreen with a sun protection factor of 30-50. However, we can conclude that communication between social media and the general public can affect people's decision-making on tanning and sunscreen use with physician advice being the most effective method of encouraging people to use sunscreen. This study will add to the growing knowledge about psychodermatology.

  3. A comparative study on the pulsed UV and the low-pressure UV inactivation of a range of microbial species in water.

    Science.gov (United States)

    Garvey, Mary; Thokala, Nikhil; Rowan, Neil

    2014-12-01

    Research into alternative methods of disinfecting water and wastewater has proven necessary due to the emergence of chlorine-resistant organisms and the disinfection byproducts associated with chlorine use. The use of UV light to inactivate microbial species has proven effective, however; standard UV lamps have proven to be less effective in their ability to inactivate parasites and bacterial endospores in water treatment settings. Pulsed UV (PUV) light may potentially provide a novel alternative to water and wastewater disinfection. Research outlined in this study assesses the potential of a novel PUV system for the rapid and reproducible inactivation of a range of test species including Bacillus endospores. In comparison to standard low-pressure (LP) UV lamps, this PUV system provided significantly higher levels of inactivation for all test species. Furthermore, there was a remarkable decrease in time needed to obtain significant inactivation rates following treatment with PUV compared to LP-UV. With the PUV system, a 70-second treatment time (7.65 μJ/cm2) resulted in similar inactivation rates of Bacillus endospores to that of the LP-UV inactivation of their vegetative counterpart. Also, at PUV doses exceeding 4.32 J/cm2, there was not a significant difference in the PUV inactivation of Bacillus endospores in the absence or presence of 10 ppm organic matter. However, the presence of organic matter resulted in a significant reduction in microbial inactivation for all treatment doses using the LP-UV system. The findings of this study suggest that PUV technology may provide a rapid effective method for the disinfection of water and wastewater.

  4. Chlorophyll mediated photodynamic inactivation of blue laser on Streptococcus mutans

    Science.gov (United States)

    Astuti, Suryani Dyah; Zaidan, A.; Setiawati, Ernie Maduratna; Suhariningsih

    2016-03-01

    Photodynamic inactivation is an inactivation method in microbial pathogens that utilize light and photosensitizer. This study was conducted to investigate photodynamic inactivation effects of low intensity laser exposure with various dose energy on Streptococcus mutans bacteria. The photodynamic inactivation was achieved with the addition of chlorophyll as photosensitizers. To determine the survival percentage of Streptococcus mutans bacteria after laser exposure, the total plate count method was used. For this study, the wavelength of the laser is 405 nm and variables of energy doses are 1.44, 2.87, 4.31, 5.74, 7.18, and 8.61 in J/cm2. The results show that exposure to laser with energy dose of 7.18 J/cm2 has the best photodynamic inactivation with a decrease of 78% in Streptococcus

  5. Pathogen Inactivation of red cells: challenges and opportunities

    Institute of Scientific and Technical Information of China (English)

    Stephen J. Wagner

    2006-01-01

    @@ Introduction Virus inactivation methods for blood have been explored as a means to further reduce the risk from tested agents and to decrease the risk of emerging or variant agents for whom no deferral or effective screening methods are available. Although inactivation methods promise to reduce transfusion-related infectious disease risk, these methods are not perfect. Most techniques for pathogen reduction will not kill bacterial spores, or inactivate bacterial endotoxin, prion protein, or certain non-enveloped viruses whose tightly packed capsid proteins prevent access of the virucidal agent to its nucleic acid target. In addition,various inactivation methods have been known to decrease blood cell yield, affect blood cell recovery or survival, and may pose risk to recipients or blood center workers. My presentation today will review two methods for pathogen inactivation of red cells.

