[History of the Strasbourg Society of Biology].
Antony, Pierre; Romier, Christophe; Mantz, Jean-Marie
2017-01-01
The Society of Biology of Strasbourg (SBS) is a learned society that was created in 1919 based on the model of the Society of Biology of which it is a subsidiary. Like its Parisian colleague, SBS aims at diffusing and promoting scientific knowledge in biology. To achieve this goal, SBS initiated since its creation a dialogue interface between researchers in biology and physicians, and more recently with other scientific disciplines, industry and the civil society. At the dawn of its first century, the Society of Biology of Strasbourg must continue to reinvent itself to pursue its development and to fulfil its mission of sharing scientific knowledge. This work continues in strong collaboration with our partners that share with SBS the willingness to foster excellence in biological research in Strasbourg, its region and beyond. © Société de Biologie, 2017.
Nuclear research in Strasbourg. The first ten years 1941-1951
International Nuclear Information System (INIS)
Casel, R.
1993-01-01
The story of the first decade of the nuclear research in Strasbourg includes three different periods. During the war there is the installation as part of the Reichsuniversitaet Strassburg (november 1941-november 1944) of one 'Medical Research Institute' the physics department of which is equipped with a very important equipment for the period, particularly a connection generator of 1.5 MeV. For the Liberation, the civil hospices and the Strasbourg Medicine Faculty decide to create from the old german installations an artificial radioisotope production laboratory: the 'Strasbourg Nuclear Research Institute' (N.R.I) which was born in 1947 as interfaculty Institute (Medicine, Science, Pharmacy). But the N.R.I doesn't make for the applied research but for the fundamental research. To the nuclear research institute will be added in 1950 the corpuscular physics and the nuclear chemistry laboratories. 163 refs., 20 figs
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Hearing. 356.23 Section 356.23 Customs Duties... § 356.23 Hearing. (a) Scheduling of hearing. The administrative law judge will schedule the hearing at a... parties adequately to prepare for the hearing and the importance of expeditiously resolving the matter. (b...
23 CFR 772.19 - Construction noise.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction noise. 772.19 Section 772.19 Highways... ABATEMENT OF HIGHWAY TRAFFIC NOISE AND CONSTRUCTION NOISE § 772.19 Construction noise. The following general... may be affected by noise from construction of the project. The identification is to be performed...
Strasbourg Eurométropole, a cross-border conurbation towards new sustainable mobility patterns
Mazzoni , Cristiana; Grigorovschi , Andreea
2015-01-01
In the French context, Strasbourg is an exemplary case study for the development pattern of the “city of short distances”: its local and regional components were developed in the long term after the polycentric “Rhineland model” of German, Swiss, and Dutch cities. According to the French law on cities of 27 January 2014, Strasbourg has become a local authority with special status - the Eurométropole - replacing the former local authority status (CUS). The n...
19 CFR 210.23 - Suspension of investigation.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Suspension of investigation. 210.23 Section 210.23 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.23 Suspension of investigation. Any party may move to...
Strasbourg Astronomical Data Center (CDS
Directory of Open Access Journals (Sweden)
F Genova
2013-01-01
Full Text Available The Centre de Donnees astronomiques de Strasbourg (CDS, created in 1972, has been a pioneer in the dissemination of digital scientific data. Ensuring sustainability for several decades has been a major issue because science and technology evolve continuously and the data flow increases endlessly. The paper briefly describes CDS activities, major services, and its R&D strategy to take advantage of new technologies. The next frontiers for CDS are the new Web 2.0/3.0 paradigm and, at a more general level, global interoperability of astronomical on-line resources in the Virtual Observatory framework.
Strasbourg Eurométropole, a cross-border conurbation towards new sustainable mobility patterns
Directory of Open Access Journals (Sweden)
Mazzoni Cristiana
2015-01-01
Full Text Available In the French context, Strasbourg is an exemplary case study for the development pattern of the “city of short distances”: its local and regional components were developed in the long term after the polycentric “Rhineland model” of German, Swiss, and Dutch cities. According to the French law on cities of 27 January 2014, Strasbourg has become a local authority with special status - the Eurométropole - replacing the former local authority status (CUS. The new Eurométropole is supposed to “enhance metropolitan economic functions, transport networks and academic resources, research and innovation, in a spirit of regional and interregional cooperation and with a desire for balanced development of its territory” (LOW 2014-58. The concept of metropolitan development territory in Strasbourg includes thus the metropolitan system of the Upper Rhine, the idea of innovative governance of the projects shared between several institutional actors referring to multiple scales and diversified skills. Taking into consideration its particular geographical, cultural, social and economical context, ‘bottom up’ approaches and exploratory scenarios mark a joint effort to invent Strasbourg’s metropolitan development.
Activities report 1991-1992: Nuclear Research Center of Strasbourg
International Nuclear Information System (INIS)
1993-01-01
This activities report of the Nuclear Research Centre of Strasbourg for the years 1991 and 1992, presents nine research axis: theoretical physics, mechanisms of reactions and nuclear structure, extreme forms of nuclei, exotic nuclei, hot and dense nuclear matter, ultra-relativistic heavy ions, physics of LEP (European Large Electron-Positron storage ring) at 'DELPHI', chemistry and physics of radiations, physics and applications of semi-conductors
16 CFR 23.19 - Misuse of the word “pearl.”
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misuse of the word âpearl.â 23.19 Section 23... JEWELRY, PRECIOUS METALS, AND PEWTER INDUSTRIES § 23.19 Misuse of the word “pearl.” (a) It is unfair or deceptive to use the unqualified word “pearl” or any other word or phrase of like meaning to describe...
The Strasbourg Large Refractor and Dome: Significant Improvements and Failed Attempts
Heck, Andre
2009-01-01
Founded by the German Empire in the late 19th century, Strasbourg Astronomical Observatory featured several novelties from the start. According to Mueller (1978), the separation of observing buildings from the study area and from the astronomers' residence was a revolution in observatory construction. The instruments were, as much as possible, isolated from the vibrations of the buildings themselves. "Gas flames" and water were used to reduce temperature effects. Thus the Large Dome (ca 11m diameter), housing the Large Refractor (ca 49cm, then the largest in Germany) and covered by zinc over wood, could be cooled down by water running from the top. Reports (including by the French who took over the observatory after World War I) are however somehow nonexistent on the effective usage and actual efficiency of such a system (which must have generated locally a significant amount of humidity). The paper will detail these technical attempts as well as the specificities of the instruments installed in that new observatory intended as a showcase of German astronomy.
International Nuclear Information System (INIS)
Frank, R.M.; Sargentini-Maier, M.L.; Turlot, J.C.; Leroy, M.J.
1990-01-01
A comparative study of the mean lead concentrations in enamel and dentin of human premolars and permanent molars was conducted by means of a systematic sampling procedure with energy-dispersive x-ray fluorescence analysis. In a first series of analyses, no significant statistical differences in mean lead concentrations at various levels of enamel and dentin were noted between young patients of Strasbourg and those of small villages of Alsace, nor between elderly patients living in these two locations, despite the fact that motor traffic was significantly lower in the rural zones. However, in both locations, a significantly higher concentration of lead was observed in enamel and dentin in relation to age. In a second series of analyses, the mean lead concentrations of both dental hard tissues of premolars and permanent molars of young individuals from Strasbourg, rural Alsace, and Mexico City were compared. Significantly higher mean lead concentrations were found in enamel and dentin samples from Mexico City. This was most evident for inner coronal dentin (5.7 and 6.1 times greater than in teeth of Strasbourg and rural zones of Alsace, respectively) and for pulpal root dentin (6.9 and 8.9 times greater than in teeth of Strasbourg and rural zones of Alsace). It is proposed that the higher lead concentrations are related to the higher lead content of motor gasoline and to more intense traffic conditions. The dental hard tissues appear to be of value for the study of environmental lead pollution
19 CFR 146.23 - Accountability for merchandise in a zone.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Accountability for merchandise in a zone. 146.23 Section 146.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY....23 Accountability for merchandise in a zone. (a) Identification of merchandise—(1) General. A zone...
49 CFR 1242.21 - Station and office buildings (account XX-19-23).
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Station and office buildings (account XX-19-23). 1242.21 Section 1242.21 Transportation Other Regulations Relating to Transportation (Continued) SURFACE... Structures § 1242.21 Station and office buildings (account XX-19-23). If the sum of the direct freight and...
19 CFR 151.23 - Allowance for moisture in raw sugar.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Allowance for moisture in raw sugar. 151.23...; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE Sugars, Sirups, and Molasses § 151.23 Allowance for moisture in raw sugar. Inasmuch as the absorption of sea water or moisture...
Present status and plans for experiments at the Q3D of Strasbourg
International Nuclear Information System (INIS)
Coffin, J.P.; Jundt, F.; Rebmeister, R.; Seltz, R.; Wagner, P.
1979-01-01
In describing the Q3D spectrometer of Strasbourg, features with characteristics particular to this instrument are discussed. The light ion counter and the heavy ion counter which have been developed to equip the focal plane are described. Three experiments already undertaken with the facility are briefly mentioned and the future research programme outlined. (UK)
Multinational History of Strasbourg Astronomical Observatory
Heck, André
2005-01-01
Strasbourg Astronomical Observatory is quite an interesting place for historians: several changes of nationality between France and Germany, high-profile scientists having been based there, big projects born or installed in its walls, and so on. Most of the documents circulating on the history of the Observatory and on related matters have however been so far poorly referenced, if at all. This made necessary the compilation of a volume such as this one, offering fully-documented historical facts and references on the first decades of the Observatory history, authored by both French and German specialists. The experts contributing to this book have done their best to write in a way understandable to readers not necessarily hyperspecialized in astronomy nor in the details of European history. After an introductory chapter by the Editor, contributions by Wolfschmidt and by Duerbeck respectively deal extensively with the German periods and review people and instrumentation, while another paper by Duerbeck is more...
Kuusk, Priit, 1938-
2001-01-01
H. von Karajani mälestuseks korraldatud suvistepühafestivalist Baden Badenis. Festivalidest : Glyndebourne'i ooperifestivalist, Leipzigi Bachi festivalist, Schwetzingeni lossifestivalist. Strasbourg'i ooperiteatri külalisetendustest Pariisi Chatelet' teatris. A.Brendeli 70. juubeli tähistamisest Londoni South Bank Centre'is
23 CFR 661.19 - When is a bridge eligible for replacement?
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false When is a bridge eligible for replacement? 661.19... replacement? To be eligible for replacement, the bridge must be considered structurally deficient or functionally obsolete and must be in accordance with 23 CFR part 650.409(a) for bridge replacement. After an...
International Nuclear Information System (INIS)
Sourdril, Antoine; Izambart, Geraldine; Pellerin, Bruno; Meyer, Walter
2017-01-01
This document contains two articles reporting visits to two waste-to-energy valorization plants: the first one, located in Liege (Belgium), comprises an energy valorization plant for municipal wastes and a bio-methanization unit (under construction) for organic wastes which will open in 2019. The second one, located in Strasbourg (France), is a wastewater treatment plant (69 millions m 3 per year) producing 5000 tonnes of sludges, a part of which (Biovalsan project) are introduced into two digesters for the ultimate production of biogas (containing about 62 pc of methane). The volume of bio-methane will cover the needs of 5000 households in the Strasbourg area
Air pollution removal by trees in public green spaces in Strasbourg city, France
Wissal Selmi; Christiane Weber; Emmanuel Riviere; Nadege Blond; Lotfi Mehdi; David Nowak
2016-01-01
This study integrates i-Tree Eco model in order to estimate air pollution removal by urban trees in Strasbourg city, France. Applied for the first time in a French city, the model shows that public trees, i.e., trees managed by the city, removed about 88 t of pollutants during one year period (from July 2012 to June 2013): about 1 ton for CO; 14 tons for NO2...
The 1988 activity report of the Nuclear Research Center of Strasbourg
International Nuclear Information System (INIS)
1989-01-01
The 1988 activity report of Nuclear Research Center of Strasbourg (France) is presented. 1988 is characterized by significant technical development activities in the field of heavy ion collisions. Several aspects involving the Vivitron system development and objectives are underlined. The main research fields are those on high angular momentum and superplasticity, layer model and nucleon transfer, nuclei far from steady state, scattering model and fusion cross sections. The research programs of the Nuclear Physics, High Energies, Chemistry and Radiation Physics Divisions are presented. Concerning technology transfer, the investigations on accelerators and dosimetry are included. International cooperation main aspects, papers, congress communications and conferences are reported [fr
Kiestra, L.R.
2013-01-01
In this research the interaction between the rights guaranteed in the European Convention of Human Rights (ECHR) and private international law has been analyzed by examining the case law of the European Court of Human Rights (the Court) in Strasbourg and selected national courts. In doing so the
Evolution of the fogwater composition in Strasbourg (France) from 1990 to 1999
Herckes, Pierre; Wortham, Henri; Mirabel, Philippe; Millet, Maurice
The chemical composition of fogwater has been studied in the city of Strasbourg (France) from 1990 to 1999. During these years, fogwater samples have been collected and analysed for major ions and trace metals. This paper reports on the analysis of the collected dataset. The analysis revealed a significant decrease in acidity of approximately one pH unit over the course of the study. This decrease in acidity appears to be linked to a decrease in SO 2(g) and the resulting SO 42-. Trace metal concentrations have also strongly decreased over the 10-year period. Pb concentrations, following the elimination of leaded gasoline, decreased by more than one order of magnitude.
19 CFR 162.23 - Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)).
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Seizure under section 596(c), Tariff Act of 1930... SEIZURE Seizures § 162.23 Seizure under section 596(c), Tariff Act of 1930, as amended (19 U.S.C. 1595a(c)). (a) Mandatory seizures. The following, if introduced or attempted to be introduced into the United...
Low molecular weight organic acids in fogwater in an urban area (Strasbourg, France)
Energy Technology Data Exchange (ETDEWEB)
Millet, M.; Wortham, H.; Sanusi, A.; Mirabel, P. [Centre de Geochime de la Surface, Equipe de Physico-Chimie de l`Atmosphere, Strasbourg (France)
1997-10-27
This work presents the chemical analysis of low weight carboxylic acids: formate and acetate in two droplet-size categories (2-6 and 5-8 {mu}m) of fogwater collected in Strasbourg (eastern France) between 1991 and 1994. For each sample, the ratio between acetate and formate was calculated, in many cases, this ratio was typically higher than one. This calculation indicates that the origin of acetate and formate can be attributed to automobile exhaust. Maximum contribution of these acids to the total free acidity of fogwater was also checked and the results show that the contribution is very low in regard to the strong mineral acids from anthropogenic origin
North–South Asymmetry in Rieger-type Periodicity during Solar Cycles 19–23
International Nuclear Information System (INIS)
Gurgenashvili, Eka; Zaqarashvili, Teimuraz V.; Kukhianidze, Vasil; Oliver, Ramon; Ballester, Jose Luis; Dikpati, Mausumi; McIntosh, Scott W.
2017-01-01
Rieger-type periodicity has been detected in different activity indices over many solar cycles. It was recently shown that the periodicity correlates with solar activity having a shorter period during stronger cycles. Solar activity level is generally asymmetric between northern and southern hemispheres, which could suggest the presence of a similar behavior in the Rieger-type periodicity. We analyze the sunspot area/number and the total magnetic flux data for northern and southern hemispheres during solar cycles 19–23, which had remarkable north–south asymmetry. Using wavelet analysis of sunspot area and number during the north-dominated cycles (19–20), we obtained the periodicity of 160–165 days in the stronger northern hemisphere and 180–190 days in the weaker southern hemisphere. On the other hand, south-dominated cycles (21–23) display the periodicity of 155–160 days in the stronger southern hemisphere and 175–188 days in the weaker northern hemisphere. Therefore, the Rieger-type periodicity has the north–south asymmetry in sunspot area/number data during solar cycles with strong hemispheric asymmetry. We suggest that the periodicity is caused by magnetic Rossby waves in the internal dynamo layer. Using the dispersion relation of magnetic Rossby waves and observed Rieger periodicity, we estimated the magnetic field strength in the layer as 45–49 kG in more active hemispheres (north during cycles 19–20 and south during cycles 21–23) and 33–40 kG in weaker hemispheres. The estimated difference in the hemispheric field strength is around 10 kG, which provides a challenge for dynamo models. Total magnetic flux data during cycles 20–23 reveals no clear north–south asymmetry, which needs to be explained in the future.
North–South Asymmetry in Rieger-type Periodicity during Solar Cycles 19–23
Energy Technology Data Exchange (ETDEWEB)
Gurgenashvili, Eka; Zaqarashvili, Teimuraz V.; Kukhianidze, Vasil [Abastumani Astrophysical Observatory at Ilia State University, Tbilisi, Georgia (United States); Oliver, Ramon; Ballester, Jose Luis [Departament de Física, Universitat de les Illes Balears, E-07122, Palma de Mallorca (Spain); Dikpati, Mausumi; McIntosh, Scott W., E-mail: Eka.gurgenashvili.1@iliauni.edu.ge [High Altitude Observatory, National Center for Atmospheric Research, P.O. Box 3000, Boulder, CO 80307 (United States)
2017-08-20
Rieger-type periodicity has been detected in different activity indices over many solar cycles. It was recently shown that the periodicity correlates with solar activity having a shorter period during stronger cycles. Solar activity level is generally asymmetric between northern and southern hemispheres, which could suggest the presence of a similar behavior in the Rieger-type periodicity. We analyze the sunspot area/number and the total magnetic flux data for northern and southern hemispheres during solar cycles 19–23, which had remarkable north–south asymmetry. Using wavelet analysis of sunspot area and number during the north-dominated cycles (19–20), we obtained the periodicity of 160–165 days in the stronger northern hemisphere and 180–190 days in the weaker southern hemisphere. On the other hand, south-dominated cycles (21–23) display the periodicity of 155–160 days in the stronger southern hemisphere and 175–188 days in the weaker northern hemisphere. Therefore, the Rieger-type periodicity has the north–south asymmetry in sunspot area/number data during solar cycles with strong hemispheric asymmetry. We suggest that the periodicity is caused by magnetic Rossby waves in the internal dynamo layer. Using the dispersion relation of magnetic Rossby waves and observed Rieger periodicity, we estimated the magnetic field strength in the layer as 45–49 kG in more active hemispheres (north during cycles 19–20 and south during cycles 21–23) and 33–40 kG in weaker hemispheres. The estimated difference in the hemispheric field strength is around 10 kG, which provides a challenge for dynamo models. Total magnetic flux data during cycles 20–23 reveals no clear north–south asymmetry, which needs to be explained in the future.
Nineteenth-century urbanization as sacred process: insights from German Strasbourg.
Steinhoff, Anthony J
2011-01-01
This article examines a crucial site for modernity’s encounter with religion during the long nineteenth century, albeit one largely ignored both by religious and urban historians: the modern big city. Drawing on evidence from Strasbourg, which joined the ranks of Germany’s big cities soon after the Franco-Prussian War, it points out first, that urbanization had a significant urban dimension. It altered the absolute and relative size of the city’s faith communities, affected the confessional composition of urban neighborhoods, and prompted faith communities to mark additional parts of the urban landscape as sacred. Second, while urban growth—both demographic and physical—frequently challenged traditional understandings of religious community, it also facilitated the construction of new understandings of piety and community, especially via voluntary organizations and the religious media. Thereby, urbanization emerged as a key force behind sacralization in city and countryside as the nineteenth century ended and the twentieth began.
1983-05-01
17AD-A12.9 860 EVALUATION OF A TAILORED DIRECT-MAIL MARKETING STRATEGY 1/ FOR RECRUITNG TH.U) WESAT INC ROCKVILLE MD K FERNANDES ET AL MAY 83 NPRDC...STANDARDS-1963-A EVALUATION OF A TAILORED DIRECT-MAIL MARKETING STRATEGY FOR RECRUITING THE 19- TO 23-YEAR-OLD MARKET APPRVEDFORPUBLIC RELE AnE [B...EVALUATION OF A TAILORED DIRECT-MAIL MARKETING STRATEGY FOR RECRUITING THE 19- TO 23-YEAR-OLD MARKET Kathleen Fernandes Navy Personnel Research and
Antibacterial Activity of Four Human Beta-Defensins: HBD-19, HBD-23, HBD-27, and HBD-29
Directory of Open Access Journals (Sweden)
David Camerini
2012-03-01
Full Text Available Human β-defensins (HBD are a family of small antimicrobial peptides that play important roles in the innate and adaptive immune defenses against microbial infection. In this study, we predicted the mature sequences and assessed the antibacterial properties of synthetic HBD-19, HBD-23, HBD-27, and HBD-29 against three species of clinically relevant bacteria: Escherichia coli, Staphylococcus aureus and Pseudomonas aeruginosa. We also examined the cytotoxicity of each β-defensin to human cells. HBD-19 exhibited modest antibacterial effects against E. coli and S. aureus but had little effect on the growth of P. aeruginosa. HBD-23 exhibited substantial antibacterial effects against all three bacterial species and was particularly potent against the Gram-negative species, E. coli and P. aeruginosa. HBD-27 exerted modest antibacterial activity only towards S. aureus while HBD-29 had modest antibacterial activity for E. coli and P. aeruginosa. HBD-23 and HBD-27 showed little or no toxicity to human peripheral blood mononuclear cells, while HBD-19 and HBD-29 decreased cell viability by 20% at 30 μg/mL.
Directory of Open Access Journals (Sweden)
Sherry L Kurtz
Full Text Available Our laboratory's investigations into mechanisms of protective immunity against Francisella tularensis Live Vaccine Strain (LVS have uncovered mediators important in host defense against primary infection, as well as those correlated with successful vaccination. One such potential correlate was IL-12p40, a pleiotropic cytokine that promotes Th1 T cell function as part of IL-12p70. LVS-infected IL-12p40 deficient knockout (KO mice maintain a chronic infection, but IL-12p35 KO mice clear LVS infection; thus the role that IL-12p40 plays in immunity to LVS is independent of the IL-12p70 heterodimer. IL-12p40 can also partner with IL-23p19 to create the heterodimeric cytokine IL-23. Here, we directly tested the role of IL-23 in LVS resistance, and found IL-23 to be largely dispensable for immunity to LVS following intradermal or intranasal infection. IL-23p19 KO splenocytes were fully competent in controlling intramacrophage LVS replication in an in vitro overlay assay. Further, antibody responses in IL-23p19 KO mice were similar to those of normal wild type mice after LVS infection. IL-23p19 KO mice or normal wild type mice that survived primary LVS infection survived maximal doses of LVS secondary challenge. Thus p40 has a novel role in clearance of LVS infection that is unrelated to either IL-12 or IL-23.
Directory of Open Access Journals (Sweden)
David Kosař
2017-03-01
Full Text Available This article discusses to what extent and how the European Court of Human Rights (ECtHR has initiated and engaged in domestic judicial reforms. It shows that the judgments of the Strasbourg Court, rather than having effects only with respect to the individual whose rights have been violated, have much deeper structural effects in the design and operation of domestic judicial systems. This article argues that this phenomenon goes rather unnoticed, but it has deep implications for both the developing and developed European democracies. To demonstrate this phenomenon, this article assesses the impact of the ECtHR on three judicial design issues. First, it illustrates how the ECtHR has challenged the role of the advocates general. Second, it explains how the ECtHR has gradually curbed the jurisdiction of military courts both over civilians and over military officers, which has brought these courts to the brink of their abolition. Finally, it outlines how the ECtHR in its judgments regarding the disciplining of judges empowers the judiciary at the expense of other political institutions within the State. Based on the analysis of these three judicial design issues, we conclude that the Strasbourg Court is affecting the internal architecture of domestic judiciaries as it gradually endorses the unification of court administration and changes the power structures within the judiciary.
Directory of Open Access Journals (Sweden)
Antoine Beyer
2012-05-01
Full Text Available L’éclairage géohistorique de la relation ville-port à Strasbourg implique un croisement de deux chronologies, l’une géopolitique, liée à une position frontalière évolutive, l’autre économique et générale, articulée à l’histoire portuaire dans une perspective plus résolument urbaine de la déconnexion-reconnexion des deux espaces fonctionnels. Dans cette logique, l’analyse suivie envisagera alternativement l’évolution de la fonction portuaire de Strasbourg dans une situation d’instabilité frontalière, pour considérer ensuite la manière dont l’espace portuaire participe au projet urbain. Ces deux approches permettront par ailleurs d’envisager l’analyse à deux échelles géographiques, celle de l’espace régional et celle de l’aménagement urbain.The geo-historical approach to the relation port-city in the case of Strasbourg (France implies to consider at the same time two chronologies. On the one hand, the geopolitical dimension with a city leaned on the french-german border. On the other hand, the more common economic development with the connection and the de-connection phases of the two functional spaces involved, i.e. port and urban spaces. In such a perspective, the paper will develop alternatively the way the port grew in a political unstable context, and replace its developement in the shaping of the global urbanization. Those two topics will in return differenciate two geographical scales, the regional environment and the more local urban planning strategies.
Beck, F. A.
2018-05-01
This article overviews a long period of an important evolution in the nuclear structure research in Strasbourg Laboratories, focussed on tracking of the weaker and weaker experimental signals carrying the more and more important physics messages. In particular we address the research of signatures of the collective behaviour of the nucleus as suggested in the early works of Bohr, Mottelson and Rainwater—at high and very high angular momenta—as well as the competition between the collective and non-collective excitation modes. These ambitious goals were possible to achieve only by constructing powerful spectrometers and developing related detectors, electronics and data acquisition systems. The theoretical modelling developed in parallel, provided essential guidance when choosing the right experiments and optimising their realisation. Theory calculations were equally helpful in interpreting the results of experiments leading to a more complete understanding of the underlying physics. Moreover, thanks to the development of heavy ion accelerators, the Strasbourg centre was the place where crossed the ways of many experimenters from European countries both from the Western and from the Central part of Europe, the place of the gradual development of more and more sophisticated European gamma-spectrometers in collaboration with more and more laboratories from the increasing number of countries allowing for the frontier-level studies of the nuclear behaviour at very high angular momenta.
International Nuclear Information System (INIS)
2010-03-01
This document reports investigation performed after information of the French Nuclear Safety authority (ASN) by Strasbourg University Hospitals of the fact that patients presented undesired effects after X-ray treatments. Inspections aimed at analyzing the circumstances and the causes of these effects, and at examining the implemented corrective actions. No technical failure has been detected on the apparatus, but an insufficient attention to dose optimization and to follow-on has been highlighted. Some failures have been identified in traceability of maintenance operations, in training, and in adjustment optimization. Corrective actions are described, and some comments are made, inspired from this experience
Jiang, Yousheng; Husain, Mansourah; Qi, Zhitao; Bird, Steve; Wang, Tiehui
2015-08-01
Interleukin (IL)-23 is a heterodimeric IL-12 family cytokine composed of a p19 α-chain, linked to a p40 β-chain that is shared with IL-12. IL-23 is distinguished functionally from IL-12 by its ability to induce the production of IL-17, and differentiation of Th17 cells in mammals. Three isoforms of p40 (p40a, p40b and p40c) have been found in some 3R teleosts. Salmonids also possess three p40 isoforms (p40b1, p40b2 and p40c) although p40a is missing, and two copies (paralogues) of p40b are present that have presumably been retained following the 4R duplication in this fish lineage. Teleost p19 has been discovered recently in zebrafish, but to date there is limited information on expression and modulation of this molecule. In this report we have cloned two p19 paralogues (p19a and p19b) in salmonids, suggesting that a salmonid can possess six potential IL-23 isoforms. Whilst Atlantic salmon has two active p19 genes, the rainbow trout p19b gene may have been pseudogenized. The salmonid p19 translations share moderate identities (22.8-29.9%) to zebrafish and mammalian p19 molecules, but their identity was supported by structural features, a conserved 4 exon/3 intron gene organisation, and phylogenetic tree analysis. The active salmonid p19 genes are highly expressed in blood and gonad. Bacterial (Yersinia ruckeri) and viral infection in rainbow trout induces the expression of p19a, suggesting pathogen-specific induction of IL-23 isoforms. Trout p19a expression was also induced by PAMPs (poly IC and peptidoglycan) and the proinflammatory cytokine IL-1β in primary head kidney macrophages. These data may indicate diverse functional roles of trout IL-23 isoforms in regulating the immune response in fish. Copyright © 2015 Elsevier Ltd. All rights reserved.
50 CFR 23.19 - What CITES documents are required to export Appendix-I plants?
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What CITES documents are required to... ENDANGERED SPECIES OF WILD FAUNA AND FLORA (CITES) Prohibitions, Exemptions, and Requirements § 23.19 What CITES documents are required to export Appendix-I plants? Answer the questions in the following decision...
The Architectural and Instrumental Heritage of the Strasbourg University Observatory
Davoigneau, Jean
When, in 1872, Alsace was handed over to Germany, Empperor Wilhelm I decided to make Strasbourg the showcase of his empire, and in particular to build a prestigious university and an observatory. The construction of the observatory was entrusted to the astronomer August Winnecke (1835-1897), former director of the Pulkovo observatory, and to the Baumeister Hermann Eggert. Begun in 1876, the work was completed in 1880. The astronomical instruments, ordered from German makers, were installed during the winter of 1880-1881, and the observatory was inaugurated on September 22, 1881 at the general assembly of the Astronomische Gesellschaft, the international association of astronomers, whose secretary was Winnecke. Marking the south-eastern extremity of the ‘imperial axis’, the architecture of the university observatory harmonizes perfectly with the new German city built on the former French parade grounds. The astronomical heritage operation conducted at the beginning of the present decade provides a richly docurnented and illustrated inventory of both the architecture and instruments of this institution. This work has also highlighted the unique quality of the collection of instruments, befitting the long and complex history of this institution.
19 CFR 103.23 - Factors in determining whether to disclose information pursuant to a demand.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Factors in determining whether to disclose... Disclosure in Federal, State, Local, and Foreign Proceedings § 103.23 Factors in determining whether to... those demands with respect to which any of the following factors exist: (1) Disclosure would violate a...
Ghédir, Houda; Ibala-Romdhane, Samira; Okutman, Ozlem; Viot, Géraldine; Saad, Ali; Viville, Stéphane
2016-01-01
The purpose of this study was to analyze DPY19L2 sequence variants to investigate the mechanism leading to the entire DPY19L2 deletion in a large cohort of infertile globozoospermic patients. An improved analysis of the DPY19L2 deletion breakpoints (BPs) allowed us to identify two BPs located in a small 1 kb region and to more precisely localize the BPs reported previously. Three genes [spermatogenesis associated 16 (SPATA16), protein interacting with PRKCA (PICK1) and DPY19L2] were previously correlated with globozoospermia, but a homozygous deletion of the entire DPY19L2 was identified as the most frequent alteration causing this phenotype. In addition, several point mutations in this gene were reported. In previous work, we have identified nine BPs for the DPY19L2 deletion clustered in two hotspot regions, while others reported a total of five BPs. We screened for the DPY19L2 deletion and for mutations in the DPY19L2, SPATA16 and PICK1 genes in a cohort of 21 Tunisian globozoospermic patients. In order to characterize the DPY19L2 deletion BPs, we sequenced a 2 kb fragment on low copy repeat (LCR) 1 and LCR2 in Tunisian fertile controls to distinguish between single-nucleotide polymorphisms (SNPs) and LCR-specific markers. Molecular analyses performed on 18 genetically independent individuals showed that 11 (61.1%) were homozygous for the DPY19L2 deletion, 2 (11.1%) were homozygous for the non-synonymous mutation (p.R298C) in exon 8, 1 patient (5.6%) was homozygous for a new splice-site mutation at the junction exon-intron 16 [c.1579_1580+4delAGGTAAinsTCAT] and no DPY19L2, SPATA16 or PICK1 mutations were identified for 4 patients (22.2%). By defining 15 specific LCR markers, we characterized 2 BPs for the DPY19L2 deletion in 11 patients showing the homozygous deletion. Using 20 non-LCR-specific SNPs, we identified 8 distinct haplotypes. A limitation of this study is the small number of patients owing to the rarity of this form of male infertility. Our data showed
2018-04-23T19:38:36Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/15320 2018-04-23T19:38:36Z ajst:ART IMPROVED COMBUSTION PROCESSES IN MEDICAL WASTES INCINERATORS FOR RURAL APPLICATIONS Ketlogetswe, C; Department of Mechanical Engineering , University of Botswana, ...
Florsch , Nicolas; Chambat , Fréderic; Hinderer , Jacques; Legros , Hilaire
1994-01-01
International audience; We have analysed more than four years of data from the Strasbourg superconducting gravimeter to retrieve the period and damping of the nearly diurnal-free wobble (NDFW). The removal of noise spikes is found to be crucial for an accurate determination of tidal-wave amplitudes and phases. A new simple algorithm is derived which allows an analytical solution for the NDFW pertod and damping using the complex gravimetric factors of three resonant diurnal waves. The results ...
2018-04-23T19:40:33Z https://www.ajol.info/index.php/all/oai oai:ojs ...
African Journals Online (AJOL)
article/79168 2018-04-23T19:40:33Z gjms:ART Prevalence of gastrointestinal parasites in dogs from Umuahia City of Abia State Nwoha, RIO Ekwuruike, JO Dogs, Toxocara canis, Ancylostoma braziliense, Linguatula serrata. A total of 210 faecal ...
Chemical composition of fogwater in an urban area: Strasbourg (France).
Millet, M; Sanusi, A; Wortham, H
1996-01-01
To investigate the acidity and to identify the predominant compounds, this work presents the chemical analysis of 18 fogwater samples collected during the year 1991 in Strasbourg, in the east of France. For each fog event, two droplet size categories (2-6 microm and 5-8 microm) have been separately collected and 16 ionic components have been analysed. These two fraction sizes were chosen because they correspond approximately to the size range that can penetrate the human lung and they may have possible health effects. The dominant species were NH4+, NO3-, SO4(2-) and Cl-, with a maximum level of 12,640, 17,270, 21,620 and 13,540 microeq litre(-1), respectively. For most of the fog events the highest concentrations of all analysed species were observed in the 2-6 microm droplets. pH values ranged between 2.79 and 5.70 and the fogwater acidity was governed by three strong acids, H2SO4, HNO3 and HCl and was partially neutralised by NH3 and probably by the presence of CaCO3 in the 'loess', which is the major constituent of soils in the upper Rhine valley. In other respects the acetate/formate ratio (methanoate/ethanoate), generally lower than 1, indicates an important pollution due to automobile exhaust, although the Pb concentrations are moderate due to the general use of unleaded gasoline in France since 1989.
Report: Fourth International Conference on Gas Hydrates, held at Yokohama, Japan, 19-23 May 2002
Digital Repository Service at National Institute of Oceanography (India)
Karisiddaiah, S.M.
formations, while Dr. L. Stern presented ne insights into the phenomena of anomalous or self- preservation of gas hydrates. JOUR.GEOL.SOC.INDIA, VOL.61, JAN. 2001 Posters on hydrate formation and prevention in pipelines and hydrate based...-1 REPORT ON THE 4TH INTERNATIONAL CONFERENCE ON GAS HYDRATES The fourth International Conference on Gas Hydrates was recently held at Yokohama, Japan, between 19-23 May 2002 following the earlier conferences held in USA (1993...
Comparison of annual dry and wet deposition fluxes of selected pesticides in Strasbourg, France
International Nuclear Information System (INIS)
Sauret, Nathalie; Wortham, Henri; Strekowski, Rafal; Herckes, Pierre; Nieto, Laura Ines
2009-01-01
This work summarizes the results of a study of atmospheric wet and dry deposition fluxes of Deisopropyl-atrazine (DEA), Desethyl-atrazine (DET), Atrazine, Terbuthylazine, Alachlor, Metolachlor, Diflufenican, Fenoxaprop-p-ethyl, Iprodione, Isoproturon and Cymoxanil pesticides conducted in Strasbourg, France, from August 2000 through August 2001. The primary objective of this work was to calculate the total atmospheric pesticide deposition fluxes induced by atmospheric particles. To do this, a modified one-dimensional cloud water deposition model was used. All precipitation and deposition samples were collected at an urban forested park environment setting away from any direct point pesticide sources. The obtained deposition fluxes induced by atmospheric particles over a forested area showed that the dry deposition flux strongly contributes to the total deposition flux. The dry particle deposition fluxes are shown to contribute from 4% (DET) to 60% (cymoxanil) to the total deposition flux (wet + dry). - A modified one-dimensional cloud water deposition model is used to estimate the deposition fluxes of pesticides in the particle phase and compare the relative importance of dry and wet depositions
Comparison of annual dry and wet deposition fluxes of selected pesticides in Strasbourg, France
Energy Technology Data Exchange (ETDEWEB)
Sauret, Nathalie [Marseilles University, Laboratoire Chimie Provence - UMR 6264, Campus Saint Charles, Case 29, 3 Place Victor Hugo, 13331 Marseilles Cedex 03 (France); Wortham, Henri [Marseilles University, Laboratoire Chimie Provence - UMR 6264, Campus Saint Charles, Case 29, 3 Place Victor Hugo, 13331 Marseilles Cedex 03 (France)], E-mail: Henri.Wortham@univ-provence.fr; Strekowski, Rafal [Marseilles University, Laboratoire Chimie Provence - UMR 6264, Campus Saint Charles, Case 29, 3 Place Victor Hugo, 13331 Marseilles Cedex 03 (France); Herckes, Pierre [Arizona State University, Department of Chemistry and Biochemistry, Tempe, AZ 85287-1604 (United States); Nieto, Laura Ines [Marseilles University, Laboratoire Chimie Provence - UMR 6264, Campus Saint Charles, Case 29, 3 Place Victor Hugo, 13331 Marseilles Cedex 03 (France)
2009-01-15
This work summarizes the results of a study of atmospheric wet and dry deposition fluxes of Deisopropyl-atrazine (DEA), Desethyl-atrazine (DET), Atrazine, Terbuthylazine, Alachlor, Metolachlor, Diflufenican, Fenoxaprop-p-ethyl, Iprodione, Isoproturon and Cymoxanil pesticides conducted in Strasbourg, France, from August 2000 through August 2001. The primary objective of this work was to calculate the total atmospheric pesticide deposition fluxes induced by atmospheric particles. To do this, a modified one-dimensional cloud water deposition model was used. All precipitation and deposition samples were collected at an urban forested park environment setting away from any direct point pesticide sources. The obtained deposition fluxes induced by atmospheric particles over a forested area showed that the dry deposition flux strongly contributes to the total deposition flux. The dry particle deposition fluxes are shown to contribute from 4% (DET) to 60% (cymoxanil) to the total deposition flux (wet + dry). - A modified one-dimensional cloud water deposition model is used to estimate the deposition fluxes of pesticides in the particle phase and compare the relative importance of dry and wet depositions.
International Nuclear Information System (INIS)
2017-10-01
In the sunniest regions of France, like the Great East, the photovoltaic self-consumption market growth is supported by the national tender (450 MW of projects to allocate) and regional aids, the new tariffing order and the new regulatory framework for collective self-consumption. This document brings together the presentations given during the Regional conference dedicated to photovoltaic self-consumption held at Strasbourg (FR) in October 2017: 1 - Conference program; 2 - Introduction (Bruno Flochon - Climaxion Region Grand Est); 3 - Regulatory context (Mathilde Ducatel - DREAL); 4 - Conditions of connection to the Enedis grid (Jean Luc Spaeth, Enedis); 5 - Experience feedback and regional support (Gautier Perrin - Region Grand Est); 6 - National news (Richard Loyen - Enerplan); 7 - Regional companies (Nicolas Randria - GMPV FFB); 8 - Great East Solar Association (Sandrine Bournaison); 9 - Electro-concept of a Supermarket at Wittelsheim (Philippe Soret); 10 - Roof PV generator on the C3 building at Clemessy-Mulhouse (Dominique Bitsch)
Directory of Open Access Journals (Sweden)
Fen Tih Fen Tih
2017-12-01
Dysmenorrhea is a menstrual disorder with the greatest prevalence followed by premenstrual syndrome that includes physical and psychological symptoms. Micronutrients intake of calcium and magnesium can help overcome these complaints. This research was conducted to find out the effect of calcium and magnesium supplements consumption on dysmenorrhea and premenstrual syndrome symptoms in 19–23 years old women. This was quasi experimental research with pre- and post-test design. The research was conducted in Maranatha Christian University Bandung from July to December 2016. The subjects of research were 60 women aged 19–23 years old, divided into two groups randomly. One group given calcium (1,000 mg/day or magnesium (250 mg/day, which was given at the second day of menstruation until the next menstrual cycle. Serum levels of calcium or magnesium were measured with spectrophotometry method. Dysmenorrhea was measured with visual analog scale (VAS, whereas score of premenstrual syndrome was measured with shortened premenstrual assessment form, before and after treatment. The consumption of calcium lowers the VAS score average on dysmenorrhea from 6.97 to 3.80 (p=0.000** and the mean score of premenstrual syndrome from 15.07 to 10.80 (p=0.000**. Consumption of magnesium reduces the VAS score average on dysmenorrhea from 7 to 4 (p=0.000** and the mean score of premenstrual syndrome from 12.27 to 9.87 (p=0.001**. In conclusion, consumption of calcium or magnesium supplements reduce dysmenorrhea and premenstrual syndrome in women aged 19–23 years old.
Liu, X.; Zhang, Y.; Wang, Z.; Zhu, G.; Han, G.; Chen, G.; Hou, C.; Wang, T.; Ma, N.; Shen, B.; Li, Y.; Wang, R.
2016-01-01
Summary Interleukin (IL)‐12 family cytokines play critical roles in autoimmune diseases. Our previous study has shown that IL‐23p19 and Epstein–Barr virus‐induced 3 (Ebi3) form a new IL‐12 family heterodimer, IL‐23p19/Ebi3, termed IL‐39, and knock‐down of p19 or Ebi3 reduced diseases by transferred GL7+ B cells in lupus‐prone mice. In the present study, we explore further the possible effect of IL‐39 on murine lupus. We found that IL‐39 in vitro and in vivo induces differentiation and/or expansion of neutrophils. GL7+ B cells up‐regulated neutrophils by secreting IL‐39, whereas IL‐39‐deficient GL7+ B cells lost the capacity to up‐regulate neutrophils in lupus‐prone mice and homozygous CD19cre (CD19‐deficient) mice. Finally, we found that IL‐39‐induced neutrophils had a positive feedback on IL‐39 expression in activated B cells by secreting B cell activation factor (BAFF). Taken together, our results suggest that IL‐39 induces differentiation and/or expansion of neutrophils in lupus‐prone mice. PMID:27400195
National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profile data were collected using MBT casts from multiple platforms in a world-wide distribution from December 23, 1964 to December 19, 1991. Additonal...
Solubility of polyvalent cations in fogwater at an urban site in Strasbourg (France)
Millet, M.; Wortham, H.; Mirabel, Ph.
The concentrations in the soluble and total (soluble + insoluble) fractions of Mg, Ca, Fe, Mn, Zn, Al, Cd and Pb have been analysed by "inductively coupled plasma (ICP)" in 14 fog events collected in 1992 at an urban site in France (Strasbourg). For each fog event, two droplet size categories (2-6 μm and 5-8 μm) have been collected separately. For the analysis of the polyvalent cations in the soluble and total fractions, an analytical procedure using ICP and filtration on cellulose/PVC filters has been developed. The study of the solubility of some polyvalent cations has shown that two of the most important factors controlling the partitioning between the soluble and insoluble fraction are the nature of the particles and the pH of the fogwater. The influence of pH depended on the element. The solubility of Pb, Cd, Al, Fe, Mg, and Ca were pH dependent whereas, Zn and Mn solubility varied but no relationship with pH existed, ranging between 25 and 100% and 10 and 100%, respectively. On the other hand, Mg, Pb and Ca were predominantly present in the soluble phase, whereas Al was prevalent in the insoluble fraction. In the case of Cd and Fe., the presence in the soluble or insoluble phase depended largely on the fogwater pH.
Energy Technology Data Exchange (ETDEWEB)
Jammes, Ch
1997-11-28
The aim of this work is to create, validate theoretically and experimentally a calculation route for a thermal irradiation reactor. This is the research reactor of the University of Strasbourg, which presents all of characteristics of this reactor-type: compact and heterogeneous core, slab-type fuel with a high 235-uranium enrichment. This calculation route is based on the first use of the following two modern transport methods: the TDT method and the Monte Carlo method. The former, programmed within the APOLLO2 code, is a two dimensional collision probabilities method. The later, used by the TRIPOLI4 code, is a stochastic method. Both can be applied to complex geometries. After a few theoretical reminders about transport codes, a set of integral experiments is described which have been realized within the research reactor of the University of Strasbourg. One of them has been performed for this study. At the beginning of the theoretical part, significant errors are apparent due to the use of calculation route based on homogenization, condensation and the diffusion approximation. An extensive comparison between the discrete ordinates method and the TDT method carries out that the use of the TDT method is relevant for the studied reactor. The treatment of axial leakage with this method is the only disadvantage. Therefore, the use of the code TRIPOLI4 is recommended for a more accurate study of leakage within a reflector. By means of the experimental data, the ability of our calculation route is confirmed for essential neutronics questions such as the critical mass determination, the power distribution and the fuel management. (author)
Energy Technology Data Exchange (ETDEWEB)
Li, Jun; Medina, Elena A.; Sleight, Arthur W.; Subramanian, M.A. [Oregon State University, Corvallis, OR (United States). Dept. of Chemistry; Stalick, Judith K. [National Institute of Standards and Technology (NIST), Gaithersburg, MD (United States). Center for Neutron Research
2016-08-01
Various oxides with the hibonite structure were synthesized and structurally analyzed using powder neutron diffraction. The structure of CaAl{sub 12}O{sub 19} at 298 and 11 K shows dipoles that are apparently too dilute to order unless subjected to a suitable electric field. Magnetoplumbites, such as BaFe{sub 12}O{sub 19}, are isostructural with hibonite. These compounds possess ferromagnetic properties, which combined with the electric dipoles may influence multiferroic behavior. Our SrAl{sub 12}O{sub 19} sample showed two distinct hexagonal phases, a major phase with the normal hibonite structure and a minor phase having a closely related structure. Our sample of the defect hibonite phase La{sub 2/3+δ}Al{sub 12-δ}O{sub 19} shows a distinctly higher δ value (0.25) vs. that reported (∝ 0.15) for samples made from the melt. Finally, we used to advantage the negative scattering length of Ti to determine the site occupancies of Ni and Ti in CaAl{sub 10}NiTiO{sub 19}.
Tracing the Magnetic Field of IRDC G028.23-00.19 Using NIR Polarimetry
Energy Technology Data Exchange (ETDEWEB)
Hoq, Sadia; Clemens, D. P.; Cashman, Lauren R. [Institute for Astrophysical Research, 725 Commonwealth Ave, Boston University, Boston, MA 02215 (United States); Guzmán, Andrés E., E-mail: shoq@bu.edu, E-mail: clemens@bu.edu, E-mail: lcashman@bu.edu, E-mail: aguzman@das.uchile.cl [Departamento de Astronomía, Universidad de Chile, Camino el Observatorio 1515, Las Condes, Santiago (Chile)
2017-02-20
The importance of the magnetic ( B ) field in the formation of infrared dark clouds (IRDCs) and massive stars is an ongoing topic of investigation. We studied the plane-of-sky B field for one IRDC, G028.23-00.19, to understand the interaction between the field and the cloud. We used near-IR background starlight polarimetry to probe the B field and performed several observational tests to assess the field importance. The polarimetric data, taken with the Mimir instrument, consisted of H -band and K -band observations, totaling 17,160 stellar measurements. We traced the plane-of-sky B -field morphology with respect to the sky-projected cloud elongation. We also found the relationship between the estimated B -field strength and gas volume density, and we computed estimates of the normalized mass-to-magnetic flux ratio. The B -field orientation with respect to the cloud did not show a preferred alignment, but it did exhibit a large-scale pattern. The plane-of-sky B -field strengths ranged from 10 to 165 μ G, and the B -field strength dependence on density followed a power law with an index consistent with 2/3. The mass-to-magnetic flux ratio also increased as a function of density. The relative orientations and relationship between the B field and density imply that the B field was not dynamically important in the formation of the IRDC. The increase in mass-to-flux ratio as a function of density, though, indicates a dynamically important B field. Therefore, it is unclear whether the B field influenced the formation of G28.23. However, it is likely that the presence of the IRDC changed the local B -field morphology.
DEFF Research Database (Denmark)
Andersen, Mette Klarskov; Autio, Kirsi; Barbany, Gisela
2011-01-01
The translocation t(1;19)(q23;p13)/der(19)t(1;19) is a risk stratifying aberration in childhood B-cell precursor acute lymphoblastic leukaemia (BCP ALL) in the Nordic countries. We have identified 47 children/adolescents with t(1;19)/der(19)t(1;19)-positive BCP ALL treated on two successive Nordic...... Society of Paediatric Haematology and Oncology (NOPHO) protocols between 1992 and 2007 and have reviewed the clinical and cytogenetic characteristics of these cases, comprising 1·8% of all cases. The translocation was balanced in 15 cases (32%) and unbalanced in 29 cases (62%). The most common additional...... and 10 years was 0·85 and 0·82, respectively. Nine patients had a bone marrow relapse after a median of 23 months; no patient had a central nervous system relapse. Additional cytogenetic abnormalities, age, gender, WBC count or whether the t(1;19) was balanced or unbalanced did not influence EFS or OS...
19 CFR 102.23 - Origin and Manufacturer Identification
2010-04-01
... Section 102.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... address of the entity performing the origin-conferring operations pursuant to § 102.21 or § 102.22, as... product from CBP custody will be denied until a determination of the country of origin is made based upon...
de Blay, F; Sanchez, J; Hedelin, G; Perez-Infante, A; Vérot, A; Chapman, M; Pauli, G
1997-01-01
Although a strong association between allergy to cockroach (CR) and asthma has been observed in the United States and Asia, there are little data about the extent of exposure to CR allergen in Europe. To determine the levels of CR allergens in dust samples from apartments in Strasbourg and to determine the concentration and size of CR allergens in the air. Nine apartments in a public housing complex were chosen on the basis of visual evidence of CR infestation. Levels of CR allergens (Bla g 1 and Bla g 2) in kitchen and mattress dust samples were measured by immunoassay with the use of monoclonal antibodies. Air was sampled for 3 to 8 hours in the kitchen under undisturbed conditions, during artificial disturbance, and during normal domestic activity by using an impinger and a parallel glass fiber filter and at flow rates of 2 to 20 L/min. Airborne CR and mite allergens were measured concurrently in the bedroom of one apartment before, during, and after artificial disturbance. High levels of Bla g 1 and Bla g 2 were found in kitchen dust from the nine apartments (geometric means of 3919 U/gm [range 530 to 14306 U/gm] and 497 U/gm [range 73 to 1946 U/gm], respectively). Under undisturbed conditions, airborne CR allergens were not detectable in any of the apartments. During vigorous artificial disturbance, Bla g 1 and Bla g 2 were detectable in air samples from seven apartments (geometric means of 4.5 U/m3 [range 0.7 to 17.2 U/m3] and 1.0 U/m3 [range 0.4 to 3.4 U/m3], respectively). Both allergens were predominantly collected on the first stage of the impinger, and 76% to 80% of the airborne allergen was associated with particles greater than 10 microns in diameter. The levels were significantly higher than those collected on the second or third stages of the impinger (p low-cost public housing in Strasbourg can be as high as or higher than the levels measured in towns in the United States. CR allergens become airborne during disturbance and are primarily associated
International Nuclear Information System (INIS)
Budnitz, R.J.; Smith, P.
1996-01-01
Within the scope of the TC Project RER/9/035, a review mission visited Ljubljana, Slovenia, 19-23 February 1996. Two outside experts, Messrs. R.J. Budnitz (USA) and Paul Smith (USA), as well as a staff member, A. Guerpinar (ESS-NSNI) took part in the review. The purpose of the mission was to assist the Slovenian Nuclear Safety Administration to review the external events PSA prepared by Krsko NPP consultants Westinghouse Energy Systems Europe and EQE International. Another seismic safety review was performed concurrently in Ljubljana involving the investigations in relation to the tectonic stability and reassessment of the design basis ground motion characterization for the Krsko NPP site
Directory of Open Access Journals (Sweden)
Shalinder Singh
2012-01-01
Full Text Available Insertional translocations in which a duplicated region of one chromosome is inserted into another chromosome are very rare. We report a 16.5-year-old girl with a terminal duplication at 9q34.3 of paternal origin inserted into 19q13.4. Chromosomal analysis revealed the karyotype 46,XX,der(19ins(19;9(q13.4;q34.3q34.3pat. Cytogenetic microarray analysis (CMA identified a ~2.3Mb duplication of 9q, which was confirmed by Fluorescence in situ hybridisation (FISH. The duplication at 9q34.3 is the smallest among the cases reported so far. The proband exhibits similar clinical features to those previously reported cases with larger duplication events.
Energy Technology Data Exchange (ETDEWEB)
Serne, R. Jeffrey; Bjornstad, Bruce N.; Lanigan, David C.; Gee, Glendon W.; Lindenmeier, Clark W.; Clayton, Ray E.; Legore, Virginia L.; O' Hara, Matthew J.; Brown, Christopher F.; Last, George V.; Kutnyakov, Igor V.; Burke, Deborah S.; Wilson, Teresa C.; Williams, Bruce A.
2008-09-11
This report was revised in September 2008 to remove acid-extractable sodium data from Tables 4.15 and 4.19. The sodium data was removed due to potential contamination introduced during the acid extraction process. The rest of the text remains unchanged from the original report issued in February 2002. The Tank Farm Vadose Zone Project is led by CH2M HILL Hanford Group, Inc. Their goals include defining risks from past and future single-shell tank farm activities, identifying and evaluating the efficacy of interim measures, and collecting geotechnical information and data. The purpose of these activities is to support future decisions made by the U.S. Department of Energy (DOE) regarding near-term operations, future waste retrieval, and final closure activities for the single-shell tank Waste Management Areas. To help in this effort, CH2M HILL Hanford Group, Inc. contracted with scientists at Pacific Northwest National Laboratory to analyze sediment samples collected from borehole 299-W23-19.
Labrude, Pierre; Strohl, Stéphanie
2007-05-01
The conclusion of the war conducted by France in 1870 was the annexation of Alsace and Moselle to the German Empire. The question of the becoming of the University of Strasbourg was put a long time before the Francfort treaty.... After many discussions, the transfer of the Faculty of medicine and of the School of pharmacy to Nancy was decided on October 1st 1872. First bound to the faculty, the school became independent in 1876. It suffered some difficult years because of the terms of the transfer decree, of the retirement of two of its four professors, of the ministerial decision to keep free the chairs for some time in order to save money, and of the difficulties of the recruitment of new professors. The paper describes successively the difficulties of the choice of Nancy for the transfer, the situation of the schools of Strasbourg and Nancy in the year 1870, the text of the decree, the beginning of the teachings and the difficulties encountered with the chairs of pharmacy and natural history, and finally the pharmacy students come in Nancy during the early years. Some thoughts on this transfer and on the difficulties occured during these years precede the conclusion.
Weinhold, Mario; Eisenblätter, Martin; Jasny, Edith; Fehlings, Michael; Finke, Antje; Gayum, Hermine; Rüschendorf, Ursula; Renner Viveros, Pablo; Moos, Verena; Allers, Kristina; Schneider, Thomas; Schaible, Ulrich E.; Schumann, Ralf R.; Mielke, Martin E.; Ignatius, Ralf
2013-01-01
Background Bacterial vectors have been proposed as novel vaccine strategies to induce strong cellular immunity. Attenuated strains of Brucella abortus comprise promising vector candidates since they have the potential to induce strong CD4+ and CD8+ T-cell mediated immune responses in the absence of excessive inflammation as observed with other Gram-negative bacteria. However, some Brucella strains interfere with the maturation of dendritic cells (DCs), which is essential for antigen-specific T-cell priming. In the present study, we investigated the interaction of human monocyte-derived DCs with the smooth attenuated B. abortus strain (S) 19, which has previously been employed successfully to vaccinate cattle. Methodology/Principal findings We first looked into the potential of S19 to hamper the cytokine-induced maturation of DCs; however, infected cells expressed CD25, CD40, CD80, and CD86 to a comparable extent as uninfected, cytokine-matured DCs. Furthermore, S19 activated DCs in the absence of exogeneous stimuli, enhanced the expression of HLA-ABC and HLA-DR, and was able to persist intracellularly without causing cytotoxicity. Thus, DCs provide a cellular niche for persisting brucellae in vivo as a permanent source of antigen. S19-infected DCs produced IL-12/23p40, IL-12p70, and IL-10, but not IL-23. While heat-killed bacteria also activated DCs, soluble mediators were not involved in S19-induced activation of human DCs. HEK 293 transfectants revealed cellular activation by S19 primarily through engagement of Toll-like receptor (TLR)2. Conclusions/Significance Thus, as an immunological prerequisite for vaccine efficacy, B. abortus S19 potently infects and potently activates (most likely via TLR2) human DCs to produce Th1-promoting cytokines. PMID:23805193
Directory of Open Access Journals (Sweden)
Mario Weinhold
Full Text Available Bacterial vectors have been proposed as novel vaccine strategies to induce strong cellular immunity. Attenuated strains of Brucella abortus comprise promising vector candidates since they have the potential to induce strong CD4(+ and CD8(+ T-cell mediated immune responses in the absence of excessive inflammation as observed with other Gram-negative bacteria. However, some Brucella strains interfere with the maturation of dendritic cells (DCs, which is essential for antigen-specific T-cell priming. In the present study, we investigated the interaction of human monocyte-derived DCs with the smooth attenuated B. abortus strain (S 19, which has previously been employed successfully to vaccinate cattle.We first looked into the potential of S19 to hamper the cytokine-induced maturation of DCs; however, infected cells expressed CD25, CD40, CD80, and CD86 to a comparable extent as uninfected, cytokine-matured DCs. Furthermore, S19 activated DCs in the absence of exogeneous stimuli, enhanced the expression of HLA-ABC and HLA-DR, and was able to persist intracellularly without causing cytotoxicity. Thus, DCs provide a cellular niche for persisting brucellae in vivo as a permanent source of antigen. S19-infected DCs produced IL-12/23p40, IL-12p70, and IL-10, but not IL-23. While heat-killed bacteria also activated DCs, soluble mediators were not involved in S19-induced activation of human DCs. HEK 293 transfectants revealed cellular activation by S19 primarily through engagement of Toll-like receptor (TLR2.Thus, as an immunological prerequisite for vaccine efficacy, B. abortus S19 potently infects and potently activates (most likely via TLR2 human DCs to produce Th1-promoting cytokines.
32 CFR 270.19 - Reports to Congress.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Reports to Congress. 270.19 Section 270.19... Reports to Congress § 270.19 Reports to Congress. Not later than September 23, 1998, the Commission will prepare and the Secretary will submit to Congress a report on the payment of claims under this part...
Indian Academy of Sciences (India)
Elected: 2015 Section: Physics. Ojha, Prof. Devendra Kumar Ph.D. (Strasbourg). Date of birth: 23 August 1967. Specialization: Star Formation & Interstellar Medium, Infrared Astronomy, Astronomical Instrumentation Address: Department of Astronomy & Astrophysics, Tata Institute of Fundamental Research, Homi Bhabha ...
Liu, Esther Yip-Mei; Chang, Jen-Chang; Lin, Jung-Chung; Chang, Feng-Yee; Fung, Chang-Phone
2016-12-01
Penicillin-resistant Streptococcus pneumoniae is a serious concern worldwide. In this study, we analyzed the cause of β-lactam resistance in pandemic multidrug-resistant clones. A total of 41 penicillin-nonsusceptible clinical isolates were collected from 1996 to 2012. Sero- and molecular typing confirmed that these isolates were clonal types of Taiwan 19F -14, Taiwan 23F -15, and Spain 23F -1. Sero-switching was found in four isolates. All isolates were multidrug resistant. Sequencing analysis of the penicillin binding proteins (PBPs) was performed on PBP1a, 2b, and 2x, and a large number of mutations were identified in comparing to clinical penicillin-susceptible isolates and the recipient strain R6 used for homologous recombination. The T 451 A substitution was the key amino acid in PBP2b that contributed to penicillin resistance. T 338 A in PBP2x played a role in resistance and reached the highest level of resistance when combined with other mutations in PBP2x. High-level penicillin resistance could not be obtained without the combination of mutations in PBP1a with PBP2b and 2x. The amino acid substitutions in PBP1a, 2b, and 2x were the crucial factors for β-lactam resistance.
Identification of ensuremath J^{π = 19/2^+} and ensuremath 23/2^+ isomeric states in 127Sb
Watanabe, H.; Lane, G. J.; Dracoulis, G. D.; Byrne, A. P.; Nieminen, P.; Kondev, F. G.; Ogawa, K.; Carpenter, M. P.; Janssens, R. V. F.; Lauritsen, T.; Seweryniak, D.; Zhu, S.; Chowdhury, P.
2009-11-01
The nucleus ensuremath ^{127Sb} , which is on the neutron-rich periphery of the ensuremath β -stability region, has been populated in complex nuclear reactions involving deep-inelastic and fusion-fission processes with ensuremath {^{136}Xe} beams incident on thick targets. The previously known isomer at 2325 keV in ensuremath {^{127}Sb} has been assigned spin and parity ensuremath 23/2^+ , based on the measured ensuremath γ - ensuremath γ angular correlations and total internal conversion coefficients. The half-life has been determined to be 234(12) ns, somewhat longer than the value reported previously. The 2194 keV state has been assigned ensuremath J^{π} = 19/2^+ and identified as an isomer with ensuremath T_{1/2} = 14(1) ns , decaying by two ensuremath E2 branches. The observed level energies and transition strengths are compared with the predictions of a shell model calculation. Two ensuremath 15/2^+ states have been identified close in energy, and their properties are discussed in terms of mixing between vibrational and three-quasiparticle configurations.
Miething, Alexander; Rostila, Mikael; Edling, Christofer; Rydgren, Jens
2016-01-01
The present study examines how the composition of social networks and perceived relationship content influence peer clustering in smoking, and how the association changes during the transition from late adolescence to early adulthood. The analysis was based on a Swedish two-wave survey sample comprising ego-centric network data. Respondents were 19 years old in the initial wave, and 23 when the follow-up sample was conducted. 17,227 ego-alter dyads were included in the analyses, which corresponds to an average response rate of 48.7 percent. Random effects logistic regression models were performed to calculate gender-specific average marginal effects of social network characteristics on smoking. The association of egos' and alters' smoking behavior was confirmed and found to be stronger when correlated in the female sample. For females, the associations decreased between age 19 and 23. Interactions between network characteristics and peer clustering in smoking showed that intense social interactions with smokers increase egos' smoking probability. The influence of network structures on peer clustering in smoking decreased during the transition from late adolescence to early adulthood. The study confirmed peer clustering in smoking and revealed that females' smoking behavior in particular is determined by social interactions. Female smokers' propensity to interact with other smokers was found to be associated with the quality of peer relationships, frequent social interactions, and network density. The influence of social networks on peer clustering in smoking decreased during the transition from late adolescence to early adulthood.
The role of IL 23 in the treatment of psoriasis.
Puig, Lluís
2017-06-01
The IL-23/IL-17 axis is currently considered to be crucial in the pathogenesis of psoriasis. Human IL-23 is primarily produced by antigen-presenting cells and induces and maintains differentiation of Th17 cells and Th22 cells, a primary cellular source of proinflammatory cytokines such as IL-17 and IL-22, which mediate the epidermal hyperplasia, keratinocyte immune activation and tissue inflammation inherent in psoriasis. Agents that target the p40 subunit common to both IL-12 and IL-23 have shown robust clinical activity, but selectivity for IL-23p19 could offer advantages in efficacy and safety with respect to anti-p40 blockade. Areas covered: Relevant references regarding the role of the IL-23/IL-17 pathway in the pathogenesis of psoriasis/psoriatic arthritis and clinical trials with IL-23p40 and IL-23p19 blocking agents were obtained through a literature search in MEDLINE/Pubmed for articles published until November 2016. Moreover, ongoing registered clinical trials (RCTs) of moderate-to-severe psoriasis and psoriatic arthritis were searched through clinicaltrials.gov website, and a manual search was made for pertinent communications at the 2016 American Academy of Dermatology and European Academy of Dermatology and Venereology meetings. Expert commentary: There are potential advantages in selective blockade of the IL23-specific p19 subunit with respect to distal blockade of IL-17A or its receptor. Acting upstream in the IL-23/IL-17 cytokine pathway is likely to reduce the expression of multiple pro-inflammatory cytokines acting on keratinocytes -including IL-17F, IL-21 and IL-22-, in addition to IL-17A. On the other hand, safety data thus far suggest that these drugs might be devoid of some adverse effects of IL-17A blockade that seem to be class related, such as mucocutaneous Candida infections or triggering or worsening of inflammatory bowel disease. Specific IL-23p19 blockade with high-affinity monoclonal antibodies seems to be able to induce long
Energy Technology Data Exchange (ETDEWEB)
Beyer, Brian M.; Ingram, Richard; Ramanathan, Lata; Reichert, Paul; Le, Hung V.; Madison, Vincent; Orth, Peter (SPRI)
2009-06-25
Interleukin (IL)-23 is a pro-inflammatory cytokine playing a key role in the pathogenesis of several autoimmune and inflammatory diseases. We have determined the crystal structures of the heterodimeric p19-p40 IL-23 and its complex with the Fab (antigen-binding fragment) of a neutralizing antibody at 2.9 and 1.9 {angstrom}, respectively. The IL-23 structure closely resembles that of IL-12. They share the common p40 subunit, and IL-23 p19 overlaps well with IL-12 p35. Along the hydrophilic heterodimeric interface, fewer charged residues are involved for IL-23 compared with IL-12. The binding site of the Fab is located exclusively on the p19 subunit, and comparison with published cytokine-receptor structures suggests that it overlaps with the IL-23 receptor binding site.
Compartir buenas prácticas docentes en la European Law Faculties Association
Directory of Open Access Journals (Sweden)
Ana Maria Delgado
2014-06-01
Full Text Available La European Law Faculties Association (http://elfa-afde.eu celebró la asamblea y la conferencia anual (http://elfa-afde.eu/agm-2014-strasbourg, coorganizada con el Parlamento Europeo, los días 19 a 21 de marzo de este año, en Estrasburgo.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Length. 658.13 Section 658.13 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS TRUCK SIZE AND WEIGHT, ROUTE... Network or in transit between these highways and terminals or service locations pursuant to § 658.19. (b...
International Nuclear Information System (INIS)
Serne, R. Jeffrey; Schaef, Herbert T.; Bjornstad, Bruce N.; Lanigan, David C.; Gee, Glendon W.; Lindenmeier, Clark W.; Clayton, Ray E.; Legore, Virginia L.; Orr, Robert D.; O'Hara, Matthew J.; Brown, Christopher F.; Last, George V.; Kutnyakov, Igor V.; Burke, Deborah Sd; Wilson, Teresa C.; Williams, Bruce A.
2001-01-01
The Tank Farm Vadose Zone Project is led by CH2M HILL Hanford Group, Inc. Their goals include defining risks from past and future single-shell tank farm activities, identifying and evaluating the efficacy of interim measures, and collecting geo-technical information and data. The purpose of these activities is to support future decisions made by the U.S. Department of Energy regarding near-term operations, future waste retrieval, and final closure activities for the single-shell tank Waste Management Areas. To help in this effort, CH2M HILL contracted with scientists at Pacific Northwest National Laboratory to analyze sediment samples collected from borehole 299-W23-19. The conclusions reached from this study support specific mechanisms influencing subsurface migration of contaminants. The mechanisms are supported by the distributions of contaminants beneath tank farms. These observations will help DOE and CH2M HILL identify and implement viable remediation and closure activities
Molle, Céline; Zhang, Tong; Ysebrant de Lendonck, Laure; Gueydan, Cyril; Andrianne, Mathieu; Sherer, Félicie; Van Simaeys, Gaetan; Blackshear, Perry J; Leo, Oberdan; Goriely, Stanislas
2013-08-26
Interleukin (IL) 12 and IL23 are two related heterodimeric cytokines produced by antigen-presenting cells. The balance between these two cytokines plays a crucial role in the control of Th1/Th17 responses and autoimmune inflammation. Most studies focused on their transcriptional regulation. Herein, we explored the role of the adenine and uridine-rich element (ARE)-binding protein tristetraprolin (TTP) in influencing mRNA stability of IL12p35, IL12/23p40, and IL23p19 subunits. LPS-stimulated bone marrow-derived dendritic cells (BMDCs) from TTP(-/-) mice produced normal levels of IL12/23p40. Production of IL12p70 was modestly increased in these conditions. In contrast, we observed a strong impact of TTP on IL23 production and IL23p19 mRNA stability through several AREs in the 3' untranslated region. TTP(-/-) mice spontaneously develop an inflammatory syndrome characterized by cachexia, myeloid hyperplasia, dermatitis, and erosive arthritis. We observed IL23p19 expression within skin lesions associated with exacerbated IL17A and IL22 production by infiltrating γδ T cells and draining lymph node CD4 T cells. We demonstrate that the clinical and immunological parameters associated with TTP deficiency were completely dependent on the IL23-IL17A axis. We conclude that tight control of IL23 mRNA stability by TTP is critical to avoid severe inflammation.
19 CFR 147.23 - Compliance with Plant Quarantine Act and Federal Food, Drug, and Cosmetic Act.
2010-04-01
... Food, Drug, and Cosmetic Act. 147.23 Section 147.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... Laws § 147.23 Compliance with Plant Quarantine Act and Federal Food, Drug, and Cosmetic Act. (a) Plant... the plant quarantine regulations. (b) Federal Food, Drug, and Cosmetic Act. The entry of food products...
File list: Unc.PSC.05.AllAg.P19 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.PSC.05.AllAg.P19 mm9 Unclassified Pluripotent stem cell P19 SRX1098120,SRX10981...23,SRX1098121,SRX1098122,SRX1098125,SRX1098124 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.PSC.05.AllAg.P19.bed ...
Shimozato, Osamu; Ugai, Shin-ichi; Chiyo, Masako; Takenobu, Hisanori; Nagakawa, Hiroyasu; Wada, Akihiko; Kawamura, Kiyoko; Yamamoto, Hiroshi; Tagawa, Masatoshi
2006-01-01
Interleukin (IL)-23 is a heterodimeric cytokine consisting of a novel p19 molecule and the p40 subunit of IL-12. Since secreted p40 can act as an antagonist for IL-12, we investigated whether p40 also inhibited IL-23-mediated immunological functions. p40 did not induce interferon (IFN)-γ or IL-17 production from splenocytes but impaired IL-23-induced cytokine production by competitive binding to the IL-23 receptors. Furthermore, a mixed population of murine colon carcinoma Colon 26 cells transduced with the p40 gene and those transduced with the IL-23 gene developed tumours in syngenic mice, whereas the IL-23-expressing Colon 26 cells were completely rejected. p40 also suppressed IFN-γ production of antigen-stimulated splenocytes and IL-23-mediated cytotoxic T-lymphocyte activities in the mice that rejected Colon 26 cells expressing IL-23. p40 can thereby antagonize IL-23 and is a possible therapeutic agent for suppression of IL-23 functions. PMID:16423037
Directory of Open Access Journals (Sweden)
Taeyeon Kim
Full Text Available Biological production of 2,3-butandiol (2,3-BD has received great attention as an alternative to the petroleum-based 2,3-BD production. In this study, a high production of 2,3-BD in fed-batch fermentation was investigated with a newly isolated bacterium designated as Raoultella ornithinolytica B6. The isolate produced 2,3-BD as the main product using hexoses (glucose, galactose, and fructose, pentose (xylose and disaccharide (sucrose. The effects of temperature, pH-control schemes, and agitation speeds on 2,3-BD production were explored to optimize the fermentation conditions. Notably, cell growth and 2,3-BD production by R. ornithinolytica B6 were higher at 25°C than at 30°C. When three pH control schemes (no pH control, pH control at 7, and pH control at 5.5 after the pH was decreased to 5.5 during fermentation were tested, the best 2,3-BD titer and productivity along with reduced by-product formation were achieved with pH control at 5.5. Among different agitation speeds (300, 400, and 500 rpm, the optimum agitation speed was 400 rpm with 2,3-BD titer of 68.27 g/L, but acetic acid was accumulated up to 23.32 g/L. Further enhancement of the 2,3-BD titer (112.19 g/L, yield (0.38 g/g, and productivity (1.35 g/L/h as well as a significant reduction of acetic acid accumulation (9.71 g/L was achieved by the overexpression of homologous budABC genes, the 2,3-BD-synthesis genes involved in the conversion of pyruvate to 2,3-BD. This is the first report presenting a high 2,3-BD production by R.ornithinolytica which has attracted little attention with respect to 2,3-BD production, extending the microbial spectrum of 2,3-BD producers.
Le Minor, Jean-Marie
2007-01-01
Théodore Vetter (Strasbourg, 1916, June 19th - 2004, July 8th) was qualified as a medical doctor in medicine in 1948 in Strasbourg, and then followed complementary courses in medical biology in Paris. He realized most of his career as an adviser for medical research in pharmaceutical industry. He presented an early talent for drawing and graphic arts, encouraged by Georges Ritleng (1875-1972), headmaster of the School of decorative arts in Strasbourg. One expression of the artistic gift of Th. Vetter consisted in design and making of ex-libris, field in which he acquired an international reputation. In total, he realized about two hundred ex-libris, mostly for physicians. Also attracted by the history of medicine, he became a member of the Société Française d'Histoire de la Médecine; he was general secretary from 1965 to 1970, then he became vice-president and president from 1976 to 1978. He was the author of about a hundred works concerning the history of medicine; all were characterized by a great rigour and by the direct use of original sources. Among his main works, his studies on the oculist Jacques Daviel (1693-1762), popularizer of the surgery of cataract, on the surgeon Claude Nicolas Le Cat (1700-1768), on the birth of pathology, a commented edition of the complete works of Hippocrates, translated by M.P.E. Littré (1801-1881), and numerous papers on the history of medicine in Strasbourg and Alsace.
ALICE honours two Italian suppliers
2006-01-01
During the ALICE week held in Bologna from 19 to 23 June, the Collaboration recognized two of its top suppliers. From left to right: Robert Terpin (MIPOT), Pier Luigi Bellutti (ITC), Andrea Zanotti, President of ITC, Luciano Bosisio (Trieste University), Gennady Zinovjev (Kiev), Catherine Decosse (CERN), Lodovico Riccati, ALICE Collaboration Board Chair (INFN Torino), Paolo Giubellino (INFN Torino), Mario Zen, Director of ITC, Maurizio Boscardin (ITC), Paolo Tonella (ITC), Jurgen Schukraft, ALICE Spokesperson (CERN), Giacomo Vito Margagliotti (Trieste University), Nevio Grion (INFN Trieste), Marco Bregant (INFN Trieste). Front row from left to right: Paolo Traverso (ITC), Federico Carminati, ALICE Computing Project Leader (CERN), and Jean-Robert Lutz, ITS-SSD Project leader (IPHC Strasbourg). It is in the picturesque city of Bologna that the ALICE Collaboration has rewarded two Italian suppliers, Istituto Trentino di Cultura ITC-irst (Trento) and MIPOT (Cormons), both involved in the construction of the Sili...
46 CFR 76.23-90 - Installations contracted for prior to November 19, 1952.
2010-10-01
... and they are maintained in good condition to the satisfaction of the Officer in Charge, Marine Inspection. Minor repairs and replacements may be made to the same standards as the original installation. (2... VESSELS FIRE PROTECTION EQUIPMENT Manual Sprinkling System, Details § 76.23-90 Installations contracted...
Anti-IL-39 (IL-23p19/Ebi3) polyclonal antibodies ameliorate autoimmune symptoms in lupus-like mice
Wang, Xiaoqian; Zhang, Yu; Wang, Zhiding; Liu, Xiaoling; Zhu, Gaizhi; Han, Gencheng; Chen, Guojiang; Hou, Chunmei; Wang, Tianxiao; Shen, Beifen; Li, Yan; Xiao, He; Ma, Ning; Wang, Renxi
2018-01-01
The interleukin (IL)-12 family cytokines have been examined as therapeutic targets in the treatment of several autoimmune diseases. Our previous study showed that a novel IL-12 family cytokine, IL-39 (IL-23p19/Ebi3) mediates inflammation in lupus-like mice. In the present study, the effect of anti-mouse IL-39 polyclonal antibodies on autoimmune symptoms in lupus-like mice was investigated. Rabbit anti-mouse IL-39 polyclonal antibodies were produced by immunization with recombinant mouse IL-39, and purified using protein A chromatography. These antibodies were subsequently used to treat lupus-like mice. Flow cytometry, captured images, ELISA and H&E staining were used to determine the effect of anti-IL-39 polyclonal antibodies on inflammatory cells, autoantibody titers, proteinuria, infiltrating inflammatory cells and the structure of the glomerular region. The anti-IL-39 polyclonal antibodies effectively reduced the numbers of inflammatory cells, splenomegaly, autoantibody titers, proteinuria, infiltrating inflammatory cells, and restored the structure of the glomerular region in MRL/lpr mice. Taken together, these results suggested that anti-IL-39 polyclonal antibodies ameliorated autoimmune symptoms in lupus-like mice. Therefore, IL-39 may be used as a possible target for the treatment of systemic lupus erythematosus. PMID:29138852
Relationship between proguanil metabolic ratio and CYP2C19 genotype in a Caucasian population.
Hoskins, J M; Shenfield, G M; Gross, A S
1998-11-01
To investigate the relationship between proguanil metabolic ratio (MR, proguanil/cycloguanil) and CYP2C19 genotype in a Caucasian population. Ninety-nine Caucasians (age range: 18-55 years, 54 female, 45 male) were genotyped for CYP2C19 and phenotyped for proguanil oxidation by collecting urine for 8 h after taking 100 mg proguanil hydrochloride. Proguanil and cycloguanil concentrations were measured by h.p.l.c. PCR was employed for CYP2C19 genotyping. The three (3%) individuals who were homozygous for CYP2C19*2 (*2/*2) had the highest proguanil MRs (range: 8.0-134.6). Seventy-three (74%) individuals were homozygous for the wild-type allele (*1/*1) and 23 (23%) were heterozygous (*1/*2). The *1/*1 individuals had lower MRs (median=1.4, range: 0.23-5.9, P=0.003, Mann-Whitney U-test) than the *1/*2 subjects (median=2.5, range: 0.88-7.3). A CYP2C19 gene-dose effect for proguanil oxidation to cycloguanil was observed, confirming a role for CYP2C19 in cycloguanil formation in vivo. However, there was substantial overlap of proguanil MRs in subjects of different CYP2C19 genotypes, due possibly to variability in the activity of other enzymes contributing to the formation of cycloguanil.
International Nuclear Information System (INIS)
Gaillard, Y.R.
1975-01-01
Angular distributions of analyzing power and differential cross section have been measured for the elastic and inelastic scattering of polarized protons on 12 C, up to 12.7MeV excitation energy. Incident energy varied from 19 to 23MeV by steps of about 200keV, the cyclotron beam energy, varying by steps of about 1MeV, was measured using crossover techniques. Fine steps of energy were obtained by use of carbon absorbers. Elastic scattering data were analyzed using a linear energy-dependent optical model. Data for the level at 4.4MeV excitation energy were analyzed using coupled channel calculations. Preliminary results for the level (1 - , Esub(x)=12.7MeV) were analyzed including giant resonances as doorways states in inelastic scattering, according to Geramb-Amos formalism. This analysis shows that it should be possible to study high-lying giant resonances through their contribution to low-lying state excitation [fr
National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical, profile and laboratory analysis oceanographic data were collected aboard the OCEAN VERITAS in the Gulf of Mexico from 2010-07-19 to 2010-07-23 in...
National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical, profile and laboratory analysis oceanographic data were collected aboard the OCEAN VERITAS in the Gulf of Mexico from 2010-06-19 to 2010-06-23 in...
International Nuclear Information System (INIS)
Shirouzono, Takumi; Chirifu, Mami; Nakamura, Chiharu; Yamagata, Yuriko; Ikemizu, Shinji
2012-01-01
Interleukin-23 (IL-23), a member of the IL-12 family, is a heterodimeric cytokine composed of p19 and p40 subunits. Human p19 and p40 subunits were cloned and coexpressed in N-acetylglucosaminyltransferase I-negative 293S cells. The glycosylated human IL-23 was purified and crystallized by the hanging-drop vapour-diffusion method. Interleukin-23 (IL-23), a member of the IL-12 family, is a heterodimeric cytokine composed of p19 and p40 subunits. IL-23 plays crucial roles in the activation, proliferation and survival of IL-17-producing helper T cells which induce various autoimmune diseases. Human p19 and p40 subunits were cloned and coexpressed in N-acetylglucosaminyltransferase I-negative 293S cells, which produce high-mannose-type glycosylated proteins in order to diminish the heterogeneity of modified N-linked glycans. The glycosylated human IL-23 was purified and crystallized by the hanging-drop vapour-diffusion method. X-ray diffraction data were then collected to 2.6 Å resolution. The crystal belonged to space group P6 1 or P6 5 , with unit-cell parameters a = b = 108.94, c = 83.79 Å, γ = 120°. Assuming that the crystal contains one molecule per asymmetric unit, the calculated Matthews coefficient was 2.69 Å 3 Da −1 , with a solvent content of 54.2%. The structure was determined by the molecular-replacement method, with an initial R factor of 52.6%. After subsequent rigid-body and positional refinement, the R work and R free values decreased to 31.4% and 38.7%, respectively
Low-temperature heat capacity of Al(C11H19O2)3
International Nuclear Information System (INIS)
Bespyatov, Michael A.; Chernyaikin, Ivan S.; Naumov, Viktor N.; Stabnikov, Pavel A.; Gelfond, Nikolay V.
2014-01-01
Highlights: • The temperature dependence of heat capacity of Al(C 11 H 19 O 2 ) 3 has been measured. • The experimental data were used to calculate standard thermodynamic functions. • The thermodynamic functions at 298.15 K are presented. - Abstract: The heat capacity of Al(C 11 H 19 O 2 ) 3 was measured by adiabatic-shield calorimetry in the temperature range 6–320 K; no transition or thermal anomalies were found. The thermodynamic functions (entropy, enthalpy, and reduced Gibbs free energy) at 298.15 K have been calculated using the obtained experimental heat capacity data. The obtained standard values are as follows: C° p,m = (882.3 ± 1.3) J mol −1 K −1 , Δ 0 298.15 S° m = J(980 ± 2) mol −1 K −1 , Δ 0 298.15 H° m = (145.1 ± 0.2) kJ mol −1 , Φ° m = (493.4 ± 1.7) J mol −1 K −1
Desmyter, Aline; Spinelli, Silvia; Boutton, Carlo; Saunders, Michael; Blachetot, Christophe; de Haard, Hans; Denecker, Geertrui; Van Roy, Maarten; Cambillau, Christian; Rommelaere, Heidi
2017-01-01
The heterodimeric cytokine interleukin (IL) 23 comprises the IL12-shared p40 subunit and an IL23-specific subunit, p19. Together with IL12 and IL27, IL23 sits at the apex of the regulatory mechanisms shaping adaptive immune responses. IL23, together with IL17, plays an important role in the development of chronic inflammation and autoimmune inflammatory diseases. In this context, we generated monovalent antihuman IL23 variable heavy chain domain of llama heavy chain antibody (V HH ) domains (Nanobodies ® ) with low nanomolar affinity for human interleukin (hIL) 23. The crystal structure of a quaternary complex assembling hIL23 and several nanobodies against p19 and p40 subunits allowed identification of distinct epitopes and enabled rational design of a multivalent IL23-specific blocking nanobody. Taking advantage of the ease of nanobody formatting, multivalent IL23 nanobodies were assembled with properly designed linkers flanking an antihuman serum albumin nanobody, with improved hIL23 neutralization capacity in vitro and in vivo , as compared to the monovalent nanobodies. These constructs with long exposure time are excellent candidates for further developments targeting Crohn's disease, rheumatoid arthritis, and psoriasis.
Directory of Open Access Journals (Sweden)
Aline Desmyter
2017-08-01
Full Text Available The heterodimeric cytokine interleukin (IL 23 comprises the IL12-shared p40 subunit and an IL23-specific subunit, p19. Together with IL12 and IL27, IL23 sits at the apex of the regulatory mechanisms shaping adaptive immune responses. IL23, together with IL17, plays an important role in the development of chronic inflammation and autoimmune inflammatory diseases. In this context, we generated monovalent antihuman IL23 variable heavy chain domain of llama heavy chain antibody (VHH domains (Nanobodies® with low nanomolar affinity for human interleukin (hIL 23. The crystal structure of a quaternary complex assembling hIL23 and several nanobodies against p19 and p40 subunits allowed identification of distinct epitopes and enabled rational design of a multivalent IL23-specific blocking nanobody. Taking advantage of the ease of nanobody formatting, multivalent IL23 nanobodies were assembled with properly designed linkers flanking an antihuman serum albumin nanobody, with improved hIL23 neutralization capacity in vitro and in vivo, as compared to the monovalent nanobodies. These constructs with long exposure time are excellent candidates for further developments targeting Crohn’s disease, rheumatoid arthritis, and psoriasis.
Desmyter, Aline; Spinelli, Silvia; Boutton, Carlo; Saunders, Michael; Blachetot, Christophe; de Haard, Hans; Denecker, Geertrui; Van Roy, Maarten; Cambillau, Christian; Rommelaere, Heidi
2017-01-01
The heterodimeric cytokine interleukin (IL) 23 comprises the IL12-shared p40 subunit and an IL23-specific subunit, p19. Together with IL12 and IL27, IL23 sits at the apex of the regulatory mechanisms shaping adaptive immune responses. IL23, together with IL17, plays an important role in the development of chronic inflammation and autoimmune inflammatory diseases. In this context, we generated monovalent antihuman IL23 variable heavy chain domain of llama heavy chain antibody (VHH) domains (Nanobodies®) with low nanomolar affinity for human interleukin (hIL) 23. The crystal structure of a quaternary complex assembling hIL23 and several nanobodies against p19 and p40 subunits allowed identification of distinct epitopes and enabled rational design of a multivalent IL23-specific blocking nanobody. Taking advantage of the ease of nanobody formatting, multivalent IL23 nanobodies were assembled with properly designed linkers flanking an antihuman serum albumin nanobody, with improved hIL23 neutralization capacity in vitro and in vivo, as compared to the monovalent nanobodies. These constructs with long exposure time are excellent candidates for further developments targeting Crohn’s disease, rheumatoid arthritis, and psoriasis. PMID:28871249
2016-11-18
gun for one fire command 56 24 Boxes of rounds loaded for the .50 Cal Machine Gun on an Abrams Tank 56 25 Mean estimates of time spent by 19Ds...Number of rounds loaded for one fire command 55 22 Total boxes of rounds loaded for .50 cal machine gun on an Abrams tank 56 23 Number of Soldiers...and 19K MOSs, respectively). A total o f 8,580 Army calvary scouts and 6,613 armor crewmen in the USA Army as of May or June of 2014 were invited
A global analysis of Y-chromosomal haplotype diversity for 23 STR loci
DEFF Research Database (Denmark)
Purps, Josephine; Siegert, Sabine; Willuweit, Sascha
2014-01-01
In a worldwide collaborative effort, 19,630 Y-chromosomes were sampled from 129 different populations in 51 countries. These chromosomes were typed for 23 short-tandem repeat (STR) loci (DYS19, DYS389I, DYS389II, DYS390, DYS391, DYS392, DYS393, DYS385ab, DYS437, DYS438, DYS439, DYS448, DYS456, DY...
19 CFR 148.24 - Determination of dutiable value.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Determination of dutiable value. 148.24 Section... Collection of Duties and Taxes § 148.24 Determination of dutiable value. (a) Principles applied. In determining the dutiable value of articles examined under § 148.23, the Customs inspector shall apply the...
IAEA Team Reviews Safety Progress at French Nuclear Power Plant 19-23 May 2014
International Nuclear Information System (INIS)
2014-01-01
An international team of nuclear installation safety experts led by the International Atomic Energy Agency (IAEA) has evaluated the Gravelines Nuclear Power Plant (NPP) in France to assess how the station has followed up on an Operational Safety Review Team (OSART) mission undertaken in 2012. The IAEA assembled a team of experts at the request of the Government of France to conduct the follow-up OSART mission at Gravelines NPP from 19 to 23 May 2014. Follow-up missions are standard components of the OSART programme; they are typically conducted 15-24 months after the initial OSART mission. The IAEA mission in 2012 made a number of recommendations and suggestions for consideration by the Gravelines NPP operators. The station thoroughly analyzed the OSART recommendations and suggestions and developed corrective action plans. In 18 months, the Gravelines plant has achieved the level ''resolved;; or ''satisfactory progress'' in almost all of the recommendations and suggestions made by the OSART in November 2012. During the follow-up mission, the team assessed that the operators have resolved the issues in several areas, including: Undertaking initiatives to improve fire prevention; Reinforcing contamination control practices; and Enhancing capabilities to protect emergency workers in the event of a release of radioactivity. The team identified some issues which have achieved satisfactory progress toward resolution, but need further work, including: Further improvement of measures to preventing the ingress of items or chemicals into circuits and equipment; Comprehensive application of the corrective actions programme; and Reinforcement of the containment protection system in the event of an extremely adverse situation. The team identified the following issue as one which has made insufficient progress toward resolution and needs further work: Emergency response arrangements do not follow current IAEA safety standards recommending that the plant should have a person on
Crystal structure of (2E,3E-N2,N3-bis(3-ethyl-[1,1′-biphenyl]-4-ylbutane-2,3-diimine
Directory of Open Access Journals (Sweden)
Yan Zhao
2015-04-01
Full Text Available In the title compound, C32H32N2, synthesized by the condensation reaction of 2-ethyl-4-phenylaniline and 2,3-butanedione, the conformation about the C=N bonds is E and the substituted biphenyl units are trans to one another. In the two biphenyl ring systems, the planes of the two rings are inclined to one another by 25.25 (19 and 28.01 (19°. The planes of the ethyl-substituted benzene rings are inclined to one another by 20.23 (19° and to the mean plane of the butane-2,3-diimine unit [maximum deviation = 0.014 (4 Å] by 83.19 (19 and 63.38 (19°. In the crystal, molecules are linked by C—H...π interactions, forming sheets lying parallel to (101.
Wu, Yan; Tan, Zhijian; Liu, Zhixiang; Xia, Dechao; Li, Jiawen
2006-01-01
To investigate the expression of vaginal IL-23 and its role in experimental murine vaginal candidiasis and its relationship with infection and immune status, immuno-competent (group A) and immuno-suppressed (group B) murine models of vaginal candidiasis were established in estrogen-treated mice. Non-estrogen-treated mice were used as controls (group C). The level of IL-23 p19 mRNA in murine vaginal tissue was determined by RT-PCR. Significantly increased levels of IL-23p19mRNA were observed on the 4th, the 7th and 14th day after inoculation in immuno-competent group when compared with that in control group (Pvaginal candidiasis and has a protective function during infection. Low vaginal IL-23 level may correlate with the increased susceptibility to Candida albicans in immuno-suppressed group.
International Nuclear Information System (INIS)
Ma, D.; Prato, C.; Godoy, A.
1992-10-01
A seismic Safety Review Mission to assist in the evaluation of the design of seismic upgrading for Kozloduy NPP was performed in Sofia from 19-23 October 1992. The objectives of the mission were to assist the Bulgarian authorities in: the evaluation of the floor response spectra of the main buildings of units 1-4 at Kozloduy NPP, calculated for the new defined seismic parameters at site (Review Level Earthquake - RLE); the evaluation of the remedial and strengthening measures proposed for the seismic upgrading of the pump house and diesel generator buildings to the new defined RLE. This mission completed the scope of previous IAEA mission - BUL/9/012-18b - (see Report 3262) performed from 3-7 August 1992, with regard to tasks which were not evaluated at that time because they had not been finished. 2 tabs
19 CFR 177.27 - Oral discussion of issues.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Oral discussion of issues. 177.27 Section 177.27....27 Oral discussion of issues. Any party authorized to request a ruling under the provisions of § 177.23 may request an opportunity for oral discussion of the issues presented in the request. The oral...