  6. Inactivation of Chikungunya virus by 1,5 iodonapthyl azide

    Directory of Open Access Journals (Sweden)

    Sharma Anuj

    2012-12-01

    Full Text Available Abstract Background Chikungunya virus (CHIKV is an arthropod borne alphavirus of the family Togaviridae. CHIKV is a reemerging virus for which there is no safe prophylactic vaccine. A live attenuated strain of CHIKV, CHIK181/25, was previously demonstrated to be highly immunogenic in humans, however, it showed residual virulence causing transient arthralgia. Findings In this study, we demonstrate the complete inactivation of CHIKV181/25 by 1,5 iodonapthyl azide (INA. No cytopathic effect and virus replication was observed in cells infected with the INA-inactivated CHIKV. However, a reduction in the INA-inactivated CHIK virus-antibody binding capacity was observed by western blot analysis. Conclusion INA completely inactivated CHIKV and can further be explored for developing an inactivated-CHIKV vaccine.

  7. Strong purifying selection at genes escaping X chromosome inactivation.

    Science.gov (United States)

    Park, Chungoo; Carrel, Laura; Makova, Kateryna D

    2010-11-01

    To achieve dosage balance of X-linked genes between mammalian males and females, one female X chromosome becomes inactivated. However, approximately 15% of genes on this inactivated chromosome escape X chromosome inactivation (XCI). Here, using a chromosome-wide analysis of primate X-linked orthologs, we test a hypothesis that such genes evolve under a unique selective pressure. We find that escape genes are subject to stronger purifying selection than inactivated genes and that positive selection does not significantly affect the evolution of these genes. The strength of selection does not differ between escape genes with similar versus different expression levels in males versus females. Intriguingly, escape genes possessing Y homologs evolve under the strongest purifying selection. We also found evidence of stronger conservation in gene expression levels in escape than inactivated genes. We hypothesize that divergence in function and expression between X and Y gametologs is driving such strong purifying selection for escape genes.

  8. UV inactivation of pathogenic and indicator microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Chang, J.C.; Ossoff, S.F.; Lobe, D.C.; Dorfman, M.H.; Dumais, C.M.; Qualls, R.G.; Johnson, J.D.

    1985-06-01

    Survival was measured as a function of the dose of germicidal UV light for the bacteria Escherichia coli, Salmonella typhi, Shigella sonnei, Streptococcus faecalis, Staphylococcus aureus, and Bacillus subtilis spores, the enteric viruses poliovirus type 1 and simian rotavirus SA11, the cysts of the protozoan Acanthamoeba castellanii, as well as for total coliforms and standard plate count microorganisms from secondary effluent. The doses of UV light necessary for a 99.9% inactivation of the cultured vegetative bacteria, total coliforms, and standard plate count microorganisms were comparable. However, the viruses, the bacterial spores, and the amoebic cysts required about 3 to 4 times, 9 times, and 15 times, respectively, the dose required for E. coli. These ratios covered a narrower relative dose range than that previously reported for chlorine disinfection of E. coli, viruses, spores, and cysts.

  9. Inactivation of microbes using ultrasound: a review.

    Science.gov (United States)

    Piyasena, P; Mohareb, E; McKellar, R C

    2003-11-01

    Alternative methods for pasteurization and sterilization are gaining importance, due to increased consumer demand for new methods of food processing that have a reduced impact on nutritional content and overall food quality. Ultrasound processing or sonication is one of the alternative technologies that has shown promise in the food industry. Sonication alone is not very effective in killing bacteria in food; however, the use of ultrasound coupled with pressure and/or heat is promising. Thermosonic (heat plus sonication), manosonic (pressure plus sonication), and manothermosonic (heat and pressure plus sonication) treatments are likely the best methods to inactivate microbes, as they are more energy-efficient and effective in killing microorganisms. Ultrasonic processing is still in its infancy and requires a great deal of future research in order to develop the technology on an industrial scale, and to more fully elucidate the effect of ultrasound on the properties of foods.

  10. Esterase resistant to inactivation by heavy metals

    KAUST Repository

    El, Dorry Hamza

    2014-09-25

    EstATII is an esterase that a halotolerant, thermophilic and resistant to a spectrum of heavy metals including toxic concentration of metals. It was isolated from the lowest convective layer of the Atlantis II Red Sea brine pool. The Atlantis II brine pool is an extreme environment that possesses multiple harsh conditions such as; high temperature, salinity, pH and high concentration of metals, including toxic heavy metals. A fosmid metagenomic library using DNA isolated from the lowest convective layer this pool was used to identify EstATII. Polynucleotides encoding EstATII and similar esterases are disclosed and can be used to make EstATII. EstATII or compositions or apparatuses that contain it may be used in various processes employing lipases/esterases especially when these processes are performed under harsh conditions that inactivate other kinds of lipases or esterases.