Marks, Wendie N; Cain, Stuart M; Snutch, Terrance P; Howland, John G
2016-10-01
Childhood absence epilepsy (CAE) is often comorbid with behavioral and cognitive symptoms, including impaired visual memory. Genetic Absence Epilepsy Rats from Strasbourg (GAERS) is an animal model closely resembling CAE; however, cognition in GAERS is poorly understood. Crossmodal object recognition (CMOR) is a recently developed memory task that examines not only purely visual and tactile memory, but also requires rodents to integrate sensory information about objects gained from tactile exploration to enable visual recognition. Both the visual and crossmodal variations of the CMOR task rely on the perirhinal cortex, an area with dense expression of T-type calcium channels. GAERS express a gain-in-function missense mutation in the Cav3.2 T-type calcium channel gene. Therefore, we tested whether the T-type calcium channel blocker Z944 dose dependently (1, 3, 10mg/kg; i.p.) altered CMOR memory in GAERS compared to the non-epileptic control (NEC) strain. GAERS demonstrated recognition memory deficits in the visual and crossmodal variations of the CMOR task that were reversed by the highest dose of Z944. Electroencephalogram recordings determined that deficits in CMOR memory in GAERS were not the result of seizures during task performance. In contrast, NEC showed a decrease in CMOR memory following Z944 treatment. These findings suggest that T-type calcium channels mediate CMOR in both the GAERS and NEC strains. Future research into the therapeutic potential of T-type calcium channel regulation may be particularly fruitful for the treatment of CAE and other disorders characterized by visual memory deficits. Copyright © 2016 Elsevier Inc. All rights reserved.
Mirrlees MB430 has 23 bar bmep potential
Energy Technology Data Exchange (ETDEWEB)
1985-04-01
Nominally rates at 1000 bhp per cylinder, the new Mirrlees Blackstone MB430 diesel engine with 430 mm bore and 480 mm stroke runs at 600 rev/min under bmep of 21 bar. Initially the engine has been released at 19 bar with the prospect of uprating to 23 bar bmep in due course. The performance testing of the engine is discussed.
CERN. Geneva. Emulsion Experiments Committee
1965-01-01
Rapport sur le déroulement de l'expérience sur le double échange de charge des mésons $\\pi^{+} \\pi^{-}$ de 70 MeV/c effectuée les 14-15 mai 1965 au CS du CERN par le Départment de Physique Corpusculaire CRN Strasbourg
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Intervention. 210.19 Section 210.19 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.19 Intervention. Any person desiring to intervene in an...
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Security. 19.47 Section 19.47 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Container Stations § 19.47 Security. The...
Parvovirus B19 infection in hospital workers: community or hospital acquisition?
Dowell, S F; Török, T J; Thorp, J A; Hedrick, J; Erdman, D D; Zaki, S R; Hinkle, C J; Bayer, W L; Anderson, L J
1995-10-01
A suspected nosocomial outbreak of parvovirus B19 infection in a maternity ward was investigated in February 1994. Questionnaires were administered and sera collected from maternity ward staff (n = 91), other ward staff in the same hospital (n = 101), and maternity ward staff at a nearby hospital (n = 81). Blood donors (n = 265) were used as community controls. Recent infection (parvovirus B19 IgM positivity) in susceptible persons (parvovirus B19 IgG-negative or IgM-positive) was common among all 4 groups (23%-30%). This high rate of recent infection occurred during a large community outbreak of fifth disease. Environmental samples collected from a room where a stillborn parvovirus B19-infected fetus was delivered were positive for parvovirus B19 DNA. Thus, this suspected nosocomial outbreak actually reflected transmission outside the hospital, but contaminated environmental surfaces were identified as one potential source for transmission of parvovirus B19.
Dufour, Franck; Koning, Estelle; Nehlig, Astrid
2003-08-01
The Genetic Absence Epilepsy Rats from Strasbourg (GAERS) are considered an isomorphic, predictive, and homologous model of human generalized absence epilepsy. It is characterized by the expression of spike-and-wave discharges in the thalamus and cortex. In this strain, basal regional rates of cerebral glucose utilization measured by the quantitative autoradiographic [(14)C]2-deoxyglucose technique display a widespread consistent increase compared to a selected strain of genetically nonepileptic rats (NE). In order to verify whether these high rates of glucose metabolism are paralleled by elevated activities of the enzymes of the glycolytic and tricarboxylic acid cycle pathways, we measured by histochemistry the regional activity of the two key enzymes of glucose metabolism, lactate dehydrogenase (LDH) for the anaerobic pathway and cytochrome oxidase (CO) for the aerobic pathway coupled to oxidative phosphorylation. CO and LDH activities were significantly higher in GAERS than in NE rats in 24 and 28 of the 30 brain regions studied, respectively. The differences in CO and LDH activity between both strains were widespread, affected all brain systems studied, and ranged from 12 to 63%. The data of the present study confirm the generalized increase in cerebral glucose metabolism in GAERS, occurring both at the glycolytic and at the oxidative step. However, they still do not allow us to understand why the ubiquitous mutation(s) generates spike-and-wave discharges only in the thalamocortical circuit.
Guerra, Evelyn Santos; Lee, Chrono K; Specht, Charles A; Yadav, Bhawna; Huang, Haibin; Akalin, Ali; Huh, Jun R; Mueller, Christian; Levitz, Stuart M
2017-01-01
Aspergillus fumigatus causes invasive pulmonary disease in immunocompromised hosts and allergic asthma in atopic individuals. We studied the contribution of lung eosinophils to these fungal diseases. By in vivo intracellular cytokine staining and confocal microscopy, we observed that eosinophils act as local sources of IL-23 and IL-17. Remarkably, mice lacking eosinophils had a >95% reduction in the percentage of lung IL-23p19+ cells as well as markedly reduced IL-23 heterodimer in lung lavage fluid. Eosinophils killed A. fumigatus conidia in vivo. Eosinopenic mice had higher mortality rates, decreased recruitment of inflammatory monocytes, and decreased expansion of lung macrophages after challenge with conidia. All of these functions underscore a potential protective role for eosinophils in acute aspergillosis. Given the postulated role for IL-17 in asthma pathogenesis, we assessed whether eosinophils could act as sources of IL-23 and IL-17 in models where mice were sensitized to either A. fumigatus antigens or ovalbumin (OVA). We found IL-23p19+ IL-17AF+ eosinophils in both allergic models. Moreover, close to 95% of IL-23p19+ cells and >90% of IL-17AF+ cells were identified as eosinophils. These data establish a new paradigm in acute and allergic aspergillosis whereby eosinophils act not only as effector cells but also as immunomodulatory cells driving the IL-23/IL-17 axis and contributing to inflammatory cell recruitment.
Exacerbating effects of human parvovirus B19 NS1 on liver fibrosis in NZB/W F1 mice.
Directory of Open Access Journals (Sweden)
Tsai-Ching Hsu
Full Text Available Systemic lupus erythematosus (SLE is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19 is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling.
Exacerbating Effects of Human Parvovirus B19 NS1 on Liver Fibrosis in NZB/W F1 Mice
Hsu, Tsai-Ching; Tsai, Chun-Chou; Chiu, Chun-Ching; Hsu, Jeng-Dong; Tzang, Bor-Show
2013-01-01
Systemic lupus erythematosus (SLE) is an autoimmune disorder with unknown etiology that impacts various organs including liver. Recently, human parvovirus B19 (B19) is recognized to exacerbate SLE. However, the effects of B19 on liver in SLE are still unclear. Herein we aimed to investigate the effects of B19 on liver in NZB/W F1 mice by injecting subcutaneously with PBS, recombinant B19 NS1, VP1u or VP2, respectively. Our experimental results revealed that B19 NS1 protein significantly enhanced the TGF-β/Smad fibrotic signaling by increasing the expressions of TGF-β, Smad2/3, phosphorylated Smad2/3, Smad4 and Sp1. The consequent fibrosis-related proteins, PAI-1 and α-SMA, were also significantly induced in livers of NZB/W F1 mice receiving B19 NS1 protein. Accordingly, markedly increased collagen deposition was also observed in livers of NZB/W F1 mice receiving B19 NS1 protein. However, no significant difference was observed in livers of NZB/W F1 mice receiving B19 VP1u or VP2 as compared to the controls. These findings indicate that B19 NS1 plays a crucial role in exacerbating liver fibrosis in NZB/W F1 mice through enhancing the TGF-â/Smad fibrotic signaling. PMID:23840852
Directory of Open Access Journals (Sweden)
Vahid Esfahanian
2018-06-01
Full Text Available Introduction: Peri-implantitis is characterized by irreversible lesions that are caused by microbial plaque, involving not only the soft tissue around the implant, but also the implant-supporting bone. In the peri-implant diseases, some cytokines are increased, and inflammatory mediators, which are observed in peri-implantitis, induce the activation of osteoclasts and bone resorption. The aim of this study was to compare the level of interleukin 23 (IL-23 in patients with peri-implantitis and those with healthy peri-implant tissue. Materials & methods: This clinical trial was conducted on 19 patients with peri-implantitis and 19 patients with healthy peri-implant tissue. The samples were collected from sulcular fluid/gingival pocket fluid by paper cone and placed in vials. The level of IL-23 was determined using ELISA reader. Furthermore, the relationship of IL-23 levels with bleeding, probing depth, and pus formation was analyzed. Data analysis was performed using independent t-test, Pearson correlation coefficient, and Spearman test. Results: According to the results, the level of IL-23 in the patients with peri-implantitis was significantly higher than that in the group with healthy peri-implant tissue (P
Jafarzadeh, Abdollah; Azizi, Sayyed-Vahab; Nemati, Maryam; Khoramdel-Azad, Hossain; Shamsizadeh, Ali; Ayoobi, Fatemeh; Taghipour, Zahra; Hassan, Zuhair Mohammad
2015-12-01
IL-17/IL-23 axis plays an important role in the pathogenesis of several autoimmune diseases such as experimental autoimmune encephalomyelitis (EAE) and multiple sclerosis (MS). The immunomodulatory properties of ginger are reported in previous studies. To evaluate the effects of ginger extract on the expression of IL-17 and IL-23 in a model of EAE. EAE was induced in C57BL/6 mice by immunization with myelin oligodendroglial glycoprotein and then treated with PBS or ginger extracts, from day +3 to +30. At day 31, mice were scarificed and the expression of IL-17 and IL-23 mRNA in spinal cord were determined by using real time-PCR. The serum levels of cytokines were measured by ELISA. The mRNA expression of IL-17, IL-23 P19 and IL-23 P40 in CNS and serum levels of IL-17 and IL-23 were significantly higher in PBS-treated EAE mice than non-EAE group (pginger-treated EAE mice the mRNA expression of IL-17, P19 and P40 in CNS and serum IL-23 levels were significantly decreased as compared to PBS-treated EAE mice (pginger-treated EAE group had significantly lower expression of IL-17, P19 and P40 in CNS and lower serum IL-17 and IL-23 levels than PBS-treated EAE group (pGinger extract reduces the expression of IL-17 and IL-23 in EAE mice. The therapeutic potential of ginger for treatment of MS could be considered in further studies.
Electric quadrupole moments of {beta}-emitter {sup 21}F and {sup 23}Mg
Energy Technology Data Exchange (ETDEWEB)
Onishi, Takashi; Matsuta, Kensaku; Fukuda, Mitsunori [Osaka Univ., Toyonaka (Japan). Faculty of Science] [and others
1997-03-01
For the systematic study of nuclear electromagnetic moments, electric quadrupole moments Q of {beta}-emitting nuclei {sup 21}F and {sup 23}Mg have been measured for the first time through combined technique of the polarized nuclear beams and {beta}-NMR technique. From the quadrupole coupling constants of {sup 21}F and {sup 23}Mg in MgF{sub 2} single crystal, the ratios of the Q`s with the known Q were determined as |Q({sup 21}F)|/|Q({sup 19}F{sup *})|=1.001{+-}0.034 and |Q({sup 23}Mg)|/|Q({sup 25}Mg)|=0.571{+-}0.017. (author)
Journal of Computer Science and Its Application - Vol 19, No 1 (2012)
African Journals Online (AJOL)
A Conceptual Trust Model for Managing E-Commerce Environment · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. OR Vincent, OE Agbola, 17-23. http://dx.doi.org/10.4314/jcsia.v19i1.3 ...
Egyptian Journal of Biochemistry and Molecular Biology - Vol 23, No ...
African Journals Online (AJOL)
Assessment of anthracyclin-related hyperlipidemia taurine or PDE4 inhibitor during endotoxemia · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Hoda E Mohamed, I Ali Sousou, Mervat E Asker, Tamer M Abd-Elfattah, 1-19. http://dx.doi.org/10.4314/ejbmb.v23i1.35912 ...
IL-1 and IL-23 mediate early IL-17A production in pulmonary inflammation leading to late fibrosis.
Directory of Open Access Journals (Sweden)
Paméla Gasse
Full Text Available BACKGROUND: Idiopathic pulmonary fibrosis is a devastating as yet untreatable disease. We demonstrated recently the predominant role of the NLRP3 inflammasome activation and IL-1β expression in the establishment of pulmonary inflammation and fibrosis in mice. METHODS: The contribution of IL-23 or IL-17 in pulmonary inflammation and fibrosis was assessed using the bleomycin model in deficient mice. RESULTS: We show that bleomycin or IL-1β-induced lung injury leads to increased expression of early IL-23p19, and IL-17A or IL-17F expression. Early IL-23p19 and IL-17A, but not IL-17F, and IL-17RA signaling are required for inflammatory response to BLM as shown with gene deficient mice or mice treated with neutralizing antibodies. Using FACS analysis, we show a very early IL-17A and IL-17F expression by RORγt(+ γδ T cells and to a lesser extent by CD4αβ(+ T cells, but not by iNKT cells, 24 hrs after BLM administration. Moreover, IL-23p19 and IL-17A expressions or IL-17RA signaling are necessary to pulmonary TGF-β1 production, collagen deposition and evolution to fibrosis. CONCLUSIONS: Our findings demonstrate the existence of an early IL-1β-IL-23-IL-17A axis leading to pulmonary inflammation and fibrosis and identify innate IL-23 and IL-17A as interesting drug targets for IL-1β driven lung pathology.
Directory of Open Access Journals (Sweden)
Fatima Zahrae Qachchachi
2016-04-01
Full Text Available In the title compound, C11H11NO2, the 1H-indole-2,3-dione unit is essentially planar, with an r.m.s. deviation of 0.0387 (13 Å. This plane makes a dihedral angle of 72.19 (17° with the plane of the propyl substituent. In the crystal, chains propagating along the b axis are formed through C—H...O hydrogen bonds.
19 CFR 19.34 - Customs supervision.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Customs supervision. 19.34 Section 19.34 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Space Bonded for the Storage of Wheat § 19.34 Customs supervision. Port...
19 CFR 133.26 - Demand for redelivery of released merchandise.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Demand for redelivery of released merchandise. 133... Recorded Trademarks or Recorded Trade Names § 133.26 Demand for redelivery of released merchandise. If it... restrictions of § 133.22 or § 133.23 of this subpart, the port director shall promptly make demand for the...
HIV-1 replication through hHR23A-mediated interaction of Vpr with 26S proteasome.
Directory of Open Access Journals (Sweden)
Ge Li
2010-06-01
Full Text Available HIV-1 Vpr is a virion-associated protein. Its activities link to viral pathogenesis and disease progression of HIV-infected patients. In vitro, Vpr moderately activates HIV-1 replication in proliferating T cells, but it is required for efficient viral infection and replication in vivo in non-dividing cells such as macrophages. How exactly Vpr contributes to viral replication remains elusive. We show here that Vpr stimulates HIV-1 replication at least in part through its interaction with hHR23A, a protein that binds to 19S subunit of the 26S proteasome and shuttles ubiquitinated proteins to the proteasome for degradation. The Vpr-proteasome interaction was initially discovered in fission yeast, where Vpr was shown to associate with Mts4 and Mts2, two 19S-associated proteins. The interaction of Vpr with the 19S subunit of the proteasome was further confirmed in mammalian cells where Vpr associates with the mammalian orthologues of fission yeast Mts4 and S5a. Consistently, depletion of hHR23A interrupts interaction of Vpr with proteasome in mammalian cells. Furthermore, Vpr promotes hHR23A-mediated protein-ubiquitination, and down-regulation of hHR23A using RNAi significantly reduced viral replication in non-proliferating MAGI-CCR5 cells and primary macrophages. These findings suggest that Vpr-proteasome interaction might counteract certain host restriction factor(s to stimulate viral replication in non-dividing cells.
DEFF Research Database (Denmark)
Tuborgh, A; Meyer, C; Marschalek, R
2013-01-01
until progression to acute myeloid leukemia, AML-M5. The leukemic cells harbored a novel apparent 3-way translocation t(6;19;11)(p22.2;p13.1;q23.3). We utilized advanced molecular cytogenetic methods including 24-color karyotyping, high-resolution array comparative genomic hybridization (aCGH) and DNA...... in the initial stages of disease before clear morphological signs of bone marrow involvement. The patient responded well to therapy and remains in remission>6 years from diagnosis. This apparent 3-way translocation is remarkable because of its rarity and presentation with myeloid sarcoma, and may, as more cases...
Chen, Yu Wai; Tajima, Toshitaka; Rees, Martin; Garcia-Maya, Mitla
2009-09-01
Human homologue A of Rad23 (hHR23A) plays dual roles in DNA repair as well as serving as a shuttle vehicle targeting polyubiquitinated proteins for degradation. Its N-terminal ubiquitin-like (UbL) domain interacts with the 19S proteasomal cap and provides the docking mechanism for protein delivery. Pyramidal crystals of the UbL domain of hHR23A were obtained by the hanging-drop vapour-diffusion method with ammonium sulfate as the crystallizing agent. The crystals diffracted to beyond 2 A resolution and belonged to the hexagonal space group P6(5)22, with unit-cell parameters a = b = 78.48, c = 63.57 A. The structure was solved by molecular replacement using the UbL domain of yeast Dsk2 as the search model.
Liaud, Céline; Brucher, Michel; Schummer, Claude; Coscollà, Clara; Wolff, Hélène; Schwartz, Jean-Jacques; Yusà, Vicent; Millet, Maurice
2016-10-02
Atmospheric samples have been collected between 14 March and 12 September 2012 on a 2-week basis (15 days of sampling and exchange of traps each 7 days) in Strasbourg (east of France) for the analysis of 43 pesticides. Samples (particle and gas phases) were separately extracted using Accelerated Solvent Extraction (ASE) and pre-concentrated by Solid Phase Micro-Extraction (SPME) before analysis by gas chromatography coupled to tandem mass spectrometry (GC-MS/MS). Four SPME consecutive injections at distinct temperatures were made in order to increase the sensitivity of detection for the all monitored pesticides. Currently used detected pesticides can be grouped in four classes; those used in maize crops (acetochlor, benoxacor, dicamba, s-metolachlor, pendimethalin, and bromoxynil), in cereal crops (benoxacor, chlorothalonil, fenpropimorph, and propiconazole), in vineyards (tebuconazole), and as herbicides for orchards, meadows of green spaces (2,4-MCPA, trichlopyr). This is in accordance with the diversity of crops found in the Alsace region and trends observed are in accordance with the period of application of these pesticides. Variations observed permit also to demonstrate that the long time sampling duration used in this study is efficient to visualize temporal variations of airborne pesticides concentrations. Then, long time high-volume sampling could be a simple method permitting atmospheric survey of atmospheric contamination without any long analysis time and consequently low cost.
International Nuclear Information System (INIS)
Denhoefer, G.
1980-01-01
In this thesis different aspects of the reaction 12 C + 12 C were studied. The first part deals with high spin states in the mirror nucki 23 Na and 23 Mg experially with the states resonantly populated at Esub(cm) = 19.3 MeV. For the state at 9.80 MeV in 23 Na with (p,γ) angular correlation measurements a spin of 17/2 + and by Doppler form analysis a lifetime of (21 +- 9)fs was found. The probably analogous state at 9.61 MeV in 23 Mg decays both under p-emission to 22 Na and under γ-emission. Because of the p-decay probabilities to 3 + and 4 + of 22 Na, which were observed in (p,n) coincidence measurements, it has also the spin 17/2 + . In the second part of this thesis it was studied whether the reaction 12 C + 12 C at incident energies between 26 MeV and 42 MeV can be described using the statistical model. (orig./HSI) [de
Application of inverse kinematics to 1H+23Na→12C+12C
International Nuclear Information System (INIS)
Bennett, S.J.; Clarke, N.M.; Freer, M.; Fulton, B.R.; Hall, S.J.; Karban, O.; Murgatroyd, J.T.; Tungate, G.; Gyapong, G.J.; Jarvis, N.S.; Watson, D.L.; Rae, W.D.M.; Smith, A.E.; Lilley, J.S.; Woods, P.J.; Page, R.D.
1993-01-01
Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the 1 H( 23 Na, 12 C) 12 C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in 24 Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the 23 Na(p, 12 C) 12 C reaction. (orig.)
19 CFR 19.10 - Examination packages.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination packages. 19.10 Section 19.10 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... Examination packages. Merchandise sent from a bonded warehouse to the appraiser's stores for examination shall...
19 CFR 19.38 - Supervision of exportation.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supervision of exportation. 19.38 Section 19.38 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN Duty-Free Stores § 19.38 Supervision of exportation. (a) Sales...
Directory of Open Access Journals (Sweden)
Stubbs Liz
2009-08-01
Full Text Available Abstract Background In Australia in June 2001, a unique pneumococcal vaccine schedule commenced for Indigenous infants; seven-valent pneumococcal conjugate vaccine (7PCV given at 2, 4, and 6 months of age and 23-valent pneumococcal polysaccharide vaccine (23PPV at 18 months of age. This study presents carriage serotypes following this schedule. Methods We conducted cross sectional surveys of pneumococcal carriage in Aboriginal children 0 to 6 years of age living in remote Aboriginal communities (RACs in 2003 and 2005. Nasal secretions were collected and processed according to published methods. Results 902 children (mean age 25 months living in 29 communities in 2003 and 818 children (mean age 35 months in 17 communities in 2005 were enrolled. 87% children in 2003 and 96% in 2005 had received two or more doses of 7PCV. From 2003 to 2005, pneumococcal carriage was reduced from 82% to 76% and reductions were apparent in all age groups; 7PCV-type carriage was reduced from 11% to 8%, and 23PPV-non-7PCV-type carriage from 31% to 25% respectively. Thus non-23PPV-type carriage increased from 57% to 67%. All these changes were statistically significant, as were changes for some specific serotypes. Shifts could not be attributed to vaccination alone. The top 10 of 40 serotypes identified were (in descending order 16F, 19A, 11A, 6C, 23B, 19F, 6A, 35B, 6B, 10A and 35B. Carriage of penicillin non-susceptible (MIC > = 0.12 μg/mL strains (15% overall was detected in serotypes (descending order 19A, 19F, 6B, 16F, 11A, 9V, 23B, and in 4 additional serotypes. Carriage of azithromycin resistant (MIC > = 2 μg/mL strains (5% overall, was detected in serotypes (descending order 23B, 17F, 9N, 6B, 6A, 11A, 23F, and in 10 additional serotypes including 6C. Conclusion Pneumococcal carriage remains high (~80% in this vaccinated population. Uptake of both pneumococcal vaccines increased, and carriage was reduced between 2003 and 2005. Predominant serotypes in combined
19 CFR 19.46 - Employee lists.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Employee lists. 19.46 Section 19.46 Customs Duties... Employee lists. A permit shall not be granted to an operator to transfer a container or containers to a... new employees. The operator shall, within 10 calendar days, advise the port director if the employment...
Odje, O E; Ramsey, J M
1995-01-01
The literature on the response of erythrocyte 2,3-diphosphoglycerate (2,3-DPG) following exercise is replete with inconsistencies, and recent studies have shown that the time of blood sampling during and following exercise, as well as the duration of exercise, are important in evaluating the response of 2,3-DPG. Experiments were designed to measure the response of 2,3-DPG following short-term strenuous exercise in two groups of untrained men. Twelve men, 19-22 years old (study 1), exercised on a bicycle ergometer at 122.5 W for 10 min and red blood cell (RBC) 2,3-DPG was measured at 0 and 50 min following exercise. The level of 2,3-DPG (mumol.ml-1 RBC) increased after exercise (P < 0.05), but this increase was not significant when 2,3-DPG was expressed as mol.mol-1 hemoglobin (Hb). However, following 50 min of rest, 2,3-DPG (mol.mol-1 Hb) decreased significantly. In a second group (study 2), nine other men, aged 18-19 years, exercised at the same workload for 15 min and 2,3-DPG was measured at 0, 30, 60, 180, and 330 min respectively after exercise, and no significant mean changes in the level of the phosphate were observed. Findings from these studies suggest that 2,3-DPG does not provide a compensatory adjustment to facilitate oxygen delivery in the hypoxia of short-term strenuous exercise in untrained males immediately following exercise and when recovery intervals of up to 330 min are also examined. It is suggested that 2,3-DPG be reported as mol.mol-1 Hb, since the phosphate exists on Hb in an equimolar ratio in normal physiological states.
Nine Years of XMM-Newton Pipeline: Experience and Feedback
Michel, Laurent; Motch, Christian
2009-05-01
The Strasbourg Astronomical Observatory is member of the Survey Science Centre (SSC) of the XMM-Newton satellite. Among other responsibilities, we provide a database access to the 2XMMi catalogue and run the part of the data processing pipeline performing the cross-correlation of EPIC sources with archival catalogs. These tasks were all developed in Strasbourg. Pipeline processing is flawlessly in operation since 1999. We describe here the work load and infrastructure setup in Strasbourg to support SSC activities. Our nine year long SSC experience could be used in the framework of the Simbol-X ground segment.
Nine Years of XMM-Newton Pipeline: Experience and Feedback
International Nuclear Information System (INIS)
Michel, Laurent; Motch, Christian
2009-01-01
The Strasbourg Astronomical Observatory is member of the Survey Science Centre (SSC) of the XMM-Newton satellite. Among other responsibilities, we provide a database access to the 2XMMi catalogue and run the part of the data processing pipeline performing the cross-correlation of EPIC sources with archival catalogs. These tasks were all developed in Strasbourg. Pipeline processing is flawlessly in operation since 1999. We describe here the work load and infrastructure setup in Strasbourg to support SSC activities. Our nine year long SSC experience could be used in the framework of the Simbol-X ground segment.
Study of 19F and 19Ne mirror nuclei
International Nuclear Information System (INIS)
Lebrun, Claude.
1976-01-01
The electromagnetic properties of the mirror nuclei 19 F and 19 Ne were studied using the 18 O(d,nγ) 19 F, 17 O( 3 He,nγ) 19 Ne and 19 F(p,nγ) 19 Ne reactions. Lifetimes of 8 levels in 19 F and 11 levels in 19 Ne have been measured using the Doppler shift attenuation method. Weak and strong components of M 1 , E 1 and E 2 transition strengths are compared with shell model predictions. M 1 and E 2 transition strengths of conjugated nuclei (A=18 to A=34) are compiled and compared with wide configuration space shell models [fr
19 CFR 19.1 - Classes of customs warehouses.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Classes of customs warehouses. 19.1 Section 19.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS WAREHOUSES, CONTAINER STATIONS AND CONTROL OF MERCHANDISE THEREIN § 19.1 Classes of...
One new 19-nor cucurbitane-type triterpenoid from the stems of Momordica charantia.
Li, Yong-chao; Xu, Xin-juan; Yang, Jing; Wu, Xing-gang; Fu, Qing-yun
2016-01-01
One new 19-nor cucurbitane-type triterpenoid (3β,9β,25-trihydroxy-7β-methoxy-19-nor-cucurbita-5,23(E)-diene) (1), together with other six known cucurbitane-type triterpenoids (2-7), were isolated from the stems of Momordica charantia L. The chemical structure of 1 was elucidated by extensive 1D NMR and 2D NMR (HSQC, HMBC, COSY and ROESY), MS experiments. Using MTT assay, compound 1 exhibited weak cytotoxicity against HL-60, A-549, and SK-BR-3 cell lines with the IC50 values at 27.3, 32.7 and 26.6 μM, respectively.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Laboratoire d'Etude des Surfaces et Interfaces de la Matière Solide (LESIMS), Université Badji Mokhtar, 23000 Annaba, Algeria; Institut de Chimie (UMR 7177, CNRS-Unistra), Université de Strasbourg, 1 rue Blaise Pascal, CS 90032, 67081 Strasbourg Cedex, France; French EPR Federation of Research (REseau NAtional ...
2,3-diphosphoglycerate in normal and pathologic pregnancy: relationship to neonatal weight.
Paparella, P; Francesconi, R; Zullo, M; Giorgino, R; Riccardi, P; Ferrazzani, S; Mancuso, S
1989-03-01
2,3-Diphosphoglycerate levels were assayed in 154 pregnant women in third trimester (61 normal, 52 diabetic, 19 with gestational hypertension, 7 with fetal macrosomia, and 15 with idiopathic fetal underdevelopment). A correlation was found between 2,3-diphosphoglycerate levels and birth weight (absolute and relative birth weight or birth weight expressed as percentile), which was negative in normal patients evaluated in the last 7 days before delivery (r = 0.38; p = 0.04) and positive in diabetic patients (evaluated in the third trimester and in the last 7 days before delivery) and in patients with gestational hypertension (evaluated in the third trimester) (r and p values differ according to whether birth weight is expressed as absolute, relative, or a percentile). No correlation was found between 2,3-diphosphoglycerate levels and birth weight in patients with neonatal underdevelopment or macrosomia of unknown origin. On the basis of these results we hypothesize that in some conditions the fetus can influence maternal 2,3-diphosphoglycerate levels and hence its own oxygen supply and growth in utero.
Parvovirus B19 reactivation presenting as neutropenia after rituximab treatment.
Klepfish, A; Rachmilevitch, E; Schattner, A
2006-11-01
A patient with primary biliary cirrhosis and associated refractory immune thrombocytopenic purpura was treated with 4 weekly courses of rituximab, a monoclonal antibody targeting B-cell surface antigen CD20. Her thrombocyte count and even cholestatic liver function tests improved. However, 17 weeks after rituximab treatment, she developed severe neutropenia (absolute neutrophil count 0.23x10(3)/mul) and recurrent thrombocytopenia with abnormal bone marrow of all three lineages. Although delayed-onset neutropenia has been reported after rituximab, reactivated viral infections have also been encountered. Parvovirus B19 was suspected and confirmed as the cause of neutropenia in our patient. The patient was supported by GCSF treatment and recovered uneventfully after several weeks. Neutropenia after rituximab can also be the predominant manifestation of reactivated parvovirus B19 infection and have a favorable prognosis.
IL-23 Is Essential for the Development of Elastase-Induced Pulmonary Inflammation and Emphysema.
Fujii, Utako; Miyahara, Nobuaki; Taniguchi, Akihiko; Waseda, Koichi; Morichika, Daisuke; Kurimoto, Etsuko; Koga, Hikari; Kataoka, Mikio; Gelfand, Erwin W; Cua, Daniel J; Yoshimura, Akihiko; Tanimoto, Mitsune; Kanehiro, Arihiko
2016-11-01
We recently reported that IL-17A plays a critical role in the development of porcine pancreatic elastase (PPE)-induced emphysema. The proliferation of T-helper type 17 (Th17) cells was induced by IL-23. To determine the contribution of IL-23 to the development of pulmonary emphysema, a mouse model of PPE-induced emphysema was used in which responses of IL-23p19-deficient (IL-23 -/- ) and wild-type (WT) mice were compared. Intratracheal instillation of PPE induced emphysematous changes in the lungs and was associated with increased levels of IL-23 in lung homogenates. Compared with WT mice, IL-23 -/- mice developed significantly lower static compliance values and markedly reduced emphysematous changes on histological analyses after PPE instillation. These changes were associated with lower levels of IL-17A and fewer Th17 cells in the lung. The neutrophilia seen in bronchoalveolar lavage fluid of WT mice was attenuated in IL-23 -/- mice, and the reduction was associated with decreased levels of keratinocyte-derived cytokine and macrophage inflammatory protein-2 in bronchoalveolar lavage fluid. Treatment with anti-IL-23p40 monoclonal antibody significantly attenuated PPE-induced emphysematous changes in the lungs of WT mice. These data identify the important contributions of IL-23 to the development of elastase-induced pulmonary inflammation and emphysema, mediated through an IL-23/IL-17 pathway. Targeting IL-23 in emphysema is a potential therapeutic strategy for delaying disease progression.
2,3-Bis[(3-methylbiphenyl-4-ylimino]butane
Directory of Open Access Journals (Sweden)
Jingjing Chen
2014-04-01
Full Text Available The title compound, C30H28N2, is a product of the condensation reaction of 2-methyl-4-phenylaniline and butane-2,3-dione. The molecule lies on a crystallographic inversion centre. The C=N bond has an E conformation. The dihedral angle between the two benzene rings of the 4-phenyl-2-methylphenyl group is 29.19 (76°. The 1,4-diazabutadiene plane makes an angle of 70.1 (10° with the N-bonded methylphenyl ring and an angle of 81.08 (97° with the terminal phenyl group.
Directory of Open Access Journals (Sweden)
Rotellini Matteo
2010-10-01
Full Text Available Abstract Background PARV4 is a new member of the Parvoviridae family not closely related to any of the known human parvoviruses. Viremia seems to be a hallmark of PARV4 infection and viral DNA persistence has been demonstrated in a few tissues. Till now, PARV4 has not been associated with any disease and its prevalence in human population has not been clearly established. This study was aimed to assess the tissue distribution and the ability to persist of PARV4 in comparison to parvovirus B19 (B19V. Results PARV4 and B19V DNA detection was carried out in various tissues of individuals without suspect of acute viral infection, by a real time PCR and a nested PCR, targeting the ORF2 and the ORF1 respectively. Low amount of PARV4 DNA was found frequently (>40% in heart and liver of adults individuals, less frequently in lungs and kidneys (23,5 and 18% respectively and was rare in bone marrow, skin and synovium samples (5,5%, 4% and 5%, respectively. By comparison, B19V DNA sequences were present in the same tissues with a higher frequency (significantly higher in myocardium, skin and bone marrow except than in liver where the frequency was the same of PARV4 DNA and in plasma samples where B19V frequency was significantly lower than that of PARV4 Conclusions The particular tropism of PARV4 for liver and heart, here emerged, suggests to focus further studies on these tissues as possible target for viral replication and on the possible role of PARV4 infection in liver and heart diseases. Neither bone marrow nor kidney seem to be a common target of viral replication.
Cox1 mutation abrogates need for Cox23 in cytochrome c oxidase biogenesis
Directory of Open Access Journals (Sweden)
Richard Dela Cruz
2016-06-01
Full Text Available Cox23 is a known conserved assembly factor for cytochrome c oxidase, although its role in cytochrome c oxidase (CcO biogenesis remains unresolved. To gain additional insights into its role, we isolated spontaneous suppressors of the respiratory growth defect in cox23∆ yeast cells. We recovered independent colonies that propagated on glycerol/lactate medium for cox23∆ cells at 37°C. We mapped these mutations to the mitochondrial genome and specifically to COX1 yielding an I101F substitution. The I101F Cox1 allele is a gain-of-function mutation enabling yeast to respire in the absence of Cox23. CcO subunit steady-state levels were restored with the I101F Cox1 suppressor mutation and oxygen consumption and CcO activity were likewise restored. Cells harboring the mitochondrial genome encoding I101F Cox1 were used to delete genes for other CcO assembly factors to test the specificity of the Cox1 mutation as a suppressor of cox23∆ cells. The Cox1 mutant allele fails to support respiratory growth in yeast lacking Cox17, Cox19, Coa1, Coa2, Cox14 or Shy1, demonstrating its specific suppressor activity for cox23∆ cells.
La acción cultural exterior: Un medio que es un fin
Vidal-Beneyto, José
1988-01-01
Texto en español de la intervención de José Vidal-Beneyto en el simposio "Rencontres avec la philosophie espagnole". Estrasburgo, 25-26 de mayo de 1987. La versión francesa fue recogida en: Rencontres avec la philosophie espagnole: Strasbourg 25-26 mai 1987 (pp. 119-124). Strasbourg: Cerf: CERIT.
Fetal thrombocytopenia in pregnancies with fetal human parvovirus-B19 infection.
Melamed, Nir; Whittle, Wendy; Kelly, Edmond N; Windrim, Rory; Seaward, P Gareth R; Keunen, Johannes; Keating, Sarah; Ryan, Greg
2015-06-01
Fetal infection with human parvovirus B19 (hParvo-B19) has been associated mainly with fetal anemia, although data regarding other fetal hematologic effects are limited. Our aim was to assess the rate and consequences of severe fetal thrombocytopenia after fetal hParvo-B19 infection. We conducted a retrospective study of pregnancies that were complicated by fetal hParvo-B19 infection that underwent fetal blood sampling (FBS). The characteristics and outcomes of fetuses with severe thrombocytopenia (B19 infection. A total of 37 pregnancies that were affected by fetal hParvo-B19 infection were identified. Of the 29 cases that underwent FBS and had information regarding fetal platelets, 11 cases (38%) were complicated by severe fetal thrombocytopenia. Severely thrombocytopenic fetuses were characterized by a lower hemoglobin concentration (2.6 ± 0.9 g/dL vs 5.5 ± 3.6 g/dL; P = .01), lower reticulocyte count (9.1% ± 2.8% vs 17.3% ± 10.6%; P = .02), and lower gestational age at the time of diagnosis (21.4 ± 3.1 wk vs 23.6 ± 2.2 wk; P = .03). Both the fetal death rate within 48 hours of FBS (27.3% vs 0%; P = .02) and the risk of prematurity (100.0% vs 13.3%; P B19 infection, can be further worsened by IUT, and may be associated with an increased risk of procedure-related fetal loss after either FBS or IUT. Copyright © 2015. Published by Elsevier Inc.
Hatakeyama, Y; Ishii, K; Murai, C; Sugamura, K; Mitomo, N; Saitoh, T; Rikimaru, Y; Okazaki, T; Sasaki, T
1998-10-01
To evaluate the usefulness of new ELISA for human parvovirus B19 (B19) antibodies and PCR for the diagnosis of acute onset of B19 polyarthritis. We evaluated the reproducibility and sensitivity on the detection of anti-B19 antibody by ELISA using recombinant VP-1 and VP-2 (empty particle), and then studied for the prevalence of IgM and IgG B19 antibody in 125 samples for anti-B19 tests. The random study on anti-B19 antibody assay as well as PCR for B19-DNA was also performed in 130 cases with acute onset of arthritis excluding those with known origins, 224 with rheumatoid arthritis and 149 with other categories. The results by using B19-empty particle ELISA were reproducible and showed the assay was a sensitive way for clinical use. IgM anti-B19 antibodies were positive not only in all samples from erythema infectiosum, but also often in those from hemolytic anemia, pure red cell aplasia, fetal hydrops, hepatic injury, fever of unknown origin. Among 130 with acute onset of arthritis, 21 showed positive tests for IgM anti-B19 antibody and/or B19 DNA. On the other hand, 4 among 224 patients with rheumatoid arthritis were positive for IgM anti-B19 antibody, but all of 149 in control group were negative for IgM anti-B19 antibodies and for B19 DNA. Anti-B19 ELISA using B19-empty particle which has been introduced as a routine test system, is a useful tool for the diagnosis of acute onset of B19 arthritis. An additional examination using PCR for B19 DNA may contribute for understanding persistent B19 polyarthritis or reactivation of B19 infection.
Food Plants of 19 butterflies species (Lepidoptera from Loreto, Peru
Directory of Open Access Journals (Sweden)
Joel Vásquez Bardales
2017-04-01
Full Text Available This work reports the food plants utilized by 19 species of butterflies from Allpahuayo-Mishana Research Center and the Community of San Rafael, Loreto, Peru. We report 23 plant species and one hybrid of angiosperms used by the butterflies. Larval host plants were 21 species and five were adult nectar sources. Two species were both host plant and nectar source: Passiflora coccinea Aubl. and Passiflora edulis Sims. The most frequently used plant families were Solanaceae, Passifloraceae, Fabaceae and Aristolochiaceae.
Scheyer, Anne; Morville, Stéphane; Mirabel, Philippe; Millet, Maurice
during this period. This is the case for diflufenican which was detected only during application. Two important peaks of concentrations were observed; a first one (101 ng L -1) in Erstein in November 2002 (4-11 November) and a second one (762 ng L -1) also in Erstein (28 April-15 May). The same behaviour can be seen for chlorfenvinphos and phosalone which have been detected, respectively, 2 and 4 times in Erstein and Strasbourg at high concentrations (28 April 2003-15 May 2003, 187 ng L -1 of phosalone and 157 ng L -1 of chlorfenvinphos in Erstein). MCPP, 2,4 MCPA and 2,4-D have been detected at high concentrations in rainwater but for the other pesticides very episodically and mainly during their use in agriculture. Maximal concentrations of MCPP and 2,4 MCPA have been measured in Erstein between 28 April and 15 May (904 and 746 ng L -1, respectively). Comparison between rural and urban sites showed that concentrations in rural areas are generally higher except for pesticides commonly applied in urban areas like Diuron. No seasonal phenomenon was observed for Diuron. This herbicide has been detected in practically all of the rainwater samples in Strasbourg (40/41) with a maximum of 1025 ng L -1 (16-23 September 2002) in 38 samples on 41 in Erstein with a maximum of 317 ng L -1 (15-23 October 2002). The total concentration of Diuron measured between 4 March 2002 and 20 July 2003 is of 4721 ng L -1 in Strasbourg and 5025 ng L -1 in Erstein. This result shows that wet deposition of Diuron in urban and rural sites was equivalent and can be explained by the "urban use" of this molecule together with its potential persistence.
Self-Paced Physics, Segments 19-23.
New York Inst. of Tech., Old Westbury.
Five study segments of the Self-Paced Physics Course materials are presented in this fourth problems and solutions book used as a part of student course work. The subject matter is related to electric charges, insulators, Coulomb's law, electric fields, lines of force, solid angles, conductors, motion of charged particles, dipoles, electric flux,…
23 CFR 658.19 - Reasonable access.
2010-04-01
... FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS TRUCK SIZE... the STAA between the NN and terminals and facilities for food, fuel, repairs, and rest. In addition... and unloading to household goods carriers, motor carriers of passengers, and any truck tractor...
Amin, U S M; Biswas, Sudip; Elias, Sabrina M; Razzaque, Samsad; Haque, Taslima; Malo, Richard; Seraj, Zeba I
2016-01-01
Soil salinity is one of the most challenging problems that restricts the normal growth and production of rice worldwide. It has therefore become very important to produce more saline tolerant rice varieties. This study shows constitutive over-expression of the vacuolar Na(+)/H(+) antiporter gene (OsNHX1) from the rice landrace (Pokkali) and attainment of enhanced level of salinity tolerance in transgenic rice plants. It also shows that inclusion of the complete un-translated regions (UTRs) of the alternatively spliced OsNHX1 gene provides a higher level of tolerance to the transgenic rice. Two separate transformation events of the OsNHX1 gene, one with 1.9 kb region containing the 5' UTR with CDS and the other of 2.3 kb, including 5' UTR, CDS, and the 3' UTR regions were performed. The transgenic plants with these two different constructs were advanced to the T3 generation and physiological and molecular screening of homozygous plants was conducted at seedling and reproductive stages under salinity (NaCl) stress. Both transgenic lines were observed to be tolerant compared to WT plants at both physiological stages. However, the transgenic lines containing the CDS with both the 5' and 3' UTR were significantly more tolerant compared to the transgenic lines containing OsNHX1 gene without the 3' UTR. At the seedling stage at 12 dS/m stress, the chlorophyll content was significantly higher (P kb > 1.9 kb > and WT lines. Yield in g/plant in the best line from the 2.3 kb plants was significantly more (P kb line and WT plants at stress of 6 dS/m. Transformation with the complete transcripts rather than the CDS may therefore provide more durable level of tolerance.
Ito, Sanae; Ishida, Hiromi; Uenishi, Kazuhiro
2016-01-01
Phosphorus homeostasis is determined by dietary intake, intestinal absorption, and renal tubular reabsorption of phosphorus. Serum fibroblast growth factor-23 (FGF-23) is considered to be a sensitive early biomarker of disordered phosphorus metabolism in both patients with chronic kidney diseases and healthy subjects. However, the number of studies evaluating serum FGF-23 concentrations in healthy subjects is limited. The objective of this cross-sectional study was to examine the relationship between serum FGF-23 concentrations and phosphorus related factors in 182 young Japanese women (mean age, 19.5±0.4 years). We found that higher serum concentrations of inorganic phosphorus and lower serum concentrations of 1,25-dihydroxy vitamin D as well as lower fat but higher phosphorus and calcium intake were weakly but significantly associated with high serum concentrations of FGF-23, adjusted for postmenarcheal age and body weight. These results suggested that in young Japanese women, serum FGF-23 might be indicative of phosphorus nutrition status. However, it is worthy of note that maturity factors, including postmenarcheal age and physical attributes, such as body weight, might be related to serum FGF-23 concentrations.
Some notes on "Leaves of Memory", the autobiography of Hermann Kobold
Vollmer, R.; Vollmer, H.; Duerbeck, H. W.
2004-12-01
We briefly describe the life of the astronomer Hermann Kobold, who lived from 1858 to 1942. He worked at the observatories of O'Gyalla, Strasbourg and Kiel, and was also involved in the observations and reductions of the German Venus transit project, 1874/82. His autobiography spans the time between his youth and his leave from Strasbourg in 1902. The subsequent time as observer and professor in Kiel and long-time editor of the Astronomische Nachrichten is not covered. The autobiography "Blaetter der Erinnerung" (Leaves of memeory), presented in the subsequent article, was written in his late age when he was already blind, using a special device. We also present some photographs of Kobold and his contemporaries, taken in Gottingen, O'Gyalla, Aiken (South Carolina), and Strasbourg.
Synthesis of Novel Fused Heterocycles Based on Pyrano[2,3-c]pyrazole
Directory of Open Access Journals (Sweden)
M. E. A. Zaki
1998-02-01
Full Text Available 3-Substituted 1,2,4-triazole derivatives (5, 9, 13, 16b, 19, pyrimidinium salts (21, triazines (24, and aryl methylene hydrazono pyrazolopyrano-pyrimidine (27a,b which are rearranged in basic medium to 30a,b, were afforded via the reaction of 6-amino 1,4,5,6-tetrahydro-5-imino-3-methyl-1-phenyl-4 (pchlorophenyl pyrazolo [4', 3' : 5,6]-pyrano [2,3-d] pyrimidine (3 with different reagents.
Analysis of 23G and 25G+vitrectomy for retinal detachment
Directory of Open Access Journals (Sweden)
Ying-Li Lu
2016-06-01
Full Text Available AIM: To compare the clinical effect of 23G and 25G+ vitrectomy for retinal detachment. METHODS: Forty seven patients with retinal detachment were treated with 23G vitrectomy(27 eyes in 27 cases as group Aand 25G+ vitrectomy(20 eyes in 20 cases as group B. The operation time and the incidence of intraoperative complications were recorded. The occurrence of retinal reposition, visual acuity, intraocular pressure(IOPand complications were observed. Postoperative follow-up time of the two groups were 3d, 1wk, 3mo.The relevant records were statistically analyzed and compared. RESULTS: The operation time of 23G group and 25G+ group were 50.21+4.52min, 49.15+5.14min,respectively and there was no significant difference between the two groups(P>0.05. The main complications were retinal hemorrhage and iatrogenic retinal hole. There were 3 eyes with retinal hemorrhage, 2 eyes with iatrogenic retinal hole in 23G group, and 1 eye with retinal hemorrhage, 1 eye with iatrogenic retinal hole in the 25G+ group, and the difference was statistically significant(PP>0.05. The number of eyes with hypotonia in 23G and 25G+ group were 3 and 1 eyes respectively, the difference was statistically significant(PP>0.05. At the last follow-up, the results showed that 26 eyes(96%with retinal reposition in 23G group, 19 eyes(95%in 25G+ group, the difference was not statistically significant(P>0.05. CONCLUSION: The clinical effect of 23G and 25G+ vitrectomy for retinal detachment is similar, but 25G+ vitrectomy can reduce incidence of complications and early postoperative low IOP.
Blaetter der Erinnerung - Leaves of Memory - an autobiography
Kobold, H. A.
2004-12-01
The following notes of the blind author, entitled "leaves of memory" were written in 1940, two years before his death. The notes, which were written by hand with the aid of a special deskpad, were later transcribed. The present condition contains the complete text; only incorrectly written or transcribed names of persons or geographical places were corrected. The autobiography covers Hermann Kobold's youth and education in Hannover (1858-1877), his scientific studies at Goettingen University (1877-1880), the time as an assistant at Nicolaus von Konkoly's private observatory (1880-1883), his participation in the Venus transit expedition to Aiken, South Carolina (1882), his work for the German Venus Transit Commission in Berlin (1883-1886), and his years as an observer and professor at the University Observatory in Strasbourg (1886-1902). The notes come to a close with Kobold's departure from Strasbourg to accept a position at Kiel University Observatory. The autobiography give a subjective view of scientific and university life in the last decades of the 19th century, a view which is, however, free from any "self-censured" texts like annual reports or obituaries. The notes offer rare insights, e.g. in the behaviour of Kobold's contemporaries and the influence exercised in the case of appointments.
MayDay Colloquium 23: The End(s) of Music Education? A Call for Re-Visioning
Bates, Vincent C.
2013-01-01
In the summer of 2011 (June 16-19), the MayDay Group met in Salt Lake City, Utah (USA) for MayDay Colloquium 23, with presentations and discussions on the theme,"The End(s) of Music Education? A Call for Re-Visioning": In a time of rapidly changing political processes, power relations, and policies, music educators are challenged to…
Creep deformation behavior at long-term in P23/T23 steels
Energy Technology Data Exchange (ETDEWEB)
Sawada, K.; Tabuchi, M.; Kimura, K. [National Institute for Materials Science (Japan)
2008-07-01
Creep behavior of ASME P23/T23 steels was investigated and analyzed, focusing on creep strength degradation at long-term. Creep rupture strength at 625 C and 650 C dropped at long-term in both P23 and T23 steels. The stress exponent of minimum creep rate at 625 C and 650 C was 7.8-13 for higher stresses and 3.9-5.3 for lower stresses in the P23/T23 steels. The change of stress exponent with stress levels was consistent with the drop in creep rupture strength at long-term. The Monkman-Grant rule was confirmed in the range examined in P23 steel, while the data points deviated from the rule at long-term in the case of T23 steel. The creep ductility of P23 steel was high over a wide stress and temperature range. On the other hand, in T23 steel, creep ductility at 625 C and 650 C decreased as time to rupture increased. The change in ductility may cause the deviation from the Monkman-Grant rule. Fracture mode changed from transgranular to intergranular fracture in the long-term at 625 C and 650 C. (orig.)
Czech Academy of Sciences Publication Activity Database
Křížová, Lucie; Kuchař, Milan; Petroková, Hana; Osička, Radim; Hlavničková, Marie; Pelák, O.; Černý, Jiří; Kalina, T.; Malý, Petr
2017-01-01
Roč. 50, č. 2 (2017), s. 102-113 ISSN 0891-6934 R&D Projects: GA MZd(CZ) NV16-27676A; GA ČR GAP303/10/1849; GA ČR GA15-09157S; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 ; RVO:61388971 Keywords : Psoriasis * Th17 cell * IL-23 * protein binder Subject RIV: EC - Immunology; EC - Immunology (MBU-M) OBOR OECD: Immunology; Immunology (MBU-M) Impact factor: 2.629, year: 2016
Imaging of tumor viability in lung cancer. Initial results using 23Na-MRI
International Nuclear Information System (INIS)
Henzler, T.; Apfaltrer, P.; Haneder, S.; Schoenberg, S.O.; Fink, C.; Konstandin, S.; Schad, L.; Schmid-Bindert, G.; Manegold, C.; Wenz, F.
2012-01-01
23 Na-MRI has been proposed as a potential imaging biomarker for the assessment of tumor viability and the evaluation of therapy response but has not yet been evaluated in patients with lung cancer. We aimed to assess the feasibility of 23 Na-MRI in patients with lung cancer. Three patients with stage IV adenocarcinoma of the lung were examined on a clinical 3 Tesla MRI system (Magnetom TimTrio, Siemens Healthcare, Erlangen, Germany). Feasibility of 23 Na-MRI images was proven by comparison and fusion of 23 Na-MRI with 1 H-MR, CT and FDG-PET-CT images. 23 Na signal intensities (SI) of tumor and cerebrospinal fluid (CSF) of the spinal canal were measured and the SI ratio in tumor and CSF was calculated. One chemonaive patient was examined before and after the initiation of combination therapy (Carboplatin, Gemcitabin, Cetuximab). All 23 Na-MRI examinations were successfully completed and were of diagnostic quality. Fusion of 23 Na-MRI images with 1 H-MRI, CT and FDG-PET-CT was feasible in all patients and showed differences in solid and necrotic tumor areas. The mean tumor SI and the tumor/CSF SI ratio were 13.3 ± 1.8 x 103 and 0.83 ± 0.14, respectively. In necrotic tumors, as suggested by central non-FDG-avid areas, the mean tumor SI and the tumor/CSF ratio were 19.4 x 103 and 1.10, respectively. 23 Na-MRI is feasible in patients with lung cancer and could provide valuable functional molecular information regarding tumor viability, and potentially treatment response. (orig.)
Karjahärm, Toomas, 1944-
2010-01-01
Arvustus: Vene impeerium ja Baltikum : venestus, rahvuslus ja moderniseerimine 19. sajandi teisel poolel ja 20. sajandi alguses. I / koostanud Tõnu Tannberg, Bradley Woodworth. Eesti Ajalooarhiivi toimetised ; 16 (23). (Tartu : Eesti Ajalooarhiiv, 2009)
49 CFR 1242.19 - Electric power systems (account XX-19-21).
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Electric power systems (account XX-19-21). 1242.19... Structures § 1242.19 Electric power systems (account XX-19-21). Separate common expenses on basis of common expenses of electric power purchased or produced for motive power (accounts XX-51-68 and XX-52-68). ...
Orlando, Thomas M.; Diebold, Ulrike
2010-03-01
The 12th International Workshop on Desorption Induced by Electronic Transitions (DIET XII) took place from 19-23 April 2009 in Pine Mountain, Georgia, USA. This was the 12th conference in a strong and vibrant series, which dates back to the early 1980s. DIET XII continued the tradition of exceptional interdisciplinary science and focused on the study of desorption and dynamics induced by electronic excitations of surfaces and interfaces. The format involved invited lectures, contributed talks and a poster session on the most recent developments and advances in this area of surface physics. The Workshop International Steering Committee and attendees wish to dedicate DIET XII to the memory of the late Professor Theodore (Ted) Madey. Ted was one of the main pioneers of this field and was one of the primary individuals working to keep this area of science exciting and adventurous. His overall contributions to surface science were countless and his contributions to the DIET field and community were enormous. He is missed and remembered by many friends and colleagues throughout the world. The papers collected in this issue cover many of the highlights of DIET XII. Topics include ultrafast electron transfer at surfaces and interfaces, quantum and spatially resolved mapping of surface dynamics and desorption, photon-, electron- and ion-beam induced processes at complex interfaces, the role of non-thermal desorption in astrochemistry and astrophysics and laser-/ion-based methods of examining soft matter and biological media. Although the workshop attracted many scientists active in the general area of non-thermal surface processes, DIET XII also attracted many younger scientists (i.e., postdoctoral fellows, advanced graduate students, and a select number of advanced undergraduate students). This field has had an impact in a number of areas including nanoscience, device physics, astrophysics, and now biophysics. We believe that this special issue of Journal of Physics
DEFF Research Database (Denmark)
Larsen, John Christian; Nørby, Karin Kristiane; Beltoft, Vibe Meister
The European Food Safety Authority (EFSA) asked the Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (the Panel) to provide scientific advice to the Commission on the implications for human health of chemically defined flavouring substances used in or on foodstuffs...... in the Member States. In particular, the Panel was requested to evaluate 19 flavouring substances in the Flavouring Group Evaluation 23, Revision 2 (FGE.23Rev2), using the Procedure as referred to in the Commission Regulation (EC) No 1565/2000. These 19 flavouring substances belong to chemical groups 15, 16, 22......-no: 03.022] Industry has informed that it occurs as a mixture of E- & Z-isomers, however, the composition of the mixture has to be specified. Two of the flavouring substances are classified into structural class I, seven are classified into structural class II and 10 are classified into structural class...
Syntheses of 24R,25-dihydroxy-[6,19,19-3H]vitamin D3 and 24R,25-dihydroxy-[6,19,19-2H]vitamin D3
International Nuclear Information System (INIS)
Yamada, S.; Shimizu, M.; Fukushima, K.; Niimura, K.; Maeda, Y.
1989-01-01
24R,25-Dihydroxy-[6,19,19-3H]vitamin D3 with a specific activity of 54 Ci/mmol and 24R,25-dihydroxy-[6,19,19-2H]vitamin D3 with 2.6 deuterium atoms/mol were synthesized in four steps starting from 24R,25-Dihydroxyvitamin D3 via its sulfur dioxide adduct
Fibroblast Growth Factor 23 (FGF23 and Disorders of Phosphate Metabolism
Directory of Open Access Journals (Sweden)
Tasuku Saito
2009-01-01
Full Text Available Derangements in serum phosphate level result in rickets/osteomalacia or ectopic calcification indicating that healthy people without these abnormalities maintain serum phosphate within certain ranges. These results indicate that there must be a regulatory mechanism of serum phosphate level. Fibroblast growth factor 23 (FGF23 was identified as the last member of FGF family. FGF23 is produced by bone and reduces serum phosphate level by suppressing phosphate reabsorption in proximal tubules and intestinal phosphate absorption through lowering 1,25-dihydroxyvitamin D level. It has been shown that excess and deficient actions of FGF23 result in hypophosphatemic rickets/osteomalacia and hyperphosphatemic tumoral calcinosis, respectively. These results indicate that FGF23 works as a hormone, and several disorders of phosphate metabolism can be viewed as endocrine diseases. It may become possible to treat patients with abnormal phosphate metabolism by pharmacologically modifying the activity of FGF23.
The prevalence of parvovirus B19 infection among pregnant women of Ardabil in 2013.
Habibzadeh, Shahram; Peeri-Doghaheh, Hadi; Mohammad-Shahi, Jafar; Mobini, Elham; Shahbazzadegan, Samira
2016-06-01
Trans-placental transmission of parvovirus B19 during pregnancy can causes adverse outcomes. Regarding its importance in prenatal care, we decided to study prevalence of parvovirus B19 infection among pregnant woman in Ardabil, Iran. In a community based study with a cluster sampling, 350 pregnant women that attended in health care centers in Ardabil were selected. Serum samples were collected and Anti-B19 specific IgG was detected using commercial enzyme-linked immunosorbent assays (Euroimmune Elisa kit, Germany). Furthermore, a questionnaire filled for all participants during samples collection. 64.6% (226/350) of participants were Ardabil citizen and the rest were from rural area (124/350). Anti-B19-specific IgG antibody was detected in 69.1% of pregnant women (242/350). Participants' ages ranged from 15 to 34 years with average of 23 years. According to our study, seroprevalence of IgG antibodies had positive significant correlation with the participants' age (r=0.268) but there were no significant relations between B19 seropositivity and living area, family member, number of commensals, number of living children, and the amount of hemoglobin (p>0.05). Approximately, one-third of the participants were at risk of primary B19 infection. Therefore, health education of pregnant women and screening of infected pregnant women is recommended to prevent fetal complications.
Application of inverse kinematics to [sup 1]H+[sup 23]Na[yields][sup 12]C+[sup 12]C
Energy Technology Data Exchange (ETDEWEB)
Bennett, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Clarke, N.M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Freer, M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Fulton, B.R. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Hall, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Karban, O. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Murgatroyd, J.T. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Tungate, G. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Gyapong, G.J. (Dept. of Physics, York Univ. (United Kingdom)); Jarvis, N.S. (Dept. of Physics, York Univ. (United Kingdom)); Watson, D.L. (Dept. of Physics, York Univ. (United Kingdom)); Rae, W.D.M. (Dept. of Nuclear Physics, Oxford Univ. (United Kingdom)); Smith, A.E. (Dept. of Nuclear; Charissa Collaboration
1993-08-15
Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the [sup 1]H([sup 23]Na, [sup 12]C)[sup 12]C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in [sup 24]Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the [sup 23]Na(p, [sup 12]C)[sup 12]C reaction. (orig.)
Relationship of 2,3-diphosphoglycerate and 2,3-diphosphoglycerate mutase in various mammals.
Chemtob, S; Gibb, W; Bard, H
1980-01-01
To investigate a possible mechanism involved in the regulation of 2,3-diphosphoglycerate (2,3-DPG) synthesis, 2,3-DPG mutase (DPGM) was measured in different mammals presenting large differences in 2,3-DPG concentration between fetal, neonatal and adult life to see the activity of this enzyme, necessary for 2,3-DPG synthesis, was related to the levels of 2,3-DPG. The data demonstrated that the minimal levels of 2,3-DPG in the adult sheep are likely due to the very low levels of DPGM. Also these findings show that the increases in 2,3-DPG levels, found in the newborn sheep during the 1st week of life, in adult rabbit and guinea pig when compared with their fetuses, are not due to an increase in levels of the DPGM.
Jeremiah 23:23–24 as polemic against prophets' views on Yahweh's ...
African Journals Online (AJOL)
2016-05-31
May 31, 2016 ... Yahweh is also a distant God who is aware of their false and deceitful attempts to provide revelatory knowledge to the people. In this regard chapter 23:23–24 serves as a polemic against so-called false prophets and implies a threat of judgement. Jeremiah 23:23–24 as polemic against prophets' views on ...
Directory of Open Access Journals (Sweden)
Xi Zhou
2017-11-01
Full Text Available Nav1. 9 voltage-gated sodium channel is preferentially expressed in peripheral nociceptive neurons. Recent progresses have proved its role in pain sensation, but our understanding of Nav1.9, in general, has lagged behind because of limitations in heterologous expression in mammal cells. In this work, functional expression of human Nav1.9 (hNav1.9 was achieved by fusing GFP to the C-terminal of hNav1.9 in ND7/23 cells, which has been proved to be a reliable method to the electrophysiological and pharmacological studies of hNav1.9. By using the hNav1.9 expression system, we investigated the electrophysiological properties of four mutations of hNav1.9 (K419N, A582T, A842P, and F1689L, whose electrophysiological functions have not been determined yet. The four mutations significantly caused positive shift of the steady-state fast inactivation and therefore increased hNav1.9 activity, consistent with the phenotype of painful peripheral neuropathy. Meanwhile, the effects of inflammatory mediators on hNav1.9 were also investigated. Impressively, histamine was found for the first time to enhance hNav1.9 activity, indicating its vital role in hNav1.9 modulating inflammatory pain. Taken together, our research provided a useful platform for hNav1.9 studies and new insight into mechanism of hNav1.9 linking to pain.
Kubota, Takuo; Kitaoka, Taichi; Miura, Kohji; Fujiwara, Makoto; Ohata, Yasuhisa; Miyoshi, Yoko; Yamamoto, Keiko; Takeyari, Shinji; Yamamoto, Takehisa; Namba, Noriyuki; Ozono, Keiichi
2014-01-01
Vitamin D-deficient rickets (DR) has recently re-emerged among developed countries. Vitamin D deficiency can influence biochemical results of patients with fibroblast growth factor 23 (FGF23)-related hereditary hypophosphatemic rickets (HR), making differential diagnosis difficult. In the present study we evaluated the utility of serum FGF23 levels in the diagnosis of DR and during its treatment. The study group comprised 24 children with DR and 8 children with HR. Serum FGF23 levels and bone metabolism-related measurements were assessed. Serum FGF23 levels in patients with DR were less than 19 pg/ml, while those in patients with HR were more than 57 pg/ml. There were significant differences in serum levels of calcium, phosphate, parathyroid hormone, and 1,25-dihydroxyvitamin D, as well as tubular maximum phosphate reabsorption per glomerular filtration rate between patients with DR and HR, but these values were not fully mutually exclusive. In addition, serum FGF23 and phosphate levels were increased following treatment. Serum FGF23 level is the most critical biochemical marker for distinguishing DR from HR and might be a good indicator of biochemical response to the intervention. Serum FGF23 levels show utility for the diagnosis of DR and in the assessment of its response to treatment.
Human parvovirus B19 infection and hydrops fetalis in Rio de Janeiro, Brazil
Directory of Open Access Journals (Sweden)
Rita CN Cubel
1996-04-01
Full Text Available Formalin-fixed paraffin embedded lung and liver tissue from 23 cases of non immune hydrops fetalis and five control cases, in which hydrops were due to syphilis (3 and genetic causes (2, were examined for the presence of human parvovirus B19 by DNA hybridisation. Using in situ hybridisation with a biotynilated probe one positive case was detected. Using 32P-labelled probes in a dot blot assay format, five further positives were obtained. These were all confirmed as positive by a nested polymerase chain reaction assay. Electron microscopy revealed virus in all these five positive cases. The six B19 DNA positive cases of hydrops fetalis were from 1974, 1980, 1982, 1987 and 1988, four of which occurred during the second half of the year, confirming the seasonality of the disease.
Czech Academy of Sciences Publication Activity Database
Myslivcová, Eva
2016-01-01
Roč. 53, 2-3 (2016), s. 300-301 ISSN 0018-7003. [19th Biennial International Nineteenth-Century Music Conference. Oxford, 11.07.2016-13.07.2016] Institutional support: RVO:68378076 Keywords : music ological conference * nineteenth-century music * Antonin Dvorak * opera Subject RIV: AL - Art, Architecture, Cultural Heritage
African Journals Online (AJOL)
Dr Olaleye
Systemic phosphate homeostasis is maintained through several hormonal mechanisms which involve fibroblast growth factor 23 (FGF-23), α-klotho, vitamin D and parathyroid hormone. FGF-23 is known to be the major regulator of phosphate balance (Mirams et al., 2004). FGF-23 is a phosphaturic hormone, which is.
23 CFR 505.17 - Applicability of Title 23, U.S. Code.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Applicability of Title 23, U.S. Code. 505.17 Section 505... INFRASTRUCTURE MANAGEMENT PROJECTS OF NATIONAL AND REGIONAL SIGNIFICANCE EVALUATION AND RATING § 505.17 Applicability of Title 23, U.S. Code. Funds made available to carry out this section shall be available for...
19 CFR 19.41 - Movement of containerized cargo to a container station.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Movement of containerized cargo to a container station. 19.41 Section 19.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... THEREIN Container Stations § 19.41 Movement of containerized cargo to a container station. Containerized...
Landry, Marie Louise
2016-06-01
Primary parvovirus B19 infection is an infrequent, but serious and treatable, cause of chronic anemia in immunocompromised hosts. Many compromised hosts have preexisting antibody to B19 and are not at risk. However, upon primary infection, some patients may be able to mount a sufficient immune response to terminate active parvovirus B19 infection of erythroid precursors. The most common consequence of B19 infection in the compromised host is pure red-cell aplasia, resulting in chronic or recurrent anemia with reticulocytopenia. Anemia persists until neutralizing antibody is either produced by the host or passively administered. Parvovirus B19 should be suspected in compromised hosts with unexplained or severe anemia and reticulocytopenia, or when bone-marrow examination shows either giant pronormoblasts or absence of red-cell precursors. Diagnosis is established by detection of B19 DNA in serum in the absence of IgG antibody to B19. In some cases, IgG antibody is detected but is not neutralizing. Anti-B19 IgM may or may not be present. Therapy includes any or all of the following: red-cell transfusion, adjustment in medications to restore or improve the patient's immune system, and administration of intravenous immunoglobulin (IVIG). Following treatment, patients should be closely monitored, especially if immunosuppression is unchanged or increased. Should hematocrit trend downward and parvovirus DNA trend upward, the therapeutic options above should be revisited. In a few instances, monthly maintenance IVIG may be indicated. Caregivers should be aware that B19 variants, though rarely encountered, can be missed or under-quantitated by some real-time polymerase-chain reaction methods.
A 19-state R-matrix investigation of resonances in e--He scattering at low energies. Pt. 4
International Nuclear Information System (INIS)
Fon, W.C.; Lim, K.P.
1993-01-01
The authors have previously reported the 11-state and 19-state R-matrix calculations of 1 1 S-2 3,1 S and 1 1 S-2 3 P differential cross sections at low energies. In this paper, the same R-matrix calculations are extended to obtain the differential cross sections and the electron-photon coincidence parameters λ and |Χ| for the excitation of the ground state helium to the 2 1 P state. Convergence studies are carried out between the 11-state and 19-state R-matrix calculations. Only the 19-state R-matrix results are presented in full at scattering angles of 20 o , 30 o , 60 o , 90 o , 120 o and 140 o from the excitation threshold up to 23.8 eV. (author)
Resuscitation of neonates at 23 weeks' gestational age: a cost-effectiveness analysis.
Partridge, J Colin; Robertson, Kathryn R; Rogers, Elizabeth E; Landman, Geri Ottaviano; Allen, Allison J; Caughey, Aaron B
2015-01-01
Resuscitation of infants at 23 weeks' gestation remains controversial; clinical practices vary. We sought to investigate the cost effectiveness of resuscitation of infants born 23 0/7-23 6/7 weeks' gestation. Decision-analytic modeling comparing universal and selective resuscitation to non-resuscitation for 5176 live births at 23 weeks in a theoretic U.S. cohort. Estimates of death (77%) and disability (64-86%) were taken from the literature. Maternal and combined maternal-neonatal utilities were applied to discounted life expectancy to generate QALYs. Incremental cost-effectiveness ratios were calculated, discounting costs and QALYs. Main outcomes included number of survivors, their outcome status and incremental cost-effectiveness ratios for the three strategies. A cost-effectiveness threshold of $100 000/QALY was utilized. Universal resuscitation would save 1059 infants: 138 severely disabled, 413 moderately impaired and 508 without significant sequelae. Selective resuscitation would save 717 infants: 93 severely disabled, 279 moderately impaired and 343 without significant sequelae. For mothers, non-resuscitation is less expensive ($19.9 million) and more effective (127 844 mQALYs) than universal resuscitation ($1.2 billion; 126 574 mQALYs) or selective resuscitation ($845 million; 125 966 mQALYs). For neonates, both universal and selective resuscitation were cost-effective, resulting in 22 256 and 15 134 nQALYS, respectively, versus 247 nQALYs for non-resuscitation. In sensitivity analyses, universal resuscitation was cost-effective from a maternal perspective only at utilities for neonatal death permissive response to parental requests for aggressive intervention at 23 weeks' gestation.
19 CFR 201.19 - Notification regarding requests for confidential business information.
2010-04-01
... business information. 201.19 Section 201.19 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Availability of Information to the Public Pursuant to 5 U.S.C. 552 § 201.19 Notification regarding requests for confidential business information. (a) In general. Business...
Brägelmann, Johannes; Klümper, Niklas; Offermann, Anne; von Mässenhausen, Anne; Böhm, Diana; Deng, Mario; Queisser, Angela; Sanders, Christine; Syring, Isabella; Merseburger, Axel S; Vogel, Wenzel; Sievers, Elisabeth; Vlasic, Ignacija; Carlsson, Jessica; Andrén, Ove; Brossart, Peter; Duensing, Stefan; Svensson, Maria A; Shaikhibrahim, Zaki; Kirfel, Jutta; Perner, Sven
2017-04-01
Purpose: The Mediator complex is a multiprotein assembly, which serves as a hub for diverse signaling pathways to regulate gene expression. Because gene expression is frequently altered in cancer, a systematic understanding of the Mediator complex in malignancies could foster the development of novel targeted therapeutic approaches. Experimental Design: We performed a systematic deconvolution of the Mediator subunit expression profiles across 23 cancer entities ( n = 8,568) using data from The Cancer Genome Atlas (TCGA). Prostate cancer-specific findings were validated in two publicly available gene expression cohorts and a large cohort of primary and advanced prostate cancer ( n = 622) stained by immunohistochemistry. The role of CDK19 and CDK8 was evaluated by siRNA-mediated gene knockdown and inhibitor treatment in prostate cancer cell lines with functional assays and gene expression analysis by RNAseq. Results: Cluster analysis of TCGA expression data segregated tumor entities, indicating tumor-type-specific Mediator complex compositions. Only prostate cancer was marked by high expression of CDK19 In primary prostate cancer, CDK19 was associated with increased aggressiveness and shorter disease-free survival. During cancer progression, highest levels of CDK19 and of its paralog CDK8 were present in metastases. In vitro , inhibition of CDK19 and CDK8 by knockdown or treatment with a selective CDK8/CDK19 inhibitor significantly decreased migration and invasion. Conclusions: Our analysis revealed distinct transcriptional expression profiles of the Mediator complex across cancer entities indicating differential modes of transcriptional regulation. Moreover, it identified CDK19 and CDK8 to be specifically overexpressed during prostate cancer progression, highlighting their potential as novel therapeutic targets in advanced prostate cancer. Clin Cancer Res; 23(7); 1829-40. ©2016 AACR . ©2016 American Association for Cancer Research.
Red blood cell 2,3-diphosphoglycerate concentration and in vivo P50 during early critical illness.
Ibrahim, Ezz el din S; McLellan, Stuart A; Walsh, Timothy S
2005-10-01
To measure red blood cell 2,3-diphosphoglycerate (RBC 2,3-DPG) concentrations in early critical illness; to investigate factors associated with high or low RBC 2,3-DPG levels; to calculate in vivo P50 in patients with early critical illness; and to explore the relationship between RBC 2,3-DPG and intensive care mortality. Prospective cohort study. General medical-surgical intensive care unit (ICU) of a major Scottish teaching hospital. One-hundred eleven critically ill patients during the first 24 hrs in the ICU with no history of chronic hematologic disorders or RBC transfusion within 24 hrs and 34 age- and sex-matched healthy reference subjects. None. We measured RBC 2,3-DPG concentration, plasma biochemistry values, and arterial blood gas parameters. On average, RBC 2,3-DPG was lower among critically ill patients than controls (mean [sd], 14.1 [6.3] vs. 16.7 [3.7] mumol/g hemoglobin; p = .004) and had a wider range of values (patients, 3.2-32.5 mumol/g hemoglobin; reference group, 9.1-24.3). Regression analysis indicated a strong independent association between plasma pH and RBC 2,3-DPG (B, 32.15 [95% confidence interval, 19.07-46.22], p level was normal (3.8 kPa) but varied widely among patients (range, 2.0-5.5 kPa). RBC 2,3-DPG concentration was similar for ICU survivors and nonsurvivors. RBC 2,3-DPG concentrations vary widely among critically ill patients. Acidosis is associated with lower RBC 2,3-DPG concentrations, but anemia is not associated with a compensatory increase in RBC 2,3-DPG early in critical illness. Lower RBC 2,3-DPG concentrations during the first 24 hrs of intensive care are not associated with higher ICU mortality.
Human parvovirus B19 (B19V) infection in systemic sclerosis patients
DEFF Research Database (Denmark)
Zakrzewska, K.; Corcioli, F.; Carlsen, Karen Marie
2009-01-01
BACKGROUND: Our previous reports suggested a possible association between parvovirus B19 (B19V) infection and systemic sclerosis (SSc), based on higher prevalence of B19V DNA in SSc patients in respect to controls. METHODS: In the present study, to further evaluate the differences in the pattern...... of B19 infection in SSc, skin biopsies and bone marrow samples from patients and controls were analysed for B19V DNA detection, genotyping and viral expression. RESULTS: B19V DNA was detected in skin biopsies from 39/49 SSc patients and from 20/28 controls. Bone marrow showed positive in 17/29 SSc...... in the skin of genotype 1-positive patients and not in control skins. CONCLUSION: The results outline some differences in the rate of persistence of B19V DNA, in the simultaneous persistence of 2 genotypes and in the pattern of viral expression among SSc patients and controls Udgivelsesdato: 2009...
Farmaki, Paraskevi F; Chini, Maria C; Mangafas, Nikolaos M; Tzanoudaki, Marianna T; Piperi, Christina P; Lazanas, Marios Z; Spoulou, Vana S
2018-05-02
Vaccine-induced memory B-cell (MBC) subsets have distinct roles in the establishment of protective immunity; MBCs expressing nonswitched immunoglobulin M (IgM+ MBCs) replenish the MBC pool, whereas MBCs expressing isotype-switched immunoglobulin (sIg+ MBCs) differentiate into plasma cells upon antigen reencounter. We investigated immunogenicity and MBCs induced by combined 13-valent pneumococcal conjugate vaccine (PCV13) and 23-valent pneumococcal polysaccharide vaccine (PPV23) in human immunodeficiency virus (HIV)-infected adults. Forty HIV-seropositive adults receiving ART with undetectable viral loads were enrolled. Seventeen had a CD4+ T-cell count of ≥400 cells/μL (group A), and 23 had a CD4+ T-cell count of 200-399 cells/μL (group B). All adults received PCV13 and, 1 year later, PPV23. Levels of IgM+ MBCs (defined as polysaccharide [PS]-specific CD19+CD10-CD27+CD21++IgM+ MBCs) and sIg+ MBCs (defined as PS-specific CD19+CD10-CD27+CD21++IgM- MBCs) and antibodies against PS14 and PS3 were measured prior and 1 month after each vaccination. Immunization caused a significant increase in PS antibodies, compared with levels at baseline (P < .001). Group B achieved significantly lower titers than group A (P < .05 for both PS14 and PS3). After receipt of PCV13, levels of IgM+ MBCs were unchanged, whereas levels of sIg+ MBCs increased significantly (P < .05 for PS14 and P < .001 for PS3). In contrast, following PPV23 receipt, levels of IgM+ MBCs were significantly reduced, and levels of sIg+ MBCs remained stable. A positive correlation was observed between baseline IgM+ and sIg+ MBC counts 1 month after PCV13 receipt but not after PPV23 receipt. PPV23 receipt 12 months after PCV13 receipt improved PCV13 immunogenicity. The reduction in the IgM+ MBC count observed after PPV23 receipt suggests that PPV23 has a depleting effect on PCV13-associated immunological memory. NCT03041051.
Tropomyosin Promotes Lamellipodial Persistence by Collaborating with Arp2/3 at the Leading Edge.
Brayford, Simon; Bryce, Nicole S; Schevzov, Galina; Haynes, Elizabeth M; Bear, James E; Hardeman, Edna C; Gunning, Peter W
2016-05-23
At the leading edge of migrating cells, protrusion of the lamellipodium is driven by Arp2/3-mediated polymerization of actin filaments [1]. This dense, branched actin network is promoted and stabilized by cortactin [2, 3]. In order to drive filament turnover, Arp2/3 networks are remodeled by proteins such as GMF, which blocks the actin-Arp2/3 interaction [4, 5], and coronin 1B, which acts by directing SSH1L to the lamellipodium where it activates the actin-severing protein cofilin [6, 7]. It has been shown in vitro that cofilin-mediated severing of Arp2/3 actin networks results in the generation of new pointed ends to which the actin-stabilizing protein tropomyosin (Tpm) can bind [8]. The presence of Tpm in lamellipodia, however, is disputed in the literature [9-19]. Here, we report that the Tpm isoforms 1.8/9 are enriched in the lamellipodium of fibroblasts as detected with a novel isoform-specific monoclonal antibody. RNAi-mediated silencing of Tpm1.8/9 led to an increase of Arp2/3 accumulation at the cell periphery and a decrease in the persistence of lamellipodia and cell motility, a phenotype consistent with cortactin- and coronin 1B-deficient cells [2, 7]. In the absence of coronin 1B or cofilin, Tpm1.8/9 protein levels are reduced while, conversely, inhibition of Arp2/3 with CK666 leads to an increase in Tpm1.8/9 protein. These findings establish a novel regulatory mechanism within the lamellipodium whereby Tpm collaborates with Arp2/3 to promote lamellipodial-based cell migration. Copyright © 2016 Elsevier Ltd. All rights reserved.
Measurement of the 19F(n,2n)18F cross section from 18 to 27 MeV
International Nuclear Information System (INIS)
Hartmann, C.L.; DeLuca, P.M. Jr.
1990-01-01
the 19 F(n,2n) 18 F cross section was measured at neutron energies of 18, 21, 23, and 27 MeV. Nearly monoenergetic neutrons bombarded teflon (CF 2 ), Zr, and Au samples. 19 F(n,2n) 18 F cross section values were determined relative to nat Zr(n,xn) 89 Zr and 197 Au(n,2n) 196 Au from measurements of the 18 F, 89 Zr, and 196 Au activities. Our results are in agreement with previous measurements below 20 MeV and extend the usefulness of this reaction to 27 MeV. 22 refs., 1 fig., 2 tabs
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Holidays. 23.11 Section 23.11... STATUTES § 23.11 Holidays. If the date determined under §§ 23.2 to 23.10 falls on a Federal holiday, then... that is not a Federal holiday. ...
Salivary Mucin 19 Glycoproteins
Culp, David J.; Robinson, Bently; Cash, Melanie N.; Bhattacharyya, Indraneel; Stewart, Carol; Cuadra-Saenz, Giancarlo
2015-01-01
Saliva functions in innate immunity of the oral cavity, protecting against demineralization of teeth (i.e. dental caries), a highly prevalent infectious disease associated with Streptococcus mutans, a pathogen also linked to endocarditis and atheromatous plaques. Gel-forming mucins are a major constituent of saliva. Because Muc19 is the dominant salivary gel-forming mucin in mice, we studied Muc19−/− mice for changes in innate immune functions of saliva in interactions with S. mutans. When challenged with S. mutans and a cariogenic diet, total smooth and sulcal surface lesions are more than 2- and 1.6-fold higher in Muc19−/− mice compared with wild type, whereas the severity of lesions are up to 6- and 10-fold higher, respectively. Furthermore, the oral microbiota of Muc19−/− mice display higher levels of indigenous streptococci. Results emphasize the importance of a single salivary constituent in the innate immune functions of saliva. In vitro studies of S. mutans and Muc19 interactions (i.e. adherence, aggregation, and biofilm formation) demonstrate Muc19 poorly aggregates S. mutans. Nonetheless, aggregation is enhanced upon adding Muc19 to saliva from Muc19−/− mice, indicating Muc19 assists in bacterial clearance through formation of heterotypic complexes with salivary constituents that bind S. mutans, thus representing a novel innate immune function for salivary gel-forming mucins. In humans, expression of salivary MUC19 is unclear. We find MUC19 transcripts in salivary glands of seven subjects and demonstrate MUC19 glycoproteins in glandular mucous cells and saliva. Similarities and differences between mice and humans in the expression and functions of salivary gel-forming mucins are discussed. PMID:25512380
Prognostic significance of preoperative serum CA125, CA19-9 and CEA in gastric carcinoma
Wang, Wei; Chen, Xiao-Long; Zhao, Shen-Yu; Xu, Yu-Hui; Zhang, Wei-Han; Liu, Kai; Chen, Xin-Zu; Yang, Kun; Zhang, Bo; Chen, Zhi-Xin; Chen, Jia-Ping; Zhou, Zong-Guang; Hu, Jian-Kun
2016-01-01
The prognostic significance of preoperative serum CA125, CA19-9 and CEA in gastric carcinoma (GC) has been widely reported and is still under debate. Here, we evaluated the prognostic significance of preoperative serum CA125, CA19-9 and CEA in patients with GC. 1692 patients with GC who underwent gastrectomy were divided into the training (from January 2005 to December 2011, n = 1024) and the validation (from January 2012 to December 2013, n = 668) cohorts. Positive groups of CA125 (> 13.72 U/ml), CA19-9 (> 23.36 U/ml) and CEA (> 4.28 ng/ml) were significantly associated with more advanced clinicopathological traits and worse outcomes than that of negative groups (all P tumor size (P tumor markers (NPTM) were more accurate in prognostic prediction than TNM stage alone. Our findings suggested that elevated preoperative serum CA125, CA19-9 and CEA were associated with more advanced clinicopathological traits and less favorable outcomes. In addition, CA125 as an independent prognostic factor should be further investigated. Nomogram based on NPTM could accurately predict the prognosis of GC patients. PMID:27097114
The radioactivity of the Hercynian Vosges; La radioactivite des Vosges hercyniennes
Energy Technology Data Exchange (ETDEWEB)
Rothe, J.P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Institut de Physique du Globe de Strasbourg, 67 (France)
1957-07-01
On november 22, 1950, in the course of the formal beginning of term ceremony, the University of Strasbourg was pleased to confer on Professor VENING-MEINESZ the degree of Doctor Honoris Causa. In his speech of acknowledgement, Professor VENING-MEINESZ paid tribute to the fact that his colleague, Edmond ROTHE, had created at Strasbourg a centre of radio-geological research and during his visit to the Institute of Terrestrial Physics, the scholar whom we are honouring today expressed an interest in the new measurements that I was able to show him. I am happy to offer to him in homage some results of a systematic study of radioactivity of the Hercynian Vosges. (author) [French] Le 22 novembre 1950, au cours de sa seance solennelle de rentree, l'Universite de Strasbourg avait la joie de decerner au professeur VENING-MEINESZ le grade de Docteur Honoris Causa. Dans son allocution de remerciements, le professeur VENING-MEINESZ voulait bien rappeler que son collegue Edmond ROTHE avait cree a Strasbourg un centre de recherches de radiogeologie; et vistant l'Institut de Physique du Globe, le savant que nous honorons aujourd'hui acceptait de s'interesser aux mesures nouvelles que je pus alors lui presenter. Je suis heureux de lui offrir en hommage quelques resultats d'une etude systematique de radioactivite des Vosges hercyniennes. (auteur)
The radioactivity of the Hercynian Vosges; La radioactivite des Vosges hercyniennes
Energy Technology Data Exchange (ETDEWEB)
Rothe, J P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Institut de Physique du Globe de Strasbourg, 67 (France)
1957-07-01
On november 22, 1950, in the course of the formal beginning of term ceremony, the University of Strasbourg was pleased to confer on Professor VENING-MEINESZ the degree of Doctor Honoris Causa. In his speech of acknowledgement, Professor VENING-MEINESZ paid tribute to the fact that his colleague, Edmond ROTHE, had created at Strasbourg a centre of radio-geological research and during his visit to the Institute of Terrestrial Physics, the scholar whom we are honouring today expressed an interest in the new measurements that I was able to show him. I am happy to offer to him in homage some results of a systematic study of radioactivity of the Hercynian Vosges. (author) [French] Le 22 novembre 1950, au cours de sa seance solennelle de rentree, l'Universite de Strasbourg avait la joie de decerner au professeur VENING-MEINESZ le grade de Docteur Honoris Causa. Dans son allocution de remerciements, le professeur VENING-MEINESZ voulait bien rappeler que son collegue Edmond ROTHE avait cree a Strasbourg un centre de recherches de radiogeologie; et vistant l'Institut de Physique du Globe, le savant que nous honorons aujourd'hui acceptait de s'interesser aux mesures nouvelles que je pus alors lui presenter. Je suis heureux de lui offrir en hommage quelques resultats d'une etude systematique de radioactivite des Vosges hercyniennes. (auteur)
International Nuclear Information System (INIS)
Osawa, Y.; Ohnishi, S.; Yarborough, C.; Ohigashi, S.; Kosaki, T.; Hashino, M.; Yanaihara, T.; Nakayama, T.
1990-01-01
19-Hydroxyandrostenedione (19-OHA) is secreted from the adrenal glands in men and women and also from the placenta during pregnancy. It has been found to cause hypertension in animal models. We have synthesized [7,7-2H2]-19-OHA with high deuterium content and, together with [7,7-2H2]A and [9,11-2H2]estrone (E1), have developed a quantitative assay of serum level 19-OHA, A, and E1 using the gas chromatography/mass spectrometry-mass fragmentography method to monitor individual subjects throughout pregnancy. The labeled 19-OHA, used as internal standard, showed only 6.73% of unlabeled compound. Recovery of standard 19-OHA, A, and E1 (5,000 pg each) added to male plasma was 97.4 +/- 2.3%, 96.3 +/- 2.1%, and 100.1 +/- 4.1% (mean +/- SD), respectively; the intraassay coefficient of variation was 2.1%, 3.5%, and 3.8%, respectively. Ten pregnant subjects without complications and 10 pregnant subjects near term with hypertension were selected (with informed consent). The 19-OHA and E1 serum concentrations of maternal venous blood from uncomplicated pregnancies increased significantly as gestation progressed (19-OHA: first trimester, 225 +/- 72; second trimester, 656 +/- 325; third trimester, 1,518 +/- 544 pg/ml), reaching the highest level at delivery (19-OHA: 1,735 +/- 684 pg/ml). Whereas a positive correlation was found between the level of 19-OHA and E1, no apparent change of the A level was observed during pregnancy. Levels of the three steroid hormones in pregnancy complicated by hypertension in the second and third trimester were not found to be significantly different from those of normal pregnancy (19-OHA of hypertensive subjects: second trimester, 762 +/- 349; third trimester, 1,473 +/- 491 pg/ml)
Directory of Open Access Journals (Sweden)
Castilho E.M.
2003-01-01
Full Text Available The position of the oxygen dissociation curve (ODC is modulated by 2,3-diphosphoglycerate (2,3-DPG. Decreases in 2,3-DPG concentration within the red cell shift the curve to the left, whereas increases in concentration cause a shift to the right of the ODC. Some earlier studies on diabetic patients have reported that insulin treatment may reduce the red cell concentrations of 2,3-DPG, causing a shift of the ODC to the left, but the reports are contradictory. Three groups were compared in the present study: 1 nondiabetic control individuals (N = 19; 2 insulin-dependent diabetes mellitus (IDDM patients (on insulin treatment (N = 19; 3 non-insulin-dependent diabetes mellitus (NIDDM patients using oral hypoglycemic agents and no insulin treatment (N = 22. The overall position of the ODC was the same for the three groups despite an increase of the glycosylated hemoglobin fraction that was expected to shift the ODC to the left in both groups of diabetic patients (HbA1c: control, 4.6%; IDDM, 10.5%; NIDDM, 9.0%. In IDDM patients, the effect of the glycosylated hemoglobin fraction on the position of the ODC appeared to be counterbalanced by small though statistically significant increases in 2,3-DPG concentration from 2.05 (control to 2.45 µmol/ml blood (IDDM. Though not statistically significant, an increase of 2,3-DPG also occurred in NIDDM patients, while red cell ATP levels were the same for all groups. The positions of the ODC were the same for control subjects, IDDM and NIDDM patients. Thus, the PO2 at 50% hemoglobin-oxygen saturation was 26.8, 28.2 and 28.5 mmHg for control, IDDM and NIDDM, respectively. In conclusion, our data question the idea of adverse side effects of insulin treatment on oxygen transport. In other words, the shift to the left reported by others to be caused by insulin treatment was not detected.
Castilho, E M; Glass, M L; Manço, J C
2003-06-01
The position of the oxygen dissociation curve (ODC) is modulated by 2,3-diphosphoglycerate (2,3-DPG). Decreases in 2,3-DPG concentration within the red cell shift the curve to the left, whereas increases in concentration cause a shift to the right of the ODC. Some earlier studies on diabetic patients have reported that insulin treatment may reduce the red cell concentrations of 2,3-DPG, causing a shift of the ODC to the left, but the reports are contradictory. Three groups were compared in the present study: 1) nondiabetic control individuals (N = 19); 2) insulin-dependent diabetes mellitus (IDDM) patients (on insulin treatment) (N = 19); 3) non-insulin-dependent diabetes mellitus (NIDDM) patients using oral hypoglycemic agents and no insulin treatment (N = 22). The overall position of the ODC was the same for the three groups despite an increase of the glycosylated hemoglobin fraction that was expected to shift the ODC to the left in both groups of diabetic patients (HbA1c: control, 4.6%; IDDM, 10.5%; NIDDM, 9.0%). In IDDM patients, the effect of the glycosylated hemoglobin fraction on the position of the ODC appeared to be counterbalanced by small though statistically significant increases in 2,3-DPG concentration from 2.05 (control) to 2.45 mol/ml blood (IDDM). Though not statistically significant, an increase of 2,3-DPG also occurred in NIDDM patients, while red cell ATP levels were the same for all groups. The positions of the ODC were the same for control subjects, IDDM and NIDDM patients. Thus, the PO2 at 50% hemoglobin-oxygen saturation was 26.8, 28.2 and 28.5 mmHg for control, IDDM and NIDDM, respectively. In conclusion, our data question the idea of adverse side effects of insulin treatment on oxygen transport. In other words, the shift to the left reported by others to be caused by insulin treatment was not detected.