  11. Ion channels to inactivate neurons in Drosophila

    Directory of Open Access Journals (Sweden)

    James J L Hodge

    2009-08-01

    Full Text Available Ion channels are the determinants of excitability; therefore, manipulation of their levels and properties provides an opportunity for the investigator to modulate neuronal and circuit function. There are a number of ways to suppress electrical activity in Drosophila neurons, for instance, over-expression of potassium channels (i.e. Shaker Kv1, Shaw Kv3, Kir2.1 and DORK that are open at resting membrane potential. This will result in increased potassium efflux and membrane hyperpolarisation setting resting membrane potential below the threshold required to fire action potentials. Alternatively over-expression of other channels, pumps or co-transporters that result in a hyperpolarised membrane potential will also prevent firing. Lastly, neurons can be inactivated by, disrupting or reducing the level of functional voltage-gated sodium (Nav1 paralytic or calcium (Cav2 cacophony channels that mediate the depolarisation phase of action potentials. Similarly, strategies involving the opposite channel manipulation should allow net depolarisation and hyperexcitation in a given neuron. These changes in ion channel expression can be brought about by the versatile transgenic (i.e. Gal4/UAS based systems available in Drosophila allowing fine temporal and spatial control of (channel transgene expression. These systems are making it possible to electrically inactivate (or hyperexcite any neuron or neural circuit in the fly brain, and much like an exquisite lesion experiment, potentially elucidate whatever interesting behaviour or phenotype each network mediates. These techniques are now being used in Drosophila to reprogram electrical activity of well-defined circuits and bring about robust and easily quantifiable changes in behaviour, allowing different models and hypotheses to be rapidly tested.

  12. Human male meiotic sex chromosome inactivation.

    Science.gov (United States)

    de Vries, Marieke; Vosters, Sanne; Merkx, Gerard; D'Hauwers, Kathleen; Wansink, Derick G; Ramos, Liliana; de Boer, Peter

    2012-01-01

    In mammalian male gametogenesis the sex chromosomes are distinctive in both gene activity and epigenetic strategy. At first meiotic prophase the heteromorphic X and Y chromosomes are placed in a separate chromatin domain called the XY body. In this process, X,Y chromatin becomes highly phosphorylated at S139 of H2AX leading to the repression of gonosomal genes, a process known as meiotic sex chromosome inactivation (MSCI), which has been studied best in mice. Post-meiotically this repression is largely maintained. Disturbance of MSCI in mice leads to harmful X,Y gene expression, eventuating in spermatocyte death and sperm heterogeneity. Sperm heterogeneity is a characteristic of the human male. For this reason we were interested in the efficiency of MSCI in human primary spermatocytes. We investigated MSCI in pachytene spermatocytes of seven probands: four infertile men and three fertile controls, using direct and indirect in situ methods. A considerable degree of variation in the degree of MSCI was detected, both between and within probands. Moreover, in post-meiotic stages this variation was observed as well, indicating survival of spermatocytes with incompletely inactivated sex chromosomes. Furthermore, we investigated the presence of H3K9me3 posttranslational modifications on the X and Y chromatin. Contrary to constitutive centromeric heterochromatin, this heterochromatin marker did not specifically accumulate on the XY body, with the exception of the heterochromatic part of the Y chromosome. This may reflect the lower degree of MSCI in man compared to mouse. These results point at relaxation of MSCI, which can be explained by genetic changes in sex chromosome composition during evolution and candidates as a mechanism behind human sperm heterogeneity.

  13. Human male meiotic sex chromosome inactivation.

    Directory of Open Access Journals (Sweden)

    Marieke de Vries

    Full Text Available In mammalian male gametogenesis the sex chromosomes are distinctive in both gene activity and epigenetic strategy. At first meiotic prophase the heteromorphic X and Y chromosomes are placed in a separate chromatin domain called the XY body. In this process, X,Y chromatin becomes highly phosphorylated at S139 of H2AX leading to the repression of gonosomal genes, a process known as meiotic sex chromosome inactivation (MSCI, which has been studied best in mice. Post-meiotically this repression is largely maintained. Disturbance of MSCI in mice leads to harmful X,Y gene expression, eventuating in spermatocyte death and sperm heterogeneity. Sperm heterogeneity is a characteristic of the human male. For this reason we were interested in the efficiency of MSCI in human primary spermatocytes. We investigated MSCI in pachytene spermatocytes of seven probands: four infertile men and three fertile controls, using direct and indirect in situ methods. A considerable degree of variation in the degree of MSCI was detected, both between and within probands. Moreover, in post-meiotic stages this variation was observed as well, indicating survival of spermatocytes with incompletely inactivated sex chromosomes. Furthermore, we investigated the presence of H3K9me3 posttranslational modifications on the X and Y chromatin. Contrary to constitutive centromeric heterochromatin, this heterochromatin marker did not specifically accumulate on the XY body, with the exception of the heterochromatic part of the Y chromosome. This may reflect the lower degree of MSCI in man compared to mouse. These results point at relaxation of MSCI, which can be explained by genetic changes in sex chromosome composition during evolution and candidates as a mechanism behind human sperm heterogeneity.

  14. Pressure-Inactivated Virus: A Promising Alternative for Vaccine Production.

    Science.gov (United States)

    Silva, Jerson L; Barroso, Shana P C; Mendes, Ygara S; Dumard, Carlos H; Santos, Patricia S; Gomes, Andre M O; Oliveira, Andréa C

    2015-01-01

    In recent years, many applications in diverse scientific fields with various purposes have examined pressure as a thermodynamic parameter. Pressure studies on viruses have direct biotechnological applications. Currently, most studies that involve viral inactivation by HHP are found in the area of food engineering and focus on the inactivation of foodborne viruses. Nevertheless, studies of viral inactivation for other purposes have also been conducted. HHP has been shown to be efficient in the inactivation of many viruses of clinical importance and the use of HHP approach has been proposed for the development of animal and human vaccines. Several studies have demonstrated that pressure can result in virus inactivation while preserving immunogenic properties. Viruses contain several components that can be susceptible to the effects of pressure. HHP has been a valuable tool for assessing viral structure function relationships because the viral structure is highly dependent on protein-protein interactions. In the case of small icosahedral viruses, incremental increases in pressure produce a progressive decrease in the folding structure when moving from assembled capsids to ribonucleoprotein intermediates (in RNA viruses), free dissociated units (dimers and/or monomers) and denatured monomers. High pressure inactivates enveloped viruses by trapping their particles in a fusion-like intermediate state. The fusogenic state, which is characterized by a smaller viral volume, is the final conformation promoted by HHP, in contrast with the metastable native state, which is characterized by a larger volume. The combined effects of high pressure with other factors, such as low or subzero temperature, pH and agents in sub-denaturing conditions (urea), have been a formidable tool in the assessment of the component's structure, as well as pathogen inactivation. HHP is a technology for the production of inactivated vaccines that are free of chemicals, safe and capable of inducing

  15. Kinetic modelling of enzyme inactivation Kinetics of heat inactivation of the extracellular proteinase from Pseudomonas fluorescens 22F.

    NARCIS (Netherlands)

    Schokker, E.P.

    1997-01-01

    The kinetics of heat inactivation of the extracellular proteinase from Pseudomonas fluorescens 22F was studied. It was established, by making use of kinetic modelling, that heat inactivation in the temperature range 35 - 70 °C was most likely caused by intermolecular autoproteolysis, where unfolded

  16. Assessment of the Effects of Various UV Sources on Inactivation and Photoproduct Induction in Phage T7 Dosimeter

    NARCIS (Netherlands)

    Fekete, A.; Vink, A.A.; Gaspar, S.; Berces, A.; Modos, K.; Ronto, Gy.; Roza, L.