Soft X-Ray Magneto-optical Faraday Effect around Ni M2,3 Edges
International Nuclear Information System (INIS)
Kai, Chen; Ming-Qi, Cui; Fen, Yan; Li-Juan, Sun; Lei, Zheng; Chen-Yan, Ma; Shi-Bo, Xi; Yi-Dong, Zhao; Jia, Zhao
2008-01-01
We present magneto-optical (MO) Faraday spectra measured around the M 2,3 edges (60–70eV) of Ni films at the Beijing Synchrotron Radiation Facility (BSRF). A polarization analysis of the final state of the transmitted radiation from the Ni film is employed to determine the Faraday rotation at the edges. The MO effect becomes resonantly enhanced at the M 2,3 edges, and accordingly large values for the rotation angle β of 1.85 ± 0.19° for this ferromagnetic Ni film with thickness of 31 nm are measured. Without the magnetic field, the azimuthal angles do not shift; with parallel and antiparallel magnetic field the rotation angles shift in the opposite way and they are symmetrical. The uncertainty of Faraday rotation angles mainly comes from the data fitting and the state change of the beamline when the angles are measured
2-(2,4-Dichlorophenyl-N-(1,5-dimethyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-ylacetamide
Directory of Open Access Journals (Sweden)
B. Narayana
2013-01-01
Full Text Available In the crystal structure of the title compound, C19H17Cl2N3O2, the molecules form dimers of the R22(10 type through N—H...O hydrogen bonding. As a result of steric repulsion, the amide group is rotated with respect to both the dichlorophenyl and 2,3-dihydro-1H-pyrazol-4-yl rings, making dihedral angles of 80.70 (13 and 64.82 (12°, respectively. The dihedral angle between the dichlorophenyl and 2,3-dihydro-1H-pyrazol-4-yl rings is 48.45 (5° while that between the 2,3-dihydro-1H-pyrazol-4-yl and phenyl rings is 56.33 (6°.
International Nuclear Information System (INIS)
Bhuvanesh, N.S.P.; Crosnier-Lopez, M.P.; Bohnke, O.; Emery, J.; Fourquet, J.L.
1999-01-01
The authors have synthesized two new lithium-containing oxides which are related to Ruddlesden-Popper phases, Li 4 Sr 3 Nb 5.77 Fe 0.23 O 19.77 and Li 4 Sr 3 Nb 6 O 20 , with partial occupancy of the 12-coordinated sites by Sr, for the first time by direct solid-state reaction. While the single crystal and powder X-ray diffraction data indicate that these oxides crystallize in tetragonal cells (space group I4/mmm; a = 3.9585(2) angstrom, c = 25.915(3) angstrom and a = 3.953(2) angstrom, c = 26.041(5) angstrom for the respective oxides), the electron diffraction of some of the crystallites shows supercell reflections with a ∼ √2a p , c ∼ 25.9 angstrom, probably indicating a twisting of the NbO 6 octahedra in the ab-plane. Although, these oxides show no significant lithium ionic conduction at room temperature, they show distinct conductivity values at elevated temperatures
CYP2C19 activity and cardiovascular risk factors in patients with an acute coronary syndrome.
Martínez-Quintana, Efrén; Rodríguez-González, Fayna; Medina-Gil, José María; Garay-Sánchez, Paloma; Tugores, Antonio
2017-09-20
CYP2C19 is a major isoform of cytochrome P450 that metabolizes a number of drugs and is involved in the glucocorticoids synthesis. CYP2C19 polymorphisms have been associated with the genetic risk for type 2 diabetes. Five hundred and three patients with an acute coronary event were studied to assess the association between the CYP2C19 activity (CYP2C19*2, CYP2C19*3 and CYP2C19*17 variants) and the type of acute coronary syndrome, cardiovascular risk factors (arterial systemic hypertension, diabetes mellitus, dyslipidemia and smoking), analytical parameters and the extent and severity of coronary atherosclerosis. Genotype distribution in our series was similar to that expected in the Caucasian population. Among the traditional cardiovascular risk factors, very poor metabolizer patients (*2/*2, *3/*3 or *2/*3) had a greater tendency to present diabetes mellitus needing insuline (P=.067). Conversely, when we compared very poor, poor and normal metabolizers vs. rapid and ultrarapid metabolizers we found significant differences in those diabetic patients under insulin treatment (64 patients [18%] vs. 17 patients [11%]; P=.032). On the contrary, analytical parameters, systemic arterial hypertension, dyslipidemia, smoking or the personal/family history of coronary artery disease did not reach statistical significance regardless of CYP2C19 activity. Similarly, the number and the type of coronary disease (thrombotic, fibrotic or both) did not differ between patients with different CYP2C19 enzyme activity. Patients with an acute coronary event and a very poor, poor and normal CYP2C19 metabolizer genotype have a higher prevalence of diabetes mellitus needing insuline than patients with the rapid and ultrarapid metabolizers CPY2C19 genotype. Copyright © 2017 Elsevier España, S.L.U. All rights reserved.
Verkaik, Melissa; Oranje, Maarten; Abdurrachim, Desiree; Goebel, Max; Gam, Zeineb; Prompers, Jeanine J; Helmes, Michiel; Ter Wee, Pieter M; van der Velden, Jolanda; Kuster, Diederik W; Vervloet, Marc G; Eringa, Etto C
2018-04-01
The overwhelming majority of patients with chronic kidney disease (CKD) die prematurely before reaching end-stage renal disease, mainly due to cardiovascular causes, of which heart failure is the predominant clinical presentation. We hypothesized that CKD-induced increases of plasma FGF23 impair cardiac diastolic and systolic function. To test this, mice were subjected to 5/6 nephrectomy (5/6Nx) or were injected with FGF23 for seven consecutive days. Six weeks after surgery, plasma FGF23 was higher in 5/6Nx mice compared to sham mice (720 ± 31 vs. 256 ± 3 pg/mL, respectively, P = 0.034). In cardiomyocytes isolated from both 5/6Nx and FGF23 injected animals the rise of cytosolic calcium during systole was slowed (-13% and -19%, respectively) as was the decay of cytosolic calcium during diastole (-15% and -21%, respectively) compared to controls. Furthermore, both groups had similarly decreased peak cytosolic calcium content during systole. Despite lower cytosolic calcium contents in CKD or FGF23 pretreated animals, no changes were observed in contractile parameters of cardiomyocytes between the groups. Expression of calcium handling proteins and cardiac troponin I phosphorylation were similar between groups. Blood pressure, the heart weight:tibia length ratio, α-MHC/β-MHC ratio and ANF mRNA expression, and systolic and diastolic function as measured by MRI did not differ between groups. In conclusion, the rapid, CKD-induced rise in plasma FGF23 and the similar decrease in cardiomyocyte calcium transients in modeled kidney disease and following 1-week treatment with FGF23 indicate that FGF23 partly mediates cardiomyocyte dysfunction in CKD. © 2018 The Authors. Physiological Reports published by Wiley Periodicals, Inc. on behalf of The Physiological Society and the American Physiological Society.
Enhancement of radiative Auger emission in lithium-like 23V20+ ions
International Nuclear Information System (INIS)
Bernstein, E.M.; Clark, M.W.
1988-01-01
Measurements have been made of projectile X-ray spectra coincident with single electron losss in collisions of 3.5-9.0 MeV amu -1 23 V q+ (q = 19, 20, 21) ions with He targets under single collision conditions. Non-monoenergetic X-rays observed in the coincidence spectra for V 20+ (lithium-like) projectiles are attributed to the radiative Auger effect (RAE). The intensity of RAE photons relative to the characteristic K x-ray yield is more than an order of magnitude larger than expected from theoretical calculations and from earlier measurements for atomic targets. (author)
Mutations of protocadherin 19 in female epilepsy (PCDH19-FE) lead to allopregnanolone deficiency
DEFF Research Database (Denmark)
Tan, Chuan; Shard, Chloe; Ranieri, Enzo
2015-01-01
Protocadherin 19 (PCDH19) female limited epilepsy (PCDH19-FE; also known as epilepsy and mental retardation limited to females, EFMR; MIM300088) is an infantile onset epilepsy syndrome with or without intellectual disability (ID) and autism. We investigated transcriptomes of PCDH19-FE female and ...
Directory of Open Access Journals (Sweden)
Levindo Alves de Oliveira
2010-12-01
Full Text Available CONTEXT: NM23, a metastasis suppressor gene, may be associated with prognosis in patients with colorectal carcinoma. OBJECTIVE: To analyze NM23 expression and its association with the presence of lymph node and liver metastases and survival in patients operated on for colorectal carcinoma. METHODS: One hundred thirty patients operated on for colorectal carcinoma were investigated. Tissue microarray blocks containing neoplastic tissue and tumor-adjacent non-neoplastic mucosa were obtained and analyzed by immunohistochemical staining using a monoclonal anti-NM23 antibody. Immunohistochemical expression was assessed using a semiquantitative scoring method, counting the percentage of stained cells. The results were compared regarding morphological and histological characteristics of the colorectal carcinoma, presence of lymph node and liver metastases, tumor staging, and patient survival. Statistical analysis was performed using the Mann-Whitney test, the Kruskal-Wallis test and Fisher's exact test. Survival analysis was performed using the Kaplan-Meier method and the log-rank test. RESULTS: NM23 expression was higher in colorectal carcinoma tissue than in adjacent non-neoplastic mucosa (P<0.0001. NM23 protein expression did not correlate with degree of cell differentiation (P = 0.57, vascular invasion (P = 0.85, lymphatic invasion (P = 0.41, perineural infiltration (P = 0.46, staging (P = 0.19, lymph node metastases (P = 0.08, or liver metastases (P = 0.59. Disease-free survival showed significant association (P = 0.01 with the intensity of NM23 protein immunohistochemical expression in colorectal carcinoma tissue, whereas overall survival showed no association with NM23 protein expression (P = 0.13. CONCLUSIONS: NM23 protein expression was higher in neoplastic colorectal carcinoma tissue than in adjacent non-neoplastic mucosa, showing no correlation with morphological aspects, presence of lymph node or liver metastases, colorectal carcinoma
Fondements du projet urbain ; enjeux et processus
Tabouret , René
1989-01-01
Ce rapport retrace l’émergence et la formalisation progressive du concept de projet urbain dans le cadre de l’Ecole d’Architecture de Strasbourg sur une décennie (1978-1988), à l’épreuve de projets contrastés (villes de Mulhouse, St Denis, Strasbourg) et de la participation au Seminario Internazionale de Arquitectura Contemporanea (sessions de Barcelone, Naples et Belfort). La projet urbain y est identifié comme ‘intervention dans le processus complexe de (trans)formation de la ville’ ; ceci ...
Li, You; Zhao, Lei; Wang, Shuai; Xing, Junji; Zheng, Chunfu
2012-09-01
Herpes simplex virus type 1 (HSV-1) triplex is a complex of three protein subunits, consisting of two copies of VP23 and one copy of VP19C. Here, we identified a non-classical NLS of VP19C between aa 50 and 61, and the nuclear import of VP19C was mediated by RanGTP and importin β1-, but not importin α5-, dependent pathway. Additionally, recombinant virus harbouring this NLS mutation (NLSm) replicates less efficiently as wild-type. These data strongly suggested that the nuclear import of VP19C is required for efficient HSV-1 production.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Recruitment. 23.310... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 23.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 23.300 through 23.310 apply shall not discriminate on the...
Magnetic structures of Er6Mn23 and Dy6Mn23
International Nuclear Information System (INIS)
Ouladdiaf, B.; Deportes, J.; Rodriguez-Carvajal, J.
1995-01-01
The R 6 Mn 23 (R=rare earth) compounds crystallize in the cubic Th 6 Mn 23 -type structure with space group Fm3m. Powder neutron-diffraction experiments were performed on Dy 6 Mn 23 and Er 6 Mn 23 . The magnetic unit cell coincides with the chemical one. The R moments have a ferromagnetic non-collinear arrangement, whereas the Mn moments are parallel to the [1 1 1] direction. The magnetic structures belong to the three-dimensional Γ 5g irreducible representation of Fm3m associated with the wave vector K=[0 0 0]. The spin configurations in both compounds result from the competition between the R-R, R-Mn magnetic interactions and the crystal electric field on the R ions. (orig.)
Ichikawa, Shoji; Sorenson, Andrea H; Austin, Anthony M; Mackenzie, Donald S; Fritz, Timothy A; Moh, Akira; Hui, Siu L; Econs, Michael J
2009-06-01
Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia. The disease is caused by inactivating mutations in fibroblast growth factor 23 (FGF23), Klotho (KL), and uridine diphosphate-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). In vitro studies indicate that GALNT3 O-glycosylates a phosphaturic hormone, FGF23, and prevents its proteolytic processing, thereby allowing secretion of intact FGF23. In this study we generated mice lacking the Galnt3 gene, which developed hyperphosphatemia without apparent calcifications. In response to hyperphosphatemia, Galnt3-deficient mice had markedly increased Fgf23 expression in bone. However, compared with wild-type and heterozygous littermates, homozygous mice had only about half of circulating intact Fgf23 levels and higher levels of C-terminal Fgf23 fragments in bone. Galnt3-deficient mice also exhibited an inappropriately normal 1,25-dihydroxyvitamin D level and decreased alkaline phosphatase activity. Furthermore, renal expression of sodium-phosphate cotransporters and Kl were elevated in Galnt3-deficient mice. Interestingly, there were sex-specific phenotypes; only Galnt3-deficient males showed growth retardation, infertility, and significantly increased bone mineral density. In summary, ablation of Galnt3 impaired secretion of intact Fgf23, leading to decreased circulating Fgf23 and hyperphosphatemia, despite increased Fgf23 expression. Our findings indicate that Galnt3-deficient mice have a biochemical phenotype of tumoral calcinosis and provide in vivo evidence that Galnt3 plays an essential role in proper secretion of Fgf23 in mice.
Mogg, T D; Palmer, J E
1995-09-01
The medical records of 23 American Miniature Horses with hyperlipidemia, hyperlipemia, or hepatic lipidosis were reviewed. The most common clinical signs were anorexia and lethargy. The mean duration of clinical signs was 2.4 days. A primary disease was identified in 19 cases. Enterocolitis was the most common primary disease (n = 10). Intentional feed restriction, as part of treatment for colic, resulted in hyperlipemia in 2 horses and hyperlipidemia in 1. Four horses had primary hyperlipemia, 3 of which had signs of hepatoencephalopathy secondary to hepatic lipidosis. Dextrose, heparin, and insulin were the most common treatments. The overall survival was 61% (14/23). All horses with peak serum triglyceride concentrations > 1,200 mg/dl died or were euthanatized, whereas all but 1 with peak serum triglyceride concentrations < 1,200 mg/dl survived. These findings suggest that when American Miniature Horses, like other ponies and donkeys, are in a negative energy balance, they can rapidly develop hyperlipidemia or hyperlipemia. Early detection and treatment may improve survival.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 19.200 Section 19.200 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 19.200 Application. Except as provided in §§ 19.205...
Wojcik, Malgorzata; Janus, Dominika; Dolezal-Oltarzewska, Katarzyna; Kalicka-Kasperczyk, Anna; Poplawska, Karolina; Drozdz, Dorota; Sztefko, Krystyna; Starzyk, Jerzy B
2012-01-01
Fibroblast growth factor 19 (FGF19) is a hormone released from the small intestine; recently, it has emerged as an endocrine regulator of glucose and lipid metabolism. The aim of this study was to investigate the role of FGF19 in the development of nonalcoholic fatty liver disease (NAFLD). This study included 23 (17 boys) obese adolescents (mean age of 14.1 years) with NAFLD. The control group consisted of 34 (13 boys) obese peers with normal ultrasonographic imaging and normal liver function tests. The definition of NAFLD was based on clinical criteria: elevated alanine aminotransferase (>35 U/L) and liver steatosis features on ultrasound imaging. Serum FGF19 levels were measured in a fasting blood sample. The definition of insulin resistance was based on the homeostasis model assessment (HOMA) threshold: >2.5. There was a significant difference between mean FGF19 levels in patients with NAFLD and controls (142.2 vs. 206 pg/mL, p=0.04). Mean fasting FGF19 levels were decreased in insulin-resistant patients in comparison with the non-insulin-resistant group (155.0 vs. 221.0 pg/mL, p=0.05). There was an inverse correlation between FGF19 and alanine aminotransferase levels (R=-0.3, pexogenous delivery of FGF19 might be therapeutically beneficial.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Recruitment. 19.310 Section... RECEIVING FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 19.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 19.300 through 19...
Valentijn, Linda J.; Koster, Jan; Versteeg, Rogier
2006-01-01
NM23-H1 and NM23-H2 are neighboring genes on chromosome 17q. They encode nucleoside diphosphate kinases that have additional roles in signal transduction, transcription, and apoptosis. NM23-H1 expression is a strong marker for prognosis and metastatic behavior in many tumor types. A new
Population genetics for 23 Y-STR loci in Tibetan in China and confirmation of DYS448 null allele.
Ye, Yi; Gao, Jingshang; Fan, Guangyao; Liao, Linchuan; Hou, Yiping
2015-05-01
Tibetan is one of 56 ethnic groups in China, where a level of genetic sub-structure might be expected. Although a global analysis of Y-chromosomal haplotype diversity for 23 STR loci and Y-STR databases with PPY23 kit were created with collaborative effort, there was a lack of data for Tibetan population. In this study we evaluated 248 unrelated male individuals of Chinese Tibetan living in the Tibet Autonomous Region to explore the underlying genetic structure of Tibetan populations. These samples were typed for 23 short-tandem repeat (STR) loci (DYS19, DYS389I, DYS389II, DYS390, DYS391, DYS392, DYS393, DYS385ab, DYS437, DYS438, DYS439, DYS448, DYS456, DYS458, DYS635, GATAH4, DYS481, DYS533, DYS549, DYS570, DYS576, and DYS643) by using PPY23 kit. A total of 224 different haplotypes were found. Haplotype diversity was 0.9990. Both Rst pairwise analyses and multidimensional scaling plot showed the genetic structure of Tibetan population was significantly different from some of Chinese ethnic groups and neighboring populations. There were few interesting null features at DYS448 observed by PPY23 that deserved some comment. It revealed that PPY23 marker set provided substantially stronger discriminatory power in Tibetan population. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Le dernier demi-siècle et les publications historiographiques alsaciennes
Vogler, Bernard
2012-01-01
La contribution étudie le rôle occupé par l’Institut d’Histoire d’Alsace à Strasbourg entre 1976 et 2003 et analyse les principaux centres d’intérêt de l’historiographie récente : les effets de quatre changements de nationalité et de langue entre 1871 et 1945, les biographies collectives et individuelles, l’apport des historiens allemands et anglo-saxons. The feature studies the part occupied by the Institute of Alsatian History in Strasbourg between 1976 and 2003, and analyses the most i...
CA 19-9 as a Marker of Survival and a Predictor of Metastization in Cholangiocarcinoma
Directory of Open Access Journals (Sweden)
Rosa Coelho
2017-02-01
Full Text Available Background: Cholangiocarcinoma is the second most frequent primitive liver malignancy and is responsible for 3% of the malignant gastrointestinal neoplasms. The aims of this study were to determine the association of serum levels of CA 19-9 at diagnosis with other clinical data and serum liver function tests and to identify possible factors that influence the survival rates during follow-up. Methods: Retrospective observational study of 89 patients with a diagnosis of cholangiocarcinoma followed at the Department of Gastroenterology during 5 years. Statistical analyses were performed using SPSS version 20.0. Results: Patients were followed up for a median time of 127 days (IQR: 48-564, and the median age at diagnosis was 71.0 years (IQR: 62.0-77.5. The median survival rate was 14.0 months (IQR: 4.3-23.7, and the mortality rate was 79%. Patients with CA 19-9 levels ≥103 U/L had lower albumin levels and higher levels of alanine aminotransferase and γ-glutamyltransferase. CA 19-9 levels ≥103 U/L were associated with a higher probability of metastization (p = 0.001 and lower rates of treatment with curative intent (p = 0.024. In a multivariate analysis, CA 19-9 levels Conclusion: Predictive factors for overall survival were identified, namely presence of metastasis, surgery, and chemotherapy. CA 19-9 levels ≥103 U/L were predictive factors for survival and metastization.
Dietz, Robert O.; Kuenzig, John K.
1947-01-01
Investigations were conducted in the Cleveland altitude wind tunnel to determine the performance and operational characteristics of the 19B-2, 19B-8, and 19XS-1 turbojet engines. One objective was to determine the effect of altitude, flight Mach number, and tail-pipe-nozzle area on the performance characteristics of the six-stage and ten-stage axial-flow compressors of the 19B-8 and 19XB-1 engines, respectively, The data were obtained over a range of simulated altitudes and flight Mach numbers. At each simulated flight condition the engine was run over its full operable range of speeds. Performance characteristics of the 19B-8 and 19XB-1 compressors for the range of operation obtainable in the turboJet-engine installation are presented. Compressor characteristics are presented as functions of air flow corrected to sea-level conditions, compressor Mach number, and compressor load coefficient. For the range of compressor operation investigated, changes in Reynolds number had no measurable effect on the relations among compressor Mach number, corrected air flow, compressor load coefficient, compressor pressure ratio, and compressor efficiency. The operating lines for the 19B-8 compressor lay on the low-air-flow side of the region of maximum compressor efficiency; the 19B-8 compressor operated at higher average pressure coefficients per stage and produced a lower over-all pressure ratio than did the 19XB-1 compressor.
23. ATSR congress - Proceedings
International Nuclear Information System (INIS)
2006-11-01
This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of the workers' decree; 19 - H. Mansoux
Many-electron effect in the resonant L23-M23V Auger-electron spectrum of Ti metal
International Nuclear Information System (INIS)
Ohno, Masahide
2006-01-01
Above the L23 absorption edge the L 23 -M 23 V resonant Auger-electron spectroscopy (RAES) spectrum of Ti metal shows a normal L 23 -M 23 V Auger decay spectrum at a constant kinetic energy (K.E.). Here LX and MY are the atomic shells Lx and My, respectively. Apart from a weak spectral feature of the L2-M23V Auger transition appearing around the L2 edge, the RAES spectra of Ti meal show a very little difference between the L2 and L3 regions [P. Le Fevre, J. Danger, H. Magnan, D. Chandesris, J. Jupille, S. Bourgeois, M.-A. Arrio, R. Gotter, A. Verdini, A. Morgante, Phys. Rev. B69 (2004) 155421]. It is shown that the time scale of relaxation of the resonantly excited L23-hole state to the L23-electron ionized state is much shorter than that of the L23-hole decay so that the L 23 -M 23 V RAES spectrum of Ti metal resembles much the normal L 23 -M 23 V Auger decay spectrum. The relaxation of the resonantly excited L23-hole state to the fully relaxed L23-hole state before the L23-hole decays, explains the extra width which is the primary cause of the discrepancy between the experimental high resolution near edge X-ray absorption spectroscopy (XAS) spectrum of Ti metal and the one calculated by the particle-hole Green's function including the Coulomb exchange interaction between the 2p hole and the 3d electron. The time scale of relaxation of the L3V two-hole state created by the L2-L3V Coster-Kronig (CK) decay to the single L3-hole state is much shorter than that of the L3-hole decay so that the L2-L3V-L3-M23V CK preceded Auger decay spectrum resembles much the L3-M23V Auger decay one
International Nuclear Information System (INIS)
Krishna Sastry, M.V.; Robertson, D.E.; Moynihan, J.A.; Roberts, M.F.
1992-01-01
2,3-Diphosphoglycerate (2,3-DPG) has been found to be the product of the enzymatic degradation of cyclic 2,3-diphosphoglycerate (cDPG) in the archaebacterium Methanobacterium thermoautotrophicum ΔH. Although 2,3-DPG has not previously been detected as a major soluble component of M. thermoautotrophicum, large pools accumulated at an incubation temperature of 50C. Under these conditions, cellular activity was significantly decreased; a return of the culture to the optimum growth temperature restored the 2,3-DPG pool back to original low levels and caused steady-state cDPG levels to increase again. While 13 CO 2 -pulse/ 12 CO 2 -chase experiments at 50C showed that the cDPG turned over, the appearance of 2,3-DPG at NMR-visible concentrations required at least 10 h. Production of 2,3-DPG in vivo was prevented by exposure of the cells to O 2 . the enzyme responsible for this hydrolysis of cDPG was purified by affinity chromatography and appears to be a 33-kDa protein. Activity was detected in the presence of oxygen and was enhanced by a solution of 1 M KCl, 25 mM MgCl 2 , and dithiothreitol. Both K m and V max have been determined at 37C; kinetics also indicate that in vitro the product, 2,3-DPG, is an inhibitor of cDPG hydrolysis. These findings are discussed in view of a proposed role for cDPG in methanogens
Chronic exercise ameliorates the neuroinflammation in mice carrying NSE/htau23
International Nuclear Information System (INIS)
Leem, Yea-Hyun; Lee, Young-Ik; Son, Hee-Jeong; Lee, Sang-Ho
2011-01-01
Research highlights: → The progress of neurodegeration are directly linked to the neuroinflammatory response. → We investigate whether exercise improves the neuroinflammation using T g -NSE/htau23 mice. → This provides insights that exercise may beneficial effects on the neuroinflammatory disorders. -- Abstract: The objective of the present study was to investigate whether chronic endurance exercise attenuates the neuroinflammation in the brain of mice with NSE/htau23. In this study, the tau-transgenic (Tg) mouse, Tg-NSE/htau23, which over expresses human Tau23 in its brain, was subjected to chronic exercise for 3 months, from 16 months of age. The brains of Tg mice exhibited increased immunoreactivity and active morphological changes in GFAP (astrocyte marker) and MAC-1 (microglia marker) expression in an age-dependent manner. To identify the effects of chronic exercise on gliosis, the exercised Tg mice groups were treadmill run at a speed of 12 m/min (intermediate exercise group) or 19 m/min (high exercise group) for 1 h/day and 5 days/week during the 3 month period. The neuroinflammatory response characterized by activated astroglia and microglia was significantly repressed in the exercised Tg mice in an exercise intensity-dependent manner. In parallel, chronic exercise in Tg mice reduced the increased expression of TNF-α, IL-6, IL-1β, COX-2, and iNOS. Consistently with these changes, the levels of phospho-p38 and phospho-ERK were markedly downregulated in the brain of Tg mice after exercise. In addition, nuclear NF-κB activity was profoundly reduced after chronic exercise in an exercise intensity-dependent manner. These findings suggest that chronic endurance exercise may alleviate neuroinflammation in the Tau pathology of Alzheimer's disease.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Labels. 19.704 Section 19... TREASURY LIQUORS DISTILLED SPIRITS PLANTS Samples of Spirits § 19.704 Labels. (a) On each container of spirits to be withdrawn under the provisions of § 19.701, the proprietor shall affix a label showing the...
New producers and new 11-, 19-, and 20-residue peptaibiotics: suzukacillins B and C
DEFF Research Database (Denmark)
Roehrich, C. R.; Iversen, Anita; Degenkolb, T.
2012-01-01
In the course of a project aimed to assess the significance of antibiotics for the producing organism(s) in the natural habitat, we screened a specimen of the fungicolous fungus Hypocrea phellinicola growing on its natural host Phellinus ferruginosus1. Using a peptaibiomics approach2,3, we detected...... 19- and 20-residue peptide sequences by (U)HPLC/HR-ESI-QqTOF-MS. Structures of peptaibiotics found were independently confirmed by analyzing the peptaibiome of an agar plate culture of H. phellinicola CBS 119283 (ex-type) grown under laboratory conditions. Notably, H. phellinicola could be identified...
Atalay, Altay; Gökahmetoğlu, Selma; Durmaz, Süleyman; Kandemir, Idris; Sağlam, Derya; Kaynar, Leylagül; Eser, Bülent; Cetin, Mustafa; Kılıç, Hüseyin
2014-06-01
We aimed to investigate posttransplant Epstein-Barr virus (EBV) and parvovirus B19 DNA in allogeneic stem cell transplant patients between 2009 and 2010. Forty-five adult patients in whom allogeneic stem cell transplantation was performed between April 2009 and November 2010 in the Erciyes University Faculty of Medicine, Department of Internal Medicine, Division of Hematology and Oncology, were included in the study. EBV and parvovirus B19 DNA positivity was investigated by using real-time polymerase chain reaction technique in 135 plasma samples obtained after transplantation at between 1 and 6 months. Pretransplant serological markers of EBV and parvovirus B19 were provided from patient files. In 32 (71.1%) of the patients, EBV antibodies in the pretransplantation period were as follows: anti-EBNA-1 IgG (+), VCA IgM (-), and VCA IgG (+). In 2 patients (4.45%), these antibodies were as follows: anti-EBNA-1 IgG (+), VCA IgM (-), and VCA IgG (-). In 1 patient (2.2%), they were as follows: anti-EBNA-1 IgG (-), VCA IgM (-), and VCA IgG (+). EBV serological markers were negative in 2 (2.2%) out of 45 patients before transplantation. There was low DNA positivity (parvovirus B19 IgM was negative and IgG was positive, parvovirus B19 IgM was positive and IgG was negative in 1 (2.3%) patient. Parvovirus B19 DNA was not identified in any of the samples obtained from these 45 patients. In this study, EBV and parvovirus B19 DNA were investigated in allogeneic stem cell transplant patients. None of the patients developed PTLD and parvovirus B19 DNA positivity was not detected. However, this issue needs to be further evaluated in prospective, multicenter studies with larger series of patients.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1230.23 Section 1230.23 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE PORK PROMOTION, RESEARCH, AND CONSUMER INFORMATION Pork Promotion, Research, and Consumer Information Order Definitions § 1230.23...
Czech Academy of Sciences Publication Activity Database
Neudorflová, Marie L.
2006-01-01
Roč. 23, - (2006), s. 201-211 ISSN 0353-6777. [Contribution of Women in Migration Context. Ljubljana, 17.11.2004-19.11.2004] Institutional research plan: CEZ:AV0Z70900502 Keywords : Austria-Hungary * emigration Subject RIV: AB - History
Minimum K_2,3-saturated Graphs
Chen, Ya-Chen
2010-01-01
A graph is K_{2,3}-saturated if it has no subgraph isomorphic to K_{2,3}, but does contain a K_{2,3} after the addition of any new edge. We prove that the minimum number of edges in a K_{2,3}-saturated graph on n >= 5 vertices is sat(n, K_{2,3}) = 2n - 3.
Ichikawa, Shoji; Sorenson, Andrea H.; Austin, Anthony M.; Mackenzie, Donald S.; Fritz, Timothy A.; Moh, Akira; Hui, Siu L.; Econs, Michael J.
2009-01-01
Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia. The disease is caused by inactivating mutations in fibroblast growth factor 23 (FGF23), Klotho (KL), and uridine diphosphate-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). In vitro studies indicate that GALNT3 O-glycosylates a phosphaturic hormone, FGF23, and prevents its proteolytic processing, thereby allowing secretion of intact FGF23. In this study we generat...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1219.23 Section 1219.23 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HASS AVOCADO PROMOTION, RESEARCH, AND INFORMATION Hass Avocado Promotion, Research, and Information Order Definitions § 1219.23 Research...
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 406.23 Section 406.23 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GRAIN MILLS POINT SOURCE CATEGORY Corn Dry Milling Subcategory § 406.23 [Reserved] ...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Promotion. 1216.23 Section 1216.23 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE PEANUT PROMOTION, RESEARCH, AND INFORMATION ORDER Peanut Promotion, Research, and Information Order Definitions § 1216.23 Promotion. Promotion...
Sastry, M V; Robertson, D E; Moynihan, J A; Roberts, M F
1992-03-24
2,3-Diphosphoglycerate (2,3-DPG) has been found to be the product of the enzymatic degradation of cyclic 2,3-diphosphoglycerate (cDPG) in the archaebacterium Methanobacterium thermoautotrophicum delta H. Although 2,3-DPG has not previously been detected as a major soluble component of M. thermoautotrophicum, large pools accumulated at an incubation temperature of 50 degrees C (below the optimum growth temperature of 62 degrees C). Under these conditions, cellular activity was significantly decreased; a return of the culture to the optimum growth temperature restored the 2,3-DPG pool back to original low levels and caused steady-state cDPG levels to increase again. While 13CO2-pulse/12CO2-chase experiments at 50 degrees C showed that the cDPG turned over, the appearance of 2,3-DPG at NMR-visible concentrations required at least 10 h. Production of 2,3-DPG in vivo was prevented by exposure of the cells to O2. The enzyme responsible for this hydrolysis of cDPG was purified by affinity chromatography and appears to be a 33-kDa protein. Activity was detected in the presence of oxygen and was enhanced by a solution of 1 M KCl, 25 mM MgCl2, and dithiothreitol. Both Km and Vmax have been determined at 37 degrees C; kinetics also indicate that in vitro the product, 2,3-DPG, is an inhibitor of cDPG hydrolysis. These findings are discussed in view of a proposed role for cDPG in methanogens.
Interleukin-19 in Breast Cancer
Directory of Open Access Journals (Sweden)
Ying-Yin Chen
2013-01-01
Full Text Available Inflammatory cytokines within the tumor microenvironment are linked to progression in breast cancer. Interleukin- (IL- 19, part of the IL-10 family, contributes to a range of diseases and disorders, such as asthma, endotoxic shock, uremia, psoriasis, and rheumatoid arthritis. IL-19 is expressed in several types of tumor cells, especially in squamous cell carcinoma of the skin, tongue, esophagus, and lung and invasive duct carcinoma of the breast. In breast cancer, IL-19 expression is correlated with increased mitotic figures, advanced tumor stage, higher metastasis, and poor survival. The mechanisms of IL-19 in breast cancer have recently been explored both in vitro and in vivo. IL-19 has an autocrine effect in breast cancer cells. It directly promotes proliferation and migration and indirectly provides a microenvironment for tumor progression, which suggests that IL-19 is a prognostic marker in breast cancer and that antagonizing IL-19 may have therapeutic potential.
Theoretical designs of 19.6 nm Ne-like Ge XRL source
International Nuclear Information System (INIS)
Zhang Guoping; Zhang Tanxin; Zheng Wudi
2004-01-01
19.6 nm Ne-like Ge X-ray laser (XRL) can be used as a source to diagnose Rayleigh-Taylor instability in laser induced plasma. In this paper, systemic optimum designs and theoretical analysis to Ne-like Ge XRL driven by pre-main short pulses were conducted by a series of codes, which had been tested by experiments. Simulation results show that, adopting driven conditions of 2%-3% pre-pulse, 6-8 ns pre-main pulse interval and 40 TW/cm 2 power intensity, a gain area of 19.6 nm laser line beyond 60 μm and gain duration of 90 ps can be obtained. Furthermore, with 16 mm plane target, the gain gets to 11.8/cm, and if 6 mrad/cm curved target is adopted, it reaches to 13.3/cm, and small signal gain-length product of single target is about 21.3, which means that saturated gain can be realized by a single target. With double targets opposite coupling, gain-length product can reach 38.4, deep saturation can be gotten, and XRL source required by demonstration of application is out of question
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Tobacco. 29.23 Section 29.23 Agriculture Regulations... Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD CONTAINER REGULATIONS TOBACCO INSPECTION Regulations Definitions § 29.23 Tobacco. Tobacco in its unmanufactured forms as it appears between...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authority. 23.502 Section 23.502 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS... WORKPLACE Drug-Free Workplace 23.502 Authority. Drug-Free Workplace Act of 1988 (Pub. L. 100-690). ...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Authorities. 23.801 Section 23.801 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... DRUG-FREE WORKPLACE Ozone-Depleting Substances 23.801 Authorities. (a) Title VI of the Clean Air Act...
“Show me thy glory” Sacred language and political rhetoric in Exodus 33:18-23
Directory of Open Access Journals (Sweden)
Osvaldo Luiz Ribeiro
2016-06-01
Full Text Available The text of the Hebrew Bible as instrument of rhetorical projection of political and theological conflicts in the horizon of its production. The objective is to analyze rhetorically Ex 33:18-23, applying at the pericope hermeneutical procedures of social-historical approach and rhetoric analysis, and intending to identify possible relationships between the narrative and the historical and social horizon of its production. As methodological steps, it was translated the Hebrew text from Ex 33:18-23, it was compared with the versions in Portuguese, it was analyzed rhetorically each section of the pericope and sought to identify the elements of contact between the narrative and the historical and social world-that produced it and serves as its semantic context. It was concluded that this is a critical and sarcastic text to priestly prerogatives that marked the political and social transformation of Judah after the Babylonian captivity. The narrative rhetorical strategy is, in the form of a request to the deity, to isolate the priestly postulated in v. 18, confronting it in v. 19-23 through three categorical denials by Yahweh.
XPA A23G polymorphism and risk of digestive system cancers: a meta-analysis.
He, Lei; Deng, Tao; Luo, Hesheng
2015-01-01
Several studies have reported an association between the A23G polymorphism (rs 1800975) in the xeroderma pigmentosum group A (XPA) gene and risk of digestive system cancers. However, the results are inconsistent. In this study, we performed a meta-analysis to assess the association between XPA A23G polymorphism and the risk of digestive system cancers. Relevant studies were identified using the PubMed, Web of Science, China National Knowledge Infrastructure, WanFang, and VIP databases up to August 30, 2014. The pooled odds ratio (OR) with a 95% confidence interval (CI) was calculated using the fixed or random effects model. A total of 18 case-control studies from 16 publications with 4,170 patients and 6,929 controls were included. Overall, no significant association was found between XPA A23G polymorphism and the risk of digestive system cancers (dominant model: GA + AA versus GG, OR 0.89, 95% CI 0.74-1.08; recessive model: AA versus GA + GG, OR 0.94, 95% CI 0.74-1.20; GA versus GG, OR 0.89, 95% CI 0.77-1.03; and AA versus GG, OR 0.87, 95% CI 0.64-1.19). When the analysis was stratified by ethnicity, similar results were observed among Asians and Caucasians in all genetic models. In stratified analysis based on tumor type, we also failed to detect any association between XPA A23G polymorphism and the risk of esophageal, gastric, or colorectal cancers. This meta-analysis indicates that the XPA A23G polymorphism is not associated with a risk of digestive system cancers.
32 CFR 776.23 - Communication.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Communication. 776.23 Section 776.23 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY MISCELLANEOUS RULES PROFESSIONAL CONDUCT... Professional Conduct § 776.23 Communication. (a) Communication: (1) A covered attorney shall keep a client...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Purpose. 23.1 Section 23.1 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.1 Purpose. The purpose...-647), are utilized in conformance with the privacy and constitutional rights of individuals. ...
24 CFR 882.123 - Conversion of Section 23 Units to Section 8 and Section 23 monitoring.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conversion of Section 23 Units to... Applicability, Scope and Basic Policies § 882.123 Conversion of Section 23 Units to Section 8 and Section 23 monitoring. (a)-(d) [Reserved] (e) Section 23 policies for units planned for conversion on or before...
Directory of Open Access Journals (Sweden)
Karin Birkenkamp-Demtröder
Full Text Available Keratin 23 (KRT23 is strongly expressed in colon adenocarcinomas but absent in normal colon mucosa. Array based methylation profiling of 40 colon samples showed that the promoter of KRT23 was methylated in normal colon mucosa, while hypomethylated in most adenocarcinomas. Promoter methylation correlated with absent expression, while increased KRT23 expression in tumor samples correlated with promoter hypomethylation, as confirmed by bisulfite sequencing. Demethylation induced KRT23 expression in vitro. Expression profiling of shRNA mediated stable KRT23 knockdown in colon cancer cell lines showed that KRT23 depletion affected molecules of the cell cycle and DNA replication, recombination and repair. In vitro analyses confirmed that KRT23 depletion significantly decreased the cellular proliferation of SW948 and LS1034 cells and markedly decreased the expression of genes involved in DNA damage response, mainly molecules of the double strand break repair homologous recombination pathway. KRT23 knockdown decreased the transcript and protein expression of key molecules as e.g. MRE11A, E2F1, RAD51 and BRCA1. Knockdown of KRT23 rendered colon cancer cells more sensitive to irradiation and reduced proliferation of the KRT23 depleted cells compared to irradiated control cells.
Directory of Open Access Journals (Sweden)
Ling Gong
2014-06-01
Full Text Available AIM: To determine whether the 23-gauge(23Gvitrecomy cutter could replace scissors in conventional 20-gauge(20Gpars plana vitrectomy for treating severe proliferative diabetic retinopathy(PDR.METHODS:Non-comparative interventional case series. Totally 27 eyes of 27 patients with PDR stageⅥ confirmed by funduscopy and B-ultrasound scan were enrolled. They underwent 20G vitrectomy, in which 23G vitrectomy cutter replaced scissors to remove neuvascular membrane. All 27 eyes received complete panretinal photocoagulation, 17 eyes received no tamponade, 6 eyes were 12% C3F8 tamponade, 4 eyes were filled with silicone oil. The follow up time was 3mo. The operation duration time, iatrogenic retinal tear and retinal bleeding need electric coagulation, best corrected visual acuity(BCVA, retinal reattachment were analyzed.RESULTS: The operative time was 35-120(average 79.19±29.82min; intraoperative iatrogenic retinal breaks were detected in 2 eyes(7%. At the end of 3mo follow up, BCVA>0.1 were in 9 eyes, from 0.05-0.1 in 10 eyes, CONCLUSION: The 23G vitrectomy cutter could replace scissors in conventional 20G pars plana vitrectomy for treating severe PDR.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1425.23 Section 1425.23 Agriculture... AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COOPERATIVE MARKETING ASSOCIATIONS § 1425.23 Reports. (a) CMA's shall annually provide CCC a report of all commodity deliveries involved in loans and LDP's by...
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.10 Section 23.10 Agriculture Office of the Secretary of Agriculture STATE AND REGIONAL ANNUAL PLANS OF WORK Regional Program § 23.10 Administration. (a) The Regional Programs will be administered through four Regional Rural Development Centers...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Background. 23.2 Section 23.2 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.2 Background. It is... potential threats to the privacy of individuals to whom such data relates, policy guidelines for Federally...
DEFF Research Database (Denmark)
Birkenkamp-Demtröder, Karin; Hahn, Stephan; Mansilla, Francisco
2013-01-01
correlated with absent expression, while increased KRT23 expression in tumor samples correlated with promoter hypomethylation, as confirmed by bisulfite sequencing. Demethylation induced KRT23 expression in vitro. Expression profiling of shRNA mediated stable KRT23 knockdown in colon cancer cell lines showed...... response, mainly molecules of the double strand break repair homologous recombination pathway. KRT23 knockdown decreased the transcript and protein expression of key molecules as e.g. MRE11A, E2F1, RAD51 and BRCA1. Knockdown of KRT23 rendered colon cancer cells more sensitive to irradiation and reduced......Keratin 23 (KRT23) is strongly expressed in colon adenocarcinomas but absent in normal colon mucosa. Array based methylation profiling of 40 colon samples showed that the promoter of KRT23 was methylated in normal colon mucosa, while hypomethylated in most adenocarcinomas. Promoter methylation...
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Discovery. 99.23 Section 99.23 Public Welfare... DEVELOPMENT FUND Hearing Procedures § 99.23 Discovery. The Department, the Lead Agency, and any individuals or groups recognized as parties shall have the right to conduct discovery (including depositions) against...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Plan. 23.3 Section 23.3 Commerce and... MISSING CHILDREN § 23.3 Plan. (a) The Department of Commerce will supplement and expand the national... biannual meetings of departmental representatives to discuss the current plan and recommendations for...
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Recruitment. 86.23 Section 86.23 Public Welfare... in Admission and Recruitment Prohibited § 86.23 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which this subpart applies shall not discriminate on the basis of sex in the recruitment and...
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Recruitment. 106.23 Section 106.23 Education... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 106.23 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which this subpart applies shall not discriminate on the basis of sex...
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Firewalls. 23.1191 Section 23.1191... § 23.1191 Firewalls. (a) Each engine, auxiliary power unit, fuel burning heater, and other combustion equipment, must be isolated from the rest of the airplane by firewalls, shrouds, or equivalent means. (b...
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false State. 1602.23 Section 1602.23 National Defense Other Regulations Relating to National Defense SELECTIVE SERVICE SYSTEM DEFINITIONS § 1602.23 State. The word State includes, where applicable, the several States of the United States, the City of New York...
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Evaluation. 900.23 Section 900.23 Food and Drugs... STANDARDS ACT MAMMOGRAPHY States as Certifiers § 900.23 Evaluation. FDA shall evaluate annually the performance of each certification agency. The evaluation shall include the use of performance indicators that...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Construction. 86.23 Section 86.23 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INLAND NAVIGATION RULES ANNEX III: TECHNICAL DETAILS OF SOUND SIGNAL APPLIANCES Bell or Gong § 86.23 Construction. Bells and gongs...
19th International Conference on Interactive Collaborative Learning
Guralnick, David; Uhomoibhi, James
2017-01-01
This book presents the proceedings of the 19th International Conference on Interactive Collaborative Learning, held 21-23 September 2016 at Clayton Hotel in Belfast, UK. We are currently witnessing a significant transformation in the development of education. The impact of globalisation on all areas of human life, the exponential acceleration of developments in both technology and the global markets, and the growing need for flexibility and agility are essential and challenging elements of this process that have to be addressed in general, but especially in the context of engineering education. To face these topical and very real challenges, higher education is called upon to find innovative responses. Since being founded in 1998, this conference has consistently been devoted to finding new approaches to learning, with a focus on collaborative learning. Today the ICL conferences have established themselves as a vital forum for the exchange of information on key trends and findings, and of practical lessons le...
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Settlement. 958.23 Section 958.23 Postal Service..., CLEAN-UP COSTS AND DAMAGES FOR VIOLATION OF HAZARDOUS MATERIAL REGULATIONS § 958.23 Settlement. Either party may make offers of settlement or proposals of adjustment at any time. The Determining Official has...
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Reports. 725.23 Section 725.23 Mineral... REGULATIONS REIMBURSEMENTS TO STATES § 725.23 Reports. (a) The agency shall, for each grant made under this part, submit semiannually to the Director or his authorized designee a Financial Status Report, SF 269...
Effect of carbogen on tumor oxygenation: combined fluorine-19 and proton MRI measurements
International Nuclear Information System (INIS)
Fan Xiaobing; River, Jonathan N.; Zamora, Marta; Al-Hallaq, Hania A.; Karczmar, Gregory S.
2002-01-01
Purpose: Blood oxygen level dependent (BOLD) contrast in magnetic resonance imaging (MRI) has been widely used for noninvasive evaluation of the effects of tumor-oxygenating agents. However, there have been few tests of the validity of this method. The goal of the present work was to use the T 1 of fluorine-19 in perfluorocarbon (PFC) emulsions as a 'gold standard' for comparison with BOLD MRI. Methods and Materials: Rats bearing R3230AC tumors implanted in the hind limb were injected with an emulsion of perfluoro-15-crown-5-ether for 2-3 days before experiments, which ensured that the PFC emulsion concentrated in the tumors. We correlated changes in tumor oxygenation caused by carbogen inhalation measured by 1 H BOLD MRI with quantitative 19 F measurements. The 19 F spin-lattice relaxation rate R 1 (= 1/T 1 ) was measured to determine initial oxygen tension (pO 2 ) in each image pixel containing the PFC, and changes in pO 2 during carbogen (95% O 2 , 5% CO 2 ) breathing. In a second carbogen breathing period, changes in water signal linewidth were measured using high spectral and spatial resolution imaging. 19 F and 1 H measurements were used to classify pixels as responders to carbogen (pixels where oxygen increased significantly) or nonresponders (no significant change in tumor oxygenation). Results: The 19 F and 1 H measurements agreed in 65% ± 11% of pixels (n = 14). Agreement was even stronger among pixels where 1 H showed increased oxygenation; 19 F measurements agreed with 1 H measurements in over 79% ± 11% of these pixels. Similarly, there was strong agreement between the two modalities in pixels where 19 F reported no change in pO 2 ; 1 H also showed no changes in 76% ± 18% of these pixels. Quantitative correlation of changes T 2 * (ΔT 2 *) in 1 H and changes R 1 (ΔR 1 ) in 19 F was weak during carbogen breathing, and averaged over the whole tumor was ∼0.40 for 14 experiments. However, the spatial patterns of 1 H and 19 F changes were qualitatively
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hulls. 23.755 Section 23.755 Aeronautics... Hulls § 23.755 Hulls. (a) The hull of a hull seaplane or amphibian of 1,500 pounds or more maximum weight must have watertight compartments designed and arranged so that the hull auxiliary floats, and...
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Abortion. 551.23 Section 551.23 Judicial..., Pregnancy, Child Placement, and Abortion § 551.23 Abortion. (a) The inmate has the responsibility to decide either to have an abortion or to bear the child. (b) The Warden shall offer to provide each pregnant...
Allele frequencies of 23 autosomal short tandem repeat loci in the Philippine population.
Rodriguez, Jae Joseph Russell Beltran; Salvador, Jazelyn M; Calacal, Gayvelline C; Laude, Rita P; De Ungria, Maria Corazon A
2015-07-01
We characterized diversity and forensic descriptive parameters of 23 autosomal STR loci (CSF1PO, D13S317, D16S539, D5S818, D7S820, TPOX, D18S51, D21S11, D3S1358, D8S1179, FGA, TH01, vWA, D1S1656, D10S1248, D12S391, D2S441, D22S1045, D19S433, D2S1338, D6S1043, Penta D and Penta E) among 167 unrelated Filipinos. The most variable autosomal STR loci observed is Penta E (observed heterozygosity: 0.9222, match probability: 0.0167). Results reveal matching probability of 8.21×10(-28) for 23 autosomal STR loci. This dataset for the Philippine population may now be used in evaluating the weight of DNA evidence for forensic applications such as in human identification, parentage/kinship testing, and interpretation of DNA mixtures. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1215.19 Section 1215.19 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Popcorn Promotion, Research, and Consumer Information Order Definitions § 1215.19...
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false [Reserved] 19.801 Section 19.801 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (the 8(a) Program) 19.801...
49 CFR 19.23 - Cost sharing or matching.
2010-10-01
... of (1) or (2). (1) The certified value of the remaining life of the property recorded in the recipient's accounting records at the time of donation. (2) The current fair market value. However, when... consistent with those paid for similar work in the recipient's organization. In those instances in which the...
19 CFR 24.23 - Fees for processing merchandise.
2010-04-01
... CBP; and (B) In the case of an underpayment, interest will accrue on the amount not paid from the date... the United States-Chile Free Trade Agreement Implementation Act (see also General Note 26, HTSUS) that... rate under paragraph (b)(1)(i)(A) of this section to the total value of such daily importations. (2...
Mehta, Jay; Prabhu, Ramkrishna; Eshpuniyani, Priya; Kantharia, Chetan; Supe, Avinash
2010-01-01
Using CA 19-9 and CEA (elevated > 2 times of normal) as predictors in determining operability and survival in pancreatic tumors. Levels of CA 19-9 and CEA were measured (pre and post operatively) in 49 patients of pancreatic malignancy. CECT was performed for diagnosis and staging. An experienced surgeon determined the operability. The levels of tumor markers were correlated with the operability and the survival based on CECT and intra-operative findings. 16/24 (67%) patients with CA 19-9 levels (CEA levels (CEA levels (p = 0.003) were found to be non-resectable. Of the 27 patients, found resectable on CECT, 5 were non-resectable intra-operatively. All of these had elevated levels of CA 19-9 and 4/5 (80%) had elevated levels of CEA. Only 5/21 (23%) non-resectable patients, with elevated levels of CA 19-9 reported at 1 year follow up. None of the non-resectable patients with CA 19-9 levels > 1000 U/ml reported at 6 month follow-up. None of the resectable patients pre-operatively showed evidence of recurrence. All achieved normal values post surgery. Elevated levels of CA 19-9 and CEA (> 2 times) predict increased chances of inoperability and poor survival in pancreatic tumors. Levels > 3 times had increased risk of inoperability even in patients deemed resectable on CT-Scan. Diagnostic laparoscopy would be beneficial in these patients. Levels of CA 19-9 (> 1000 U/ml) indicate a dismal survival in non-resectable group of patients.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Offices. 2.3 Section 2.3 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE GENERAL AND TECHNICAL PROVISIONS (ARTICLE II) § 2.3 Offices. The principal office of the Postal Service is located in Washington, DC, with...
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Discovery. 17.23 Section 17.23 Food and Drugs FOOD... HEARINGS § 17.23 Discovery. (a) No later than 60 days prior to the hearing, unless otherwise ordered by the..., depositions, and any forms of discovery, other than those permitted under paragraphs (a) and (e) of this...
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Circumvention. 61.19 Section 61.19 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS General Provisions § 61.19 Circumvention. No owner or...
Chart of the nuclides - Strasbourg 1990
International Nuclear Information System (INIS)
Antony, M.S.
1991-01-01
Data were compiled for a nuclide chart over the last two years. The compilation is complete to the end of September 1990. The chart includes about 30000 data. Decay modes are represented by colours. Announcement capabilities and prices are given. (G.P.) 3 refs
23. ATSR congress - Proceedings; 23eme congres de l'ATSR - Recueil des conferences
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-11-15
the workers' decree; 19 - H. Mansoux (IAEA): the workers' decree in perspective with IAEA recommendations; 20 - J. Champlong (SFRP): training of the radiation protection skilled person; 21 - B. Marc (Alpha Dir): mission, role and interface of the radiation protection skilled person; 22 - C. Roy (veterinarian): decree impact on a veterinary clinic; 23 - J-L. Rehel (IRSN): methodology for a workplace study, application in interventional radiology; 24 - A. Rannou (IRSN): assessment of workers' exposure to ionising radiations, lessons learnt and perspectives
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Financing. 705.19 Section 705.19 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY UNITED STATES NAVY REGULATIONS AND OFFICIAL RECORDS PUBLIC AFFAIRS REGULATIONS § 705.19 Financing. (a) The financial requirements for...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Advertising. 19.540 Section 19.540 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Programs or Activities Prohibited § 19.540 Advertising. A recipient shall not in any advertising related to...
2010-07-01
... SUSPENSION (NONPROCUREMENT) Definitions § 19.995 Principal. Principal means— (a) An officer, director, owner, partner, principal investigator, or other person within a participant with management or supervisory... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Principal. 19.995 Section 19.995...
Parvovirus B19 and Other Illnesses
... Cheek Rash Parvovirus B19 and Other Illnesses References Parvovirus B19 and Other Illnesses Recommend on Facebook Tweet Share ... disease is the most common illness caused by parvovirus B19 infection. Learn More Parvovirus B19 infection can cause ...
Feagan, Brian G.; Sandborn, William J.; D'Haens, Geert; Panés, Julián; Kaser, Arthur; Ferrante, Marc; Louis, Edouard; Franchimont, Denis; Dewit, Olivier; Seidler, Ursula; Kim, Kyung-Jo; Neurath, Markus F.; Schreiber, Stefan; Scholl, Paul; Pamulapati, Chandrasena; Lalovic, Bojan; Visvanathan, Sudha; Padula, Steven J.; Herichova, Ivona; Soaita, Adina; Hall, David B.; Böcher, Wulf O.
2017-01-01
Background The interleukin-23 pathway is implicated genetically and biologically in the pathogenesis of Crohn's disease. We aimed to assess the efficacy and safety of risankizumab (BI 655066, Boehringer Ingelheim, Ingelheim, Germany), a humanised monoclonal antibody targeting the p19 subunit of
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Security. 19.966 Section 19.966 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF... and Security § 19.966 Security. Proprietors shall provide security adequate to deter the unauthorized...
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Gambling. 1903.19 Section 1903.19 National Defense Other Regulations Relating to National Defense CENTRAL INTELLIGENCE AGENCY CONDUCT ON AGENCY INSTALLATIONS § 1903.19 Gambling. Gambling in any form, or the operation of gambling devices, is prohibited...
2010-01-01
... GENERAL ADMINISTRATIVE POLICY FOR NON-ASSISTANCE COOPERATIVE AGREEMENTS Management of Agreements Financial Management § 550.19 Purpose. Sections 550.20 through 550.25 of this subpart prescribe standards for financial... 7 Agriculture 6 2010-01-01 2010-01-01 false Purpose. 550.19 Section 550.19 Agriculture Regulations...
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Principles. 776.19 Section 776.19 National... Professional Conduct § 776.19 Principles. The Rules of this subpart are based on the following principles... exists, this subpart should be interpreted consistent with these general principles. (a) Covered...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Security. 18.19 Section 18.19 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... Provisions Document Requirements § 18.19 Security. The concentrate plant and equipment will be so constructed...
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Labor. 440.19 Section 440.19 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION WEATHERIZATION ASSISTANCE FOR LOW-INCOME PERSONS § 440.19 Labor. Payments for labor... supplement wages paid to training participants, public service employment workers, or other Federal or State...
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Report. 229.19 Section 229.19 National Defense... ARCHAEOLOGICAL RESOURCES: UNIFORM REGULATIONS § 229.19 Report. (a) Each Federal land manager, when requested by... comply with section 13 of the Act and comprehensively report on activities carried out under provisions...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Alcohol. 19.398 Section 19.398 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... Articles Bottling, Packaging, and Removal of Products § 19.398 Alcohol. (a) Containers. Subject to the...
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Performance. 19.9 Section 19.9 Mineral... MINING PRODUCTS ELECTRIC CAP LAMPS § 19.9 Performance. In addition to the general design and the safety... respect to performance, as follows: (a) Time of burning and candlepower. Permissible electric cap lamps...
Sisko, Andrea M; Keehan, Sean P; Cuckler, Gigi A; Madison, Andrew J; Smith, Sheila D; Wolfe, Christian J; Stone, Devin A; Lizonitz, Joseph M; Poisal, John A
2014-10-01
In 2013 health spending growth is expected to have remained slow, at 3.6 percent, as a result of the sluggish economic recovery, the effects of sequestration, and continued increases in private health insurance cost-sharing requirements. The combined effects of the Affordable Care Act's coverage expansions, faster economic growth, and population aging are expected to fuel health spending growth this year and thereafter (5.6 percent in 2014 and 6.0 percent per year for 2015-23). However, the average rate of increase through 2023 is projected to be slower than the 7.2 percent average growth experienced during 1990-2008. Because health spending is projected to grow 1.1 percentage points faster than the average economic growth during 2013-23, the health share of the gross domestic product is expected to rise from 17.2 percent in 2012 to 19.3 percent in 2023. Project HOPE—The People-to-People Health Foundation, Inc.
2010-01-01
... or review to determine the extent to which sales are to be disallowed, establish a claim, and/or... 7 Agriculture 4 2010-01-01 2010-01-01 false Reviews. 250.19 Section 250.19 Agriculture Regulations... TERRITORIES AND POSSESSIONS AND AREAS UNDER ITS JURISDICTION General Operating Provisions § 250.19 Reviews. (a...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Settlement. 18.19 Section 18.19... Procedures for Considering Applications § 18.19 Settlement. The applicant and agency counsel may agree on a proposed settlement of the award before final action on the application, either in connection with a...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Housing. 19.405 Section 19... Prohibited § 19.405 Housing. (a) Generally. A recipient shall not, on the basis of sex, apply different rules... related to housing, except as provided in this section (including housing provided only to married...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Employment. 19.500 Section 19... FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 19.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Definitions. 19.242 Section 19.242 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19.242 Definitions. As used in this...
Ahmadi, Amjad; Salimizand, Himen
2017-07-01
Early detection of Acinetobacter baumannii, an emerging pathogen in hospital settings, is of interest. The bla OXA-51-like family had been used as a marker to detect A. baumannii. During an infection outbreak, 14 isolates produced a 1.7-kb PCR band instead of 353 bp for this marker. This work sought the reasons behind the increased marker size. Characterisation of isolates was done by API-20NE, gyrB multiplex PCR and 16S-23S rRNA ITS sequencing. The 1.7-kb band generated and the complete bla OXA-51-like variant were sequenced to find the probable integrated element. Susceptibility testing to various antimicrobials was performed by microdilution. bla OXA-like , metallo-β-lactamases (MBLs), the ISAba1 element and the presence of ISAba1 adjacent to bla OXA-like were sought. rep-PCR, global clonal (GC) lineage determination and multilocus sequence typing (MLST) were performed to analyse the relationship among isolates. Isolates were characterised as Acinetobacter baumannii-calcoaceticus complex by API-20NE. gyrB multiplex PCR and 16S-23S ITS sequencing verified the isolates as A. baumannii. Sequencing of the 1.7-kb band revealed ISAba19 as the disrupting element. The bla OXA-51 variant was bla OXA-66 , which was elongated to 2.2 kb due to ISAba19. The bla OXA-23-like family was found in 67% of isolates. MBL genes were not detected; however, ISAba1-bla OXA-23-like was characterised in carbapenem-resistant isolates (53%; 8/15). Isolates were divided into three clusters by rep-PCR. All strains were ST2 and all but one belonged to GC II. Identification of A. baumannii based only on bla OXA-51-like is not reliable. Besides bla OXA-51-like , multiplex PCR of gyrB and rpoB could provide rapid and cost-effective results. Copyright © 2017 Elsevier B.V. and International Society of Chemotherapy. All rights reserved.
Physiological Actions of Fibroblast Growth Factor-23
Directory of Open Access Journals (Sweden)
Reinhold G. Erben
2018-05-01
Full Text Available Fibroblast growth factor-23 (FGF23 is a bone-derived hormone suppressing phosphate reabsorption and vitamin D hormone synthesis in the kidney. At physiological concentrations of the hormone, the endocrine actions of FGF23 in the kidney are αKlotho-dependent, because high-affinity binding of FGF23 to FGF receptors requires the presence of the co-receptor αKlotho on target cells. It is well established that excessive concentrations of intact FGF23 in the blood lead to phosphate wasting in patients with normal kidney function. Based on the importance of diseases associated with gain of FGF23 function such as phosphate-wasting diseases and chronic kidney disease, a large body of literature has focused on the pathophysiological consequences of FGF23 excess. Less emphasis has been put on the role of FGF23 in normal physiology. Nevertheless, during recent years, lessons we have learned from loss-of-function models have shown that besides the paramount physiological roles of FGF23 in the control of 1α-hydroxylase expression and of apical membrane expression of sodium-phosphate co-transporters in proximal renal tubules, FGF23 also is an important stimulator of calcium and sodium reabsorption in distal renal tubules. In addition, there is an emerging role of FGF23 as an auto-/paracrine regulator of alkaline phosphatase expression and mineralization in bone. In contrast to the renal actions of FGF23, the FGF23-mediated suppression of alkaline phosphatase in bone is αKlotho-independent. Moreover, FGF23 may be a physiological suppressor of differentiation of hematopoietic stem cells into the erythroid lineage in the bone microenvironment. At present, there is little evidence for a physiological role of FGF23 in organs other than kidney and bone. The purpose of this mini-review is to highlight the current knowledge about the complex physiological functions of FGF23.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Report. 7.19 Section 7.19 Public Lands... § 7.19 Report. (a) Each Federal land manager, when requested by the Secretary of the Interior, will... comprehensively report on activities carried out under provisions of the Act. (b) The Secretary of the Interior...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Drugs. 140.19 Section 140.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES LICENSED INDIAN TRADERS § 140.19 Drugs. Traders shall not keep for sale, or sell, give away, or use any opium, chloral, cocaine, peyote or mescal bean...
Stojkovic Lalosevic, Milica; Stankovic, Sanja; Stojkovic, Mirjana; Markovic, Velimir; Dimitrijevic, Ivan; Lalosevic, Jovan; Petrovic, Jelena; Brankovic, Marija; Pavlovic Markovic, Aleksandra; Krivokapic, Zoran
2017-01-01
This study was designed to investigate the efficiency of preoperative serum carcinoembryonic antigen (CEA) and carbohydrate cancer antigen (CA19-9) levels for diagnosing synchronous liver metastases and lymph node in colorectal carcinoma (CRC) patients. A total of 300 patients with histologically diagnosed CRC were included in this study between May 2014 and March 2015. The data were obtained prospectively from patient's medical records: medical history, demographics, tumor location, differentiation (grade), depth of the tumor (T), lymph node metastases (N), distant metastases (M), lymphatics, venous and perineural invasion, and disease stage. Tumor markers were measured with an electrochemiluminescent assay and the reference value was 5ng/ml for CEA and for Ca19-9, 37u/ml. There was A high statistically significant difference in the levels of serum CEA and CA19-9 between different disease stages of CRC (PCEA (stage I 3.76±8.73; II 5.68±17.27, III 7.56±14.81, and IV 70.90±253.23) and CA 19-9 levels (stage I 9.65±11.03, II 9.83±11.09; III 19.58±36.91, and IV 228.9±985.38, respectively). The mean CEA and CA19-9 serum levels were significantly higher in patients with regional lymph nodes involvement (CEA 37.21±177.85 vs 4.79±9.90, CA19-9 119.51±687.71 VS 12.24±17.69, respectively, PCEA 86.56±277.65 vs. 5.98±12.98, and CA19-9 273.27±1073.46 vs. 4.98±3142, respectively, with PCEA and CA 19-9, 3.5 ng/mL and 7.5 U/mL, respectively. While, a cut-off value for the presence of synchronous liver metastases of these two markers was 3.5ng/mL AND 5.5 U/mL. Our study showed that tumor makers, CEA and CA19-9, can be used as diagnostic factors regarding the severity of CRC specifically to suggest metastatic disease in CRC.
International Nuclear Information System (INIS)
Bakkum, E.L.
1987-01-01
A study of 23 Na via the 22 Ne(p,γ) 23 Na and 23 Na(γ,γ) 23 Na reactions is presented. Only a limited number of resonances has been studied, selected on the basis of strong excitation of the lowest levels of which the spin was unknown. As a result the spins are now known of all levels of 23 Na with excitation energies up to 7 MeV, except for a few high-spin states which are too weakly excited in the decay of the known 22 Ne(p,γ) resonances. The mean lifetimes of the 23 Na levels at 4.43 and 7.89 MeV were found to be 350±70 and 220±17 attoseconds (1 attosecond = 10 -18 seconds) respectively. 97 refs.; 22 figs.; 12 tabs
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Settlement. 1434.19 Section 1434.19 Agriculture... FOR HONEY § 1434.19 Settlement. The value of the settlement of loans shall be made by CCC on the... commodity: (1) If the value of the collateral at settlement is less than the amount due, the producer shall...
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Audit. 725.19 Section 725.19 Mineral Resources... REGULATIONS REIMBURSEMENTS TO STATES § 725.19 Audit. The agency shall arrange for an independent audit no less... Circular No. A-102, Attachment P. The audits will be performed in accordance with the “Standards for Audit...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false State. 19.1005 Section 19.1005 Money... (NONPROCUREMENT) Definitions § 19.1005 State. (a) State means— (1) Any of the states of the United States; (2) The... States; or (5) Any agency or instrumentality of a state. (b) For purposes of this part, State does not...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Tax. 19.21 Section 19.21 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Taxes Gallonage Taxes § 19.21 Tax. (a) A tax is imposed by 26 U.S...
DEFF Research Database (Denmark)
Jørgensen, Christel Thea; Pedersen, Christian; Søtofte, Inger
1998-01-01
The new 2,3-Aziridino-2,3-dideoxyhexonamides 3 and 11 were prepared by a three-step procedure from commercially available D-glucono-1,5-lactone and D-gulono-1,4-lactone, respectively. The lactones were converted into methyl 3,4;5,6-di-O-isopropylidene-2-Omesyl esters 2 and 10, which upon treatmen...... with ammonia formed the title aziridino compounds. These were reductively cleaved by hydrazine to give 3-amino-2,3-dideoxyhexonic hydrazides 13 and 15, which were easily converted into corresponding lactone 14 and acid 16, respectively....
Directory of Open Access Journals (Sweden)
Balducci Anthony
2012-06-01
Full Text Available Abstract Background Non-invasive imaging of inflammation to measure the progression of autoimmune diseases, such as rheumatoid arthritis (RA, and to monitor responses to therapy is critically needed. V-Sense, a perfluorocarbon (PFC contrast agent that preferentially labels inflammatory cells, which are then recruited out of systemic circulation to sites of inflammation, enables detection by 19F MRI. With no 19F background in the host, detection is highly-specific and can act as a proxy biomarker of the degree of inflammation present. Methods Collagen-induced arthritis in rats, a model with many similarities to human RA, was used to study the ability of the PFC contrast agent to reveal the accumulation of inflammation over time using 19F MRI. Disease progression in the rat hind limbs was monitored by caliper measurements and 19F MRI on days 15, 22 and 29, including the height of clinically symptomatic disease. Naïve rats served as controls. The capacity of the PFC contrast agent and 19F MRI to assess the effectiveness of therapy was studied in a cohort of rats administered oral prednisolone on days 14 to 28. Results Quantification of 19F signal measured by MRI in affected limbs was linearly correlated with disease severity. In animals with progressive disease, increases in 19F signal reflected the ongoing recruitment of inflammatory cells to the site, while no increase in 19F signal was observed in animals receiving treatment which resulted in clinical resolution of disease. Conclusion These results indicate that 19F MRI may be used to quantitatively and qualitatively evaluate longitudinal responses to a therapeutic regimen, while additionally revealing the recruitment of monocytic cells involved in the inflammatory process to the anatomical site. This study may support the use of 19F MRI to clinically quantify and monitor the severity of inflammation, and to assess the effectiveness of treatments in RA and other diseases with an inflammatory
Circulating C19MC MicroRNAs in Preeclampsia, Gestational Hypertension, and Fetal Growth Restriction
Directory of Open Access Journals (Sweden)
Ilona Hromadnikova
2013-01-01
Full Text Available The objective of the study was to identify the profile of circulating C19MC microRNAs (miR-516-5p, miR-517*, miR-518b, miR-520a*, miR-520h, miR-525, and miR-526a in patients with established preeclampsia (n=63, fetal growth restriction (n=27, and gestational hypertension (n=23. We examined the correlation between plasmatic concentrations and expression levels of microRNAs and the severity of the disease with respect to clinical signs, requirements for the delivery, and Doppler ultrasound parameters. Using absolute and relative quantification approaches, increased extracellular C19MC microRNA levels (miR-516-5p, P=0.037, P=0.009; miR-517*, P=0.033, P=0.043; miR-520a*, P=0.001, P=0.009; miR-525, P=0.026, P=0.01; miR-526a, P=0.03, P=0.035 were detected in patients with preeclampsia. The association analysis pointed to no relationship between C19MC microRNA plasmatic concentrations and expression profile and identified risk factors for a poorer perinatal outcome. However, the dependence between the levels of plasmatic C19MC microRNAs and the pulsatility index in the middle cerebral artery and the values of cerebroplacental ratio was demonstrated. The study brought the interesting finding that the upregulation of miR-516-5p, miR-517*, miR-520a*, miR-525, and miR-526a is a characteristic phenomenon of established preeclampsia.
Jia, Huiying; Tao, Feng; Liu, Changqin; Guo, Ting; Zhu, Wei; Wang, Shu; Cui, Bin; Ning, Guang
2015-03-01
Two independent Chinese cohorts were used to study the genetic association between the interleukin-23A (IL-23A) gene polymorphism (rs11171806) and susceptibility to Graves' disease (GD). The initial Shanghai cohort consisted of 712 unrelated patients with GD and 705 healthy control subjects, and the replication cohort from Xiamen Island included 433 patients with GD and 410 healthy control subjects. The serum concentration of IL-23 in GD patients was measured significantly higher than in health controls. Moreover in the subgroup analysis, higher concentrations of IL-23 were identified in patients of older age (⩾40 years) and female gender. We also performed an association study with the IL-23 gene polymorphism rs11171806 in both cohorts, in Shanghai cohorts, the frequencies of rs11171806 alleles were strongly different between Graves' disease patients (G 95.7% and A 4.3%) and healthy controls (G 97.7% and A 2.3%) (P=2.6×10(-3), OR=1.93 (95% CI: 1.25-2.97)), and in Xiamen cohorts, the proportion of individuals carrying the A allele of rs11171806 was the same significantly higher in Graves' disease patients than in controls [Graves' disease vs. control, 4.8% vs. 4.3%, OR=2.15 (95% CI: 1.23-3.79), P(allele)=6.3×10(-3)]. The distribution of rs11171806 genotype was also investigated in subgroups according to the age and gender. All of these findings suggested that IL-23 may play an important role in the development of GD, and the IL-23A gene is a genetic risk marker for GD in Han Chinese population. Copyright © 2015 Elsevier Inc. All rights reserved.
Stan, Ana; Zsigmond, Eva
2009-01-01
Since the main reason for transfusing preserved red cells is to increase the oxygen carrying capacity of the recipient, the circulating preserved red cells should have at the time of transfusion normal oxygen uptake and normal oxyhemoglobin dissociation characteristics. We evaluated the effectiveness of transfused red cells, through periodical determination of erythrocyte components, during 72 hours after transfusions of large quantities (3,000 mL) of blood. Three patients with massive hemorrhages, two after amputation and one after nephrectomy were given each 3,000 mL preserved blood (in ACD, 10 days, at 4 degrees C). Red cell 2,3-DPG and serum inorganic phosphorus were determined prior to transfusion and after, periodically, for three days. Red cell 2,3-DPG was determined by Krimsky's method and inorganic phosphorus by Kuttner and Lichtenstein's method. The in vivo restoration of 2,3-DPG--of transfused red cells is shown as a percentage of recipient's final 2,3-DPG level, and was calculated in each of the three patients. The level of erythrocyte 2,3-DPG was greater than 60% of the final level within 24 hours, after the end of transfusion. The in vivo rates of restoration of 2,3-DPG in transfused red cells for periods of 0-6, 6-24, 24-48 and 48-72 hours are 0.251, 0.238, 0.133, 0.120 mM/L cells/hour. The therapeutic significance of the increased oxygen affinity of stored blood becomes very important in clinical conditions, when large volumes of red cells are urgently needed. After massive transfusions, the restoration of 2,3-DPG in red cells produces a decrease of serum inorganic phosphorus through its consumption. The stored blood with low values of erythrocyte 2,3-DPG can be used without hesitation when correcting a chronic anemia for instance, but in acute situation, when the organism needs restoration of the oxygen releasing capacity within minutes, the resynthesis is obviously insufficient. In such situations, fresh blood or blood with a near normal 2,3-DPG
Jeremiah 23:23–24 as polemic against prophets’ views on Yahweh’s presence
Directory of Open Access Journals (Sweden)
Wilhelm Wessels
2016-05-01
Full Text Available Jeremiah 23:23–24 is a short passage in the cycle of oracles in which the prophet Jeremiah is supposedly in conflict with other prophets in his society. It is possible that this short passage first had an independent existence before it became part of the collection of oracles in 23:9-40 This article argues that as an independent oracle the passage claims that Yahweh is not just a localised god, but an omnipresent God from whom no person can hide. When read as part of the mentioned cycle, it should be regarded as a polemic against a view held by some prophets that Yahweh’s nearness guarantees peace and security. Their domesticated view leads to complacency and disregard. It is argued that Jeremiah opposes their view by stating that Yahweh is also a distant God who is aware of their false and deceitful attempts to provide revelatory knowledge to the people. In this regard chapter 23:23–24 serves as a polemic against so-called false prophets and implies a threat of judgement. Keywords: False prophets, temple, Yahweh's presence, polemic
49 CFR 1242.17 - Signals and interlockers (accounts XX-17-19 and XX-18-19).
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Signals and interlockers (accounts XX-17-19 and XX... RAILROADS 1 Operating Expenses-Way and Structures § 1242.17 Signals and interlockers (accounts XX-17-19 and XX-18-19). Separate common expenses on the basis of the total train-hours in running service, and/or...
Effect of the CYP2C19 genotype on the pharmacokinetics of icotinib in healthy male volunteers.
Ruan, Can-Jun; Liu, Dong-Yang; Jiang, Ji; Hu, Pei
2012-12-01
Icotinib hydrochloride {4-[(3-ethynylphenyl)amino]-6,7-benzo-12-crown-4-quinazoline hydrochloride}, a novel epidermal growth factor receptor (EGFR)-tyrosine kinase inhibitor (TKI), was designed for the treatment of non-small cell lung cancer (NSCLC). In the present study, we investigated the influence of the CYP2C19*2 and CYP2C19*3 alleles on the pharmacokinetics of icotinib in healthy Chinese volunteers. In a single-dose pharmacokinetic study, 12 healthy Chinese volunteers received an oral dose of 600 mg of icotinib. Plasma was sampled for up to 72 h post-dose, followed by quantification of icotinib by liquid chromatography-mass spectrometry/mass spectrometry (LC-MS-MS). Five subjects genotyped as homozygous extensive metabolizers (CYP2C19*1/*1), 6 subjects genotyped as heterozygous extensive metabolizers (CYP2C19*1/*2 or CYP2C19*1/*3), and 1 subject genotyped as a poor metabolizer (CYP2C19*2/*3) and was withdrawn from the research because of urticaria. The mean icotinib AUC(0-∞) and C(max) (14.56 ±5.31 h mg/L and 2.32 ± 0.49 μg/mL) in homozygous EMs was 1.56 and 1.41-fold lower than that in heterozygous EMs (22.7 ± 6.11 and 3.28 ± 0.48, P = 0.046 and 0.047). The mean CL/F (44.18 ± 12.17 L/h) in homozygous EMs was 1.55-fold higher than that in heterozygous EMs (28.42 ± 9.23 L/h, P = 0.013). The data showed that the pharmacokinetics of icotinib differ significantly between homozygous EMs and heterozygous EMs in CYP2C19.
Alvarez-Sola, Gloria; Uriarte, Iker; Latasa, M Ujue; Fernandez-Barrena, Maite G; Urtasun, Raquel; Elizalde, Maria; Barcena-Varela, Marina; Jiménez, Maddalen; Chang, Haisul C; Barbero, Roberto; Catalán, Victoria; Rodríguez, Amaia; Frühbeck, Gema; Gallego-Escuredo, José M; Gavaldà-Navarro, Aleix; Villarroya, Francesc; Rodriguez-Ortigosa, Carlos M; Corrales, Fernando J; Prieto, Jesus; Berraondo, Pedro; Berasain, Carmen; Avila, Matias A
2017-10-01
Fibroblast growth factor 15/19 (FGF15/19), an enterokine that regulates synthesis of hepatic bile acids (BA), has been proposed to influence fat metabolism. Without FGF15/19, mouse liver regeneration after partial hepatectomy (PH) is severely impaired. We studied the role of FGF15/19 in response to a high fat diet (HFD) and its regulation by saturated fatty acids. We developed a fusion molecule encompassing FGF19 and apolipoprotein A-I, termed Fibapo, and evaluated its pharmacological properties in fatty liver regeneration. Fgf15 -/- mice were fed a HFD. Liver fat and the expression of fat metabolism and endoplasmic reticulum (ER) stress-related genes were measured. Influence of palmitic acid (PA) on FGF15/19 expression was determined in mice and in human liver cell lines. In vivo half-life and biological activity of Fibapo and FGF19 were compared. Hepatoprotective and proregenerative activities of Fibapo were evaluated in obese db/db mice undergoing PH. Hepatosteatosis and ER stress were exacerbated in HFD-fed Fgf15 -/- mice. Hepatic expression of Pparγ2 was elevated in Fgf15 -/- mice, being reversed by FGF19 treatment. PA induced FGF15/19 expression in mouse ileum and human liver cells, and FGF19 protected from PA-mediated ER stress and cytotoxicity. Fibapo reduced liver BA and lipid accumulation, inhibited ER stress and showed enhanced half-life. Fibapo provided increased db/db mice survival and improved regeneration upon PH. FGF15/19 is essential for hepatic metabolic adaptation to dietary fat being a physiological regulator of Pparγ2 expression . Perioperative administration of Fibapo improves fatty liver regeneration. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
THE MAY 23TH 2007 GULF OF MEXICO EARTHQUAKE
Yamamoto, J.; Jimenez, Z.
2009-12-01
On the 23th of May 2007 at 14:09 local time (19:09 UT) an insolated earthquake of local magnitude 5.2 occurred offshore northern Veracruz in the Gulf of Mexico. The seismic focus was located using local and regional data at 20.11° N, 97.38° W and 7.8 km depth at 175 km distance from Tuxpan a city of 134,394 inhabitants. The earthquake was widely felt along the costal states of southern Tamaulipas and Veracruz in which several schools and public buildings were evacuated. Neither Laguna Verde nuclear plant, located approximately 245 km from the epicenter, nor PEMEX petroleum company reported damage. First-motion data indicates that the rupture occurred as strike slip faulting along two possible planes, one oriented roughly north-south and the other east-west. In the present paper a global analysis of the earthquake is made to elucidate its origin and possible correlation with known geotectonic features of the region.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Will Commerce entities issue a refund if money is erroneously collected on a Commerce debt? 19.19 Section 19.19 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce Debts § 19.19...
Treatment of Pediatric Condylar Fractures: A 20-Year Experience.
Ghasemzadeh, Ali; Mundinger, Gerhard S; Swanson, Edward W; Utria, Alan F; Dorafshar, Amir H
2015-12-01
The purpose of this study was to define patterns of injury and treatment for condylar and subcondylar fractures and evaluate short-term outcomes in the pediatric population. A retrospective chart review was performed on pediatric patients with mandibular condylar fractures who presented between 1990 and 2010. Computed tomographic imaging was reviewed for all patients to assess fracture characteristics. Mandibular fractures were codified using the Strasbourg Osteosynthesis Research Group and Lindahl classification methods. Sixty-four patients with 92 condylar fractures were identified. Of these patients, 29 had isolated condylar fracture and 35 had a condylar fracture associated with an additional mandibular arch fracture. The most common fracture patterns were diacapitular fracture in the Strasbourg Osteosynthesis Research Group system (n = 46) and vertical condylar head fracture in the Lindahl system (n = 14). Condylar fracture with additional mandibular arch fractures were treated with maxillomandibular fixation more often than patients with condylar fracture [n = 40 (74.1 percent) versus n = 14 (25.9 percent); p = 0.004]. No condylar fracture was treated in an open fashion. Forty-three patients returned for follow-up. The median follow-up period was 81 days (interquartile range, 35 to 294 days). Ten patients had complications (23.3 percent). The most common complication was malocclusion (n = 5). Nine of 10 patients with complications had condylar fracture with an additional mandibular arch fracture. Closed treatment of condylar fractures yields satisfactory results in pediatric patients. Pediatric patients with condylar fractures combined with additional arch fractures experience a higher rate of unfavorable outcomes.
Energy Technology Data Exchange (ETDEWEB)
Holm, V.A.; Hudgins, L. [Univ. of Washington School of Medicine, Seattle, WA (United States); Cassidy, S.B. [Univ. of Washington School of Medicine, and Children`s Hospital and Medical Center, Seattle, WA (United States)]|[Univ. Hospitals of Cleveland, OH (United States)
1996-09-06
Each year for the last 10 years, scientists conducting research on Prader-Willi syndrome have come together to exchange information during a scientific conference held in conjunction with the annual Prader-Willi Syndrome Association (USA) meeting. Presentations based on submitted abstracts encompass such varied fields as genetics, endocrinology, pediatrics, nutrition, psychology, psychiatry, and education. This year`s scientific conference was held in Seattle, Washington, on July 19, 1995, in conjunction with the 14th PWSA (USA) meeting held July 20-23. Seventeen reports were presented at the scientific meeting, the abstracts of which follow.
7 CFR 1206.23 - United States.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1206.23 Section 1206.23 Agriculture... INFORMATION Mango Promotion, Research, and Information Order Definitions § 1206.23 United States. United... Rico, and the territories and possessions of the United States. ...
19 CFR 19.39 - Delivery for exportation.
2010-04-01
... sales ticket certifying exportation and return it to the proprietor for retention in the files. The port... as required by § 19.36(b) of this part. The officer shall sign the sales ticket certifying... following conditions are met: (i) Sales may be made only to passengers holding a through ticket on the same...
Directory of Open Access Journals (Sweden)
Arantxa Gorostiaga
2011-01-01
Full Text Available A pesar de la relación existente entre la inteligencia emocional y el ajuste psicológico y social, actualmente no se dispone de ningún instrumento que evalúe de forma válida y fiable dicho constructo en la población adolescente vascoparlante. El TMMS-23 es un instrumento ampliamente utilizado que evalúa la inteligencia emocional autopercibida en la adolescencia a partir de las creencias y actitudes de los sujetos sobre su propia experiencia emocional. El objetivo del presente estudio instrumental consistió en adaptar el TMMS-23 a la cultura vasca. Las propiedades psicométricas de la versión en lengua vasca del TMMS-23 fueron examinadas en una muestra de 1038 adolescentes con edades comprendidas entre los 13 y los 19 años. Los resultados del AFC corroboraron la estructura de tres factores de la escala original (Atención, Comprensión y Regulación emocional. Las tres dimensiones mostraron buena consistencia interna y estabilidad temporal, además de correlacionar entre sí en la dirección esperada. Asimismo, se obtuvieron evidencias de validez convergente, así como evidencias externas de validez asociadas a las diferencias observadas en las dimensiones del TMMS-23 en función del autoconcepto, el sexo y la edad de los participantes.
Smith, Kenneth; Muther, Jennifer J; Duke, Angie L; McKee, Emily; Zheng, Nai-Ying; Wilson, Patrick C; James, Judith A
2013-05-01
B lymphocyte memory generates antibody-secreting cells (ASCs) that represent a source of protective antibodies that may be exploited for therapeutics. Here we vaccinated four donors with Pneumovax®23 and produced human monoclonal antibodies (hmAbs) from ASCs. We have cloned 137 hmAbs and the specificities of these antibodies encompass 19 of the 23 serotypes in the vaccine, as well as cell wall polysaccharide (CWPS). Although the majority of the antibodies are serotype specific, 12% cross-react with two serotypes. The Pneumovax®23 ASC antibody sequences are highly mutated and clonal, indicating an anamnestic response, even though this was a primary vaccination. Hmabs from 64% of the clonal families facilitate opsonophagocytosis. Although 9% of the total antibodies bind to CWPS impurity in the vaccine, none of these clonal families showed opsonophagocytic activity. Overall, these studies have allowed us to address unanswered questions in the field of human immune responses to polysaccharide vaccines, including the cross-reactivity of individual antibodies between serotypes and the percentage of antibodies that are protective after vaccination with Pneumovax®23. Copyright © 2012 Elsevier GmbH. All rights reserved.
AXEL-2015 - Introduction To Particle Accelerators | starting 19 January
2014-01-01
CERN Technical Training 2015: Learning for the LHC AXEL-2015 is a lecture series on particle accelerators, given at CERN within the framework of the 2014 Technical Training Programme. As part of the BE Department’s Operations Group Shutdown Lecture series, the general accelerator physics module has been organised since 2003 as a joint venture between the BE Department and Technical Training, and is open to the general CERN community. The AXEL-2015 course is designed for technicians who are operating an accelerator or whose work is closely linked to accelerators, but it is also open to technicians, engineers, and physicists interested in this field. The course does not require any prior knowledge of accelerators. However, some basic knowledge of trigonometry, matrices and differential equations and some basic knowledge of magnetism would be an advantage. The series will consists of 10 one-hour sessions (Monday 19 January 2015 – Friday 23 January 2015, from 9 a.m. to 10.15 a.m. and ...
14 CFR 23.239 - Spray characteristics.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Spray characteristics. 23.239 Section 23.239 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... Handling Characteristics § 23.239 Spray characteristics. Spray may not dangerously obscure the vision of...
28 CFR 23.30 - Funding guidelines.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Funding guidelines. 23.30 Section 23.30 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.30 Funding guidelines. The following funding guidelines shall apply to all Crime Control Act funded...
Focal seizure associated with human parvovirus B19 infection in a non-encephalopathic child.
Samanta, Debopam; Willis, Erin
2016-02-01
The incidence of acute symptomatic (at the time of documented brain insult) seizures and single unprovoked seizures are 29-39 and 23-61 per 100 000 per year, respectively. After stabilization of the patient, finding the etiology of the seizure is of paramount importance. A careful history and physical examination may allow a diagnosis without need for further evaluation. In the literature, severe central nervous system involvement has been reported from human parvovirus B19 infection. We reported a previously healthy 7-year-old girl who presented after an episode of focal seizure. She was afebrile and didn't have any focal neurological abnormalities. She had erythematous malar rash along with reticulating pattern of rash over her both upper extremities. Parvovirus infection was suspected due to the characteristic erythematous malar rash. Serum human parvovirus B19 DNA polymerase chain reaction was positive which was consistent with acute parvovirus infection. Further confirmation of current infection was done with Sandwich enzyme immunoassays showing positive anti-B19 IgM Index (>1.1). IgG index was equivocal (0.9-1.1). We report an extremely rare presentation of non-febrile seizure from acute parvovirus infection in a child without encephalopathy who had an excellent recovery. Timely diagnosis can provide counselling regarding future seizure recurrence risk, curtail expenditure from expensive diagnostic work up and provide additional recommendations about potential risks to a pregnant caregiver.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Mass balance. 23.659 Section 23.659 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS... Surfaces § 23.659 Mass balance. The supporting structure and the attachment of concentrated mass balance...
45 CFR 1304.23 - Child nutrition.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Child nutrition. 1304.23 Section 1304.23 Public... AGENCIES Early Childhood Development and Health Services § 1304.23 Child nutrition. (a) Identification of... into account staff and family discussions concerning: (1) Any relevant nutrition-related assessment...
29 CFR 1905.23 - Prehearing conferences.
2010-07-01
...-STEIGER OCCUPATIONAL SAFETY AND HEALTH ACT OF 1970 Hearings § 1905.23 Prehearing conferences. (a... 29 Labor 5 2010-07-01 2010-07-01 false Prehearing conferences. 1905.23 Section 1905.23 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...
7 CFR 1205.23 - United States.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false United States. 1205.23 Section 1205.23 Agriculture... Procedures for Conduct of Sign-up Period Definitions § 1205.23 United States. The term United States means the 50 states of the United States of America. Procedures ...
14 CFR 23.53 - Takeoff performance.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Takeoff performance. 23.53 Section 23.53... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Performance § 23.53 Takeoff performance. (a) For normal, utility, and acrobatic category airplanes, the takeoff distance must be...
Geography 2050, November 19, 2014
2016-02-04
16. SECURITY CLASSIFICATION OF: On November 19, 2014, the American Geographical Society hosted Geography 2050, a high?level symposium including top...UU UU UU UU 04-02-2016 Approved for public release; distribution is unlimited. Geography 2050, November 19, 2014 The views, opinions and/or findings...ABOVE ADDRESS. University of Kansas 2385 Irving Hill Road Lawrence, KS 66044 -7552 ABSTRACT Geography 2050, November 19, 2014 Report Title On November
19 CFR 19.18 - Smelting and refining; allowance for wastage; withdrawal for consumption.
2010-04-01
...; withdrawal for consumption. 19.18 Section 19.18 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT... wastage; withdrawal for consumption. (a) Except where absolute deductions have been allowed in the... entered for consumption or for warehouse, during a 12-month period beginning on the first day of the month...
14 CFR 23.3 - Airplane categories.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane categories. 23.3 Section 23.3... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES General § 23.3 Airplane categories. (a) The normal category is limited to airplanes that have a seating configuration, excluding pilot...
45 CFR 1151.23 - New construction.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false New construction. 1151.23 Section 1151.23 Public... Prohibited Accessibility § 1151.23 New construction. (a) Design, construction, and alteration. New facilities... Accessibility Standards. (1) Effective as of January 18, 1991, design, construction, or alteration of buildings...
22 CFR 120.23 - Distribution agreement.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Distribution agreement. 120.23 Section 120.23... § 120.23 Distribution agreement. An agreement (e.g., a contract) to establish a warehouse or distribution point abroad for defense articles exported from the United States for subsequent distribution to...
Kim, K A; Song, W K; Park, J Y
2009-11-01
We assessed the association of CYP2B6, CYP3A5, and CYP2C19 polymorphisms with sibutramine pharmacokinetics. Forty six healthy male subjects were enrolled, and their CYP2B6 (*4 and *6), CYP3A5 (*3), and CYP2C19 (*2, and *3) genotypes were analyzed. After a single 15-mg dose of sibutramine was administered, plasma concentrations of sibutramine and its metabolites, M1 and M2, were measured. CYP2B6 and CYP3A5 polymorphisms did not affect the pharmacokinetics of sibutramine and its metabolites. However, the CYP2C19 genotype substantially influenced plasma levels of sibutramine and its metabolites. The mean area under the curve (AUC) of sibutramine in CYP2C19 intermediate metabolizers (IMs; *1/*2 or *1/*3) and poor metabolizers (PMs; *2/*2, *2/*3)) was 18.5 and 252.2% higher, respectively, than the AUC in extensive metabolizers (EMs, *1/*1) (P sibutramine.
International Nuclear Information System (INIS)
Casey, M.L.; Guerami, A.; Milewich, L.; Gomez-Sanchez, C.E.; MacDonald, P.C.