    1998-01-01

    The correlation between the biologically effective dose (BED) of a phage T7 biological dosimeter and the induction of cyclobutane pyrimidine dimers (CPD) and (6-4) photoproducts ((6-4)PD) in the phage DNA was determined using seven various UV sources. The BED is the inactivation rate of phage T7 exp

  17. Hepatic steroid inactivating enzymes, hepatic portal blood flow, and corpus luteum blood perfusion in lactating dairy cattle

    Science.gov (United States)

    In ruminants, a decrease in pregnancy rates may be due to decreased concentrations of progesterone (P4). It is important to note that both production from the corpus luteum and/or hepatic steroid inactivation impacts peripheral concentrations of P4. Cattle with an elevated dry matter intake have inc...

  18. Data analysis of the inactivation of foodborne microorganisms under high hydrostatic pressure to establish global kinetic parameters and influencing factors

    NARCIS (Netherlands)

    Santillana Farakos, S.M.; Zwietering, M.H.

    2011-01-01

    The inactivation rate of foodborne microorganisms under high hydrostatic pressure (HHP) is influenced by factors such as substrate, species, strain, temperature, pH, and stage of growth of the cell. In this study, 445 DP-values from previously published data were analyzed, including those from bacte

  19. Some aspects of the mechanism of bacteriophage function. Final progress report. [Mechanisms of inactivation of bacteriophages by ionizing radiation

    Energy Technology Data Exchange (ETDEWEB)

    Freifelder, D.

    1977-06-12

    Data are summarized from a ten-year study on the radiobiology of phages. The results showed that: phages are inactivated principally by damage to DNA; DNA damage is of two types, base damage and double-strand breakage; double-strand breakage may be lethal because of interruption within a gene, however in phage systems the damage is more fundamental in that only a single DNA fragment is injected into the host; E. coli phage T4 is relatively resistant to inactivation by x-rays; and the rate of production of strand breaks and base damage is nearly the same in bacteriophage and bacteria.

  20. Plant uptake-assisted round-the-clock photocatalysis for complete purification of aquaculture wastewater using sunlight.

    Science.gov (United States)

    Bian, Zhenfeng; Cao, Fenglei; Zhu, Jian; Li, Hexing

    2015-02-17

    A novel reactor equipped with solar batteries, Bi2O3/TiO2 film photocatalyst, and celery plant was designed and used for purification of aquaculture wastewater. The Bi2O3/TiO2 film photocatalyst started photocatalytic degradation of organonitrogen compounds under irradiation of sunlight. Meanwhile, the solar batteries absorbed and converted excess sunlight into electric energy and then started UV lamps at night, leading to round-the-clock photocatalysis. Subsequently, the inorganic nitrogen species including NH4(+), NO2(-), and NO3(-) resulting from photocatalytic degradation of the organonitrogen compounds could subsequently be uptaken by the celery plant as the fertilizer to reduce the secondary pollution. It was found that, after 24 h circulation, both organonitrogen compounds and NO2(-) species were completely removed, while NH4(+) and NO3(-) contents also decreased by 30% and 50%, respectively. The reactor could be used repetitively, showing a good potential in practical application.

  1. Development of an algorithm to predict serum vitamin D levels using a simple questionnaire based on sunlight exposure.

    Science.gov (United States)

    Vignali, Edda; Macchia, Enrico; Cetani, Filomena; Reggiardo, Giorgio; Cianferotti, Luisella; Saponaro, Federica; Marcocci, Claudio

    2017-01-01

    Sun exposure is the main determinant of vitamin D production. The aim of this study was to develop an algorithm to assess individual vitamin D status, independently of serum 25(OHD) measurement, using a simple questionnaire, mostly relying upon sunlight exposure, which might help select subjects requiring serum 25(OHD) measurement. Six hundred and twenty adult subjects living in a mountain village in Southern Italy, located at 954 m above the sea level and at a latitude of 40°50'11″76N, were asked to fill the questionnaire in two different periods of the year: August 2010 and March 2011. Seven predictors were considered: month of investigation, age, sex, BMI, average daily sunlight exposure, beach holidays in the past 12 months, and frequency of going outdoors. The statistical model assumes four classes of serum 25(OHD) concentrations: ≤10, 10-19.9, 20-29.9, and ≥30 ng/ml. The algorithm was developed using a two-step procedure. In Step 1, the linear regression equation was defined in 385 randomly selected subjects. In Step 2, the predictive ability of the regression model was tested in the remaining 235 subjects. Seasonality, daily sunlight exposure and beach holidays in the past 12 months accounted for 27.9, 13.5, and 6.4 % of the explained variance in predicting vitamin D status, respectively. The algorithm performed extremely well: 212 of 235 (90.2 %) subjects were assigned to the correct vitamin D status. In conclusion, our pilot study demonstrates that an algorithm to estimate the vitamin D status can be developed using a simple questionnaire based on sunlight exposure.