1985-01-01
It is known that 19-nor-deoxycorticosterone (19-nor-DOC) is a potent mineralocorticosteroid that is present in urine of rats and humans in a free, i.e., nonconjugated, form. In the present investigation, the authors evaluated the metabolism of intravenously infused [ 3 H]19-nor-DOC and the possibility that 19-nor-DOC was formed from plasma DOC. They found that the metabolism of [ 3 H]19-nor-DOC infused intravenously in men and women was similar to that of DOC with important exceptions. The majority of the radiolabeled urinary metabolites of intravenously infused [ 3 H]19-nor-DOC were excreted in urine as glucuronosides. Little radioactivity, infused as [ 3 H]19-nor-DOC, was recovered in urine as nonconjugated or sulfoconjugated steroids. There was no free radiolabeled 19-nor-DOC in urine after the simultaneous infusion of [ 3 H]19-nor-DOC and [ 14 C]DOC. A major metabolite of [ 3 H]19-nor-DOC in urine was 19-nor-DOC-21-glucuronoside, whereas little or no intravenously infused radiolabeled DOC was excreted as radiolabeled DOC-glucuronoside. They also found that intravenously infused [ 14 C]DOC was not converted to urinary [ 14 C]19-nor-DOC (glucuronoside) and that other tritium-labeled metabolites of infused [ 3 H]19-nor-DOC contained no carbon-14. These findings are supportive of the proposition that free urinary 19-nor-DOC is not formed from plasma DOC; it may be formed in kidney from a precursor other than DOC or it may be formed nonenzymatically in kidney or urine from a precursor such as 19-oic-DOC
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Treatment. 319.8-23 Section 319.8-23 Agriculture....8-23 Treatment. (a)(1) Vacuum fumigation as required in this subpart shall consist of fumigation, in... the substitution of processing, utilization, or other form of treatment for vacuum fumigation when in...
7 CFR 550.23 - Program income.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Program income. 550.23 Section 550.23 Agriculture... Financial Management § 550.23 Program income. (a) REE Agencies shall apply the standards set forth in this section in requiring Cooperator organizations to account for program income related to projects financed...
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Testing Plan. 282.23 Section 282.23 Mineral... § 282.23 Testing Plan. All testing activities shall be conducted in accordance with a Testing Plan... detailed Mining Plan than is obtainable under an approved Delineation Plan, to prepare feasibility studies...
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Recruitment. 15a.23 Section 15a.23 Agriculture Office... FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 15a.23 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which this subpart applies shall...
14 CFR 23.1399 - Riding light.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Riding light. 23.1399 Section 23.1399... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Equipment Lights § 23.1399 Riding light. (a) Each riding (anchor) light required for a seaplane or amphibian, must be installed so that it...
30 CFR 14.23 - New technology.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false New technology. 14.23 Section 14.23 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF... § 14.23 New technology. MSHA may approve a conveyor belt that incorporates technology for which the...
34 CFR 104.23 - New construction.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false New construction. 104.23 Section 104.23 Education... Accessibility § 104.23 New construction. (a) Design and construction. Each facility or part of a facility..., if the construction was commenced after the effective date of this part. (b) Alteration. Each...
14 CFR 23.689 - Cable systems.
2010-01-01
... in cable tension throughout the range of travel under operating conditions and temperature variations... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Cable systems. 23.689 Section 23.689... Systems § 23.689 Cable systems. (a) Each cable, cable fitting, turnbuckle, splice, and pulley used must...
[The role of 2,3-DPG in nerve conduction of children with type 1 diabetes].
Pańkowska, Ewa; Szypowska, Agnieszka; Wysocka, Marta; Lipka, Maria
2005-01-01
Neuropathy is one of the chronic complications of diabetes, and it is uncommon in children and adolescents. It can be recognized in a short period after the onset of diabetes and not always is connected with poor metabolic control. Hypoxia is considered as one from greatest factors diabetic neuropathy and oxygen transport to tissue partially depends on the diphosphoglycerate (2,3 DPG) concentration. As showed recent clinical studies, its concentration in children with diabetes can be abnormal. To assess the role of 2,3 DPG in nerve conduction velocity, as well as qualification of risk factors. To study were included randomly selected 37 patients with diabetes type 1, average age 15.5+/-2.25 years, with a duration of diabetes of more than 5 years (av 9.64+/-1.95 years), treated with intensive insulin therapy (MDI and CSII), without metabolic acidosis pH - 7.35. The nerve conduction velocity was measured in the sensor and motor nerves. HbA1c and 2,3 DPG were assessed additionally. Changes in motor nerve conduction velocity were observed at 22 patients. Average value of HbA1c in the studied group was 8.22+/-1.2%, Average concentration of 2,3 DPG was 6.15+/-1.67 mmol/l (3.84-11 mmol/l), in group with nerve dysfunction was lower - 5.86+/-1.69 mmol/l vs. 6.38+/-1.67, but this difference was not statistically significant. The lower value of 2,3 DPG significantly correlated with abnormal results of electroneurography test, especially with motor and sensor nerve latency (r=-0.34, p=0.038; r=-0.4, p=0.013) but not correlated with HbA1c (r= -0,19;p= 0,25), age of patients (r=0.008; p=0.96) and diabetes duration (r=-0.16; p=0.31). Nerve dysfunction is common in children with type 1 diabetes despite metabolic control and duration of diabetes. 2,3 DPG can be an independent factor of diabetes neuropathy correlated with abnormal value of the nerve conduction test.
A study of the changes of Th17 cells and IL-23 in patients with Guillain-Barré syndrome
Directory of Open Access Journals (Sweden)
Gai-ping HE
2014-06-01
Full Text Available Guillain-Barré syndrome (GBS is an acute autoimmune-mediated inflammatory neuropathy. In this paper, the percentage of Th17 in peripheral blood lymphocyte and the level of IL-23 in serum and cerebrospinal fluid (CSF of patients with GBS were detected. Twenty-five patients with GBS and 20 controls were analyzed. The percentage of Th17 cells in patients with GBS was (4.86 ± 0.60%, which was higher than that in controls [(2.71 ± 0.54%; t = 2.616, P = 0.012]. Serum IL-23 increased in patients with GBS [(111.80 ± 13.84 pg/ml vs (72.55 ± 8.19 pg/ml; t = 2.300, P = 0.026]. The level of IL-23 in serum and CSF from patients with GBS before therapy [(110.50 ± 15.66 and (102.30 ± 7.52 pg/ml] declined to normal after therapy [(74.13 ± 6.18 and (72.92 ± 12.09 pg/ml], and the difference was statistically significant (t = 2.557, P = 0.022; t = 1.422, P = 0.046. Th17 cells and IL-23 increased in patients with GBS, indicating that they may involve in the pathogenesis of GBS. doi: 10.3969/j.issn.1672-6731.2014.06.012
12 CFR 228.23 - Investment test.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Investment test. 228.23 Section 228.23 Banks... COMMUNITY REINVESTMENT (REGULATION BB) Standards for Assessing Performance § 228.23 Investment test. (a) Scope of test. The investment test evaluates a bank's record of helping to meet the credit needs of its...
DEFF Research Database (Denmark)
Müller-Uri, Frieder; Cameron-Mills, Verena; Mundy, John
2002-01-01
The barley gene (Jip23) encoding a 23,000-Da protein of unknown function was isolated and shown to be induced by jasmonate methyl ester (MeJA) in leaves. 5'upstream Jip23 sequence was isolated and fused to the beta-glucuronidase gene (GUS), and this reporter was introduced by particle bombardment...
45 CFR 605.23 - New construction.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false New construction. 605.23 Section 605.23 Public... Accessibility § 605.23 New construction. (a) Design and construction. Each facility or part of a facility... persons, if the construction was commenced after the effective date of this part. (b) Alteration. Each...
22 CFR 217.23 - New construction.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...
10 CFR 50.23 - Construction permits.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Construction permits. 50.23 Section 50.23 Energy NUCLEAR... Description of Licenses § 50.23 Construction permits. A construction permit for the construction of a... part 52 of this chapter, the construction permit and operating license are deemed to be combined in a...
22 CFR 212.23 - Current index.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Current index. 212.23 Section 212.23 Foreign... Inspection and Copying § 212.23 Current index. USAID maintains and makes available for public inspection and copying a current index providing identifying information for the public as to any matter which has been...
Genetic polymorphism of 23 Y-STR loci in the Zhuang minority population in Guangxi of China.
Luo, Haibo; Song, Feng; Zhang, Lushun; Hou, Yiping
2015-07-01
In the present study, 23 Y-STR loci (DYS576, DYS389I, DYS389 II, DYS448, DYS19, DYS391, DYS481, DYS549, DYS533, DYS438, DYS437, DYS570, DYS635, DYS390, DYS439, DYS392, DYS393, DYS458 DYS456, DYS643, YGATAH4, and DYS385ab) were investigated in 266 unrelated, healthy autochthonous individuals from the Zhuang minority population residing in the Guangxi Zhuang Autonomous Region, China. One hundred and eighty-nine alleles and 245 haplotypes were found in the Zhuang group. Two hundred and twenty-four haplotypes among them were unique, and the remaining 21 haplotypes were found in two individuals. Discrimination capacity was 0.9211. Haplotype diversity was 0.9993 and gene diversity ranged from 0.4173 (DYS437) to 0.9678 (DYS385ab). Populations' differentia was calculated and compared with Tibetan, Bai, Dai, Minnan Han, Beijing Han, Chengdu Han, Xuanwei Han, and Southern Han ethnic groups in China, the Singapore Han population, and the Kinh group from Ho Chi Minh City, Vietnam, in the same 23 Y-STR loci. Our results showed that these 23 Y-STRs are highly genetically polymorphic in the Zhuang group and can also enrich Chinese ethnic genetic information.
Fibroblast growth factor 23 - et fosfatregulerende hormon
DEFF Research Database (Denmark)
Beck-Nielsen, Signe; Pedersen, Susanne Møller; Kassem, Moustapha
2010-01-01
Fibroblast growth factor 23 (FGF23) er et nyligt identificeret fosfatonin. FGF23's fysiologiske hovedfunktion er at opretholde normalt serumfosfat og at virke som et D-vitaminmodregulatorisk hormon. Sygdomme, der er koblet til forhøjet serum FGF23, er hypofosfatæmisk rakitis, fibrøs dysplasi og t...
Albrecht, Piotr; Antczak, Adam; Hryniewicz, Waleria; Skoczyńska, Anna; Radzikowski, Andrzej; Kedziora-Kornatowska, Kornelia; Bernatowska, Ewa; Stompór, Tomasz; Grodzicki, Tomasz; Gyrczuk, Ewa; Imiela, Jacek; Jedrzejczak, Wiesław; Windak, Adam
2014-02-01
Invasive pneumococcal disease (IPD) is a main cause of mortality associated with pneumococcal infections. Although, IPD is regarding mainly small children and persons in the age > 65 years, the investigations showed that because of IPD exactly sick persons are burdened with the greatest mortality in the older age, rather than of children. The most frequent form of IPD is community acquired pneumonia (CAP) with the bacteremia. The presence of even a single additional risk factor is increasing the probability of the unfavorable descent of pneumococcal infection. The risk factors for IPD and/or pneumonia with bacteremia apart from the age are among others asthma (> 2 x), chronic obstructive pulmonary disease (COPD), sarcoidosis (4 x), idiopathic pulmonary fibrosis (5 x), bronchiectases (2 x), allergic alveolitis (1.9 x) and pneumoconiosis (2 x), type 1 diabetes (4.4 x), type 2 diabetes (1.2 x), autoimmune diseases (e.g. rheumatoid arthritis (4.2 to 14.9 x), kidney failure with the necessity to dialysis (12 x), immunosuppression, cardiovascular disease, alcoholism and cancers. Examinations show that the best method of IPD and CAP preventing are pneumococcal vaccinations. On the market for ages 23-valent polysaccharide vaccine (PPV23) is available covering close the 90% of IPD triggering stereotypes. Her role in preventing CAP is uncertain and the immunological answer after vaccination at older persons and after revaccination is weak. Widely discussed disadvantageous effects of growing old of the immunological system show on the benefit from applying the immunization inducing the immunological memory, i.e. of conjugated vaccines which are activating the T-dependent reply and are ensuring the readiness for the effective secondary response. Examinations so far conducted with conjugated 7-valent and 13-valent (PCV13) vaccines at persons in the age > 50 years are confirming these expectations. Also sick persons can take benefits from PCV13 applying back from so-called IPD
FLAG-tagged CD19-specific CAR-T cells eliminate CD19-bearing solid tumor cells in vitro and in vivo.
Berahovich, Robert; Xu, Shirley; Zhou, Hua; Harto, Hizkia; Xu, Qumiao; Garcia, Andres; Liu, Fenyong; Golubovskaya, Vita M; Wu, Lijun
2017-06-01
Autologous T cells expressing chimeric antigen receptors (CARs) specific for CD19 have demonstrated remarkable efficacy as therapeutics for B cell malignancies. In the present study, we generated FLAG-tagged CD19-specific CAR-T cells (CD19-FLAG) and compared them to their non-tagged counterparts for their effects on solid and hematological cancer cells in vitro and in vivo . For solid tumors, we used HeLa cervical carcinoma cells engineered to overexpress CD19 (HeLa-CD19), and for hematological cancer we used Raji Burkitt's lymphoma cells, which endogenously express CD19. Like non-tagged CD19 CAR-T cells, CD19-FLAG CAR-T cells expanded in culture >100-fold and exhibited potent cytolytic activity against both HeLa-CD19 and Raji cells in vitro . CD19-FLAG CAR-T cells also secreted significantly more IFN-gamma and IL-2 than the control T cells. In vivo , CD19-FLAG CAR-T cells significantly blocked the growth of HeLa-CD19 solid tumors, increased tumor cleaved caspase-3 levels, and expanded systemically. CD19-FLAG CAR-T cells also significantly reduced Raji tumor burden and extended mouse survival. These results demonstrate the strong efficacy of FLAG-tagged CD19 CAR-T cells in solid and hematological cancer models.
49 CFR 260.19 - Preapplication meeting.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preapplication meeting. 260.19 Section 260.19 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Financial Assistance § 260.19 Preapplication meeting. Potential Applicants may request a meeting with the...
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Action level. 850.23 Section 850.23 Energy DEPARTMENT OF ENERGY CHRONIC BERYLLIUM DISEASE PREVENTION PROGRAM Specific Program Requirements § 850.23 Action level. (a) The responsible employer must include in its CBDPP an action level that is no greater than 0.2 µg...
14 CFR 431.23 - Policy review.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Policy review. 431.23 Section 431.23... TRANSPORTATION LICENSING LAUNCH AND REENTRY OF A REUSABLE LAUNCH VEHICLE (RLV) Policy Review and Approval for Launch and Reentry of a Reusable Launch Vehicle § 431.23 Policy review. (a) The FAA reviews an RLV...
14 CFR 415.23 - Policy review.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Policy review. 415.23 Section 415.23... TRANSPORTATION LICENSING LAUNCH LICENSE Policy Review and Approval § 415.23 Policy review. (a) The FAA reviews a... raised during a policy review that would impede issuance of a policy approval. The applicant may respond...
14 CFR 23.1143 - Engine controls.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Engine controls. 23.1143 Section 23.1143... Accessories § 23.1143 Engine controls. (a) There must be a separate power or thrust control for each engine... supercharger controls must be arranged to allow— (1) Separate control of each engine and each supercharger; and...
14 CFR 23.753 - Main float design.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Main float design. 23.753 Section 23.753... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Design and Construction Floats and Hulls § 23.753 Main float design. Each seaplane main float must meet the requirements of § 23.521. [Doc...
14 CFR 23.307 - Proof of structure.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Proof of structure. 23.307 Section 23.307... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Structure General § 23.307 Proof of structure. (a) Compliance with the strength and deformation requirements of § 23.305 must be shown for each...
Ivanova, Masha Y.; Achenbach, Thomas M.; Rescorla, Leslie A.; Harder, Valerie S.; Ang, Rebecca P.; Bilenberg, Niels; Bjarnadottir, Gudrun; Capron, Christiane; De Pauw, Sarah S. W.; Dias, Pedro; Dobrean, Anca; Doepfner, Manfred; Duyme, Michele; Eapen, Valsamma; Erol, Nese; Esmaeili, Elaheh Mohammad; Ezpeleta, Lourdes; Frigerio, Alessandra; Goncalves, Miguel M.; Gudmundsson, Halldor S.; Jeng, Suh-Fang; Jetishi, Pranvera; Jusiene, Roma; Kim, Young-Ah; Kristensen, Solvejg; Lecannelier, Felipe; Leung, Patrick W. L.; Liu, Jianghong; Montirosso, Rosario; Oh, Kyung Ja; Plueck, Julia; Pomalima, Rolando; Shahini, Mimoza; Silva, Jaime R.; Simsek, Zynep; Sourander, Andre; Valverde, Jose; Van Leeuwen, Karla G.; Woo, Bernardine S. C.; Wu, Yen-Tzu; Zubrick, Stephen R.; Verhulst, Frank C.
2010-01-01
Objective: To test the fit of a seven-syndrome model to ratings of preschoolers' problems by parents in very diverse societies. Method: Parents of 19,106 children 18 to 71 months of age from 23 societies in Asia, Australasia, Europe, the Middle East, and South America completed the Child Behavior Checklist for Ages 1.5-5 (CBCL/1.5-5). Confirmatory…
Yarkın, Fügen
1992-01-01
Human parvavirus B19'un morfolojisi, oluşturduğu enfeksiyonun klinik belirtileri,tanı yöntemleri, epidemik özellikleri göz önüne alındığında, özellikle kronik olgularda B19 antikorlarının ilave edildiği immünglobulinlerin intravenöz infüzyonunun tedavide etkili olabilmektedir.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel pumps. 23.991 Section 23.991... § 23.991 Fuel pumps. (a) Main pumps. For main pumps, the following apply: (1) For reciprocating engine installations having fuel pumps to supply fuel to the engine, at least one pump for each engine must be directly...
43 CFR 23.9 - Performance bond.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Performance bond. 23.9 Section 23.9 Public... LANDS § 23.9 Performance bond. (a)(1) Upon approval of an exploration plan or mining plan, the operator shall be required to file a suitable performance bond of not less than $2,000 with satisfactory surety...
44 CFR 19.115 - Assurance required.
2010-10-01
... RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.115 Assurance required. (a) General. Either at the... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Assurance required. 19.115 Section 19.115 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...
47 CFR 19.735-104 - Delegations.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Delegations. 19.735-104 Section 19.735-104 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL EMPLOYEE RESPONSIBILITIES AND CONDUCT General Provisions § 19.735-104 Delegations. (a) The Commission has delegated to the Chairman responsibility for the...
22 CFR 19.11 - Survivor benefits.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Survivor benefits. 19.11 Section 19.11 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.11 Survivor benefits. ...
7 CFR 774.19 - Processing applications.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Processing applications. 774.19 Section 774.19 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS EMERGENCY LOAN FOR SEED PRODUCERS PROGRAM § 774.19 Processing applications...
23andMe: a new two-sided data-banking market model.
Stoeklé, Henri-Corto; Mamzer-Bruneel, Marie-France; Vogt, Guillaume; Hervé, Christian
2016-03-31
Since 2006, the genetic testing company 23andMe has collected biological samples, self-reported information, and consent documents for biobanking and research from more than 1,000,000 individuals (90% participating in research), through a direct-to-consumer (DTC) online genetic-testing service providing a genetic ancestry report and a genetic health report. However, on November 22, 2013, the Food and Drug Administration (FDA) halted the sale of genetic health testing, on the grounds that 23andMe was not acting in accordance with federal law, by selling tests of undemonstrated reliability as predictive tests for medical risk factors. Consumers could still obtain the genetic ancestry report, but they no longer had access to the genetic health report in the United States (US). However, this did not prevent the company from continuing its health research, with previously obtained and future samples, provided that consent had been obtained from the consumers concerned, or with health reports for individuals from other countries. Furthermore, 23andMe was granted FDA authorization on February 19, 2015, first to provide reports about Bloom syndrome carrier status, and, more recently, to provide consumers with "carrier status" information for 35 genes known (with high levels of confidence) to cause disease. In this Debate, we highlight the likelihood that the primary objective of the company was probably two-fold: promoting itself within the market for predictive testing for human genetic diseases and ancestry at a low cost to consumers, and establishing a high-value database/biobank for research (one of the largest biobanks of human deoxyribonucleic acid (DNA) and personal information). By dint of this marketing approach, a two-sided market has been established between the consumer and the research laboratories, involving the establishment of a database/DNA biobank for scientific and financial gain. We describe here the profound ethical issues raised by this setup.
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 407.23 Section 407.23 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED FRUITS AND VEGETABLES PROCESSING POINT SOURCE CATEGORY Apple Products Subcategory...
Gevorkyan-Airapetov, Lada; Zohary, Keren; Popov-Celeketic, Dusan; Mapa, Koyeli; Hell, Kai; Neupert, Walter; Azem, Abdussalam; Mokranjac, Dejana
2009-02-20
The TIM23 complex is the major translocase of the mitochondrial inner membrane responsible for the import of essentially all matrix proteins and a number of inner membrane proteins. Tim23 and Tim50, two essential proteins of the complex, expose conserved domains into the intermembrane space that interact with each other. Here, we describe in vitro reconstitution of this interaction using recombinantly expressed and purified intermembrane space domains of Tim50 and Tim23. We established two independent methods, chemical cross-linking and surface plasmon resonance, to track their interaction. In addition, we identified mutations in Tim23 that abolish its interaction with Tim50 in vitro. These mutations also destabilized the interaction between the two proteins in vivo, leading to defective import of preproteins via the TIM23 complex and to cell death at higher temperatures. This is the first study to describe the reconstitution of the Tim50-Tim23 interaction in vitro and to identify specific residues of Tim23 that are vital for the interaction with Tim50.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Loan terms. 2201.19 Section 2201.19 Agriculture Regulations of the Department of Agriculture (Continued) LOCAL TELEVISION LOAN GUARANTEE BOARD LOCAL TELEVISION LOAN GUARANTEE PROGRAM-PROGRAM REGULATIONS Loan Guarantees § 2201.19 Loan terms. (a) All Loans...
6 CFR 13.19 - Prehearing conferences.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Prehearing conferences. 13.19 Section 13.19 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.19 Prehearing conferences. (a) The ALJ may schedule prehearing conferences as appropriate. (b...
49 CFR 266.19 - Environmental impact.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Environmental impact. 266.19 Section 266.19... TRANSPORTATION ACT § 266.19 Environmental impact. (a) General. The Administrator has determined that providing..., or other significant adverse environmental impact on any mode of transportation; (6) The action is...
47 CFR 15.19 - Labelling requirements.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Labelling requirements. 15.19 Section 15.19 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES General § 15.19 Labelling... label shall be located in a conspicuous location on the device and shall contain the unique...
International Nuclear Information System (INIS)
Dinallo, Michael A.; Holmes, Parris; Merewether, Kimball O.; Morris, Marvin E.
1999-01-01
On September 24, 25, 28, and 29, 1998 and on October 19 and 23, 1998, transfer impedance measurements were made on Los Alamos National Laboratories TA 16 - Building 411 and TA 8-- Building 23 to characterize their interior open-circuit voltage response to a direct lightning flash attachment to the structures. The theory, history, measurement methods and equipment, and specific measured results are detailed. The measured results demonstrate that if the remaining metallic penetrations are bonded, then the rebar of the two structures is sufficiently well connected to form a Faraday cage that reduces the maximum open-circuit voltage inside the structure to a sufficiently low level that the required standoff distance to prevent arcing to explosive assemblies is 6.8 inches for TA 16 - Building 411 and is 11.5 inches for TA 8 - Building 23
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Advertising. 23.540 Section 23.540 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
Valencia Pacheco, Guillermo; Nakazawa Ueji, Yumi E; Rodríguez Dzul, Edwin A; Angulo Ramírez, Angélica V; López Villanueva, Ricardo F; Quintal Ortiz, Irma G; Rosado Paredes, Elsy P
2017-09-30
Systemic lupus erythematosus (SLE) is a systemic autoimmune disease that mainly affects women, characterized by the production of autoantibodies. Its causal agent is unknown, but the combination of environmental, hormonal and genetic factors may favor the development of the disease. Parvovirus B19 has been associated with the development of SLE, since it induces the production of anti-single stranded DNA antibodies. It is unknown whether PV-B19 infection is an environmental factor that trigger or reactivate SLE in the Mexican Mayan population. A preliminary serological and molecular study of PV-B19 infection in Mayan women with established SLE was done. IgG and IgM anti PV-B19 were evaluated in 66 SLE patients and 66 control subjects, all women of Mayan origin. Viral DNA and viral load were analyzed by qPCR. Insignificant levels of IgM were observed in 14.3% (4/28) of the patients and 11.4% (4/35) of control subjects. IgG was detected in 82.1% (23/28) of the patients and 82.9% (29/35) of control subjects, but were significantly higher in patients. Viral DNA was found in 86.0% (57/66) of the patients and 81.0% (54/66) of control subjects. Viral load, quantified in 28/66 patients and 31/66 controls which were positive for IgM and IgG, was significantly higher in controls. The high prevalence of PV-B19 in Yucatan, and the presence of IgM, IgG, and viral load in Mayan women with established SLE suggest that PV-B19 infection could be an environmental factor to trigger or reactivate SLE.
7 CFR 1425.19 - Member cooperatives.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Member cooperatives. 1425.19 Section 1425.19... OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COOPERATIVE MARKETING ASSOCIATIONS § 1425.19 Member cooperatives. A CMA may obtain loans or LDP's on behalf of a member cooperative when the member...
31 CFR 19.920 - Civil judgment.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Civil judgment. 19.920 Section 19.920... SUSPENSION (NONPROCUREMENT) Definitions § 19.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of competent jurisdiction, whether by verdict, decision, settlement...
34 CFR 300.19 - Homeless children.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Homeless children. 300.19 Section 300.19 Education... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH DISABILITIES General Definitions Used in This Part § 300.19 Homeless children. Homeless children has the...
22 CFR 901.19 - Labor organization.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Labor organization. 901.19 Section 901.19 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD GENERAL Meanings of Terms As Used in This Chapter § 901.19 Labor organization. Labor organization means any employee organization accorded recognition as the...
46 CFR 151.03-19 - Environment.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Environment. 151.03-19 Section 151.03-19 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES BARGES CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Definitions § 151.03-19 Environment. This term refers to the atmosphere...
10 CFR 19.20 - Employee protection.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Employee protection. 19.20 Section 19.20 Energy NUCLEAR... Employee protection. Employment discrimination by a licensee, a holder of a certificate of compliance... as delineated in § 19.2(a), against an employee for engaging in protected activities under this part...
49 CFR 19.24 - Program income.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Program income. 19.24 Section 19.24 Transportation... Requirements § 19.24 Program income. (a) Federal awarding agencies shall apply the standards set forth in this section in requiring recipient organizations to account for program income related to projects financed in...
32 CFR 634.19 - Registration policy.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Registration policy. 634.19 Section 634.19 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS MOTOR VEHICLE TRAFFIC SUPERVISION Motor Vehicle Registration § 634.19 Registration policy. (a) Motor vehicles will be...
32 CFR 203.19 - Appeals process.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Appeals process. 203.19 Section 203.19 National....19 Appeals process. DoD Components will establish an appeals process to settle potential disputes... process. The Department of Defense recognizes that the RAB/TRC may disagree with the findings of the...
12 CFR 19.132 - Disciplinary orders.
2010-01-01
... PROCEDURE Disciplinary Proceedings Involving the Federal Securities Laws § 19.132 Disciplinary orders. (a... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Disciplinary orders. 19.132 Section 19.132... Comptroller may serve on the bank or persons concerned a disciplinary order, as provided in the Exchange Act...
12 CFR 561.19 - Financial institution.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Financial institution. 561.19 Section 561.19... AFFECTING ALL SAVINGS ASSOCIATIONS § 561.19 Financial institution. The term financial institution has the same meaning as the term depository institution set forth in 12 U.S.C. 1813(c)(1). ...
49 CFR 19.52 - Financial reporting.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Financial reporting. 19.52 Section 19.52... Requirements Reports and Records § 19.52 Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized for obtaining financial information from recipients. (1) SF-269...
International Nuclear Information System (INIS)
Beak, Jin Wook; KIm, Dong Wook; Kim, Bo Mi
2011-01-01
To assess the difference in the cytological adequacy of ultrasonography (US)-guided fine needle aspiration cytology (US-FNAC) for cervical lymphadenopathy using 21 and 23 gauge needles. US-FNACs were separately performed on two cervical lymph nodes and in each patient using 21 gauge (group A) and 23 gauge (group B) needles, respectively. We used 4 grade classifications for the cytological analysis of each slide and compared the cytological adequacy of US-FNAC for cervical lymphadenopathy in the two groups. We performed US-FNACs on 58 cervical lymph nodes from 29 patients, with a cytological adequacy of 69.0%. The number of adequate cytological results was 19 (65.5%) in group A and 21 (72.4%) in group B, and the diagnostic adequacy did not differ significantly between the two groups (Mann-Whitney test, p = 0.574). There was no statistically significant difference in the cytological adequacy of US-FNAC for cervical lymphadenopathy according using of 21 and 23 gauge needles.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false State office. 90.19 Section 90.19...¢ Training ⢠Officers ⢠Prosecutors) Violence Against Women Formula Grant Program § 90.19 State office. (a... office for the purposes of: (1) Certifying qualifications for funding under this subpart B; (2...
10 CFR 19.32 - Discrimination prohibited.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Discrimination prohibited. 19.32 Section 19.32 Energy... § 19.32 Discrimination prohibited. No person shall on the grounds of sex be excluded from participation in, be denied a license, be denied the benefit of, or be subjected to discrimination under any...
2010-04-01
... for Minority, Disadvantaged, and Women Business Enterprises § 230.202 Definitions. (a) Minority... disadvantaged business enterprise (DBE), all defined under 49 CFR part 23. This expanded definition is used only... 23 Highways 1 2010-04-01 2010-04-01 false Definitions. 230.202 Section 230.202 Highways FEDERAL...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI
Ajdukovic, Mia; Pejic, Lucija; Papic, Neven; Vince, Adriana
2017-01-01
Abstract Background Human Parvovirus B19 (HPV-B19) occurs worldwide and causes mild, acute exanthematous disease that occurs in a form of cyclic local epidemics. The aim of this study was to analyze clinical features and complication rates of acute HPV-B19 infection in different age groups. Methods We retrospectively reviewed the charts of 718 consecutive patients clinicaly diagnosed with acute HPV-B19 infection who visited outpatient department at the University Hospital for Infectious Diseases in Zagreb, Croatia during 2013–2014 outbreak. In 212 patients (of 298 tested) diagnosis was confirmed by positive IgM antibodies and/or HPV-B19 DNA in peripheral blood. Results Outbreak started in June 2013 and had a peak in April 2014, with highest prevalence in schoolchildren. There were no difference in clinical presentation or laboratory findings between clinicaly and serologicaly diagnosed patients. Biphasic presentation, fever, myalgia, arthralgia, headache and peripheral edema were more frequent in adults, but „slapped cheeks” was found predominantly in children. Complications were more common in adults, most commonly hematological disordes (mild anemia, thrombocytopenia and leukopenia), vasculitis, hepatitis and aseptic meningitis. There were no deaths in our cohort. Children (n = 52) Adults (n = 160) P-value Age, years 8.8 ± 4.1 39 ± 10.7 Male sex 31 (59.6%) 26 (12.3%) 0.0001 Clinical presentation Biphasic presentation 8 (15.4%) 48 (30.0 %) 0.0460 Fever 26 (50.0%) 110 (68.7%) 0.0194 Rash 51 (98.1%) 127 (79.4%) 0.0008 Myalgia 5 (9.6%) 50 (31.2%) 0.0017 Arthralgia 9 (17.3%) 100 (62.5%) 0.0001 Headache 3 (5.8%) 34 (21.2%) 0.0107 “Slapped cheeks” 29 (55,8%) 24 (15.0%) 0.0001 Peripheral edema 6 (11.5%) 63 (39.4%) 0.0001 Anemia 4 (7.7%) 19 (11.8%) 0.6076 Leukopenia 1 (1.9%) 23 (14.5%) 0.0111 Thrombocytopenia 4 (7.7%) 35 (21.8%) 0.0231 Hepatitis 1 (1.9%) 11 (6.87%) 0.3011 Vasculitis 1 (1.9%) 2 (1.25%) 0.5721 Other 2 (3.8%) 3 (1.9%) 0.5982 Conclusion
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1209.19 Section 1209.19 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE MUSHROOM PROMOTION, RESEARCH, AND CONSUMER INFORMATION ORDER Mushroom Promotion, Research, and Consumer Information Order Definitions § 1209...
32 CFR 635.19 - Offense codes.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Offense codes. 635.19 Section 635.19 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS LAW ENFORCEMENT REPORTING Offense Reporting § 635.19 Offense codes. (a) The offense code describes, as nearly as possible, the...
Characterization of a gene from the EDM1-PSACH region of human chromosome 19p
Energy Technology Data Exchange (ETDEWEB)
Lennon, G.G.; Giorgi, D.; Martin, J.R. [Lawrence Livermore National Lab., CA (United States)] [and others
1994-09-01
Genetic linkage mapping has indicated that both multiple epiphyseal dysplasia (EDM1), a dominantly inherited chondrodysplasia, and pseudoachondroplasia (PSACH), a skeletal disorder associated with dwarfism, map to a 2-3 Mb region of human chromosome 19p. We have isolated a partial cDNA from this region using hybrid selection, and report on progress towards the characterization of the genomic structure and transcription of the corresponding gene. Sequence analysis of the cDNA to date indicates that this gene is likely to be expressed within extracellular matrix tissues. Defects in this gene or neighboring gene family members may therefore lead to EDM1, PSACH, or other connective tissue and skeletal disorders.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Leasing. 710.407 Section 710.407 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RIGHT-OF-WAY AND ENVIRONMENT RIGHT-OF-WAY AND REAL ESTATE Real Property Management § 710.407 Leasing. (a) Leasing of real property acquired with title 23 of...
Alvarado, David M; Aferol, Hyuliya; McCall, Kevin; Huang, Jason B; Techy, Matthew; Buchan, Jillian; Cady, Janet; Gonzales, Patrick R; Dobbs, Matthew B; Gurnett, Christina A
2010-07-09
Clubfoot is a common musculoskeletal birth defect for which few causative genes have been identified. To identify the genes responsible for isolated clubfoot, we screened for genomic copy-number variants with the Affymetrix Genome-wide Human SNP Array 6.0. A recurrent chromosome 17q23.1q23.2 microduplication was identified in 3 of 66 probands with familial isolated clubfoot. The chromosome 17q23.1q23.2 microduplication segregated with autosomal-dominant clubfoot in all three families but with reduced penetrance. Mild short stature was common and one female had developmental hip dysplasia. Subtle skeletal abnormalities consisted of broad and shortened metatarsals and calcanei, small distal tibial epiphyses, and thickened ischia. Several skeletal features were opposite to those described in the reciprocal chromosome 17q23.1q23.2 microdeletion syndrome associated with developmental delay and cardiac and limb abnormalities. Of note, during our study, we also identified a microdeletion at the locus in a sibling pair with isolated clubfoot. The chromosome 17q23.1q23.2 region contains the T-box transcription factor TBX4, a likely target of the bicoid-related transcription factor PITX1 previously implicated in clubfoot etiology. Our result suggests that this chromosome 17q23.1q23.2 microduplication is a relatively common cause of familial isolated clubfoot and provides strong evidence linking clubfoot etiology to abnormal early limb development. Copyright 2010 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.
Magnetic structures of Er{sub 6}Mn{sub 23} and Dy{sub 6}Mn{sub 23}
Energy Technology Data Exchange (ETDEWEB)
Ouladdiaf, B. [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France); Deportes, J. [Laboratoire de Magnetisme L. Neel, C.N.R.S., BP 166, 38042 Grenoble Cedex 9 (France); Rodriguez-Carvajal, J. [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)]|[Laboratoire Leon Brillouin (CEA-CNRS), Centre d`Etudes de Saclay, Gif sur Yvette (France)
1995-08-01
The R{sub 6}Mn{sub 23} (R=rare earth) compounds crystallize in the cubic Th{sub 6}Mn{sub 23}-type structure with space group Fm3m. Powder neutron-diffraction experiments were performed on Dy{sub 6}Mn{sub 23} and Er{sub 6}Mn{sub 23}. The magnetic unit cell coincides with the chemical one. The R moments have a ferromagnetic non-collinear arrangement, whereas the Mn moments are parallel to the [1 1 1] direction. The magnetic structures belong to the three-dimensional {Gamma}{sub 5g} irreducible representation of Fm3m associated with the wave vector K=[0 0 0]. The spin configurations in both compounds result from the competition between the R-R, R-Mn magnetic interactions and the crystal electric field on the R ions. (orig.).
12 CFR 19.240 - Inflation adjustments.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Inflation adjustments. 19.240 Section 19.240... PROCEDURE Civil Money Penalty Inflation Adjustments § 19.240 Inflation adjustments. (a) The maximum amount... Civil Penalties Inflation Adjustment Act of 1990 (28 U.S.C. 2461 note) as follows: ER10NO08.001 (b) The...
Human parvovirus B19: a review.
Rogo, L D; Mokhtari-Azad, T; Kabir, M H; Rezaei, F
2014-01-01
Parvovirus B19 (B19V) is a small non-enveloped single-stranded DNA (ssDNA) virus of the family Parvoviridae, the subfamily Parvovirinae, the genus Erythrovirus and Human parvovirus B19 type species. It is a common community-acquired respiratory pathogen without ethnic, socioeconomic, gender, age or geographic boundaries. Moreover, the epidemiological and ecological relationships between human parvovirus B19, man and environment have aroused increasing interest in this virus. B19V infection is associated with a wide spectrum of clinical manifestations, some of which were well established and some are still controversial, however, it is also underestimated from a clinical perspective. B19V targets the erythroid progenitors in the bone marrow by binding to the glycosphingolipid globoside (Gb4), leading to large receptor-induced structural changes triggering cell death either by lysis or by apoptosis mediated by the nonstructural (NS)1 protein. The pattern of genetic evolution, its peculiar properties and functional profile, the characteristics of its narrow tropism and restricted replication, its complex relationship with the host and its ample pathogenetic potential are all topics that are far from a comprehensive understanding. The lack of efficient adaptation to in vitro cellular cultures and the absence of animal models have limited classical virological studies and made studies on B19V dependent on molecular biology. The present review looks at the nature of this virus with the view to provide more information about its biology, which may be useful to the present and future researchers. human parvovirus B19; respiratory pathogen; biology; genome; fifth disease; transient aplastic crisis; anemia.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2
The radioactivity of the Hercynian Vosges
International Nuclear Information System (INIS)
Rothe, J.P.
1957-01-01
On november 22, 1950, in the course of the formal beginning of term ceremony, the University of Strasbourg was pleased to confer on Professor VENING-MEINESZ the degree of Doctor Honoris Causa. In his speech of acknowledgement, Professor VENING-MEINESZ paid tribute to the fact that his colleague, Edmond ROTHE, had created at Strasbourg a centre of radio-geological research and during his visit to the Institute of Terrestrial Physics, the scholar whom we are honouring today expressed an interest in the new measurements that I was able to show him. I am happy to offer to him in homage some results of a systematic study of radioactivity of the Hercynian Vosges. (author) [fr
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Housing. 23.405 Section... Discrimination on the Basis of Sex in Education Programs or Activities Prohibited § 23.405 Housing. (a) Generally... fees or requirements, or offer different services or benefits related to housing, except as provided in...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 23.6 Section 23.6 Commerce and Foreign Trade Office of the Secretary of Commerce USE OF PENALTY MAIL IN THE LOCATION AND... entities outside the Office of the Secretary charged with carrying out specified substantive functions (i.e...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Employment. 23.500... Discrimination on the Basis of Sex in Employment in Education Programs or Activities Prohibited § 23.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.2 Section 23.2 Agriculture Office... Administration. (a) Title V will be administered by the Administrators of the Extension Service and the... Act of 1914 and the Hatch Act (as amended), August 11, 1955, the administration of the programs shall...
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Hearing. 1639.23 Section 1639.23... Hearing. (a) Request for hearing. Except as provided in paragraph (b) of this section, an employee who desires a hearing concerning the existence or amount of the debt or the proposed offset schedule must send...
Imel, Erik A; Zhang, Xiaoping; Ruppe, Mary D; Weber, Thomas J; Klausner, Mark A; Ito, Takahiro; Vergeire, Maria; Humphrey, Jeffrey S; Glorieux, Francis H; Portale, Anthony A; Insogna, Karl; Peacock, Munro; Carpenter, Thomas O
2015-07-01
In X-linked hypophosphatemia (XLH), elevated fibroblast growth factor 23 (FGF23) decreases the renal tubular maximum reabsorption rate of phosphate/glomerular filtration rate (TmP/GFR) and serum inorganic phosphorus (Pi), resulting in rickets and/or osteomalacia. The objective was to test the hypothesis that monthly KRN23 (anti-FGF23 antibody) would safely improve serum Pi in adults with XLH. Two sequential open-label phase 1/2 studies were done. Six academic medical centers were used. Twenty-eight adults with XLH participated in a 4-month dose-escalation study (0.05-0.6 mg/kg); 22 entered a 12-month extension study (0.1-1 mg/kg). KRN23 was injected sc every 28 days. The main outcome measure was the proportion of subjects attaining normal serum Pi and safety. At baseline, mean TmP/GFR, serum Pi, and 1,25-dihydroxyvitamin D [1,25(OH)2D] were 1.6 ± 0.4 mg/dL, 1.9 ± 0.3 mg/dL, and 36.6 ± 14.3 pg/mL, respectively. During dose escalation, TmP/GFR, Pi, and 1,25(OH)2D increased, peaking at 7 days for TmP/GFR and Pi and at 3-7 days for 1,25(OH)2D, remaining above (TmP/GFR, Pi) or near [1,25(OH)2D] pre-dose levels at trough. After each of the four escalating doses, peak Pi was between 2.5 and 4.5 mg/dL in 14.8, 37.0, 74.1, and 88.5% of subjects, respectively. During the 12-month extension, peak Pi was in the normal range for 57.9-85.0% of subjects, and ≥25% maintained trough Pi levels within the normal range. Serum Pi did not exceed 4.5 mg/dL in any subject. Although 1,25(OH)2D levels increased transiently, mean serum and urinary calcium remained normal. KRN23 treatment increased biomarkers of skeletal turnover and had a favorable safety profile. Monthly KRN23 significantly increased serum Pi, TmP/GFR, and 1,25(OH)2D in all subjects. KRN23 has potential for effectively treating XLH.
Sprague, Stuart M; Wetmore, James B; Gurevich, Konstantin; Da Roza, Gerald; Buerkert, John; Reiner, Maureen; Goodman, William; Cooper, Kerry
2015-06-05
Cinacalcet and vitamin D are often combined to treat secondary hyperparathyroidism (SHPT) in patients on dialysis. Independent effects on fibroblast growth factor-23 (FGF-23) concentrations in patients on hemodialysis administered cinacalcet or vitamin D analogs as monotherapies during treatment of SHPT are evaluated. A multicenter, randomized, open-label study to compare the efficacy of cinacalcet versus traditional vitamin D therapy for management of secondary hyperparathyroidism among subjects undergoing hemodialysis (PARADIGM) was a prospective, phase 4, multicenter, randomized, open-label study conducted globally. Participants (n=312) were randomized 1:1 to cinacalcet (n=155) or vitamin D analog (n=157) for 52 weeks. Levels of FGF-23 were measured at baseline and weeks 20 and 52. The absolute and percentage changes from baseline in plasma FGF-23, parathyroid hormone (PTH), calcium (Ca), phosphorus (P), and calcium-phosphorus product (Ca×P) were assessed. Correlations and logistic regression were used to explore relationships between changes in FGF-23 and changes in PTH, Ca, P, and Ca×P from baseline to week 52 by treatment arm. Median (quartiles 1, 3) decrease in FGF-23 concentrations was observed in the cinacalcet arm (-40%; -63%, 16%) compared with median increase in the vitamin D analog arm (47%; 0%, 132%) at week 52 (P<0.001). Changes in FGF-23 in both arms were unrelated to changes in PTH (cinacalcet: r=0.17, P=0.11; vitamin D analog: r=-0.04, P=0.70). Changes in FGF-23 in the vitamin D analog but not the cinacalcet arm were correlated with changes in Ca (cinacalcet: r=0.11, P=0.30; vitamin D analog: r=0.32, P<0.01) and P (cinacalcet: r=0.19, P=0.07; vitamin D analog: r=0.49, P<0.001). Changes in FGF-23 were correlated with changes in Ca×P in both arms (cinacalcet: r=0.26, P=0.01; vitamin D analog: r=0.57, P<0.001). Independent of treatment arm, participants with reductions in P or Ca×P were significantly more likely to show reductions in FGF-23
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.230 Section 19.230 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Order To Dismiss a... and part 6 of this chapter. ...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Athletics. 19.450 Section 19.450 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND... hockey, football, basketball, and other sports the purpose or major activity of which involves bodily...
Parvovirus B19 Associated Hepatitis
Bihari, Chhagan; Rastogi, Archana; Saxena, Priyanka; Rangegowda, Devraj; Chowdhury, Ashok; Gupta, Nalini; Sarin, Shiv Kumar
2013-01-01
Parvovirus B19 infection can present with myriads of clinical diseases and syndromes; liver manifestations and hepatitis are examples of them. Parvovirus B19 hepatitis associated aplastic anemia and its coinfection with other hepatotropic viruses are relatively underrecognized, and there is sufficient evidence in the literature suggesting that B19 infections can cause a spectrum of liver diseases from elevation of transaminases to acute hepatitis to fulminant liver failure and even chronic hepatitis. It can also cause fatal macrophage activation syndrome and fibrosing cholestatic hepatitis. Parvovirus B19 is an erythrovirus that can only be replicate in pronormoblasts and hepatocytes, and other cells which have globosides and glycosphingolipids in their membrane can also be affected by direct virus injury due to nonstructural protein 1 persistence and indirectly by immune mediated injury. The virus infection is suspected in bone marrow aspiration in cases with sudden drop of hemoglobin and onset of transient aplastic anemia in immunosuppressed or immunocompetent patients and is confirmed either by IgM and IgG positive serology, PCR analysis, and in situ hybridization in biopsy specimens or by application of both. There is no specific treatment for parvovirus B19 related liver diseases, but triple therapy regimen may be effective consisting of immunoglobulin, dehydrohydrocortisone, and cyclosporine. PMID:24232179
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/
[2,3 diphosphoglycerate in preterm newborns].
Scopesi, F; Canini, S; Mazzella, M; Arioni, C; Lantieri, P; Serra, G
2000-01-01
It has been largely shown that during the first month of life, in the preterm neonate Hb levels and Hct percentages rapidly decrease, high HbF concentration persists and a high oxygen affinity occurs. Data are needed to establish the level at which 2,3 dyphosphoglycerate (2,3 DPG) interacts with the regulation of oxygen affinity. 24 samples, from eight uncomplicated preterm newborns (34.1 +/- 1.83 GW, 1869 +/- +/- 291 BW) obtained at the same time as those required for the clinical management of the infants, were collected on the 2nd, 7th and 14th day of life. Blood gases, total hemoglobin and hematocrit were obtained from 0.3 ml arterialised capillary blood. Assays of 2,3 DPG were made separately on 0.4 ml venous blood. As expected tHb concentration and Hct percentages significantly decreased from day 2 to day 14 in all eight cases. On the contrary 2,3 DPG and p50 values remained stable. Subsequently throughout the study period all neonates had an increased 2,3 DPG/Hb ratio that was significantly related with p50 at standard conditions (p < 0.05). Stable 2,3 DPG concentrations during all study period have been detected. The subsequent significant increased 2.3 DPG/Hb, ratio related to increased p50 values, could have a key role in a physiological mechanism aimed to ensure adequate oxygen delivery to the tissues and to counteract the higher oxygen affinity of fetal hemoglobin. A wider sample is needed to validate this hypothesis.
Lima, John J; Lang, Jason E; Mougey, Edward B; Blake, Kathryn B; Gong, Yan; Holbrook, Janet T; Wise, Robert A; Teague, W G
2013-09-01
To determine whether cytochrome P450 (CYP)2C19 haplotype associates with lansoprazole-associated adverse event frequency. Respiratory adverse events from a clinical trial of lansoprazole in children with asthma were analyzed for associations with extensive or poor metabolizer (PM) phenotype based on CYP2C19 haplotypes. Carriers of CYP2C19*2, *3, *8, or *9 alleles were PMs; carriers of 2 wild-type alleles were extensive metabolizers (EMs). Plasma concentrations of lansoprazole were determined in PM and EM phenotypes. The frequency of upper respiratory infection among PMs (n = 45) was higher than that among EMs (n = 91), which in turn was higher than that in placebo subjects (n = 135; P = .0039). The frequency of sore throat (ST) was similarly distributed among EMs and PMs (P = .0015). The OR (95% CI) for upper respiratory infections in PMs was 2.46 (1.02-5.96) (P = .046); for EMs, the OR (95% CI) was 1.55 (0.86-2.79). The OR (95% CI) for ST in EMs and PMs was 2.94 (1.23-7.05, P = .016) vs 1.97 (1.09-3.55, P = .024), respectively. Mean ± SD plasma concentrations of lansoprazole were higher in PMs than in EMs: 207 ± 179 ng/mL vs 132 ± 141 ng/mL (P = .04). Lansoprazole-associated upper respiratory infections and ST in children are related in part to CYP2C19 haplotype. Our data suggest that lansoprazole-associated adverse events in children may be mitigated by adjusting the conventional dose in PMs. Additional studies are required to replicate our findings. Copyright © 2013 Mosby, Inc. All rights reserved.
7 CFR 1735.23-1735.29 - [Reserved
2010-01-01
... AGRICULTURE GENERAL POLICIES, TYPES OF LOANS, LOAN REQUIREMENTS-TELECOMMUNICATIONS PROGRAM Loan Purposes and Basic Policies §§ 1735.23-1735.29 [Reserved] ... 7 Agriculture 11 2010-01-01 2010-01-01 false [Reserved] 1735.23-1735.29 Section 1735.23-1735.29...
Pozzuto, Tanja
2012-01-01
Human Parvovirus B19 (B19V) is the causative agent of erythema infectiosum, hydrops fetalis, aplastic crises and polyarthritis. B19V displays a very narrow cell and tissue tropism with productive infection thought to be restricted exclusively to erythroid progenitor cells in the bone marrow and fetal liver. However, over the last years increasing evidence for the presence of B19V DNA in other cell types and tissues such as synovial fibroblasts, tonsilles and skin as well as endothelial cells ...
13 CFR 302.19 - Indemnification.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Indemnification. 302.19 Section 302.19 Business Credit and Assistance ECONOMIC DEVELOPMENT ADMINISTRATION, DEPARTMENT OF COMMERCE... permitted by law, a Recipient shall indemnify and hold EDA harmless from any liability that EDA may incur...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Application. 19.822 Section 19.822 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Production of Vinegar by the Vaporizing Process...
ECLOUD04 workshop (Napa, California, April 19-23, 2004)
International Nuclear Information System (INIS)
Furman, Miguel A.
2004-01-01
As in previous workshops dealing with electron-cloud effects (KEK, July 1997; Santa Fe, February 2000; KEK, September 2001; CERN, April 2002), the focus of this workshop was broad, covering all aspects of the phenomena. The work presented at ECLOUD04 represented a significant advance relative to ECLOUD02 (CERN, April 2002). The systematic experimental program being carried out at the SPS for many years now, in preparation for LHC operation, keeps yielding valuable information particularly concerning surface conditioning by the beam. Clear evidence for an electron-cloud effect at RHIC was presented, although direct detection of electrons in the cold regions remains to be achieved. With the clear establishment of electron-cloud effects at the PSR, other high-intensity hadron machines are studying the effect either experimentally or by simulations, or both. In particular, ORNL personnel are paying special attention to the phenomenon as the fabrication of the SNS storage ring vacuum chamber is being completed. Electron effects are being investigated at ISIS (RAL), and at the HCX experiment for heavy-ion fusion drivers (LBNL). On the simulation front, there has been significant progress towards extending simulation techniques to three dimensions, towards more realistic description of machine lattice elements, and towards self-consistency (in which both the beam and the electrons respond dynamically to each other). The electron-cloud community is thus enriched by the expertise brought in by researchers in intense hadron machines, which includes advanced computational techniques on parallel computers. The two B factories were reported to be running quite well, exceeding their design specifications on beam current and luminosity, after controlling the electron-cloud effect largely by means of weak solenoidal fields. Ambitious plans for future luminosity upgrades were presented for both machines. Multi-lab collaborations were discussed and encouraged; one notable example of such a possibility would be a collaboration between the LARP project in the US and ESGARD in Europe
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 15.23 Section 15.23 Commerce and Foreign Trade Office of the Secretary of Commerce LEGAL PROCEEDINGS Involuntary Child and... approved under part D of title IV of the Social Security Act (42 U.S.C. 651-664), who has the duty or...
2014-01-01
Background D-2,3-butanediol has many industrial applications such as chiral reagents, solvents, anti-freeze agents, and low freezing point fuels. Traditional D-2,3-butanediol producing microorganisms, such as Klebsiella pneumonia and K. xoytoca, are pathogenic and not capable of producing D-2,3-butanediol at high optical purity. Bacillus licheniformis is a potential 2,3-butanediol producer but the wild type strain (WX-02) produces a mix of D- and meso-type isomers. BudC in B. licheniformis is annotated as 2,3-butanediol dehydrogenase or acetoin reductase, but no pervious experiment was performed to verify this hypothesis. Results We developed a genetically modified strain of B. licheniformis (WX-02 ΔbudC) as a D-2,3-butanediol producer with high optimal purity. A marker-less gene deletion protocol based on a temperature sensitive knock-out plasmid T2-Ori was used to knock out the budC gene in B. licheniformis WX-02. The budC knock-out strain successfully abolished meso-2,3-butanediol production with enhanced D-2,3-butanediol production. No meso-BDH activity was detectable in cells of this strain. On the other hand, the complementary strain restored the characteristics of wild strain, and produced meso-2,3-butanediol and possessed meso-BDH activity. All of these data suggested that budC encoded the major meso-BDH catalyzing the reversible reaction from acetoin to meso-2,3-butanediol in B. licheniformis. The budC knock-out strain produced D-2,3-butanediol isomer only with a high yield of 30.76 g/L and a productivity of 1.28 g/L-h. Conclusions We confirmed the hypothesis that budC gene is responsible to reversibly transfer acetoin to meso-2,3-butanediol in B. licheniformis. A mutant strain of B. licheniformis with depleted budC gene was successfully developed and produced high level of the D-2,3-butanediol with high optimal purity. PMID:24475980
Floods of July 23-26, 2010, in the Little Maquoketa River and Maquoketa River Basins, Northeast Iowa
Eash, David A.
2012-01-01
Minor flooding occurred July 23, 2010, in the Little Maquoketa River Basin and major flooding occurred July 23–26, 2010, in the Maquoketa River Basin in northeast Iowa following severe thunderstorm activity over the region during July 22–24. A breach of the Lake Delhi Dam on July 24 aggravated flooding on the Maquoketa River. Rain gages at Manchester and Strawberry Point, Iowa, recorded 72-hour-rainfall amounts of 7.33 and 12.23 inches, respectively, on July 24. The majority of the rainfall occurred during a 48-hour period. Within the Little Maquoketa River Basin, a peak-discharge estimate of 19,000 cubic feet per second (annual flood-probability estimate of 4 to 10 percent) at the discontinued 05414500 Little Maquoketa River near Durango, Iowa streamgage on July 23 is the sixth largest flood on record. Within the Maquoketa River Basin, peak discharges of 26,600 cubic feet per second (annual flood-probability estimate of 0.2 to 1 percent) at the 05416900 Maquoketa River at Manchester, Iowa streamgage on July 24, and of 25,000 cubic feet per second (annual flood-probability estimate of 1 to 2 percent) at the 05418400 North Fork Maquoketa River near Fulton, Iowa streamgage on July 24 are the largest floods on record for these sites. A peak discharge affected by the Lake Delhi Dam breach on July 24 at the 05418500 Maquoketa River near Maquoketa, Iowa streamgage, located downstream of Lake Delhi, of 46,000 cubic feet per second on July 26 is the third highest on record. High-water marks were measured at five locations along the Little Maquoketa and North Fork Little Maquoketa Rivers between U.S. Highway 52 near Dubuque and County Road Y21 near Rickardsville, a distance of 19 river miles. Highwater marks were measured at 28 locations along the Maquoketa River between U.S. Highway 52 near Green Island and State Highway 187 near Arlington, a distance of 142 river miles. High-water marks were measured at 13 locations along the North Fork Maquoketa River between
Nakazawa Ueji, Yumi E; Rodríguez Dzul, Edwin A; Angulo Ramírez, Angélica V; López Villanueva, Ricardo F; Quintal Ortiz, Irma G; Rosado Paredes, Elsy P
2017-01-01
Abstract Background: Systemic lupus erythematosus (SLE) is a systemic autoimmune disease that mainly affects women, characterized by the production of autoantibodies. Its causal agent is unknown, but the combination of environmental, hormonal and genetic factors may favor the development of the disease. Parvovirus B19 has been associated with the development of SLE, since it induces the production of anti-single stranded DNA antibodies. It is unknown whether PV-B19 infection is an environmental factor that trigger or reactivate SLE in the Mexican Mayan population. Aim: A preliminary serological and molecular study of PV-B19 infection in Mayan women with established SLE was done. Methods: IgG and IgM anti PV-B19 were evaluated in 66 SLE patients and 66 control subjects, all women of Mayan origin. Viral DNA and viral load were analyzed by qPCR. Results: Insignificant levels of IgM were observed in 14.3% (4/28) of the patients and 11.4% (4/35) of control subjects. IgG was detected in 82.1% (23/28) of the patients and 82.9% (29/35) of control subjects, but were significantly higher in patients. Viral DNA was found in 86.0% (57/66) of the patients and 81.0% (54/66) of control subjects. Viral load, quantified in 28/66 patients and 31/66 controls which were positive for IgM and IgG, was significantly higher in controls. Conclusion: The high prevalence of PV-B19 in Yucatan, and the presence of IgM, IgG, and viral load in Mayan women with established SLE suggest that PV-B19 infection could be an environmental factor to trigger or reactivate SLE. PMID:29213152
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Recruitment. 19.510 Section... Programs or Activities Prohibited § 19.510 Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a...
14 CFR 23.965 - Fuel tank tests.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel tank tests. 23.965 Section 23.965 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Powerplant Fuel System § 23.965 Fuel...
14 CFR 23.971 - Fuel tank sump.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel tank sump. 23.971 Section 23.971 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Powerplant Fuel System § 23.971 Fuel...
14 CFR 23.963 - Fuel tanks: General.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel tanks: General. 23.963 Section 23.963 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Powerplant Fuel System § 23.963 Fuel...
14 CFR 31.23 - Flight load factor.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight load factor. 31.23 Section 31.23... STANDARDS: MANNED FREE BALLOONS Strength Requirements § 31.23 Flight load factor. In determining limit load, the limit flight load factor must be at least 1.4. ...
14 CFR 23.609 - Protection of structure.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Protection of structure. 23.609 Section 23.609 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT... § 23.609 Protection of structure. Each part of the structure must— (a) Be suitably protected against...
34 CFR 34.23 - Exclusions from garnishment.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Exclusions from garnishment. 34.23 Section 34.23 Education Office of the Secretary, Department of Education ADMINISTRATIVE WAGE GARNISHMENT § 34.23... months. (b) You have the burden of informing us of the circumstances surrounding an involuntary...
Sotomatsu, M; Hayashi, Y; Kawamura, M; Yugami, S; Shitara, T
1993-10-01
A new human pre-B acute lymphoblastic leukemia cell line (KMO-90) was established from the bone marrow sample of a 12-year-old girl with acute lymphoblastic leukemia (ALL) carrying 1;19 chromosome translocation. KMO-90 cells expressed HLA-DR, CD10, CD19, and CD22 antigens. These cells had also cytoplasmic immunoglobulin lacking surface immunoglobulin, indicating that these had a pre-B phenotype. Chromosome analysis of this cell line showed 48, XX, +8, +19, t(1;19)(q23;p13). Southern blot analysis showed the same sized rearrangements of the E2A gene in KMO-90 cells as those in the original leukemic cells. By means of reverse transcriptase-polymerase chain reaction analysis, we detected E2A/PBX1 fusion transcripts in KMO-90 cells. KMO-90 is useful when studying the role of the 1;19 translocation in the etiology of pre-B ALL. Furthermore, we studied alterations of the p53 gene in this cell line by polymerase chain reaction, single-strand conformation polymorphism analysis. KMO-90 cells were identified to have a point mutation at codon 177 (CCC-->TCC) of the p53 gene, suggesting that alterations of the p53 gene may have an important role in the establishment of this cell line.
[Parental socialization styles and psychosocial development in 16 to 19 year old adolescents].
Sepúlveda, G; Almonte, C; Valenzuela, C; Avendaño, A
1991-01-01
To study relationships between perceptions that 16 to 19 year old adolescents have about socialization styles and disciplinary methods used by their parents, with their view of the world, interpersonal relations, moral development, use of psychotropic substances and maladjusted behaviours, 241 adolescents--123 males--which belong to a follow up study on growth and development from northern metropolitan Santiago, Chile, were asked to answer a questionary of psychosocial development, previously elaborated by two of the authors (GS and CA). The most used socialization styles by these fathers and mothers were the negative power one (39.2% and 38.5%) and the inductive one (23.8% and 30.0%), while permissive styles occurred at much lower frequency (1.5% and 1.1%). Coincidence among parents in socialization styles was found in 47.7% and disagreement in 19.2% of cases. The inductive style and coincidence in it's use by both parents, were frequently associated to idealistic world views, autonomous and conventional moral development, satisfactory interpersonal relationships and low frequency of psychotropic consumption, and maladjusted behaviours while negative power based styles by both parents and disagreement of styles among them were rather related to realistic or negative world view, preconventional moral development, higher frequency of relational problems, psychotropic consumption and maladjusted behaviours.
Swansbury, G J; Slater, R; Bain, B J; Moorman, A V; Secker-Walker, L M
1998-05-01
This paper reports clinical and cytogenetic data from 125 cases with t(9;11)(p21-22;q32) which were accepted for a European Union Concerted Action Workshop on 11q23. This chromosome abnormality is known to occur predominantly in acute myeloid leukemia (AML) FAB type M5a and less often in AML M4; in this series it was also found to occur, uncommonly, in other AML FAB types, in childhood acute lymphoblastic leukemia (ALL) (nine cases), in relatively young patients with myelodysplastic syndrome (MDS) (five cases), acute biphenotypic leukemia (two cases), and acute undifferentiated leukemia (one case). All age groups were represented but 50% of the patients were aged less than 15 years. The t(9;11) was the sole abnormality in 57 cases with AML; trisomy 8 was the most common additional abnormality (23 cases, including seven with further abnormalities), and 28 cases had other additional abnormalities. Among the t(9;11)+ve patients with AML, the white cell count (WBC) and age group were significant predictors of event-free survival; central nervous system (CNS) involvement or karyotype class (sole, with trisomy 8, or with other), also contributed to prognosis although our data could not show these to be independent factors. The best outcome was for patients aged 1-9 years, with low WBC, and with absence of CNS disease or presence of trisomy 8. For patients aged less than 15 years, the event-free survival for ALL patients was not significantly worse than that of AML patients.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.220 Section 19.220 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Procedures for... the OCC pursuant to section 38 of the Federal Deposit Insurance Act and this part. ...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.210 Section 19.210 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Equal Access to... adjudicatory proceedings under this part are set forth at 31 CFR part 6. ...
2010-04-01
... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Report. 1312.19 Section... ARCHAEOLOGICAL RESOURCES: UNIFORM REGULATIONS § 1312.19 Report. (a) Each Federal land manager, when requested by... comply with section 13 of the Act and comprehensively report on activities carried out under provisions...
40 CFR 610.23 - Operator interaction effects.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Operator interaction effects. 610.23 Section 610.23 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL... Analysis § 610.23 Operator interaction effects. The device will also be evaluated with respect to: (a) The...
14 CFR 23.303 - Factor of safety.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Factor of safety. 23.303 Section 23.303... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Structure General § 23.303 Factor of safety. Unless otherwise provided, a factor of safety of 1.5 must be used. ...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq
Respect for privacy from the Strasbourg perspective
Directory of Open Access Journals (Sweden)
Lorenc Danaj
2012-02-01
Full Text Available Some of the most promising post-Cold War developments in Marxian thought have been stimulated by problems facing Marxists in Western Europe, to that extent they all seem to lay bare, intentionally or otherwise, the lacking of qualities, of Marx’s prediction. The most significant example of the failure of Marxist theory to be realised in practice is the persistent survival of the capitalist mode of production. The inevitable crisis foreseen by Marx, which would lead to revolution, failed to materialise and that claim is now itself historical, since capitalism has become the norm for social organisation in most of the world’s nations. By asking the question how capitalism can persist amid crisis, Gramsci, provided the most promising way of revision to the stunted Marxian orthodoxy. Today for us is important to ask whether Marxist analysis of neoliberal global strategy or globalisation and fragmentation invite reconsideration of the tendency on the part of many international relations scholarships to ignore and simply dismiss Marxism. It is also important to consider whether the significance of Marxist project of developing a critical approach to international politics, is but one way in which Marxism progressed beyond the traditional Anglo-American scholarship to IR.
EANM 1989 - Strasbourg. Highlights - 1 September 1989
International Nuclear Information System (INIS)
Rigo, P.
1990-01-01
The second annual congress of the European Association of Nuclear Medicine, (EANM), was attended by 2900 participants; a total of 999 abstracts were submitted from all over the world. The topics of the 748 oral and poster presentations were as follows: Heart and circulation (151 papers), oncology (89); instrumentation and data analysis (64), radiopharmaceuticals (55), neurology (48), gastro-enterology (44), nephrology (39), bone-joint disease (36), endocrinology (34), pediatrics (25), immunology - infectious disease (24), pulmonary disease (21), radioassay (18), and nuclear magnetic resonance (14 papers). Some remarkable results concerning cardiology, monoclonal antibodies, oncology as well as neurology are presented. (orig./MG)
7 CFR 634.23 - Water quality plan.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Water quality plan. 634.23 Section 634.23 Agriculture... AGRICULTURE LONG TERM CONTRACTING RURAL CLEAN WATER PROGRAM Participant RCWP Contracts § 634.23 Water quality plan. (a) The participant's water quality plan, developed with technical assistance by the NRCS or its...
32 CFR 34.23 - Property management system.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Property management system. 34.23 Section 34.23... Requirements Property Standards § 34.23 Property management system. The recipient's property management system... control system shall be in effect to insure adequate safeguards to prevent loss, damage, or theft of the...
29 CFR 1450.23 - Deduction from pay.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Deduction from pay. 1450.23 Section 1450.23 Labor... OWED THE UNITED STATES Salary Offset § 1450.23 Deduction from pay. (a) Deduction by salary offset, from an employee's current disposable pay, shall be subject to the following conditions: (1) Ordinarily...
49 CFR 10.23 - Accounting of disclosures.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Accounting of disclosures. 10.23 Section 10.23... INDIVIDUALS Maintenance of Records § 10.23 Accounting of disclosures. Each operating administration, the... accurate accounting of: (1) The date, nature, and purpose of each disclosure of a record to any person or...
14 CFR 23.775 - Windshields and windows.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Windshields and windows. 23.775 Section 23... Personnel and Cargo Accommodations § 23.775 Windshields and windows. (a) The internal panels of windshields and windows must be constructed of a nonsplintering material, such as nonsplintering safety glass. (b...
14 CFR 23.173 - Static longitudinal stability.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Static longitudinal stability. 23.173... Stability § 23.173 Static longitudinal stability. Under the conditions specified in § 23.175 and with the airplane trimmed as indicated, the characteristics of the elevator control forces and the friction within...
14 CFR 23.253 - High speed characteristics.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High speed characteristics. 23.253 Section... Requirements § 23.253 High speed characteristics. If a maximum operating speed VMO/MMO is established under § 23.1505(c), the following speed increase and recovery characteristics must be met: (a) Operating...
12 CFR 541.23 - Residential real estate.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Residential real estate. 541.23 Section 541.23... AFFECTING FEDERAL SAVINGS ASSOCIATIONS § 541.23 Residential real estate. The terms residential real estate... home used in part for business); (c) Other real estate used for primarily residential purposes other...
14 CFR 23.237 - Operation on water.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Operation on water. 23.237 Section 23.237... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Ground and Water Handling Characteristics § 23.237 Operation on water. A wave height, demonstrated to be safe for operation, and any...
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Settlement. 719.19 Section 719.19... Settlement. (a) Settlements before issuance of a NOVA. When the parties have agreed to a settlement of the case, the Director of the Office of Export Enforcement will recommend the settlement to the Secretary...
International Nuclear Information System (INIS)
Hsieh, Hui-Chuan; Hsieh, Yi-Hsuan; Huang, Yu-Hsin; Shen, Fan-Ching; Tsai, Han-Ni; Tsai, Jui-He; Lai, Yu-Ting; Wang, Yu-Ting; Chuang, Woei-Jer; Huang, Wenya
2005-01-01
HHR23A and hHR23B are the human homologs of Saccharomyces cerevisiae Rad23. hHR23B is associated with the nucleotide excision repair (NER) factor xeroderma pigmentosum C (XPC) protein and is required for global genome repair. The function of hHR23A is not yet clear. In this study, the potential function of the hHR23A protein was investigated using RNA interference techniques. The hHR23A knock-down (KD) construct diminished the RNA level of hHR23A protein by approximately 60%, and it did not interfere with expression of the hHR23B gene. Based on Southwestern immunoblot and host-cell reactivation assays, hHR23A KD cells were found to be deficient in DNA repair activity against the DNA damage caused by UVC irradiation. In these hHR23A KD cells, the XPC gene was not normally induced by UVC irradiation, indicating that the hHR23A protein is involved in NER through regulation of the DNA damage recognition protein XPC. Co-immunoprecipitation experiments revealed that hHR23A was associated with a small portion of hHR23B and the majority of p53 protein, indicating that hHR23A regulates the function of XPC by its association with the NER activator p53
19 CFR 19.12 - Inventory control and recordkeeping system.
2010-04-01
... invoice with any discrepancy reported to the port director as provided in § 19.6(a). (3) Recordation... discovery. The responsible party must pay the applicable duties, taxes and interest on thefts and shortages... discovery. The responsible party must pay the applicable duties, taxes and interest on thefts and shortages...
Parvovirus B19 associated acute cholestatic hepatitis
Directory of Open Access Journals (Sweden)
S. Perrini
2014-12-01
Full Text Available There are few reports in the literature of hepatitis as a manifestation of Parvovirus B19 infection. We describe a case of Parvovirus B19 associated acute cholestatic hepatitis diagnosed based on a positive serologic test (IgM and molecular detection of parvovirus B19 DNA in peripheral blood. Parvovirus B19 infection should be considered in the differential diagnosis of patient presenting with acute hepatitis of unknown etiology.
Moon, Chan Hong; Kim, Jung-Hwan; Zhao, Tiejun; Bae, Kyongtae Ty
2013-11-01
To develop quantitative dual-tuned (DT) (1) H/(23) Na MRI of human knee cartilage in vivo at 7 Tesla (T). A sensitive (23) Na transceiver array RF coil was developed at 7T. B1 fields generated by the transceiver array coil were characterized and corrected in the (23) Na images. Point spread function (PSF) of the (23) Na images was measured, and the signal decrease due to partial-volume-effect was compensated in [(23) Na] quantification of knee cartilage. SNR and [(23) Na] in anterior femoral cartilage were measured from seven healthy subjects. SNR of (23) Na image with the transceiver array coil was higher than that of birdcage coil. SNR in the cartilage at 2-mm isotropic resolution was 26.80 ± 3.69 (n = 7). B1 transmission and reception fields produced by the DT coil at 7T were similar to each other. Effective full-width-half-maximum of (23) Na image was ∼5 mm at 2-mm resolution. Mean [(23) Na] was 288.13 ± 29.50 mM (n = 7) in the anterior femoral cartilage of normal subjects. We developed a new high-sensitivity (23) Na RF coil for knee MRI at 7T. Our (1) H/(23) Na MRI allowed quantitative measurement of [(23) Na] in knee cartilage by measuring PSF and cartilage thickness from (23) Na and (1) H image, respectively. Copyright © 2013 Wiley Periodicals, Inc.
46 CFR 151.50-23 - Phosphoric acid.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Phosphoric acid. 151.50-23 Section 151.50-23 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Special Requirements § 151.50-23 Phosphoric acid. (a) The term phosphoric acid as used in this subpart shall include, in addition to phosphoric acid, aqueous solutions of...
Sobala-Szczygieł, Barbara; Boroń-Kaczmarska, Anna; Kępa, Lucjan; Oczko-Grzesik, Barbara; Piotrowski, Damian; Stolarz, Wojciech
Parvovirus B19 infection is associated with a broad spectrum of clinical manifestations among which some are well known but others remain controversial. The role of this infection as a cause of acute hepatitis or exacerbation of chronic liver disease requires discussion regarding its significance in a strategy of prevention and treatment of patients with chronic hepatitis. Clinical importance of this infection in patients with chronic hepatitis B treated with pegylated interferon alpha 2a is still unclear but exactly in this population significant complications during treatment may arise. Parvovirus B19 infection is not rare among persons with chronic hepatitis B, therefore searching for co-infection should be placed in standard diagnostic procedures especially in case of exacerbation of chronic hepatitis, pancytopaenia or anaemia of unknown origin. Pegylated interferon alpha 2a still remains a gold standard of therapy of patients with chronic hepatitis B according to European (EASL) and Polish guidelines. We present a case of 35 years old woman treated with pegylated interferon alpha 2a who developed acute liver failure in 23rd week of chronic hepatitis B therapy. An exacerbation of hepatitis with encephalopathy and pancytopaenia have been observed. Parvovirus B19 and HBV co-infection does not increase the frequency of liver function abnormalities in patients with chronic hepatitis B. Further investigations should be done to describe the natural course of co-infection with parvovirus B19 and HBV and to establish possible association between parvovirus B19 infection and chronic hepatitis B and also the influence of interferon alpha 2a on the infections course.
Directory of Open Access Journals (Sweden)
Abbas eBahador
2015-11-01
Full Text Available Carbapenem-resistant Acinetobacter baumannii (CR-AB causes serious nosocomial infections, especially in ICU wards of hospitals, worldwide. Expression of blaOXA genes is the chief mechanism of conferring carbapenem resistance among CR-AB. Although some blaOXA genes have been studied among CR-AB isolates from Iran, their blaOXA-23-like genes have not been investigated. We used a multiplex-PCR to detect Ambler class A, B, and D carbapenemases of 85 isolates, and determined that 34 harbored blaOXA-23-like genes. Amplified fragment length polymorphism (AFLP genotyping, followed by DNA sequencing of blaOXA-23-like amplicons of CR-AB from each AFLP group was used to characterize their blaOXA-23-like genes. We also assessed the antimicrobial susceptibility pattern of CR-AB isolates, and tested whether they harbored insertion sequences ISAba1 and ISAba4. Sequence comparison with reference strain A. baumannii (NCTC12156 revealed five types of mutations in blaOXA-23-like genes; including one novel variant and four mutants that were already reported from China and the USA. All of the blaOXA-23-like genes mutations were associated with increased minimum inhibitory concentrations (MICs against imipenem. ISAba1 and ISAba4 sequences were detected upstream of blaOXA-23 genes in 19% and 7% of isolates, respectively. The isolation of CR-AB with new blaOXA-23 mutations including some that have been reported from the USA and China highlights CR-AB pervasive distribution, which underscores the importance of concerted national and global efforts to control the spread of CR-AB isolates worldwide.
2010-04-01
... principal display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Petitions. 502.19 Section 502.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS...
2010-04-01
... display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Petitions. 102.19 Section 102.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
Adrenal neoplasms: Effectiveness and safety of CT-guided ablation of 23 tumors in 22 patients
Energy Technology Data Exchange (ETDEWEB)
Wolf, Farrah J.; Dupuy, Damian E.; Machan, Jason T. [Department of Diagnostic Imaging and the Office of Research Administration, Alpert Medical School of Brown University, Rhode Island Hospital, 593 Eddy Street, Providence, RI 02903 (United States); Mayo-Smith, William W., E-mail: wmayo-smith@lifespan.org [Department of Diagnostic Imaging and the Office of Research Administration, Alpert Medical School of Brown University, Rhode Island Hospital, 593 Eddy Street, Providence, RI 02903 (United States)
2012-08-15
Purpose: To retrospectively evaluate the effectiveness and safety of image-guided ablation of adrenal tumors. Materials and methods: : This HIPAA-compliant study was IRB approved and informed consent was waived. From 5/1999-6/2008, 20 consecutive adrenal metastases (mean diameter 4.2 cm; range, 2-8) and 3 hormonally active primary adrenal tumors (mean diameter 2.3 cm; range, 1-4), including an aldosteronoma and 2 pheochromocytomas in 22 patients (14 men, 8 women; mean age 61 years; range 40-84) were ablated in 23 sessions. Bilateral metastases were treated in a single patient. Radiofrequency ablation was used to treat 16 adrenal metastases and the 3 hyperfunctioning tumors. Microwave ablation was used to treat 4 metastases. Successful treatment was defined as a lack of both enhancement on follow-up contrast enhanced CT and/or up-take on FDG PET-CT and for functioning tumors, resolution of biochemical abnormalities. Results: Technical success was achieved in all sessions. Mean follow-up was 45.1 months (range, 1-91) Local tumor progression (focal enhancement at ablation site {>=}1 cm in short axis) was detected in 4 of 23 tumors, two of which were identified bilaterally in a single patient prompting re-treatment. Of 19 patients with metastatic disease, 16 had fatal extra-adrenal disease progression, and 3 remain alive. Two of the 3 patients who underwent ablation of hyperfunctioning tumors remain alive, including the patient with an aldosteronoma who had recurrent symptoms 91 months post ablation. Intra-ablative hypertension occurred in 9% (2/23) of sessions and was successfully treated pharmacologically. Conclusion: Ablation of metastatic and hyperfunctioning adrenal tumors is safe and may provide local control and treatment of pathologic biochemical activity.
Adrenal neoplasms: Effectiveness and safety of CT-guided ablation of 23 tumors in 22 patients
International Nuclear Information System (INIS)
Wolf, Farrah J.; Dupuy, Damian E.; Machan, Jason T.; Mayo-Smith, William W.
2012-01-01
Purpose: To retrospectively evaluate the effectiveness and safety of image-guided ablation of adrenal tumors. Materials and methods: : This HIPAA-compliant study was IRB approved and informed consent was waived. From 5/1999-6/2008, 20 consecutive adrenal metastases (mean diameter 4.2 cm; range, 2–8) and 3 hormonally active primary adrenal tumors (mean diameter 2.3 cm; range, 1–4), including an aldosteronoma and 2 pheochromocytomas in 22 patients (14 men, 8 women; mean age 61 years; range 40–84) were ablated in 23 sessions. Bilateral metastases were treated in a single patient. Radiofrequency ablation was used to treat 16 adrenal metastases and the 3 hyperfunctioning tumors. Microwave ablation was used to treat 4 metastases. Successful treatment was defined as a lack of both enhancement on follow-up contrast enhanced CT and/or up-take on FDG PET-CT and for functioning tumors, resolution of biochemical abnormalities. Results: Technical success was achieved in all sessions. Mean follow-up was 45.1 months (range, 1–91) Local tumor progression (focal enhancement at ablation site ≥1 cm in short axis) was detected in 4 of 23 tumors, two of which were identified bilaterally in a single patient prompting re-treatment. Of 19 patients with metastatic disease, 16 had fatal extra-adrenal disease progression, and 3 remain alive. Two of the 3 patients who underwent ablation of hyperfunctioning tumors remain alive, including the patient with an aldosteronoma who had recurrent symptoms 91 months post ablation. Intra-ablative hypertension occurred in 9% (2/23) of sessions and was successfully treated pharmacologically. Conclusion: Ablation of metastatic and hyperfunctioning adrenal tumors is safe and may provide local control and treatment of pathologic biochemical activity.
44 CFR 19.140 - Dissemination of policy.
2010-10-01
... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.140 Dissemination of policy. (a... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Dissemination of policy. 19.140 Section 19.140 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT...
32 CFR 536.19 - Disaster claims planning.
2010-07-01
... 32 National Defense 3 2010-07-01 2010-07-01 true Disaster claims planning. 536.19 Section 536.19... AGAINST THE UNITED STATES The Army Claims System § 536.19 Disaster claims planning. All ACOs will prepare... requirements related to disaster claims planning. ...
14 CFR 23.1329 - Automatic pilot system.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Automatic pilot system. 23.1329 Section 23...: Installation § 23.1329 Automatic pilot system. If an automatic pilot system is installed, it must meet the following: (a) Each system must be designed so that the automatic pilot can— (1) Be quickly and positively...
14 CFR 65.19 - Retesting after failure.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Retesting after failure. 65.19 Section 65.19 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: AIRMEN OTHER THAN FLIGHT CREWMEMBERS General § 65.19 Retesting after failure. An...
48 CFR 19.808 - Contract negotiation.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract negotiation. 19.808 Section 19.808 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC....808 Contract negotiation. ...
12 CFR 908.23 - Good faith certification.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Good faith certification. 908.23 Section 908.23... OPERATIONS RULES OF PRACTICE AND PROCEDURE IN HEARINGS ON THE RECORD General Rules § 908.23 Good faith... filing or submission of record is well-grounded in fact and is warranted by existing law or a good faith...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Step 2+3. 35.2109 Section 35.2109... ASSISTANCE Grants for Construction of Treatment Works § 35.2109 Step 2+3. The Regional Administrator may award a Step 2+3 grant which will provide the Federal share of an allowance under appendix B and the...
10 CFR 2.3 - Resolution of conflict.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Resolution of conflict. 2.3 Section 2.3 Energy NUCLEAR REGULATORY COMMISSION RULES OF PRACTICE FOR DOMESTIC LICENSING PROCEEDINGS AND ISSUANCE OF ORDERS § 2.3 Resolution of conflict. (a) In any conflict between a general rule in subpart C of this part and a special...
12 CFR 23.21 - Estimated residual value.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Estimated residual value. 23.21 Section 23.21...) Leases § 23.21 Estimated residual value. (a) Recovery of investment and costs. A national bank's estimate of the residual value of the property that the bank relies upon to satisfy the requirements of a full...
14 CFR 23.673 - Primary flight controls.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Primary flight controls. 23.673 Section 23... Control Systems § 23.673 Primary flight controls. Primary flight controls are those used by the pilot for the immediate control of pitch, roll, and yaw. [Doc. No. 4080, 29 FR 17955, Dec. 18, 1964, as amended...
Välismaalased ja õigus perekonnaelu puutumatusele / Uno Lõhmus
Lõhmus, Uno, 1952-
2000-01-01
Riigi õigusest kontrollida välismaalaste lubamist riiki, riigis viibimist ja väljasaatmist; perekonnaelu mõistest ning välismaalaste õigusest perekonnaelu puutumatusele Strasbourg'i kohtu ja Riigikohtu praktikas
50 CFR 401.19 - Statements and payrolls.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Statements and payrolls. 401.19 Section 401.19 Wildlife and Fisheries JOINT REGULATIONS (UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT... FISHERIES CONSERVATION, DEVELOPMENT AND ENHANCEMENT § 401.19 Statements and payrolls. The regulations of the...
44 CFR 19.120 - Transfers of property.
2010-10-01
... RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.120 Transfers of property. If a recipient sells or... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Transfers of property. 19.120 Section 19.120 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...
42 CFR 61.19 - Copyright and reproduction.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Copyright and reproduction. 61.19 Section 61.19 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING FELLOWSHIPS Regular Fellowships § 61.19 Copyright and reproduction. Where the work accomplished...
Antisickling effects of 2,3-diphosphoglycerate depletion.
Poillon, W N; Kim, B C; Labotka, R J; Hicks, C U; Kark, J A
1995-06-01
Elevation of 2,3-bisphosphoglycerate (2,3-DPG) in sickle erthrocytes (SS RBCs) and concomitant acidification of the cell interior promote polymerization by decreasing the solubility (csat) of deoxyhemoglobin S. The antisickling effect of 2,3-DPG depletion was evaluated after activation of the 2,3-DPG phosphatase activity of bisphosphoglycerate mutase by glycolate-2-phosphate, leading to rapid loss of intracellular 2,3-DPG. To ensure its maximal reduction in a physiologic medium, isosmotic CO2/bicarbonate-buffered saline, pH 7.0, was used. Substitution of K+ for Na+ as the major extracellular cation suppressed K:Cl cotransport, prevented cell shrinkage, and allowed demonstration of the full antisickling effect of 2,3-DPG depletion. The modest effect on solubility per se of removing intraerythrocytic 2,3-DPG (delta Csat = 1.6 g/dL) was amplified into a much larger antisickling effect by interaction with three other cellular variables affecting solubility and polymer content (intracellular pH, O2 saturation, and mean cell hemoglobin concentration). Acting in concert, these four antisickling effects (three solubilizing, one osmotic) reduced polymer fraction of glycolate-treated SS RBCs by 32% to 63%, with a concomitant decrease in sickling of 46% to 95% at the nominal pO2 of the microcirculation (20 mm Hg). A decrement in sickling of this magnitude should significantly ameliorate the vasoocclusive severity of sickle cell disease.
Lenke, Nils; Roudet, Nicolas
Until now, Philipp Feselius has been perceived only indirectly as Kepler's antagonist. Not much is known about his life besides his work as Baden private physician and his book against astrology which was cited intensely in Kepler's «Tertius Interveniens». This paper traces the stations of his career as a physician, about his presumable provenance and education in Strasbourg, his academic career in Tübingen, Strasbourg, Rostock and Padua, the doctorate in Basel in 1592, up to his employment, in 1599, as a court physician in Sulzburg and later in Durlach. Further hand-written and printed traces of Feselius are presented, and his social environment is investigated so that his personality becomes clearer, and relations can be established between his education and his writing against astrology.
45 CFR 1310.23 - Coordinated transportation.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Coordinated transportation. 1310.23 Section 1310... START PROGRAM HEAD START TRANSPORTATION Special Requirements § 1310.23 Coordinated transportation. (a) Each agency providing transportation services must make reasonable efforts to coordinate transportation...
28 CFR 26.23 - Certification process.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Certification process. 26.23 Section 26.23 Judicial Administration DEPARTMENT OF JUSTICE DEATH SENTENCES PROCEDURES Certification Process for... mechanism for providing legal representation to indigent prisoners in state postconviction proceedings in...
14 CFR 101.19 - Rapid deflation device.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Rapid deflation device. 101.19 Section 101.19 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... BALLOONS Moored Balloons and Kites § 101.19 Rapid deflation device. No person may operate a moored balloon...
10 CFR 19.12 - Instruction to workers.
2010-01-01
... observe, to the extent within the workers control, the applicable provisions of Commission regulations and... 10 Energy 1 2010-01-01 2010-01-01 false Instruction to workers. 19.12 Section 19.12 Energy NUCLEAR REGULATORY COMMISSION NOTICES, INSTRUCTIONS AND REPORTS TO WORKERS: INSPECTION AND INVESTIGATIONS § 19.12...
21 CFR 640.23 - Testing the blood.
2010-04-01
... this chapter and § 640.5 (a), (b), and (c). (b) The tests shall be performed on a sample of blood... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Testing the blood. 640.23 Section 640.23 Food and... ADDITIONAL STANDARDS FOR HUMAN BLOOD AND BLOOD PRODUCTS Platelets § 640.23 Testing the blood. (a) Blood from...
Directory of Open Access Journals (Sweden)
Cristina Pellegrini
Full Text Available Several immune-related markers have been implicated in basal cell carcinoma (BCC pathogenesis. The BCC inflammatory infiltrate is dominated by Th2 cytokines, suggesting a specific state of immunosuppression. In contrast, regressing BCC are characterized by a Th1 immune response with IFN-γ promoting a tumor suppressive activity. IL-23/Th17-related cytokines, as interleukin (IL-17, IL-23 and IL-22, play a significant role in cutaneous inflammatory diseases, but their involvement in skin carcinogenesis is controversial and is poorly investigated in BCC. In this study we investigated the expression of IFN-γ, IL-17, IL-23 and IL-22 cytokines in BCC at the protein and mRNA level and their modulation during imiquimod (IMQ treatment or photodynamic therapy (PDT. IFN-γ, IL-17, IL-23 and IL-22 levels were evaluated by immunohistochemistry and quantitative Real Time PCR in 41 histopathologically-proven BCCs (28 superficial and 13 nodular from 39 patients. All BCC samples were analyzed at baseline and 19 of 41 also during medical treatment (9 with IMQ 5% cream and 10 with MAL-PDT. Association between cytokines expression and clinico-pathological variables was evaluated. Higher levels of IFN-γ, IL-17, IL-23 and IL-22 were found in BCCs, mainly in the peritumoral infiltrate, compared to normal skin, with the expression being correlated to the severity of the inflammatory infiltrate. IFN-γ production was higher in superficial BCCs compared to nodular BCCs, while IL-17 was increased in nodular BCCs. A significant correlation was found between IFN-γ and IL-17 expression with both cytokines expressed by CD4+ and CD8+ T-cells. An increase of all cytokines occurred during the inflammatory phase induced by IMQ and at the early time point of PDT treatment, with significant evidence for IFN-γ, IL-23, and IL-22. Our results confirm the role of IFN-γ and support the involvement of IL-23/Th17-related cytokines in BCC pathogenesis and in the inflammatory response
Sungkate, S; Phongsamart, W; Rungmaitree, S; Lapphra, K; Wittawatmongkol, O; Pumsuwan, V; Wiruchkul, N; Assanasen, S; Rongrungruang, Y; Onlamoon, N; Horthongkham, N; Lermankul, W; Kongstan, N; Chokephaibulkit, K
2017-06-01
Nosocomial outbreaks of parvovirus B19 (pB19) have been reported, but they rarely occur among healthcare personnel (HCP). Susceptibility among pregnant HCP was the major concern. An outbreak of pB19 among HCP is described in a paediatric ward with a cross-sectional serologic study in all HCP and patients exposed to the outbreak. Acute infection was diagnosed by polymerase chain reaction or positive anti-parvovirus B19 IgM. Among 48 HCP (three pregnant) and 22 patients included in the outbreak serologic study, 11 (23%) HCP and two (9%) patients had acute infection. Of these, six HCP and no patients were symptomatic. Clinical manifestations included itchy rash (100%) and joint pain following resolution of rash (67%), with median rash duration of four days. Forty percent of HCP and 50% of patients had positive anti-parvovirus IgG, indicating previously immune status. HCP with acute infection and HCP who were susceptible without infection were younger than HCP with previous immunity (mean age 32.2 vs 40.5 years, respectively; P = 0.003). The attack rate was 38% among HCP and 18% among patients who were susceptible, respectively. The outbreak ended within two weeks following strict droplet precaution and segregation of symptomatic HCP. Parvovirus B19 infection may cause nosocomial outbreak with high attack rate among HCP. Outbreak control with droplet precaution was highly effective. Copyright © 2017 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.
Gao, Tianzhen; Yun, Libing; Gao, Shuang; Gu, Yan; He, Wang; Luo, Haibo; Hou, Yiping
2016-11-01
In this study, 23 Y chromosomal STRs (DYS19, DYS389I, DYS389II, DYS390, DYS391, DYS392, DYS393, DYS385a, DYS385b, DYS438, DYS439, DYS437, DYS448, DYS456, DYS458, DYS635, YGATAH4, DYS576, DYS481, DYS549, DYS533, DYS570, and DYS643) were investigated in 258 unrelated individuals of Mongolian descent living in the Inner Mongolia Autonomous Region. A total of 233 different haplotypes were found, and 209 of them were unique. Haplotype diversity was 0.9992 and gene diversity ranged from 0.4840 (DYS391) to 0.9679 (DYS385ab). Both R st pairwise analysis and multidimensional scaling plot showed that the genetic structure of the Mongolian population was significantly different from some Chinese ethnic groups and neighboring populations. It is notable that there were null features existing at DYS448 as observed by the PowerPlex® Y23 System, which could be also obtained by sequencing in the Tibetan population.
27 CFR 19.464 - Denatured spirits inventories.
2010-04-01
... of Articles Inventories § 19.464 Denatured spirits inventories. Each proprietor shall take a physical inventory of all denatured spirits in the processing account at the close of each calendar quarter and at... inventories. 19.464 Section 19.464 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE...
18 CFR 367.19 - Accounting for leases.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Accounting for leases. 367.19 Section 367.19 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... Instructions § 367.19 Accounting for leases. (a) All leases must be classified as either capital or operating...
14 CFR 99.19-99.31 - [Reserved
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false [Reserved] 99.19-99.31 Section 99.19-99.31 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SECURITY CONTROL OF AIR TRAFFIC General §§ 99.19-99.31 [Reserved] ...
31 CFR 203.19 - Sources of balances.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Sources of balances. 203.19 Section 203.19 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... § 203.19 Sources of balances. A financial institution must be a collector depositary that accepts term...
34 CFR 668.19 - Financial aid history.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Financial aid history. 668.19 Section 668.19 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION... Programs § 668.19 Financial aid history. (a) Before an institution may disburse title IV, HEA program funds...