  2. Sunlight exposure and cutaneous human papillomavirus seroreactivity in basal cell and squamous cell carcinomas of the skin.

    Science.gov (United States)

    Iannacone, Michelle R; Wang, Wei; Stockwell, Heather G; O'Rourke, Kathleen; Giuliano, Anna R; Sondak, Vernon K; Messina, Jane L; Roetzheim, Richard G; Cherpelis, Basil S; Fenske, Neil A; Michael, Kristina M; Waterboer, Tim; Pawlita, Michael; Rollison, Dana E

    2012-08-01

    Ultraviolet radiation exposure may interact synergistically with cutaneous human papillomavirus (HPV) infection in the development of basal cell carcinoma (BCC) and squamous cell carcinoma (SCC) of the skin. To investigate differences in the risk of sunlight-associated BCC and SCC by cutaneous genus-specific HPV serostatus, a case-control study was conducted among 204 BCC and 156 SCC cases who were recruited from a university dermatology clinic and 297 controls who had no history of cancer and screened negative for current skin cancer. Logistic regression was used to calculate odds ratios (ORs) and 95% confidence intervals (CIs) for the associations between measures of sunlight exposure and BCC/SCC, stratified by genus-specific HPV serostatus, with adjustment for age and sex. Sunburn due to cutaneous sensitivity to sunlight exposure (P = .006) and poor tanning ability (P = .003) were associated with a higher seroprevalence for genus beta HPV types. Poor or no tanning ability was more strongly associated with SCC among individuals who were seropositive for antibodies to cutaneous HPV types in genera alpha (OR, 15.60; 95% CI, 5.40-45.1; P = .01 for interaction) and beta (OR, 6.86; 95% CI, 3.68-12.80; P = .001 for interaction), compared with individuals who were seronegative for these HPV types. Seropositivity for HPV types in genera alpha or beta increased the risk of SCC associated with poor tanning ability.

  3. Cellular and molecular mechanism of ofloxacin induced apoptotic cell death under ambient UV-A and sunlight exposure.

    Science.gov (United States)

    Dwivedi, A; Mujtaba, S F; Yadav, N; Kushwaha, H N; Amar, S K; Singh, S K; Pant, M C; Ray, R S

    2014-03-01

    Ofloxacin (OFLX) is a racemic mixture of levofloxacin which revealed phototoxicity in patients exposed with sunlight after medication. Here, we have been addressed the possible cellular and molecular mechanisms of OFLX induced apoptosis under ambient UV-A and sunlight exposure using HaCaT cell line as a model. The results showed that Photodegradation and three photo-products formation of OFLX by LC-MS/MS under ambient intensities of UV-A (1.5 and 2.2 mW/cm(2)) and sunlight. OFLX produced (1)O2, O2(.-), and OH radicals via type-II- and type-I-dependent reaction mechanism, which corroborated by its specific quenchers. 2'-dGua degradation in photochemical and % tail DNA formation in cell line using comet test advocated the genotoxic potential of OFLX. Photocytotoxic assays (MTT and NRU) revealed the considerable decline in cell viability by OFLX. OFLX triggered apoptosis, proved by cell cycle, Annexin V/PI double staining along with acridine orange (AO)/ethidium bromide (EB), and Hoechst staining as well as caspase-3 activity by colorimetric assay. OFLX induced lysosomal disruption and mitochondrial membrane destabilization confirmed through fluorescence staining with AO/JC-1. OFLX significantly upregulated the expression of p21 and bax genes. In conclusion, the study revealed that photosensitized OFLX induced apoptosis via ROS-mediated DNA damage, destabilization of lysosomal and mitochondrial membrane, and upregulation of p21, bax, and caspase-3 genes.

  4. Photocatalytic degradation of Orange G on nitrogen-doped TiO2 catalysts under visible light and sunlight irradiation.

    Science.gov (United States)

    Sun, Jianhui; Qiao, Liping; Sun, Shengpeng; Wang, Guoliang

    2008-06-30

    In this paper, the degradation of an azo dye Orange G (OG) on nitrogen-doped TiO2 photocatalysts has been investigated under visible light and sunlight irradiation. Under visible light irradiation, the doped TiO2 nanocatalysts demonstrated higher activity than the commercial Dugussa P25 TiO2, allowing more efficient utilization of solar light, while under sunlight, P25 showed higher photocatalytic activity. According to the X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV-vis spectra analyses, it was found that both the nanosized anatase structure and the appearance of new absorption band in the visible region caused by nitrogen doping were responsible for the significant enhancement of OG degradation under visible light. In addition, the photosensitized oxidation mechanism originated from OG itself was also considered contributing to the higher visible-light-induced degradation efficiency. The effect of the initial pH of the solution and the dosage of hydrogen peroxide under different light sources was also investigated. Under visible light and sunlight, the optimal solution pH was both 2.0, while the optimal dosage of H2O2 was 5.0 and 15.0 mmol/l, respectively.

  5. Decoloring Methyl Orange under Sunlight by a Photocatalytic Membrane Reactor Based on ZnO Nanoparticles and Polypropylene Macroporous Membrane

    Directory of Open Access Journals (Sweden)

    Bing Hu

    2013-01-01

    Full Text Available Decoloring methyl orange (MeOr under sunlight was conducted in a photocatalytic membrane reactor (PMR. Zinc oxide nanoparticles (ZnO NPs were suspended in the solution or immobilized on the membrane. The membrane was modified by grafting 2-hydroxyethyl methacrylate (HEMA to enhance the adsorption of ZnO NPs on the hydrophobic membrane surface and improve the membrane permeability. The results show that the water fluxes through the modified membranes are higher than that through the unmodified membrane. After introducing ZnO NPs to the membrane, the water fluxes still rise with the immobilization degree of ZnO NPs. For the PMR with ZnO NPs in suspension, the photocatalytic decoloration percent (PDP was over 98.2% after 40 min under sunlight. For the PMR with ZnO NPs immobilized on the membrane, the max of PDP was 74.3% after 6 h under sunlight, and maintained at 72% after repeated uses for five times. These results demonstrate that photocatalytic membrane reactor (PMR based on ZnO NPs and polypropylene macroporous membrane(PPMM could be applied in decoloring dyes.

  6. Kinetic Analysis of Guanidine Hydrochloride Inactivation of β-Galactosidase in the Presence of Galactose

    Directory of Open Access Journals (Sweden)

    Charles O. Nwamba

    2012-01-01

    Full Text Available Inactivation of purified β-Galactosidase was done with GdnHCl in the absence and presence of varying [galactose] at 50°C and at pH 4.5. Lineweaver-Burk plots of initial velocity data, in the presence and absence of guanidine hydrochloride (GdnHCl and galactose, were used to determine the relevant and max values, with p-nitrophenyl β-D-galactopyranoside (pNPG as substrate, S. Plots of ln([]∞−[] against time in the presence of GdnHCl yielded the inactivation rate constant, A. Plots of A versus [S] at different galactose concentrations were straight lines that became increasingly less steep as the [galactose] increased, showing that A was dependent on [S]. Slopes and intercepts of the 1/[]∞ versus 1/[] yielded +0 and ′+0, the microscopic rate constants for the free enzyme and the enzyme-substrate complex, respectively. Plots of +0 and ′+0 versus [galactose] showed that galactose protected the free enzyme as well as the enzyme-substrate complex (only at the lowest and highest [galactose] against GdnHCl inactivation. In the absence of galactose, GdnHCl exhibited some degree of non-competitive inhibition. In the presence of GdnHCl, galactose exhibited competitive inhibition at the lower [galactose] of 5 mM which changed to non-competitive as the [galactose] increased. The implications of our findings are further discussed.

  7. Virus-specific thermostability and heat inactivation profiles of alphaviruses.

    Science.gov (United States)

    Park, So Lee; Huang, Yan-Jang S; Hsu, Wei-Wen; Hettenbach, Susan M; Higgs, Stephen; Vanlandingham, Dana L

    2016-08-01

    Serological diagnosis is a critical component for disease surveillance and is important to address the increase in incidence and disease burden of alphaviruses, such as the chikungunya (CHIKV) and Ross River (RRV) viruses. The gold standard for serological diagnosis is the plaque reduction neutralization test (PRNT), which demonstrates the neutralizing capacity of serum samples after the removal of complement activity and adventitious viruses. This procedure is normally performed following inactivation of the virus at 56°C for 30min. Although this protocol has been widely accepted for the inactivation of envelope RNA viruses, recent studies have demonstrated that prolonged heat inactivation is required to completely inactivate two alphaviruses, Western equine encephalitis virus and CHIKV. Incomplete inactivation of viruses poses a laboratory biosafety risk and can also lead to spurious test results. Despite its importance in ensuring the safety of laboratory personnel as well as test integrity, systematic investigation on the thermostability of alphaviruses has not been performed. In this study, the temperature tolerance and heat inactivation profiles of RRV, Barmah Forest, and o'nyong-nyong viruses were determined. Variations in thermostability were observed within the Semliki forest serocomplex. Therefore, evidence-based heat inactivation procedures for alphaviruses are recommended.

  8. X chromosome inactivation and X-linked mental retardation

    Energy Technology Data Exchange (ETDEWEB)

    Willard, H.F. [Case Western Reserve Univ. School of Medicine, Cleveland, OH (United States)]|[Univ. Hospitals of Cleveland, OH (United States)

    1996-07-12

    The expression of X-linked genes in females heterozygous for X-linked defects can be modulated by epigenetic control mechanisms that constitute the X chromosome inactivation pathway. At least four different effects have been found to influence, in females, the phenotypic expression of genes responsible for X-linked mental retardation (XLMR). First, non-random X inactivation, due either to stochastic or genetic factors, can result in tissues in which one cell type (for example, that in which the X chromosome carrying a mutant XLMR gene is active) dominates, instead of the normal mosaic cell population expected as a result of random X inactivation. Second, skewed inactivation of the normal X in individuals carrying a deletion of part of the X chromosome has been documented in a number of mentally retarded females. Third, functional disomy of X-linked genes that are expressed inappropriately due to the absence of X inactivation has been found in mentally retarded females with structurally abnormal X chromosomes that do not contain the X inactivation center. And fourth, dose-dependent overexpression of X-linked genes that normally {open_quotes}escape{close_quotes} X inactivation may account for the mental and developmental delay associated with increasing numbers of otherwise inactive X chromosomes in individuals with X chromosome aneuploidy. 53 refs., 1 fig.

  9. Daytime Cognitive Performance in Response to Sunlight or Fluorescent Light Controlling for Sleep Duration

    Science.gov (United States)

    Ramos, Jhanic; Zamos, Adela; Rao, Rohit; Flynn-Evans, Erin

    2015-01-01

    Light is the primary synchronizer of the human circadian rhythm and also has acute alerting effects. Our study involves and comparing the alertness, performance and sleep of participants in the NASA Ames Sustainability Base, which uses sunlight as its primary light source, to in a traditional office building which uses overhead florescent lighting and varying exposure to natural light. The purpose of this study is to determine whether the use of natural lighting as a primary light source improves daytime cognitive function and promotes nighttime sleep. Participants from the Sustainability Base will be matched by gender and age to individuals working in other NASA buildings. In a prior study we found no differences in performance between those working in the Sustainability Base and those working in other buildings. Unexpectedly, we found that the average sleep duration among participants in both buildings was short, which likely obscured our ability to detect a difference the effect of light exposure on alertness. Given that such sleep deprivation has negative effects on cognitive performance, in this iteration of the study we are asking the participants to maintain a regula